F490605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1134 | 918 | 439 | 258 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2599185301|2599939305 |
| Length | 278 |
| Sequence | HQVTLDTATAVRPDGMNETPRVVLSARGLRRDFAGFVAVKDVDLDIHHGKIHALIGPNGAGKTTIFNLLTKFLQPTSGTIELLGTDITRTPPAKVARMGLVRSFQISAIFPHLSVLDNVRVALQRPGGLGYQFWRPVSALDQLTPRARELLAIVGLDDAAHRLAGDLSYGRKRVLEIATTLALDPKVLLLDEPMAGMGHEDVGTISGIIRSLAKDRAVLMVEHNLTVVADLCDWITVMQRGQVLAAGDYATVSKDERVRVAYMGTEHGGTEHGGTEHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 9 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 13 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 14 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 20 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 21 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 22 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 23 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 24 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 25 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 26 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 27 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 28 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 29 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 30 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 31 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 32 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 33 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 34 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 35 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 36 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 37 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 38 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 39 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 40 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 41 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 42 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 43 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 44 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 45 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 46 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 47 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 48 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 49 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 50 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 51 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 52 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 53 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 54 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 55 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 56 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 57 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 58 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 59 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 60 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 61 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 62 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 63 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 64 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 65 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 66 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 67 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 68 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 69 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 70 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 71 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 72 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 73 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 74 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 75 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 76 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 77 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 78 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 79 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 80 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 81 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 82 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 83 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 84 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 85 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 86 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 87 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 88 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 89 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 90 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 91 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 92 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 93 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 94 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 95 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 96 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 97 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 98 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 99 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 100 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 101 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 102 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 103 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 104 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 105 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 106 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 107 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 108 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 109 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 110 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 111 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 112 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 113 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 114 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 115 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 116 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 117 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 118 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 119 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 120 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 121 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 122 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 123 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 124 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 125 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 126 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 127 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 128 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 129 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 130 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 131 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 132 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 133 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 134 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 135 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 136 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 137 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 138 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 139 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 140 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 141 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 142 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 143 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 144 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 145 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 146 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 147 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 148 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 149 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 150 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 151 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 152 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 153 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 154 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 155 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 156 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 157 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 158 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 159 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 160 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 161 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 162 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 163 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 164 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 165 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 166 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 167 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 168 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 169 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 170 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 171 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 172 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 173 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 174 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 175 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 176 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 177 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 178 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 179 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 180 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 181 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 182 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 183 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 184 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 185 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 186 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 187 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 188 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 189 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 190 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 191 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 192 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 193 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 194 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 195 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 196 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 197 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 198 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 199 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 200 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 201 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 202 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 203 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 204 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 205 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 206 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 207 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 208 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 209 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 210 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 211 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 212 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 213 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 214 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 215 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 216 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 217 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 218 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 219 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 220 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 221 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 222 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 223 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 224 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 225 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 226 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 227 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 228 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 229 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 230 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 231 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 232 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 233 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 234 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 235 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 236 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 237 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 238 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 239 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 240 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 241 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 242 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 243 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 244 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 245 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 246 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 247 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 248 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 249 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 250 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 251 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 252 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 253 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 254 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 255 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 256 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 257 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 258 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 259 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 260 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 261 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 262 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 263 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 264 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 265 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 266 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 267 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 268 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 269 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 270 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 271 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 272 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 273 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 274 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 275 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 276 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 277 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 278 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 279 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 280 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 281 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 282 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 283 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 284 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 285 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 286 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 287 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 288 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 289 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 290 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 291 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 292 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 293 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 294 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 295 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 296 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 297 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 298 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 299 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 300 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 301 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 302 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 303 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 304 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 305 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 306 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 307 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 308 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 309 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 310 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 311 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 312 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 313 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 314 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 315 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 316 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 317 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 318 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 319 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 320 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 321 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 322 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 323 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 324 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 325 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 326 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 327 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 328 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 329 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 330 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 331 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 332 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 333 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 334 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 335 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 336 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 337 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 338 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 339 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 340 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 341 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 342 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 343 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 344 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 345 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 346 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 347 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 348 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 349 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 350 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 351 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 352 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 353 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 354 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 355 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 356 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 357 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 358 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 359 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 360 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 361 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 362 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 363 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 364 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 365 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 366 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 367 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 368 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 369 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 370 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 371 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 372 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 373 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 374 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 375 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 376 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 377 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 378 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 379 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 380 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 381 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 382 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 383 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 384 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 385 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 386 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 387 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 388 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 389 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 390 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 391 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 392 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 393 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 394 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 395 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 396 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 397 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 398 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 399 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 400 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 401 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 402 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 403 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 404 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 405 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 406 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 407 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 408 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 409 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 410 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 411 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 412 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 413 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 414 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 415 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 416 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 417 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 418 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 419 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 420 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 421 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 422 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 423 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 424 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 425 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 426 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 427 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 428 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 429 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 430 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 431 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 432 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 433 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 434 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 435 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 436 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 437 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 438 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 439 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 440 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 441 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 442 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 443 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 444 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 445 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 446 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 447 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 448 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 449 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 450 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 451 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 452 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 453 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 454 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 455 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 456 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 457 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 458 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 459 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 460 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 461 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 462 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 463 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 464 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 465 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 466 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 467 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 468 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 469 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 470 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 471 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 472 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 473 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 474 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 475 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 476 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 477 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 478 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 479 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 480 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 481 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 482 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 483 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 484 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 485 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 486 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 487 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 488 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 489 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 490 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 491 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 492 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 493 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 494 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 495 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 496 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 497 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 498 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 499 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 500 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 501 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 502 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 503 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 504 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 505 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 506 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 507 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 508 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 509 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 510 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 511 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 512 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 513 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 514 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 515 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 516 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 517 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 518 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 519 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 520 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 521 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 522 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 523 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 524 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 525 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 526 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 527 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 528 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 529 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 530 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 531 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 532 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 533 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 534 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 535 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 536 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 537 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 538 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 539 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 540 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 541 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 542 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 543 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 544 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 545 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 546 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 547 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 548 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 549 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 550 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 551 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 552 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 553 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 554 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 555 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 556 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 557 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 558 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 559 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 560 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 561 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 562 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 563 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 564 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 565 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 566 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 567 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 568 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 569 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 570 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 571 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 572 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 573 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 574 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 575 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 576 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 577 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 578 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 579 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 580 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 581 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 582 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 583 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 584 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 585 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 586 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 587 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 588 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 589 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 590 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 591 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 592 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 593 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 594 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 595 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 596 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 597 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 598 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 599 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 600 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 601 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 602 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 603 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 604 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 605 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 606 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 607 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 608 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 609 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 610 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 611 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 612 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 613 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 614 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 615 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 616 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 617 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 618 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 619 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 620 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 621 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 622 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 623 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 624 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 625 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 626 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 627 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 628 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 629 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 630 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 631 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 632 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 633 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 634 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 635 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 636 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 637 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 638 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 639 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 640 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 641 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 642 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 643 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 644 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 645 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 646 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 647 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 648 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 649 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 650 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 651 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 652 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 653 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 654 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 655 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 656 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 657 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 658 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 659 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 660 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 661 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 662 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 663 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 664 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 665 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 666 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 667 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 668 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 669 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 670 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 671 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 672 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 673 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 674 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 675 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 676 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 677 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 678 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 679 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 680 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 681 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 682 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 683 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 684 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 685 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 686 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 687 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 688 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 689 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 690 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 691 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 692 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 693 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 694 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 695 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 696 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 697 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 698 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 699 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 700 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 701 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 702 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 703 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 704 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 705 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 706 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 707 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 708 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 709 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 710 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 711 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 712 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 713 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 714 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 715 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 716 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 717 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 718 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 719 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 720 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 721 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 722 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 723 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 724 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 725 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 726 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 727 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 728 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 729 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 730 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 731 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 732 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 733 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 734 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 735 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 736 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 737 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 738 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 739 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 740 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 741 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 742 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 743 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 744 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 745 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 746 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 747 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 748 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 749 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 750 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 751 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 752 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 753 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 754 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 755 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 756 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 757 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 758 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 759 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 760 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 761 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 762 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 763 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 764 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 765 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 766 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 767 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 768 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 769 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 770 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 802 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 803 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 804 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 805 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 806 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 807 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 808 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 809 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 810 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 811 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 812 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 813 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 814 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 815 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 816 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 817 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 818 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 819 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 820 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 821 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 822 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 823 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 824 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 825 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 826 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 827 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 828 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 829 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 830 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 831 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 832 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 833 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 834 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 835 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 836 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 837 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 838 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 839 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 840 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 841 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 842 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 843 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 844 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 845 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 846 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 847 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 848 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 849 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 850 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 851 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 852 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 853 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 854 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 855 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 856 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 857 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 858 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 859 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 860 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 861 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 862 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 863 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 864 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 865 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 866 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 867 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 868 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 869 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 870 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 871 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 872 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 873 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 874 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 875 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 876 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 877 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 878 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 879 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 880 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 881 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 882 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 883 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 884 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 885 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 886 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 887 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 888 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 889 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 890 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 891 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 892 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 893 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 894 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 895 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 896 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 897 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 898 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 899 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 900 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 901 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 902 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 903 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 904 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 905 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 906 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 907 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 908 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 909 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 910 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 911 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 912 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 913 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 914 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 915 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 916 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 917 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 918 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 38.45 |
| Metatranscriptomes | 0.26 |
| Isolates | 61.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 15.78 |
| Nodule | 50.09 |
| Rhizoplane | 1.5 |
| Rhizosphere | 19.49 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 12.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000016 | 3300001979 | Bacteria | 58332 |
| 2 | JGI25155J39150_1000013 | 3300002704 | Bacteria | 198215 |
| 3 | JGI25156J39149_1000011 | 3300002705 | Bacteria | 198215 |
| 4 | JGI25162J39368_1000169 | 3300002737 | Bacteria | 72114 |
| 5 | JGI25162J39368_1001105 | 3300002737 | Bacteria | 16322 |
| 6 | JGI25154J39366_1000030 | 3300002738 | Bacteria | 191444 |
| 7 | JGI25158J39367_1000948 | 3300002739 | Bacteria | 5357 |
| 8 | JGI25157J39369_1000013 | 3300002741 | Bacteria | 198211 |
| 9 | JGI25157J39369_1000714 | 3300002741 | Bacteria | 17847 |
| 10 | JGI25152J39213_1001230 | 3300002773 | Bacteria | 11702 |
| 11 | JGI25152J39213_1005165 | 3300002773 | Bacteria | 3901 |
| 12 | JGI25152J39213_1012244 | 3300002773 | Bacteria | 1851 |
| 13 | JGI25152J39213_1012447 | 3300002773 | Bacteria | 1825 |
| 14 | JGI25150J39212_1008843 | 3300002774 | Bacteria | 1949 |
| 15 | JGI25159J45721_1000227 | 3300002987 | Bacteria | 26401 |
| 16 | JGI25159J45721_1000591 | 3300002987 | Bacteria | 16244 |
| 17 | JGI25151J46595_10000632 | 3300003187 | Bacteria | 30374 |
| 18 | JGI25151J46595_10001667 | 3300003187 | Bacteria | 14569 |
| 19 | JGI25151J46595_10004763 | 3300003187 | Bacteria | 7118 |
| 20 | JGI25165J46597_1000025 | 3300003214 | Bacteria | 333075 |
| 21 | JGI25165J46597_1000349 | 3300003214 | Bacteria | 52229 |
| 22 | JGI25165J46597_1000355 | 3300003214 | Bacteria | 51475 |
| 23 | JGI25153J46596_10016054 | 3300003215 | Bacteria | 3020 |
| 24 | JGI25153J46596_10016244 | 3300003215 | Bacteria | 2993 |
| 25 | JGI25153J46596_10023228 | 3300003215 | Bacteria | 2265 |
| 26 | JGI25153J46596_10023597 | 3300003215 | Bacteria | 2238 |
| 27 | rootL2_10021228 | 3300003322 | Bacteria | 2403 |
| 28 | JGI25160J50197_1000041 | 3300003354 | Bacteria | 152843 |
| 29 | JGI25160J50197_1000983 | 3300003354 | Bacteria | 14834 |
| 30 | JGI25160J50197_1002019 | 3300003354 | Bacteria | 9675 |
| 31 | JGI25160J50197_1026521 | 3300003354 | Bacteria | 1596 |
| 32 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 33 | JGI25161J50226_1000306 | 3300003374 | Bacteria | 27312 |
| 34 | Ga0006562J51391_1007623 | 3300003578 | Bacteria | 4340 |
| 35 | Ga0055526_1001289 | 3300003771 | Bacteria | 17973 |
| 36 | Ga0055526_1003389 | 3300003771 | Bacteria | 10153 |
| 37 | Ga0055526_1005911 | 3300003771 | Bacteria | 6835 |
| 38 | Ga0055526_1006104 | 3300003771 | Bacteria | 6652 |
| 39 | Ga0055524_1001745 | 3300003775 | Bacteria | 12006 |
| 40 | Ga0055524_1005317 | 3300003775 | Bacteria | 5778 |
| 41 | Ga0055524_1010426 | 3300003775 | Bacteria | 3699 |
| 42 | Ga0055524_1017184 | 3300003775 | Bacteria | 2561 |
| 43 | Ga0055536_1012753 | 3300003781 | Bacteria | 3088 |
| 44 | Ga0055528_1000514 | 3300003790 | Bacteria | 30392 |
| 45 | Ga0055528_1000943 | 3300003790 | Bacteria | 19373 |
| 46 | Ga0055528_1001128 | 3300003790 | Bacteria | 17523 |
| 47 | Ga0055528_1001756 | 3300003790 | Bacteria | 12485 |
| 48 | Ga0055528_1005266 | 3300003790 | Bacteria | 6065 |
| 49 | Ga0055528_1031768 | 3300003790 | Bacteria | 1365 |
| 50 | Ga0055540_1000050 | 3300003792 | Bacteria | 145565 |
| 51 | Ga0055540_1018276 | 3300003792 | Bacteria | 1924 |
| 52 | Ga0055540_1029040 | 3300003792 | Bacteria | 1299 |
| 53 | Ga0058692_1023785 | 3300003856 | Bacteria | 1239 |
| 54 | Ga0055543_1000008 | 3300004625 | Bacteria | 202062 |
| 55 | Ga0055543_1000021 | 3300004625 | Bacteria | 150116 |
| 56 | Ga0055543_1006579 | 3300004625 | Bacteria | 2788 |
| 57 | Ga0055543_1014863 | 3300004625 | Bacteria | 1508 |
| 58 | Ga0065165_1000031 | 3300005262 | Bacteria | 216330 |
| 59 | Ga0065165_1012183 | 3300005262 | Bacteria | 3520 |
| 60 | Ga0065165_1012996 | 3300005262 | Bacteria | 3342 |
| 61 | Ga0065165_1016664 | 3300005262 | Bacteria | 2742 |
| 62 | Ga0065165_1020275 | 3300005262 | Bacteria | 2345 |
| 63 | Ga0065165_1033862 | 3300005262 | Bacteria | 1586 |
| 64 | Ga0070683_100558009 | 3300005329 | Bacteria | 1095 |
| 65 | Ga0070666_10385916 | 3300005335 | Bacteria | 1006 |
| 66 | Ga0070666_10403420 | 3300005335 | Bacteria | 983 |
| 67 | Ga0070668_100241722 | 3300005347 | Bacteria | 1496 |
| 68 | Ga0070669_100549279 | 3300005353 | Bacteria | 963 |
| 69 | Ga0070663_100296542 | 3300005455 | Bacteria | 1293 |
| 70 | Ga0068853_100174852 | 3300005539 | Bacteria | 1944 |
| 71 | Ga0068853_100283511 | 3300005539 | Bacteria | 1527 |
| 72 | Ga0070665_100132863 | 3300005548 | Bacteria | 2490 |
| 73 | Ga0068855_100721926 | 3300005563 | Bacteria | 1065 |
| 74 | Ga0068857_100141418 | 3300005577 | Bacteria | 2175 |
| 75 | Ga0068856_100052105 | 3300005614 | Bacteria | 4035 |
| 76 | Ga0068856_100175722 | 3300005614 | Bacteria | 2154 |
| 77 | Ga0068856_100424527 | 3300005614 | Bacteria | 1349 |
| 78 | Ga0081538_10026446 | 3300005981 | Bacteria | 4058 |
| 79 | Ga0075365_10000959 | 3300006038 | Bacteria | 12253 |
| 80 | Ga0075365_10014397 | 3300006038 | Bacteria | 4757 |
| 81 | Ga0075365_10014902 | 3300006038 | Bacteria | 4687 |
| 82 | Ga0075365_10020300 | 3300006038 | Bacteria | 4117 |
| 83 | Ga0075365_10489461 | 3300006038 | Bacteria | 869 |
| 84 | Ga0075368_10001344 | 3300006042 | Bacteria | 7817 |
| 85 | Ga0075368_10071957 | 3300006042 | Bacteria | 1398 |
| 86 | Ga0075363_100028806 | 3300006048 | Bacteria | 2861 |
| 87 | Ga0075363_100050082 | 3300006048 | Bacteria | 2225 |
| 88 | Ga0075363_100051617 | 3300006048 | Bacteria | 2194 |
| 89 | Ga0075364_10007393 | 3300006051 | Bacteria | 6518 |
| 90 | Ga0075364_10039812 | 3300006051 | Bacteria | 3048 |
| 91 | Ga0075362_10003234 | 3300006177 | Bacteria | 5651 |
| 92 | Ga0075362_10004260 | 3300006177 | Bacteria | 5111 |
| 93 | Ga0075362_10085558 | 3300006177 | Bacteria | 1458 |
| 94 | Ga0075367_10005140 | 3300006178 | Bacteria | 6460 |
| 95 | Ga0075367_10017983 | 3300006178 | Bacteria | 3892 |
| 96 | Ga0075367_10030507 | 3300006178 | Bacteria | 3091 |
| 97 | Ga0075367_10205331 | 3300006178 | Bacteria | 1231 |
| 98 | Ga0075369_10162961 | 3300006186 | Bacteria | 1022 |
| 99 | Ga0075366_10007386 | 3300006195 | Bacteria | 6067 |
| 100 | Ga0075366_10206974 | 3300006195 | Bacteria | 1194 |
| 101 | Ga0075370_10003972 | 3300006353 | Bacteria | 7107 |
| 102 | Ga0075370_10031999 | 3300006353 | Bacteria | 2938 |
| 103 | Ga0075370_10089005 | 3300006353 | Bacteria | 1780 |
| 104 | Ga0075370_10208737 | 3300006353 | Bacteria | 1153 |
| 105 | Ga0075430_100227304 | 3300006846 | Bacteria | 1548 |
| 106 | Ga0079104_1003805 | 3300006946 | Bacteria | 6778 |
| 107 | Ga0099826_10001282 | 3300006948 | Bacteria | 14779 |
| 108 | Ga0099826_10013390 | 3300006948 | Bacteria | 6198 |
| 109 | Ga0105244_10063044 | 3300009036 | Bacteria | 1862 |
| 110 | Ga0105248_10178354 | 3300009177 | Bacteria | 2394 |
| 111 | Ga0105237_10005808 | 3300009545 | Bacteria | 13843 |
| 112 | Ga0105237_10035890 | 3300009545 | Bacteria | 5015 |
| 113 | Ga0105237_10191329 | 3300009545 | Bacteria | 2046 |
| 114 | Ga0105249_10087412 | 3300009553 | Bacteria | 2908 |
| 115 | Ga0123341_1000115 | 3300009765 | Bacteria | 35967 |
| 116 | Ga0123342_1016494 | 3300009766 | Bacteria | 6412 |
| 117 | Ga0105239_10070535 | 3300010375 | Bacteria | 3839 |
| 118 | Ga0105239_10575632 | 3300010375 | Bacteria | 1283 |
| 119 | Ga0105239_10800674 | 3300010375 | Bacteria | 1080 |
| 120 | Ga0105246_10319943 | 3300011119 | Bacteria | 1260 |
| 121 | Ga0157373_10000761 | 3300013100 | Bacteria | 24994 |
| 122 | Ga0157373_10094705 | 3300013100 | Bacteria | 2102 |
| 123 | Ga0157371_10000235 | 3300013102 | Bacteria | 79378 |
| 124 | Ga0157371_10267839 | 3300013102 | Bacteria | 1232 |
| 125 | Ga0157370_10002006 | 3300013104 | Bacteria | 25031 |
| 126 | Ga0157370_10177769 | 3300013104 | Bacteria | 1978 |
| 127 | Ga0157370_10247367 | 3300013104 | Bacteria | 1649 |
| 128 | Ga0157369_10300389 | 3300013105 | Bacteria | 1670 |
| 129 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 130 | Ga0157374_10077167 | 3300013296 | Bacteria | 3152 |
| 131 | Ga0163162_10746923 | 3300013306 | Bacteria | 1098 |
| 132 | Ga0157372_10253722 | 3300013307 | Bacteria | 2042 |
| 133 | Ga0183363_1024 | 3300015690 | Bacteria | 54122 |
| 134 | Ga0214543_1000053 | 3300021327 | Bacteria | 141797 |
| 135 | Ga0228711_1008337 | 3300022739 | Bacteria | 14590 |
| 136 | Ga0228710_1008588 | 3300022740 | Bacteria | 14595 |
| 137 | Ga0209435_100026 | 3300025206 | Bacteria | 198295 |
| 138 | Ga0209437_100056 | 3300025233 | Bacteria | 363071 |
| 139 | Ga0209437_100196 | 3300025233 | Bacteria | 121199 |
| 140 | Ga0207425_1001570 | 3300025245 | Bacteria | 9267 |
| 141 | Ga0207425_1004911 | 3300025245 | Bacteria | 3914 |
| 142 | Ga0207425_1026251 | 3300025245 | Bacteria | 1197 |
| 143 | Ga0207425_1032715 | 3300025245 | Bacteria | 1028 |
| 144 | Ga0209646_1000084 | 3300025246 | Bacteria | 198295 |
| 145 | Ga0209646_1009081 | 3300025246 | Bacteria | 1582 |
| 146 | Ga0209646_1010980 | 3300025246 | Bacteria | 1409 |
| 147 | Ga0209646_1017879 | 3300025246 | Bacteria | 1042 |
| 148 | Ga0209026_1000071 | 3300025250 | Bacteria | 205592 |
| 149 | Ga0209026_1000080 | 3300025250 | Bacteria | 198295 |
| 150 | Ga0209677_100374 | 3300025253 | Bacteria | 27370 |
| 151 | Ga0209148_1002561 | 3300025254 | Bacteria | 6042 |
| 152 | Ga0209148_1003556 | 3300025254 | Bacteria | 4228 |
| 153 | Ga0209759_1000061 | 3300025256 | Bacteria | 198295 |
| 154 | Ga0209759_1000620 | 3300025256 | Bacteria | 33871 |
| 155 | Ga0209129_1000120 | 3300025258 | Bacteria | 137898 |
| 156 | Ga0209129_1000536 | 3300025258 | Bacteria | 26442 |
| 157 | Ga0209129_1000571 | 3300025258 | Bacteria | 25391 |
| 158 | Ga0209129_1004628 | 3300025258 | Bacteria | 5267 |
| 159 | Ga0209129_1006416 | 3300025258 | Bacteria | 3803 |
| 160 | Ga0209129_1018203 | 3300025258 | Bacteria | 1355 |
| 161 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 162 | Ga0209233_1000053 | 3300025261 | Bacteria | 444909 |
| 163 | Ga0209233_1000071 | 3300025261 | Bacteria | 363290 |
| 164 | Ga0209233_1000243 | 3300025261 | Bacteria | 90170 |
| 165 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 166 | Ga0209673_1000757 | 3300025273 | Bacteria | 44039 |
| 167 | Ga0209673_1001620 | 3300025273 | Bacteria | 19608 |
| 168 | Ga0209673_1001741 | 3300025273 | Bacteria | 18243 |
| 169 | Ga0209673_1002370 | 3300025273 | Bacteria | 13233 |
| 170 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 171 | Ga0209130_1000382 | 3300025284 | Bacteria | 49448 |
| 172 | Ga0209025_1000072 | 3300025294 | Bacteria | 283452 |
| 173 | Ga0209025_1000252 | 3300025294 | Bacteria | 126233 |
| 174 | Ga0209025_1000277 | 3300025294 | Bacteria | 117930 |
| 175 | Ga0209025_1003388 | 3300025294 | Bacteria | 15189 |
| 176 | Ga0209025_1020739 | 3300025294 | Bacteria | 3574 |
| 177 | Ga0209025_1023751 | 3300025294 | Bacteria | 3191 |
| 178 | Ga0209025_1071735 | 3300025294 | Bacteria | 1225 |
| 179 | Ga0209564_1000100 | 3300025295 | Bacteria | 224016 |
| 180 | Ga0209564_1001025 | 3300025295 | Bacteria | 34384 |
| 181 | Ga0209564_1002118 | 3300025295 | Bacteria | 16837 |
| 182 | Ga0209564_1004021 | 3300025295 | Bacteria | 9301 |
| 183 | Ga0209564_1038546 | 3300025295 | Bacteria | 1327 |
| 184 | Ga0209758_1000053 | 3300025297 | Bacteria | 337751 |
| 185 | Ga0209758_1000105 | 3300025297 | Bacteria | 221415 |
| 186 | Ga0209758_1000712 | 3300025297 | Bacteria | 49095 |
| 187 | Ga0209758_1000937 | 3300025297 | Bacteria | 39370 |
| 188 | Ga0209758_1016480 | 3300025297 | Bacteria | 3751 |
| 189 | Ga0209758_1021425 | 3300025297 | Bacteria | 3013 |
| 190 | Ga0209758_1027414 | 3300025297 | Bacteria | 2434 |
| 191 | Ga0209758_1049679 | 3300025297 | Bacteria | 1478 |
| 192 | Ga0209758_1068289 | 3300025297 | Bacteria | 1132 |
| 193 | Ga0209050_1003885 | 3300025298 | Bacteria | 10612 |
| 194 | Ga0209050_1009391 | 3300025298 | Bacteria | 5013 |
| 195 | Ga0209256_1000818 | 3300025299 | Bacteria | 39749 |
| 196 | Ga0209256_1001066 | 3300025299 | Bacteria | 31822 |
| 197 | Ga0209256_1005113 | 3300025299 | Bacteria | 7776 |
| 198 | Ga0209256_1013141 | 3300025299 | Bacteria | 3097 |
| 199 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 200 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 201 | Ga0207426_1000035 | 3300025302 | Bacteria | 448327 |
| 202 | Ga0207426_1002475 | 3300025302 | Bacteria | 11751 |
| 203 | Ga0209051_1000062 | 3300025303 | Bacteria | 251081 |
| 204 | Ga0209051_1000968 | 3300025303 | Bacteria | 28047 |
| 205 | Ga0209051_1001021 | 3300025303 | Bacteria | 26776 |
| 206 | Ga0209051_1004132 | 3300025303 | Bacteria | 9088 |
| 207 | Ga0209051_1007606 | 3300025303 | Bacteria | 5897 |
| 208 | Ga0209051_1048620 | 3300025303 | Bacteria | 1436 |
| 209 | Ga0209257_1002192 | 3300025304 | Bacteria | 20207 |
| 210 | Ga0209257_1004328 | 3300025304 | Bacteria | 11122 |
| 211 | Ga0207647_10048823 | 3300025904 | Bacteria | 2627 |
| 212 | Ga0207705_10106390 | 3300025909 | Bacteria | 2069 |
| 213 | Ga0207695_10000036 | 3300025913 | Bacteria | 477897 |
| 214 | Ga0207695_10172606 | 3300025913 | Bacteria | 2087 |
| 215 | Ga0207671_10002082 | 3300025914 | Bacteria | 21889 |
| 216 | Ga0207671_10051807 | 3300025914 | Bacteria | 3041 |
| 217 | Ga0207694_10033380 | 3300025924 | Bacteria | 3942 |
| 218 | Ga0207650_10145578 | 3300025925 | Bacteria | 1866 |
| 219 | Ga0207669_10406271 | 3300025937 | Bacteria | 1068 |
| 220 | Ga0207711_10091723 | 3300025941 | Bacteria | 2672 |
| 221 | Ga0207661_10546636 | 3300025944 | Bacteria | 1061 |
| 222 | Ga0207667_10938729 | 3300025949 | Bacteria | 855 |
| 223 | Ga0207712_10101877 | 3300025961 | Bacteria | 2136 |
| 224 | Ga0207640_10064525 | 3300025981 | Bacteria | 2439 |
| 225 | Ga0207640_10081709 | 3300025981 | Bacteria | 2211 |
| 226 | Ga0207678_10125485 | 3300026067 | Bacteria | 2190 |
| 227 | Ga0207702_10018934 | 3300026078 | Bacteria | 5696 |
| 228 | Ga0207702_10035872 | 3300026078 | Bacteria | 4147 |
| 229 | Ga0207702_10565177 | 3300026078 | Bacteria | 1113 |
| 230 | Ga0207702_10574594 | 3300026078 | Bacteria | 1104 |
| 231 | Ga0207674_10184107 | 3300026116 | Bacteria | 2039 |
| 232 | Ga0207698_10072392 | 3300026142 | Bacteria | 2740 |
| 233 | Ga0209281_1000596 | 3300027111 | Bacteria | 41157 |
| 234 | Ga0209281_1002300 | 3300027111 | Bacteria | 8028 |
| 235 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 236 | Ga0209371_1002757 | 3300027312 | Bacteria | 9420 |
| 237 | Ga0209371_1008430 | 3300027312 | Bacteria | 3430 |
| 238 | Ga0209282_1000157 | 3300027666 | Bacteria | 39435 |
| 239 | Ga0209282_1000173 | 3300027666 | Bacteria | 36304 |
| 240 | Ga0209282_1033066 | 3300027666 | Bacteria | 3155 |
| 241 | Ga0209813_10006996 | 3300027866 | Bacteria | 2800 |
| 242 | Ga0209813_10031977 | 3300027866 | Bacteria | 1556 |
| 243 | Ga0207428_10000096 | 3300027907 | Bacteria | 123081 |
| 244 | Ga0268266_10212673 | 3300028379 | Bacteria | 1774 |
| 245 | Ga0268266_10468436 | 3300028379 | Bacteria | 1199 |
| 246 | Ga0268266_10584702 | 3300028379 | Bacteria | 1072 |
| 247 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 248 | Ga0268256_1008754 | 3300030500 | Bacteria | 3439 |
| 249 | Ga0307408_100224731 | 3300031548 | Bacteria | 1534 |
| 250 | Ga0307408_100381959 | 3300031548 | Bacteria | 1204 |
| 251 | Ga0307413_10199635 | 3300031824 | Bacteria | 1443 |
| 252 | Ga0307413_10365486 | 3300031824 | Bacteria | 1119 |
| 253 | Ga0307406_10368312 | 3300031901 | Bacteria | 1129 |
| 254 | Ga0307407_10034112 | 3300031903 | Bacteria | 2783 |
| 255 | Ga0307412_10243738 | 3300031911 | Bacteria | 1392 |
| 256 | Ga0315914_1000965 | 3300031967 | Bacteria | 40741 |
| 257 | Ga0307409_100187829 | 3300031995 | Bacteria | 1836 |
| 258 | Ga0307409_100594148 | 3300031995 | Bacteria | 1093 |
| 259 | Ga0307414_10000876 | 3300032004 | Bacteria | 15390 |
| 260 | Ga0307415_100328642 | 3300032126 | Bacteria | 1278 |
| 261 | Ga0307510_10199050 | 3300033180 | Bacteria | 1541 |
| 262 | Ga0307510_10239906 | 3300033180 | Bacteria | 1308 |
| 263 | Ga0315913_1000276 | 3300033430 | Bacteria | 40740 |
| 264 | Ga0315915_1000499 | 3300033464 | Bacteria | 40728 |
| 265 | Ga0395900_0152072 | 3300037418 | Bacteria | 2364 |
| 266 | Ga0395905_0001086 | 3300037471 | Bacteria | 34208 |
| 267 | Ga0395905_0006215 | 3300037471 | Bacteria | 12056 |
| 268 | Ga0395905_0215862 | 3300037471 | Bacteria | 1796 |
| 269 | Ga0395905_0251058 | 3300037471 | Bacteria | 1652 |
| 270 | Ga0395905_0411431 | 3300037471 | Bacteria | 1248 |
| 271 | Ga0395905_0451404 | 3300037471 | Bacteria | 1183 |
| 272 | Ga0395901_0050098 | 3300038443 | Bacteria | 4340 |
| 273 | Ga0395901_0156455 | 3300038443 | Bacteria | 2394 |
| 274 | Ga0395901_0426964 | 3300038443 | Bacteria | 1358 |
| 275 | Ga0395901_0667657 | 3300038443 | Bacteria | 1041 |
| 276 | Ga0439436_0011711 | 3300041404 | Bacteria | 2664 |
| 277 | Ga0439466_0082570 | 3300041411 | Bacteria | 1013 |
| 278 | Ga0439465_0004075 | 3300041413 | Bacteria | 4757 |
| 279 | Ga0439465_0033388 | 3300041413 | Bacteria | 1645 |
| 280 | Ga0439465_0037614 | 3300041413 | Bacteria | 1557 |
| 281 | Ga0451851_0673005 | 3300041507 | Bacteria | 1319 |
| 282 | Ga0439449_0015719 | 3300042007 | Bacteria | 2846 |
| 283 | Ga0466970_0117416 | 3300044765 | Bacteria | 1455 |
| 284 | Ga0466960_0217002 | 3300044901 | Bacteria | 1051 |
| 285 | Ga0466958_0261262 | 3300045836 | Bacteria | 1108 |
| 286 | Ga0495603_0178475 | 3300046455 | Bacteria | 1229 |
| 287 | Ga0495638_0001300 | 3300046460 | Bacteria | 23172 |
| 288 | Ga0495638_0089498 | 3300046460 | Bacteria | 1857 |
| 289 | Ga0495605_0112303 | 3300046474 | Bacteria | 1242 |
| 290 | Ga0495662_0024666 | 3300046476 | Bacteria | 2902 |
| 291 | Ga0495664_0125800 | 3300046477 | Bacteria | 1551 |
| 292 | Ga0495585_0022101 | 3300046492 | Bacteria | 3652 |
| 293 | Ga0495585_0113079 | 3300046492 | Bacteria | 1442 |
| 294 | Ga0495607_0044805 | 3300046501 | Bacteria | 2606 |
| 295 | Ga0495583_0000748 | 3300046506 | Bacteria | 41309 |
| 296 | Ga0495606_0001591 | 3300046507 | Bacteria | 29647 |
| 297 | Ga0495616_0107622 | 3300046513 | Bacteria | 1299 |
| 298 | Ga0495620_0153106 | 3300046515 | Bacteria | 898 |
| 299 | Ga0495620_0174774 | 3300046515 | Bacteria | 832 |
| 300 | Ga0495631_0017761 | 3300046518 | Bacteria | 3358 |
| 301 | Ga0495631_0080547 | 3300046518 | Bacteria | 1405 |
| 302 | Ga0495632_0000696 | 3300046519 | Bacteria | 30538 |
| 303 | Ga0495632_0016377 | 3300046519 | Bacteria | 4128 |
| 304 | Ga0495643_0025720 | 3300046522 | Bacteria | 3328 |
| 305 | Ga0495643_0058815 | 3300046522 | Bacteria | 2044 |
| 306 | Ga0495643_0065937 | 3300046522 | Bacteria | 1911 |
| 307 | Ga0495654_0000152 | 3300046530 | Bacteria | 70943 |
| 308 | Ga0495609_0077834 | 3300046538 | Bacteria | 1452 |
| 309 | Ga0495622_0048413 | 3300046557 | Bacteria | 1975 |
| 310 | Ga0495633_0019049 | 3300046558 | Bacteria | 3474 |
| 311 | Ga0495656_0092854 | 3300046615 | Bacteria | 1383 |
| 312 | Ga0495668_0131585 | 3300046616 | Bacteria | 1369 |
| 313 | Ga0495625_0011341 | 3300046660 | Bacteria | 7277 |
| 314 | Ga0495625_0047807 | 3300046660 | Bacteria | 3084 |
| 315 | Ga0495625_0067828 | 3300046660 | Bacteria | 2509 |
| 316 | Ga0495588_0014518 | 3300046674 | Bacteria | 3772 |
| 317 | Ga0495671_0019894 | 3300046692 | Bacteria | 3543 |
| 318 | Ga0495671_0127701 | 3300046692 | Bacteria | 1240 |
| 319 | Ga0495589_0110186 | 3300046794 | Bacteria | 1329 |
| 320 | Ga0495600_0064861 | 3300046809 | Bacteria | 2387 |
| 321 | Ga0495660_0082288 | 3300046810 | Bacteria | 1686 |
| 322 | Ga0495604_0005541 | 3300047317 | Bacteria | 10010 |
| 323 | Ga0495672_0101995 | 3300047320 | Bacteria | 1554 |
| 324 | Ga0495681_0008484 | 3300047470 | Bacteria | 6442 |
| 325 | Ga0495686_0002544 | 3300047472 | Bacteria | 17029 |
| 326 | Ga0495686_0108119 | 3300047472 | Bacteria | 1671 |
| 327 | Ga0495626_0044213 | 3300048091 | Bacteria | 2086 |
| 328 | Ga0495626_0081479 | 3300048091 | Bacteria | 1437 |
| 329 | Ga0496102_0186729 | 3300048905 | Bacteria | 1954 |
| 330 | Ga0496102_0276185 | 3300048905 | Bacteria | 1584 |
| 331 | Ga0496102_0554993 | 3300048905 | Bacteria | 1071 |
| 332 | Ga0496105_0076652 | 3300048908 | Bacteria | 2761 |
| 333 | Ga0496106_0039386 | 3300048909 | Bacteria | 3539 |
| 334 | Ga0496110_0072086 | 3300048913 | Bacteria | 3064 |
| 335 | Ga0496111_0156995 | 3300048914 | Bacteria | 1688 |
| 336 | Ga0496114_0558796 | 3300048917 | Bacteria | 1011 |
| 337 | Ga0496115_0316602 | 3300048918 | Bacteria | 1277 |
| 338 | Ga0496116_0018353 | 3300048919 | Bacteria | 5396 |
| 339 | Ga0496116_0073789 | 3300048919 | Bacteria | 2149 |
| 340 | Ga0496116_0145547 | 3300048919 | Bacteria | 1325 |
| 341 | Ga0496117_0000066 | 3300048920 | Bacteria | 253534 |
| 342 | Ga0496117_0118304 | 3300048920 | Bacteria | 1634 |
| 343 | Ga0496118_0000231 | 3300048921 | Bacteria | 97930 |
| 344 | Ga0496118_0112379 | 3300048921 | Bacteria | 1803 |
| 345 | Ga0496119_0024379 | 3300048922 | Bacteria | 4257 |
| 346 | Ga0496119_0033679 | 3300048922 | Bacteria | 3391 |
| 347 | Ga0496119_0050439 | 3300048922 | Bacteria | 2565 |
| 348 | Ga0496120_0000463 | 3300048923 | Bacteria | 64041 |
| 349 | Ga0496120_0002893 | 3300048923 | Bacteria | 16428 |
| 350 | Ga0496120_0011718 | 3300048923 | Bacteria | 6012 |
| 351 | Ga0496120_0017106 | 3300048923 | Bacteria | 4712 |
| 352 | Ga0496120_0123223 | 3300048923 | Bacteria | 1337 |
| 353 | Ga0496121_0022022 | 3300048924 | Bacteria | 6207 |
| 354 | Ga0496121_0038709 | 3300048924 | Bacteria | 4216 |
| 355 | Ga0496121_0067349 | 3300048924 | Bacteria | 2902 |
| 356 | Ga0496121_0097085 | 3300048924 | Bacteria | 2284 |
| 357 | Ga0496121_0107839 | 3300048924 | Bacteria | 2131 |
| 358 | Ga0496121_0112114 | 3300048924 | Bacteria | 2078 |
| 359 | Ga0496121_0313487 | 3300048924 | Bacteria | 1059 |
| 360 | Ga0496122_0000057 | 3300048925 | Bacteria | 253452 |
| 361 | Ga0496122_0019450 | 3300048925 | Bacteria | 6201 |
| 362 | Ga0496122_0104127 | 3300048925 | Bacteria | 1886 |
| 363 | Ga0496122_0139312 | 3300048925 | Bacteria | 1521 |
| 364 | Ga0496122_0158166 | 3300048925 | Bacteria | 1386 |
| 365 | Ga0496122_0206333 | 3300048925 | Bacteria | 1143 |
| 366 | Ga0496122_0257056 | 3300048925 | Bacteria | 972 |
| 367 | Ga0496123_0000401 | 3300048926 | Bacteria | 79665 |
| 368 | Ga0496123_0127002 | 3300048926 | Bacteria | 1421 |
| 369 | Ga0496123_0194668 | 3300048926 | Bacteria | 1045 |
| 370 | Ga0496124_0004181 | 3300048927 | Bacteria | 17013 |
| 371 | Ga0496124_0019787 | 3300048927 | Bacteria | 6248 |
| 372 | Ga0496124_0190220 | 3300048927 | Bacteria | 1571 |
| 373 | Ga0496124_0197550 | 3300048927 | Bacteria | 1533 |
| 374 | Ga0496125_0045484 | 3300048928 | Bacteria | 3693 |
| 375 | Ga0496125_0091097 | 3300048928 | Bacteria | 2285 |
| 376 | Ga0496126_0052537 | 3300048929 | Bacteria | 3702 |
| 377 | Ga0496126_0093950 | 3300048929 | Bacteria | 2632 |
| 378 | Ga0496126_0322633 | 3300048929 | Bacteria | 1269 |
| 379 | Ga0496126_0559939 | 3300048929 | Bacteria | 906 |
| 380 | Ga0501032_0178682 | 3300049569 | Bacteria | 1390 |
| 381 | Ga0501033_0023658 | 3300049570 | Bacteria | 4633 |
| 382 | Ga0501033_0063731 | 3300049570 | Bacteria | 2712 |
| 383 | Ga0501033_0266499 | 3300049570 | Bacteria | 1211 |
| 384 | Ga0501034_0033440 | 3300049571 | Bacteria | 5216 |
| 385 | Ga0501034_0090204 | 3300049571 | Bacteria | 3063 |
| 386 | Ga0501037_0087442 | 3300049573 | Bacteria | 2256 |
| 387 | Ga0501037_0240192 | 3300049573 | Bacteria | 1270 |
| 388 | Ga0501040_0099154 | 3300049576 | Bacteria | 2031 |
| 389 | Ga0501043_0034502 | 3300049579 | Bacteria | 3979 |
| 390 | Ga0501047_0027460 | 3300049581 | Bacteria | 5484 |
| 391 | Ga0501047_0030187 | 3300049581 | Bacteria | 5227 |
| 392 | Ga0501047_0048073 | 3300049581 | Bacteria | 4120 |
| 393 | Ga0501047_0194449 | 3300049581 | Bacteria | 1891 |
| 394 | Ga0501047_0323062 | 3300049581 | Bacteria | 1383 |
| 395 | Ga0501048_0030062 | 3300049582 | Bacteria | 3934 |
| 396 | Ga0501068_0180106 | 3300049584 | Bacteria | 1336 |
| 397 | Ga0501070_0271963 | 3300049586 | Bacteria | 1383 |
| 398 | Ga0501035_0088575 | 3300049822 | Bacteria | 2727 |
| 399 | Ga0501044_0052590 | 3300049823 | Bacteria | 4196 |
| 400 | Ga0501044_0198705 | 3300049823 | Bacteria | 1964 |
| 401 | Ga0501044_0287564 | 3300049823 | Bacteria | 1576 |
| 402 | nmdc:mga03683_152350_c1 | 3300050489 | Bacteria | 1044 |
| 403 | nmdc:mga03n38_21859_c1 | 3300050490 | Bacteria | 2581 |
| 404 | nmdc:mga00v17_158726_c1 | 3300050491 | Bacteria | 1455 |
| 405 | nmdc:mga00v17_16076_c1 | 3300050491 | Bacteria | 4214 |
| 406 | nmdc:mga0yw44_114070_c1 | 3300050492 | Bacteria | 1734 |
| 407 | nmdc:mga0yw44_887_c1 | 3300050492 | Bacteria | 11269 |
| 408 | nmdc:mga04h51_21723_c2 | 3300050495 | Bacteria | 1554 |
| 409 | nmdc:mga07m45_117635_c1 | 3300050496 | Bacteria | 1534 |
| 410 | nmdc:mga07m45_61480_c1 | 3300050496 | Bacteria | 2128 |
| 411 | nmdc:mga08y16_62_c1 | 3300050511 | Bacteria | 89583 |
| 412 | nmdc:mga0sz30_13122_c1 | 3300050516 | Bacteria | 3238 |
| 413 | Ga0500610_0031643 | 3300053079 | Bacteria | 2689 |
| 414 | Ga0500610_0165133 | 3300053079 | Bacteria | 1098 |
| 415 | Ga0495655_0026994 | 3300053083 | Bacteria | 1358 |
| 416 | Ga0500557_062594 | 3300053105 | Bacteria | 1210 |
| 417 | Ga0500560_003025 | 3300053107 | Bacteria | 3328 |
| 418 | Ga0500560_017143 | 3300053107 | Bacteria | 1993 |
| 419 | Ga0500594_0048362 | 3300053118 | Bacteria | 1189 |
| 420 | Ga0500618_000028 | 3300053125 | Bacteria | 140440 |
| 421 | Ga0500618_005616 | 3300053125 | Bacteria | 3785 |
| 422 | Ga0500618_014087 | 3300053125 | Bacteria | 2052 |
| 423 | Ga0500658_0001954 | 3300053134 | Bacteria | 8068 |
| 424 | Ga0500658_0059571 | 3300053134 | Bacteria | 1584 |
| 425 | Ga0500561_0000056 | 3300053137 | Bacteria | 21920 |
| 426 | Ga0500568_0001903 | 3300053139 | Bacteria | 12834 |
| 427 | Ga0500573_0021214 | 3300053140 | Bacteria | 3721 |
| 428 | Ga0500590_075759 | 3300053148 | Bacteria | 1663 |
| 429 | Ga0500604_0004558 | 3300053151 | Bacteria | 3671 |
| 430 | Ga0500604_0033565 | 3300053151 | Bacteria | 1518 |
| 431 | Ga0500616_0001321 | 3300053153 | Bacteria | 24446 |
| 432 | Ga0500616_0001649 | 3300053153 | Bacteria | 20642 |
| 433 | Ga0500622_0001224 | 3300053156 | Bacteria | 21087 |
| 434 | Ga0500633_0109602 | 3300053160 | Bacteria | 1022 |
| 435 | Ga0500611_005341 | 3300053727 | Bacteria | 1800 |
| 436 | Ga0587082_007109 | 3300059504 | Bacteria | 1517 |
| 437 | Ga0587072_013588 | 3300059643 | Bacteria | 1361 |
| 438 | Ga0501082_0324748 | 3300060353 | Bacteria | 1341 |
| 439 | Ga0466962_0049409 | 3300061719 | Bacteria | 2010 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9162 | 13 | 246 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.916 | 16 | 244 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9148 | 13 | 246 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9117 | 15 | 255 |
| 7e7o-assembly1.cif.gz_A | cryo-em structure of human abca4 in nrpe-bound state | 0.9057 | 9 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9149 | 11 | 245 | 3.40.50.300 |
| af_A1ZBS3_470_698_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9139 | 14 | 246 | 3.40.50.300 |
| af_Q9VDR4_479_718_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9127 | 10 | 248 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9122 | 16 | 239 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9036 | 14 | 245 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3MZI9-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9599 | 14 | 109 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A239NU23-F1-model_v4 | Branched-chain amino acid transport system ATP-binding protein | 0.9368 | 12 | 258 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A7W0T098-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9291 | 12 | 116 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A7Z2ZL50-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9273 | 14 | 246 |
GO:0005524
GO:0016887 GO:0043215 GO:1900753 |
| AF-A0A512DTK1-F1-model_v4 | ABC transporter ATP-binding protein | 0.9268 | 14 | 258 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar