F490605

General Info

Members Datasets Scaffolds Average Seq Length
1134 918 439 258

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2599185301|2599939305
Length 278
Sequence HQVTLDTATAVRPDGMNETPRVVLSARGLRRDFAGFVAVKDVDLDIHHGKIHALIGPNGAGKTTIFNLLTKFLQPTSGTIELLGTDITRTPPAKVARMGLVRSFQISAIFPHLSVLDNVRVALQRPGGLGYQFWRPVSALDQLTPRARELLAIVGLDDAAHRLAGDLSYGRKRVLEIATTLALDPKVLLLDEPMAGMGHEDVGTISGIIRSLAKDRAVLMVEHNLTVVADLCDWITVMQRGQVLAAGDYATVSKDERVRVAYMGTEHGGTEHGGTEHG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875024 Mesorhizobium loti R88b Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
25 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
29 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
30 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
31 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
32 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
33 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
37 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
38 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
39 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
40 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
41 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
42 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
43 2516143018 Ensifer sp. BR816 Isolate Nodule
44 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
45 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
46 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
47 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
48 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
49 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
50 2519899620 Rhizobium sp. Pop5 Isolate Nodule
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
57 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
58 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
59 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
60 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
61 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
62 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
63 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
64 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
65 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
66 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
67 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
68 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
69 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
70 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
75 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
78 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
79 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
80 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
81 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
82 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
83 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
84 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
85 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
86 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
87 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
88 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
89 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
90 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
91 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
92 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
93 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
94 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
95 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
96 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
97 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
98 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
99 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
100 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
101 2643221558 Rhizobium sp. Root149 Isolate Unclassified
102 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
103 2643221582 Rhizobium sp. Root651 Isolate Unclassified
104 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
105 2643221599 Rhizobium sp. Root708 Isolate Unclassified
106 2643221618 Ensifer sp. Root231 Isolate Unclassified
107 2643221626 Ensifer sp. Root31 Isolate Unclassified
108 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
109 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
110 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
111 2643221655 Ensifer sp. Root1252 Isolate Unclassified
112 2643221659 Ensifer sp. Root127 Isolate Unclassified
113 2643221688 Rhizobium sp. Root482 Isolate Unclassified
114 2643221693 Rhizobium sp. Root491 Isolate Unclassified
115 2643221698 Ensifer sp. Root142 Isolate Unclassified
116 2643221712 Ensifer sp. Root258 Isolate Unclassified
117 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
118 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
119 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
120 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
121 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
122 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
123 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
124 2718217882 Rhizobium sp. N741 Isolate Nodule
125 2718217927 Rhizobium sp. N324 Isolate Nodule
126 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
127 2718218009 Rhizobium sp. N561 Isolate Nodule
128 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
129 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
130 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
131 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
132 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
133 2718218363 Rhizobium sp. N113 Isolate Nodule
134 2718218365 Rhizobium sp. N731 Isolate Nodule
135 2718218366 Rhizobium sp. N621 Isolate Nodule
136 2718218423 Rhizobium sp. N941 Isolate Nodule
137 2721755514 Rhizobium sp. N6212 Isolate Nodule
138 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
139 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
140 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
141 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
142 2721755809 Rhizobium sp. N541 Isolate Nodule
143 2721755810 Rhizobium sp. N871 Isolate Nodule
144 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
145 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
146 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
147 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
148 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
149 2728369365 Rhizobium sp. N1341 Isolate Nodule
150 2728369397 Rhizobium sp. N1314 Isolate Nodule
151 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
152 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
153 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
154 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
155 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
156 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
157 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
158 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
159 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
160 2791355256 Rhizobium sp. M10 Isolate Nodule
161 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
162 2791355261 Rhizobium sp. J15 Isolate Nodule
163 2791355262 Rhizobium sp. M1 Isolate Nodule
164 2791355263 Rhizobium chutanense C5 Isolate Nodule
165 2791355264 Rhizobium sp. S9 Isolate Nodule
166 2791355265 Rhizobium sp. H4 Isolate Nodule
167 2791355266 Rhizobium sp. L43 Isolate Nodule
168 2791355267 Rhizobium sp. L18 Isolate Nodule
169 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
170 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
171 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
172 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
173 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
174 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
175 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
176 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
177 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
178 2802429633 Rhizobium anhuiense J3 Isolate Nodule
179 2802429634 Rhizobium anhuiense S10 Isolate Nodule
180 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
181 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
182 2802429637 Rhizobium anhuiense C15 Isolate Nodule
183 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
184 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
185 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
186 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
187 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
188 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
189 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
190 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
191 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
192 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
193 2838048938 Rhizobium pisi 27/80 Isolate Nodule
194 2838061910 Rhizobium phaseoli L15 Isolate Nodule
195 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
196 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
197 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
198 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
199 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
200 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
201 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
202 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
203 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
204 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
205 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
206 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
207 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
208 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
209 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
210 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
211 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
212 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
213 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
214 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
215 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
216 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
217 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
218 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
219 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
220 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
221 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
222 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
223 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
224 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
225 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
226 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
227 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
228 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
229 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
230 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
231 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
232 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
233 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
234 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
235 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
236 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
237 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
238 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
239 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
240 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
241 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
242 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
243 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
244 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
245 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
246 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
247 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
248 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
249 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
250 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
251 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
252 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
253 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
254 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
255 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
256 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
257 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
258 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
259 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
260 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
261 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
262 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
263 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
264 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
265 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
266 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
267 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
268 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
269 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
270 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
271 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
272 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
273 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
274 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
275 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
276 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
277 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
278 2844163670 Ensifer sp. 1H6 Isolate Unclassified
279 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
280 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
281 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
282 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
283 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
284 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
285 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
286 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
287 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
288 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
289 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
290 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
291 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
292 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
293 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
294 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
295 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
296 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
297 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
298 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
299 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
300 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
301 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
302 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
303 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
304 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
305 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
306 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
307 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
308 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
309 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
310 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
311 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
312 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
313 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
314 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
315 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
316 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
317 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
318 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
319 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
320 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
321 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
322 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
323 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
324 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
325 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
326 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
327 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
328 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
329 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
330 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
331 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
332 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
333 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
334 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
335 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
336 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
337 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
338 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
339 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
340 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
341 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
342 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
343 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
344 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
345 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
346 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
347 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
348 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
349 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
350 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
351 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
352 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
353 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
354 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
355 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
356 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
357 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
358 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
359 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
360 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
361 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
362 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
363 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
364 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
365 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
366 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
367 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
368 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
369 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
370 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
371 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
372 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
373 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
374 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
375 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
376 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
377 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
378 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
379 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
380 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
381 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
382 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
383 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
384 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
385 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
386 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
387 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
388 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
389 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
390 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
391 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
392 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
393 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
394 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
395 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
396 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
397 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
398 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
399 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
400 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
401 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
402 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
403 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
404 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
405 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
406 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
407 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
408 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
409 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
410 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
411 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
412 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
413 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
414 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
415 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
416 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
417 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
418 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
419 2933599457 Rhizobium phaseoli M3 Isolate Nodule
420 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
421 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
422 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
423 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
424 2936381700 Rhizobium chutanense C16 Isolate Unclassified
425 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
426 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
427 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
428 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
429 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
430 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
431 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
432 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
433 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
434 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
435 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
436 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
437 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
438 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
439 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
440 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
441 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
442 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
443 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
444 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
445 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
446 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
447 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
448 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
449 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
450 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
451 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
452 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
453 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
454 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
455 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
456 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
457 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
458 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
459 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
460 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
461 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
462 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
463 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
464 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
465 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
466 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
467 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
468 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
469 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
470 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
471 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
472 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
473 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
474 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
475 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
476 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
477 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
478 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
479 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
480 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
481 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
482 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
483 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
484 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
485 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
486 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
487 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
488 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
489 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
490 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
491 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
492 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
493 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
494 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
495 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
496 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
497 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
498 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
499 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
500 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
501 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
502 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
503 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
504 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
505 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
506 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
507 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
508 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
509 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
510 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
511 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
512 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
513 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
514 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
515 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
516 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
517 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
518 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
519 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
520 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
521 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
522 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
523 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
524 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
525 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
526 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
527 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
528 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
529 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
530 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
531 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
532 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
533 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
534 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
535 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
536 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
537 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
538 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
539 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
540 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
541 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
542 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
543 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
544 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
545 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
546 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
547 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
548 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
549 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
550 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
551 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
552 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
553 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
554 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
555 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
556 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
557 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
558 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
559 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
560 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
561 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
562 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
563 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
564 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
565 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
566 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
567 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
568 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
569 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
570 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
571 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
572 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
573 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
574 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
575 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
576 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
577 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
578 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
579 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
580 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
581 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
582 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
583 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
584 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
585 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
586 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
587 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
588 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
589 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
590 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
591 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
592 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
593 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
594 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
595 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
596 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
597 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
598 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
599 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
600 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
601 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
602 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
603 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
604 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
605 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
606 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
607 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
608 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
609 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
610 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
611 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
612 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
613 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
614 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
615 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
616 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
617 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
618 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
619 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
620 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
621 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
622 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
623 2996887358 Rhizobium sp. R711 Isolate Nodule
624 2996893221 Rhizobium sp. R635 Isolate Nodule
625 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
626 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
627 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
628 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
629 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
630 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
631 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
632 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
633 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
634 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
635 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
636 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
637 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
638 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
639 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
640 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
641 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
642 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
643 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
644 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
645 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
646 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
647 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
648 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
649 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
650 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
651 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
652 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
653 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
654 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
655 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
656 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
657 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
658 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
659 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
660 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
661 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
662 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
663 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
664 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
665 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
666 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
667 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
668 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
669 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
670 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
671 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
672 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
673 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
674 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
675 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
676 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
677 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
678 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
679 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
680 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
681 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
682 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
683 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
684 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
685 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
686 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
687 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
688 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
689 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
690 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
691 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
692 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
693 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
694 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
695 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
696 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
697 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
698 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
699 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
700 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
701 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
702 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
703 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
704 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
705 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
706 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
707 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
708 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
709 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
710 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
711 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
712 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
713 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
714 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
715 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
716 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
717 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
718 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
719 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
720 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
721 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
722 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
723 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
724 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
725 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
726 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
727 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
728 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
729 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
730 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
731 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
732 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
733 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
734 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
735 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
736 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
737 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
738 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
739 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
740 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
741 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
742 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
743 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
744 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
745 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
746 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
747 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
748 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
749 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
750 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
751 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
752 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
753 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
754 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
755 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
756 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
757 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
758 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
759 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
760 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
761 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
762 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
763 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
764 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
765 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
766 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
767 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
768 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
769 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
770 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
771 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
772 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
773 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
774 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
775 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
776 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
777 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
778 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
779 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
780 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
781 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
782 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
783 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
784 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
785 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
786 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
787 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
788 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
789 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
790 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
791 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
792 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
793 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
794 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
795 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
796 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
797 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
798 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
799 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
800 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
801 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
802 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
803 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
804 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
805 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
806 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
807 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
808 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
809 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
810 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
811 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
812 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
813 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
814 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
815 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
816 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
817 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
818 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
819 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
820 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
821 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
822 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
823 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
824 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
825 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
826 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
827 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
828 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
829 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
830 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
831 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
832 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
833 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
834 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
835 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
836 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
837 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
838 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
839 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
840 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
841 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
842 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
843 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
844 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
845 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
846 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
847 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
848 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
849 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
850 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
851 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
852 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
853 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
854 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
855 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
856 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
857 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
858 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
859 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
860 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
861 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
862 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
863 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
864 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
865 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
866 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
867 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
868 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
869 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
870 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
871 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
872 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
873 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
874 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
875 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
876 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
877 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
878 8005258706 Rhizobium sp. R693 Isolate Nodule
879 8005275841 Rhizobium sp. N4311 Isolate Nodule
880 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
881 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
882 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
883 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
884 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
885 8005321885 Rhizobium sp. R72 Isolate Nodule
886 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
887 8005382845 Rhizobium sp. R634 Isolate Nodule
888 8005395548 Rhizobium sp. R339 Isolate Nodule
889 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
890 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
891 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
892 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
893 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
894 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
895 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
896 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
897 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
898 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
899 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
900 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
901 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
902 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
903 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
904 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
905 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
906 8018176218 Rhizobium sp. N122 Isolate Nodule
907 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
908 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
909 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
910 8024501048 Rhizobium sp. H4 Isolate Nodule
911 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
912 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
913 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
914 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
915 8056382006 Rhizobium croatiense 13T Isolate Nodule
916 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
917 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
918 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.45
Metatranscriptomes 0.26
Isolates 61.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 15.78
Nodule 50.09
Rhizoplane 1.5
Rhizosphere 19.49
Stem 0
Stem Tuber 0.09
Unclassified 12.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000016 3300001979 Bacteria 58332
2 JGI25155J39150_1000013 3300002704 Bacteria 198215
3 JGI25156J39149_1000011 3300002705 Bacteria 198215
4 JGI25162J39368_1000169 3300002737 Bacteria 72114
5 JGI25162J39368_1001105 3300002737 Bacteria 16322
6 JGI25154J39366_1000030 3300002738 Bacteria 191444
7 JGI25158J39367_1000948 3300002739 Bacteria 5357
8 JGI25157J39369_1000013 3300002741 Bacteria 198211
9 JGI25157J39369_1000714 3300002741 Bacteria 17847
10 JGI25152J39213_1001230 3300002773 Bacteria 11702
11 JGI25152J39213_1005165 3300002773 Bacteria 3901
12 JGI25152J39213_1012244 3300002773 Bacteria 1851
13 JGI25152J39213_1012447 3300002773 Bacteria 1825
14 JGI25150J39212_1008843 3300002774 Bacteria 1949
15 JGI25159J45721_1000227 3300002987 Bacteria 26401
16 JGI25159J45721_1000591 3300002987 Bacteria 16244
17 JGI25151J46595_10000632 3300003187 Bacteria 30374
18 JGI25151J46595_10001667 3300003187 Bacteria 14569
19 JGI25151J46595_10004763 3300003187 Bacteria 7118
20 JGI25165J46597_1000025 3300003214 Bacteria 333075
21 JGI25165J46597_1000349 3300003214 Bacteria 52229
22 JGI25165J46597_1000355 3300003214 Bacteria 51475
23 JGI25153J46596_10016054 3300003215 Bacteria 3020
24 JGI25153J46596_10016244 3300003215 Bacteria 2993
25 JGI25153J46596_10023228 3300003215 Bacteria 2265
26 JGI25153J46596_10023597 3300003215 Bacteria 2238
27 rootL2_10021228 3300003322 Bacteria 2403
28 JGI25160J50197_1000041 3300003354 Bacteria 152843
29 JGI25160J50197_1000983 3300003354 Bacteria 14834
30 JGI25160J50197_1002019 3300003354 Bacteria 9675
31 JGI25160J50197_1026521 3300003354 Bacteria 1596
32 JGI25161J50226_1000002 3300003374 Bacteria 420324
33 JGI25161J50226_1000306 3300003374 Bacteria 27312
34 Ga0006562J51391_1007623 3300003578 Bacteria 4340
35 Ga0055526_1001289 3300003771 Bacteria 17973
36 Ga0055526_1003389 3300003771 Bacteria 10153
37 Ga0055526_1005911 3300003771 Bacteria 6835
38 Ga0055526_1006104 3300003771 Bacteria 6652
39 Ga0055524_1001745 3300003775 Bacteria 12006
40 Ga0055524_1005317 3300003775 Bacteria 5778
41 Ga0055524_1010426 3300003775 Bacteria 3699
42 Ga0055524_1017184 3300003775 Bacteria 2561
43 Ga0055536_1012753 3300003781 Bacteria 3088
44 Ga0055528_1000514 3300003790 Bacteria 30392
45 Ga0055528_1000943 3300003790 Bacteria 19373
46 Ga0055528_1001128 3300003790 Bacteria 17523
47 Ga0055528_1001756 3300003790 Bacteria 12485
48 Ga0055528_1005266 3300003790 Bacteria 6065
49 Ga0055528_1031768 3300003790 Bacteria 1365
50 Ga0055540_1000050 3300003792 Bacteria 145565
51 Ga0055540_1018276 3300003792 Bacteria 1924
52 Ga0055540_1029040 3300003792 Bacteria 1299
53 Ga0058692_1023785 3300003856 Bacteria 1239
54 Ga0055543_1000008 3300004625 Bacteria 202062
55 Ga0055543_1000021 3300004625 Bacteria 150116
56 Ga0055543_1006579 3300004625 Bacteria 2788
57 Ga0055543_1014863 3300004625 Bacteria 1508
58 Ga0065165_1000031 3300005262 Bacteria 216330
59 Ga0065165_1012183 3300005262 Bacteria 3520
60 Ga0065165_1012996 3300005262 Bacteria 3342
61 Ga0065165_1016664 3300005262 Bacteria 2742
62 Ga0065165_1020275 3300005262 Bacteria 2345
63 Ga0065165_1033862 3300005262 Bacteria 1586
64 Ga0070683_100558009 3300005329 Bacteria 1095
65 Ga0070666_10385916 3300005335 Bacteria 1006
66 Ga0070666_10403420 3300005335 Bacteria 983
67 Ga0070668_100241722 3300005347 Bacteria 1496
68 Ga0070669_100549279 3300005353 Bacteria 963
69 Ga0070663_100296542 3300005455 Bacteria 1293
70 Ga0068853_100174852 3300005539 Bacteria 1944
71 Ga0068853_100283511 3300005539 Bacteria 1527
72 Ga0070665_100132863 3300005548 Bacteria 2490
73 Ga0068855_100721926 3300005563 Bacteria 1065
74 Ga0068857_100141418 3300005577 Bacteria 2175
75 Ga0068856_100052105 3300005614 Bacteria 4035
76 Ga0068856_100175722 3300005614 Bacteria 2154
77 Ga0068856_100424527 3300005614 Bacteria 1349
78 Ga0081538_10026446 3300005981 Bacteria 4058
79 Ga0075365_10000959 3300006038 Bacteria 12253
80 Ga0075365_10014397 3300006038 Bacteria 4757
81 Ga0075365_10014902 3300006038 Bacteria 4687
82 Ga0075365_10020300 3300006038 Bacteria 4117
83 Ga0075365_10489461 3300006038 Bacteria 869
84 Ga0075368_10001344 3300006042 Bacteria 7817
85 Ga0075368_10071957 3300006042 Bacteria 1398
86 Ga0075363_100028806 3300006048 Bacteria 2861
87 Ga0075363_100050082 3300006048 Bacteria 2225
88 Ga0075363_100051617 3300006048 Bacteria 2194
89 Ga0075364_10007393 3300006051 Bacteria 6518
90 Ga0075364_10039812 3300006051 Bacteria 3048
91 Ga0075362_10003234 3300006177 Bacteria 5651
92 Ga0075362_10004260 3300006177 Bacteria 5111
93 Ga0075362_10085558 3300006177 Bacteria 1458
94 Ga0075367_10005140 3300006178 Bacteria 6460
95 Ga0075367_10017983 3300006178 Bacteria 3892
96 Ga0075367_10030507 3300006178 Bacteria 3091
97 Ga0075367_10205331 3300006178 Bacteria 1231
98 Ga0075369_10162961 3300006186 Bacteria 1022
99 Ga0075366_10007386 3300006195 Bacteria 6067
100 Ga0075366_10206974 3300006195 Bacteria 1194
101 Ga0075370_10003972 3300006353 Bacteria 7107
102 Ga0075370_10031999 3300006353 Bacteria 2938
103 Ga0075370_10089005 3300006353 Bacteria 1780
104 Ga0075370_10208737 3300006353 Bacteria 1153
105 Ga0075430_100227304 3300006846 Bacteria 1548
106 Ga0079104_1003805 3300006946 Bacteria 6778
107 Ga0099826_10001282 3300006948 Bacteria 14779
108 Ga0099826_10013390 3300006948 Bacteria 6198
109 Ga0105244_10063044 3300009036 Bacteria 1862
110 Ga0105248_10178354 3300009177 Bacteria 2394
111 Ga0105237_10005808 3300009545 Bacteria 13843
112 Ga0105237_10035890 3300009545 Bacteria 5015
113 Ga0105237_10191329 3300009545 Bacteria 2046
114 Ga0105249_10087412 3300009553 Bacteria 2908
115 Ga0123341_1000115 3300009765 Bacteria 35967
116 Ga0123342_1016494 3300009766 Bacteria 6412
117 Ga0105239_10070535 3300010375 Bacteria 3839
118 Ga0105239_10575632 3300010375 Bacteria 1283
119 Ga0105239_10800674 3300010375 Bacteria 1080
120 Ga0105246_10319943 3300011119 Bacteria 1260
121 Ga0157373_10000761 3300013100 Bacteria 24994
122 Ga0157373_10094705 3300013100 Bacteria 2102
123 Ga0157371_10000235 3300013102 Bacteria 79378
124 Ga0157371_10267839 3300013102 Bacteria 1232
125 Ga0157370_10002006 3300013104 Bacteria 25031
126 Ga0157370_10177769 3300013104 Bacteria 1978
127 Ga0157370_10247367 3300013104 Bacteria 1649
128 Ga0157369_10300389 3300013105 Bacteria 1670
129 Ga0171463_1004 3300013249 Bacteria 437207
130 Ga0157374_10077167 3300013296 Bacteria 3152
131 Ga0163162_10746923 3300013306 Bacteria 1098
132 Ga0157372_10253722 3300013307 Bacteria 2042
133 Ga0183363_1024 3300015690 Bacteria 54122
134 Ga0214543_1000053 3300021327 Bacteria 141797
135 Ga0228711_1008337 3300022739 Bacteria 14590
136 Ga0228710_1008588 3300022740 Bacteria 14595
137 Ga0209435_100026 3300025206 Bacteria 198295
138 Ga0209437_100056 3300025233 Bacteria 363071
139 Ga0209437_100196 3300025233 Bacteria 121199
140 Ga0207425_1001570 3300025245 Bacteria 9267
141 Ga0207425_1004911 3300025245 Bacteria 3914
142 Ga0207425_1026251 3300025245 Bacteria 1197
143 Ga0207425_1032715 3300025245 Bacteria 1028
144 Ga0209646_1000084 3300025246 Bacteria 198295
145 Ga0209646_1009081 3300025246 Bacteria 1582
146 Ga0209646_1010980 3300025246 Bacteria 1409
147 Ga0209646_1017879 3300025246 Bacteria 1042
148 Ga0209026_1000071 3300025250 Bacteria 205592
149 Ga0209026_1000080 3300025250 Bacteria 198295
150 Ga0209677_100374 3300025253 Bacteria 27370
151 Ga0209148_1002561 3300025254 Bacteria 6042
152 Ga0209148_1003556 3300025254 Bacteria 4228
153 Ga0209759_1000061 3300025256 Bacteria 198295
154 Ga0209759_1000620 3300025256 Bacteria 33871
155 Ga0209129_1000120 3300025258 Bacteria 137898
156 Ga0209129_1000536 3300025258 Bacteria 26442
157 Ga0209129_1000571 3300025258 Bacteria 25391
158 Ga0209129_1004628 3300025258 Bacteria 5267
159 Ga0209129_1006416 3300025258 Bacteria 3803
160 Ga0209129_1018203 3300025258 Bacteria 1355
161 Ga0209233_1000037 3300025261 Bacteria 554620
162 Ga0209233_1000053 3300025261 Bacteria 444909
163 Ga0209233_1000071 3300025261 Bacteria 363290
164 Ga0209233_1000243 3300025261 Bacteria 90170
165 Ga0209673_1000023 3300025273 Bacteria 411385
166 Ga0209673_1000757 3300025273 Bacteria 44039
167 Ga0209673_1001620 3300025273 Bacteria 19608
168 Ga0209673_1001741 3300025273 Bacteria 18243
169 Ga0209673_1002370 3300025273 Bacteria 13233
170 Ga0209130_1000001 3300025284 Bacteria 831557
171 Ga0209130_1000382 3300025284 Bacteria 49448
172 Ga0209025_1000072 3300025294 Bacteria 283452
173 Ga0209025_1000252 3300025294 Bacteria 126233
174 Ga0209025_1000277 3300025294 Bacteria 117930
175 Ga0209025_1003388 3300025294 Bacteria 15189
176 Ga0209025_1020739 3300025294 Bacteria 3574
177 Ga0209025_1023751 3300025294 Bacteria 3191
178 Ga0209025_1071735 3300025294 Bacteria 1225
179 Ga0209564_1000100 3300025295 Bacteria 224016
180 Ga0209564_1001025 3300025295 Bacteria 34384
181 Ga0209564_1002118 3300025295 Bacteria 16837
182 Ga0209564_1004021 3300025295 Bacteria 9301
183 Ga0209564_1038546 3300025295 Bacteria 1327
184 Ga0209758_1000053 3300025297 Bacteria 337751
185 Ga0209758_1000105 3300025297 Bacteria 221415
186 Ga0209758_1000712 3300025297 Bacteria 49095
187 Ga0209758_1000937 3300025297 Bacteria 39370
188 Ga0209758_1016480 3300025297 Bacteria 3751
189 Ga0209758_1021425 3300025297 Bacteria 3013
190 Ga0209758_1027414 3300025297 Bacteria 2434
191 Ga0209758_1049679 3300025297 Bacteria 1478
192 Ga0209758_1068289 3300025297 Bacteria 1132
193 Ga0209050_1003885 3300025298 Bacteria 10612
194 Ga0209050_1009391 3300025298 Bacteria 5013
195 Ga0209256_1000818 3300025299 Bacteria 39749
196 Ga0209256_1001066 3300025299 Bacteria 31822
197 Ga0209256_1005113 3300025299 Bacteria 7776
198 Ga0209256_1013141 3300025299 Bacteria 3097
199 Ga0207426_1000005 3300025302 Bacteria 1037188
200 Ga0207426_1000012 3300025302 Bacteria 730942
201 Ga0207426_1000035 3300025302 Bacteria 448327
202 Ga0207426_1002475 3300025302 Bacteria 11751
203 Ga0209051_1000062 3300025303 Bacteria 251081
204 Ga0209051_1000968 3300025303 Bacteria 28047
205 Ga0209051_1001021 3300025303 Bacteria 26776
206 Ga0209051_1004132 3300025303 Bacteria 9088
207 Ga0209051_1007606 3300025303 Bacteria 5897
208 Ga0209051_1048620 3300025303 Bacteria 1436
209 Ga0209257_1002192 3300025304 Bacteria 20207
210 Ga0209257_1004328 3300025304 Bacteria 11122
211 Ga0207647_10048823 3300025904 Bacteria 2627
212 Ga0207705_10106390 3300025909 Bacteria 2069
213 Ga0207695_10000036 3300025913 Bacteria 477897
214 Ga0207695_10172606 3300025913 Bacteria 2087
215 Ga0207671_10002082 3300025914 Bacteria 21889
216 Ga0207671_10051807 3300025914 Bacteria 3041
217 Ga0207694_10033380 3300025924 Bacteria 3942
218 Ga0207650_10145578 3300025925 Bacteria 1866
219 Ga0207669_10406271 3300025937 Bacteria 1068
220 Ga0207711_10091723 3300025941 Bacteria 2672
221 Ga0207661_10546636 3300025944 Bacteria 1061
222 Ga0207667_10938729 3300025949 Bacteria 855
223 Ga0207712_10101877 3300025961 Bacteria 2136
224 Ga0207640_10064525 3300025981 Bacteria 2439
225 Ga0207640_10081709 3300025981 Bacteria 2211
226 Ga0207678_10125485 3300026067 Bacteria 2190
227 Ga0207702_10018934 3300026078 Bacteria 5696
228 Ga0207702_10035872 3300026078 Bacteria 4147
229 Ga0207702_10565177 3300026078 Bacteria 1113
230 Ga0207702_10574594 3300026078 Bacteria 1104
231 Ga0207674_10184107 3300026116 Bacteria 2039
232 Ga0207698_10072392 3300026142 Bacteria 2740
233 Ga0209281_1000596 3300027111 Bacteria 41157
234 Ga0209281_1002300 3300027111 Bacteria 8028
235 Ga0209371_1000035 3300027312 Bacteria 368979
236 Ga0209371_1002757 3300027312 Bacteria 9420
237 Ga0209371_1008430 3300027312 Bacteria 3430
238 Ga0209282_1000157 3300027666 Bacteria 39435
239 Ga0209282_1000173 3300027666 Bacteria 36304
240 Ga0209282_1033066 3300027666 Bacteria 3155
241 Ga0209813_10006996 3300027866 Bacteria 2800
242 Ga0209813_10031977 3300027866 Bacteria 1556
243 Ga0207428_10000096 3300027907 Bacteria 123081
244 Ga0268266_10212673 3300028379 Bacteria 1774
245 Ga0268266_10468436 3300028379 Bacteria 1199
246 Ga0268266_10584702 3300028379 Bacteria 1072
247 Ga0268256_1000037 3300030500 Bacteria 367024
248 Ga0268256_1008754 3300030500 Bacteria 3439
249 Ga0307408_100224731 3300031548 Bacteria 1534
250 Ga0307408_100381959 3300031548 Bacteria 1204
251 Ga0307413_10199635 3300031824 Bacteria 1443
252 Ga0307413_10365486 3300031824 Bacteria 1119
253 Ga0307406_10368312 3300031901 Bacteria 1129
254 Ga0307407_10034112 3300031903 Bacteria 2783
255 Ga0307412_10243738 3300031911 Bacteria 1392
256 Ga0315914_1000965 3300031967 Bacteria 40741
257 Ga0307409_100187829 3300031995 Bacteria 1836
258 Ga0307409_100594148 3300031995 Bacteria 1093
259 Ga0307414_10000876 3300032004 Bacteria 15390
260 Ga0307415_100328642 3300032126 Bacteria 1278
261 Ga0307510_10199050 3300033180 Bacteria 1541
262 Ga0307510_10239906 3300033180 Bacteria 1308
263 Ga0315913_1000276 3300033430 Bacteria 40740
264 Ga0315915_1000499 3300033464 Bacteria 40728
265 Ga0395900_0152072 3300037418 Bacteria 2364
266 Ga0395905_0001086 3300037471 Bacteria 34208
267 Ga0395905_0006215 3300037471 Bacteria 12056
268 Ga0395905_0215862 3300037471 Bacteria 1796
269 Ga0395905_0251058 3300037471 Bacteria 1652
270 Ga0395905_0411431 3300037471 Bacteria 1248
271 Ga0395905_0451404 3300037471 Bacteria 1183
272 Ga0395901_0050098 3300038443 Bacteria 4340
273 Ga0395901_0156455 3300038443 Bacteria 2394
274 Ga0395901_0426964 3300038443 Bacteria 1358
275 Ga0395901_0667657 3300038443 Bacteria 1041
276 Ga0439436_0011711 3300041404 Bacteria 2664
277 Ga0439466_0082570 3300041411 Bacteria 1013
278 Ga0439465_0004075 3300041413 Bacteria 4757
279 Ga0439465_0033388 3300041413 Bacteria 1645
280 Ga0439465_0037614 3300041413 Bacteria 1557
281 Ga0451851_0673005 3300041507 Bacteria 1319
282 Ga0439449_0015719 3300042007 Bacteria 2846
283 Ga0466970_0117416 3300044765 Bacteria 1455
284 Ga0466960_0217002 3300044901 Bacteria 1051
285 Ga0466958_0261262 3300045836 Bacteria 1108
286 Ga0495603_0178475 3300046455 Bacteria 1229
287 Ga0495638_0001300 3300046460 Bacteria 23172
288 Ga0495638_0089498 3300046460 Bacteria 1857
289 Ga0495605_0112303 3300046474 Bacteria 1242
290 Ga0495662_0024666 3300046476 Bacteria 2902
291 Ga0495664_0125800 3300046477 Bacteria 1551
292 Ga0495585_0022101 3300046492 Bacteria 3652
293 Ga0495585_0113079 3300046492 Bacteria 1442
294 Ga0495607_0044805 3300046501 Bacteria 2606
295 Ga0495583_0000748 3300046506 Bacteria 41309
296 Ga0495606_0001591 3300046507 Bacteria 29647
297 Ga0495616_0107622 3300046513 Bacteria 1299
298 Ga0495620_0153106 3300046515 Bacteria 898
299 Ga0495620_0174774 3300046515 Bacteria 832
300 Ga0495631_0017761 3300046518 Bacteria 3358
301 Ga0495631_0080547 3300046518 Bacteria 1405
302 Ga0495632_0000696 3300046519 Bacteria 30538
303 Ga0495632_0016377 3300046519 Bacteria 4128
304 Ga0495643_0025720 3300046522 Bacteria 3328
305 Ga0495643_0058815 3300046522 Bacteria 2044
306 Ga0495643_0065937 3300046522 Bacteria 1911
307 Ga0495654_0000152 3300046530 Bacteria 70943
308 Ga0495609_0077834 3300046538 Bacteria 1452
309 Ga0495622_0048413 3300046557 Bacteria 1975
310 Ga0495633_0019049 3300046558 Bacteria 3474
311 Ga0495656_0092854 3300046615 Bacteria 1383
312 Ga0495668_0131585 3300046616 Bacteria 1369
313 Ga0495625_0011341 3300046660 Bacteria 7277
314 Ga0495625_0047807 3300046660 Bacteria 3084
315 Ga0495625_0067828 3300046660 Bacteria 2509
316 Ga0495588_0014518 3300046674 Bacteria 3772
317 Ga0495671_0019894 3300046692 Bacteria 3543
318 Ga0495671_0127701 3300046692 Bacteria 1240
319 Ga0495589_0110186 3300046794 Bacteria 1329
320 Ga0495600_0064861 3300046809 Bacteria 2387
321 Ga0495660_0082288 3300046810 Bacteria 1686
322 Ga0495604_0005541 3300047317 Bacteria 10010
323 Ga0495672_0101995 3300047320 Bacteria 1554
324 Ga0495681_0008484 3300047470 Bacteria 6442
325 Ga0495686_0002544 3300047472 Bacteria 17029
326 Ga0495686_0108119 3300047472 Bacteria 1671
327 Ga0495626_0044213 3300048091 Bacteria 2086
328 Ga0495626_0081479 3300048091 Bacteria 1437
329 Ga0496102_0186729 3300048905 Bacteria 1954
330 Ga0496102_0276185 3300048905 Bacteria 1584
331 Ga0496102_0554993 3300048905 Bacteria 1071
332 Ga0496105_0076652 3300048908 Bacteria 2761
333 Ga0496106_0039386 3300048909 Bacteria 3539
334 Ga0496110_0072086 3300048913 Bacteria 3064
335 Ga0496111_0156995 3300048914 Bacteria 1688
336 Ga0496114_0558796 3300048917 Bacteria 1011
337 Ga0496115_0316602 3300048918 Bacteria 1277
338 Ga0496116_0018353 3300048919 Bacteria 5396
339 Ga0496116_0073789 3300048919 Bacteria 2149
340 Ga0496116_0145547 3300048919 Bacteria 1325
341 Ga0496117_0000066 3300048920 Bacteria 253534
342 Ga0496117_0118304 3300048920 Bacteria 1634
343 Ga0496118_0000231 3300048921 Bacteria 97930
344 Ga0496118_0112379 3300048921 Bacteria 1803
345 Ga0496119_0024379 3300048922 Bacteria 4257
346 Ga0496119_0033679 3300048922 Bacteria 3391
347 Ga0496119_0050439 3300048922 Bacteria 2565
348 Ga0496120_0000463 3300048923 Bacteria 64041
349 Ga0496120_0002893 3300048923 Bacteria 16428
350 Ga0496120_0011718 3300048923 Bacteria 6012
351 Ga0496120_0017106 3300048923 Bacteria 4712
352 Ga0496120_0123223 3300048923 Bacteria 1337
353 Ga0496121_0022022 3300048924 Bacteria 6207
354 Ga0496121_0038709 3300048924 Bacteria 4216
355 Ga0496121_0067349 3300048924 Bacteria 2902
356 Ga0496121_0097085 3300048924 Bacteria 2284
357 Ga0496121_0107839 3300048924 Bacteria 2131
358 Ga0496121_0112114 3300048924 Bacteria 2078
359 Ga0496121_0313487 3300048924 Bacteria 1059
360 Ga0496122_0000057 3300048925 Bacteria 253452
361 Ga0496122_0019450 3300048925 Bacteria 6201
362 Ga0496122_0104127 3300048925 Bacteria 1886
363 Ga0496122_0139312 3300048925 Bacteria 1521
364 Ga0496122_0158166 3300048925 Bacteria 1386
365 Ga0496122_0206333 3300048925 Bacteria 1143
366 Ga0496122_0257056 3300048925 Bacteria 972
367 Ga0496123_0000401 3300048926 Bacteria 79665
368 Ga0496123_0127002 3300048926 Bacteria 1421
369 Ga0496123_0194668 3300048926 Bacteria 1045
370 Ga0496124_0004181 3300048927 Bacteria 17013
371 Ga0496124_0019787 3300048927 Bacteria 6248
372 Ga0496124_0190220 3300048927 Bacteria 1571
373 Ga0496124_0197550 3300048927 Bacteria 1533
374 Ga0496125_0045484 3300048928 Bacteria 3693
375 Ga0496125_0091097 3300048928 Bacteria 2285
376 Ga0496126_0052537 3300048929 Bacteria 3702
377 Ga0496126_0093950 3300048929 Bacteria 2632
378 Ga0496126_0322633 3300048929 Bacteria 1269
379 Ga0496126_0559939 3300048929 Bacteria 906
380 Ga0501032_0178682 3300049569 Bacteria 1390
381 Ga0501033_0023658 3300049570 Bacteria 4633
382 Ga0501033_0063731 3300049570 Bacteria 2712
383 Ga0501033_0266499 3300049570 Bacteria 1211
384 Ga0501034_0033440 3300049571 Bacteria 5216
385 Ga0501034_0090204 3300049571 Bacteria 3063
386 Ga0501037_0087442 3300049573 Bacteria 2256
387 Ga0501037_0240192 3300049573 Bacteria 1270
388 Ga0501040_0099154 3300049576 Bacteria 2031
389 Ga0501043_0034502 3300049579 Bacteria 3979
390 Ga0501047_0027460 3300049581 Bacteria 5484
391 Ga0501047_0030187 3300049581 Bacteria 5227
392 Ga0501047_0048073 3300049581 Bacteria 4120
393 Ga0501047_0194449 3300049581 Bacteria 1891
394 Ga0501047_0323062 3300049581 Bacteria 1383
395 Ga0501048_0030062 3300049582 Bacteria 3934
396 Ga0501068_0180106 3300049584 Bacteria 1336
397 Ga0501070_0271963 3300049586 Bacteria 1383
398 Ga0501035_0088575 3300049822 Bacteria 2727
399 Ga0501044_0052590 3300049823 Bacteria 4196
400 Ga0501044_0198705 3300049823 Bacteria 1964
401 Ga0501044_0287564 3300049823 Bacteria 1576
402 nmdc:mga03683_152350_c1 3300050489 Bacteria 1044
403 nmdc:mga03n38_21859_c1 3300050490 Bacteria 2581
404 nmdc:mga00v17_158726_c1 3300050491 Bacteria 1455
405 nmdc:mga00v17_16076_c1 3300050491 Bacteria 4214
406 nmdc:mga0yw44_114070_c1 3300050492 Bacteria 1734
407 nmdc:mga0yw44_887_c1 3300050492 Bacteria 11269
408 nmdc:mga04h51_21723_c2 3300050495 Bacteria 1554
409 nmdc:mga07m45_117635_c1 3300050496 Bacteria 1534
410 nmdc:mga07m45_61480_c1 3300050496 Bacteria 2128
411 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
412 nmdc:mga0sz30_13122_c1 3300050516 Bacteria 3238
413 Ga0500610_0031643 3300053079 Bacteria 2689
414 Ga0500610_0165133 3300053079 Bacteria 1098
415 Ga0495655_0026994 3300053083 Bacteria 1358
416 Ga0500557_062594 3300053105 Bacteria 1210
417 Ga0500560_003025 3300053107 Bacteria 3328
418 Ga0500560_017143 3300053107 Bacteria 1993
419 Ga0500594_0048362 3300053118 Bacteria 1189
420 Ga0500618_000028 3300053125 Bacteria 140440
421 Ga0500618_005616 3300053125 Bacteria 3785
422 Ga0500618_014087 3300053125 Bacteria 2052
423 Ga0500658_0001954 3300053134 Bacteria 8068
424 Ga0500658_0059571 3300053134 Bacteria 1584
425 Ga0500561_0000056 3300053137 Bacteria 21920
426 Ga0500568_0001903 3300053139 Bacteria 12834
427 Ga0500573_0021214 3300053140 Bacteria 3721
428 Ga0500590_075759 3300053148 Bacteria 1663
429 Ga0500604_0004558 3300053151 Bacteria 3671
430 Ga0500604_0033565 3300053151 Bacteria 1518
431 Ga0500616_0001321 3300053153 Bacteria 24446
432 Ga0500616_0001649 3300053153 Bacteria 20642
433 Ga0500622_0001224 3300053156 Bacteria 21087
434 Ga0500633_0109602 3300053160 Bacteria 1022
435 Ga0500611_005341 3300053727 Bacteria 1800
436 Ga0587082_007109 3300059504 Bacteria 1517
437 Ga0587072_013588 3300059643 Bacteria 1361
438 Ga0501082_0324748 3300060353 Bacteria 1341
439 Ga0466962_0049409 3300061719 Bacteria 2010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0033388 Ga0439465_0033388_613_1392 225
2 3300003856 Ga0058692_1023785 Ga0058692_10237852 230
3 3300031911 Ga0307412_10243738 Ga0307412_102437382 232
4 3300049570 Ga0501033_0266499 Ga0501033_0266499_262_1062 233
5 3300049581 Ga0501047_0323062 Ga0501047_0323062_381_1181 233
6 iso_pu_bacteria 650716007 650843760 241
7 iso_pu_bacteria 2508501122 2509109396 243
8 iso_pu_bacteria 2509276021 2509385519 243
9 iso_pu_bacteria 2510917022 2511134773 243
10 iso_pu_bacteria 2513237084 2513569619 243
11 iso_pu_bacteria 2513237085 2513576443 243
12 iso_pu_bacteria 2513237086 2513588612 243
13 iso_pu_bacteria 2513237093 2513635285 243
14 iso_pu_bacteria 2513237143 2513907404 243
15 iso_pu_bacteria 2513237162 2514018809 243
16 iso_pu_bacteria 2515154107 2515613531 243
17 iso_pu_bacteria 2515154113 2515633287 243
18 iso_pu_bacteria 2515154116 2515658489 243
19 iso_pu_bacteria 2515154134 2515741954 243
20 iso_pu_bacteria 2524023207 2524453246 243
21 iso_pu_bacteria 2524023209 2524458263 243
22 iso_pu_bacteria 2551306084 2551679014 243
23 iso_pu_bacteria 2551306086 2551692572 243
24 iso_pu_bacteria 2551306087 2551699423 243
25 iso_pu_bacteria 2551306089 2551713064 243
26 iso_pu_bacteria 2551306091 2551728350 243
27 iso_pu_bacteria 2551306092 2551734246 243
28 iso_pu_bacteria 2551306093 2551742628 243
29 iso_pu_bacteria 2582581307 2585273840 243
30 iso_pu_bacteria 2585427526 2585524200 243
31 iso_pu_bacteria 2585427528 2585539236 243
32 iso_pu_bacteria 2585427531 2585560016 243
33 iso_pu_bacteria 2585427593 2585837190 243
34 iso_pu_bacteria 2585427609 2585905804 243
35 iso_pu_bacteria 2585428125 2587979080 243
36 iso_pu_bacteria 2599185236 2599718691 243
37 iso_pu_bacteria 2765235942 2766068408 243
38 iso_pu_bacteria 2775507049 2776914771 243
39 iso_pu_bacteria 2791355094 2792643487 243
40 iso_pu_bacteria 2791355267 2793369717 243
41 iso_pu_bacteria 2802429636 2806066064 243
42 iso_pu_bacteria 2802429637 2806073354 243
43 iso_pu_bacteria 2838029111 2838029390 243
44 iso_pu_bacteria 2838074704 2838078359 243
45 iso_pu_bacteria 2841851746 2841858449 243
46 iso_pu_bacteria 2842156927 2842162697 243
47 iso_pu_bacteria 2842180545 2842186201 243
48 iso_pu_bacteria 2842205361 2842210305 243
49 iso_pu_bacteria 2842243621 2842250753 243
50 iso_pu_bacteria 2842278818 2842283759 243
51 iso_pu_bacteria 2842298080 2842299551 243
52 iso_pu_bacteria 2842357229 2842360978 243
53 iso_pu_bacteria 2842395702 2842396380 243
54 iso_pu_bacteria 2842475841 2842476180 243
55 iso_pu_bacteria 2842502639 2842502918 243
56 iso_pu_bacteria 2842509118 2842512766 243
57 iso_pu_bacteria 2844163670 2844164126 243
58 iso_pu_bacteria 2852387548 2852388377 243
59 iso_pu_bacteria 2882632389 2882633747 243
60 iso_pu_bacteria 2896384573 2896389893 243
61 iso_pu_bacteria 2904578770 2904582526 243
62 iso_pu_bacteria 2919408235 2919408701 243
63 iso_pu_bacteria 2920760137 2920760539 243
64 iso_pu_bacteria 2936375103 2936377888 243
65 iso_pu_bacteria 2936996657 2936997656 243
66 iso_pu_bacteria 648276728 648741870 243
67 iso_pu_bacteria 651053060 651174340 243
68 iso_pu_bacteria 8005376324 8005381897 243
69 iso_pu_bacteria 8005460587 8005466828 243
70 iso_pu_bacteria 8005556819 8005562138 243
71 iso_pu_bacteria 8056375014 8056375162 243
72 iso_pu_bacteria 8057874678 8057878363 243
73 iso_pu_bacteria 2510917028 2511184364 246
74 3300003187 JGI25151J46595_10004763 JGI25151J46595_100047635 247
75 3300003215 JGI25153J46596_10016244 JGI25153J46596_100162442 247
76 3300003215 JGI25153J46596_10023597 JGI25153J46596_100235972 247
77 3300003354 JGI25160J50197_1000983 JGI25160J50197_100098310 247
78 3300003781 Ga0055536_1012753 Ga0055536_10127533 247
79 3300004625 Ga0055543_1006579 Ga0055543_10065793 247
80 3300005262 Ga0065165_1020275 Ga0065165_10202752 247
81 3300006353 Ga0075370_10089005 Ga0075370_100890052 247
82 3300025295 Ga0209564_1038546 Ga0209564_10385462 247
83 3300025297 Ga0209758_1068289 Ga0209758_10682892 247
84 3300025299 Ga0209256_1005113 Ga0209256_10051137 247
85 3300025302 Ga0207426_1000035 Ga0207426_1000035197 247
86 3300031901 Ga0307406_10368312 Ga0307406_103683121 247
87 3300031995 Ga0307409_100187829 Ga0307409_1001878292 247
88 3300037471 Ga0395905_0411431 Ga0395905_0411431_414_1169 247
89 3300038443 Ga0395901_0426964 Ga0395901_0426964_547_1302 247
90 3300041507 Ga0451851_0673005 Ga0451851_0673005_563_1306 247
91 3300046455 Ga0495603_0178475 Ga0495603_0178475_176_919 247
92 3300046492 Ga0495585_0113079 Ga0495585_0113079_305_1048 247
93 3300046513 Ga0495616_0107622 Ga0495616_0107622_508_1251 247
94 3300046518 Ga0495631_0080547 Ga0495631_0080547_581_1324 247
95 3300046615 Ga0495656_0092854 Ga0495656_0092854_225_968 247
96 3300046794 Ga0495589_0110186 Ga0495589_0110186_103_846 247
97 3300048917 Ga0496114_0558796 Ga0496114_0558796_257_1000 247
98 3300003354 JGI25160J50197_1026521 JGI25160J50197_10265211 250
99 3300003775 Ga0055524_1010426 Ga0055524_10104262 250
100 3300005335 Ga0070666_10385916 Ga0070666_103859161 250
101 3300005347 Ga0070668_100241722 Ga0070668_1002417222 250
102 3300005455 Ga0070663_100296542 Ga0070663_1002965422 250
103 3300006038 Ga0075365_10014397 Ga0075365_100143973 250
104 3300006048 Ga0075363_100050082 Ga0075363_1000500822 250
105 iso_pu_bacteria 2657244999 2657682655 252
106 iso_pu_bacteria 2751185821 2753462868 252
107 iso_pu_bacteria 2802429268 2804753455 252
108 3300037471 Ga0395905_0001086 Ga0395905_0001086_30159_30920 253
109 3300049823 Ga0501044_0287564 Ga0501044_0287564_529_1290 253
110 iso_pu_bacteria 2713897090 2715498835 253
111 iso_pu_bacteria 2855020534 2855021549 253
112 iso_pu_bacteria 2899259804 2899260959 253
113 iso_pu_bacteria 2582581316 2585330244 254
114 iso_pu_bacteria 2643221564 2643840171 254
115 iso_pu_bacteria 2996336353 2996336963 254
116 iso_pu_bacteria 3000405567 3000408581 254
117 iso_pu_bacteria 2503198000 2503198680 255
118 iso_pu_bacteria 2508501123 2509114083 255
119 iso_pu_bacteria 2509276018 2509368717 255
120 iso_pu_bacteria 2512875024 2512962123 255
121 iso_pu_bacteria 2585427608 2585900691 255
122 iso_pu_bacteria 2588253730 2588519999 255
123 iso_pu_bacteria 2643221595 2643983522 255
124 iso_pu_bacteria 2643221627 2644157164 255
125 iso_pu_bacteria 2687453392 2688595969 255
126 iso_pu_bacteria 2844002411 2844003451 255
127 iso_pu_bacteria 2844009547 2844010784 255
128 iso_pu_bacteria 2856328259 2856332547 255
129 iso_pu_bacteria 2856334872 2856338447 255
130 iso_pu_bacteria 2857367948 2857369777 255
131 iso_pu_bacteria 2869169390 2869171991 255
132 iso_pu_bacteria 2869234852 2869241813 255
133 iso_pu_bacteria 2869242130 2869243837 255
134 iso_pu_bacteria 2869249662 2869254458 255
135 iso_pu_bacteria 2869256925 2869262880 255
136 iso_pu_bacteria 2869264136 2869270750 255
137 iso_pu_bacteria 2869271264 2869277209 255
138 iso_pu_bacteria 2871435913 2871442144 255
139 iso_pu_bacteria 2871451962 2871454354 255
140 iso_pu_bacteria 2871459585 2871460564 255
141 iso_pu_bacteria 2871481445 2871488022 255
142 iso_pu_bacteria 2874109183 2874111035 255
143 iso_pu_bacteria 2874116593 2874117589 255
144 iso_pu_bacteria 2874123672 2874124434 255
145 iso_pu_bacteria 2874131515 2874134580 255
146 iso_pu_bacteria 2874162495 2874165897 255
147 iso_pu_bacteria 2876386047 2876386421 255
148 iso_pu_bacteria 2876399893 2876400096 255
149 iso_pu_bacteria 2876420981 2876423447 255
150 iso_pu_bacteria 2878730984 2878737073 255
151 iso_pu_bacteria 2878774303 2878774584 255
152 iso_pu_bacteria 2878781027 2878781363 255
153 iso_pu_bacteria 2903513507 2903517846 255
154 iso_pu_bacteria 2906363423 2906367020 255
155 iso_pu_bacteria 2906370794 2906371178 255
156 iso_pu_bacteria 2906386501 2906392573 255
157 iso_pu_bacteria 2906393657 2906396905 255
158 iso_pu_bacteria 2906401398 2906401885 255
159 iso_pu_bacteria 2906408224 2906412562 255
160 iso_pu_bacteria 2906427513 2906431667 255
161 iso_pu_bacteria 2922151315 2922156937 255
162 iso_pu_bacteria 2922178524 2922185293 255
163 iso_pu_bacteria 2924710171 2924715046 255
164 iso_pu_bacteria 2924733363 2924734790 255
165 iso_pu_bacteria 2924748358 2924748888 255
166 iso_pu_bacteria 2937861824 2937862848 255
167 iso_pu_bacteria 2937980651 2937982749 255
168 iso_pu_bacteria 2958064165 2958065240 255
169 iso_pu_bacteria 2958108152 2958108566 255
170 iso_pu_bacteria 2958122699 2958129998 255
171 iso_pu_bacteria 2958137437 2958138913 255
172 iso_pu_bacteria 2958158011 2958163706 255
173 iso_pu_bacteria 2961136820 2961143561 255
174 iso_pu_bacteria 2961183825 2961184187 255
175 iso_pu_bacteria 2965025482 2965029995 255
176 iso_pu_bacteria 2965032056 2965035803 255
177 iso_pu_bacteria 2965040258 2965043064 255
178 iso_pu_bacteria 2965047637 2965054816 255
179 iso_pu_bacteria 2965089291 2965092644 255
180 iso_pu_bacteria 2965102966 2965108388 255
181 iso_pu_bacteria 2965110997 2965114870 255
182 iso_pu_bacteria 2968138860 2968145769 255
183 iso_pu_bacteria 2970489779 2970492031 255
184 iso_pu_bacteria 2970510686 2970513192 255
185 iso_pu_bacteria 2970532167 2970532353 255
186 iso_pu_bacteria 2970547951 2970553295 255
187 iso_pu_bacteria 2970619444 2970626158 255
188 iso_pu_bacteria 2970627176 2970628136 255
189 iso_pu_bacteria 2977851361 2977855779 255
190 iso_pu_bacteria 2977872689 2977876617 255
191 iso_pu_bacteria 2977898635 2977903915 255
192 iso_pu_bacteria 2977915119 2977917355 255
193 iso_pu_bacteria 2977935797 2977941082 255
194 iso_pu_bacteria 2977950692 2977951998 255
195 iso_pu_bacteria 2977957713 2977960830 255
196 iso_pu_bacteria 2977986579 2977992061 255
197 iso_pu_bacteria 2979764755 2979772083 255
198 iso_pu_bacteria 2979772303 2979772562 255
199 iso_pu_bacteria 2979793036 2979798174 255
200 iso_pu_bacteria 2987645492 2987649962 255
201 iso_pu_bacteria 2987673487 2987678667 255
202 iso_pu_bacteria 2996386984 2996387078 255
203 iso_pu_bacteria 3004195979 3004203396 255
204 iso_pu_bacteria 3004232784 3004235240 255
205 iso_pu_bacteria 3004239961 3004244818 255
206 iso_pu_bacteria 3004248173 3004250451 255
207 iso_pu_bacteria 3004268573 3004269203 255
208 iso_pu_bacteria 649633066 649870537 255
209 iso_pu_bacteria 8004300914 8004304217 255
210 iso_pu_bacteria 8004312739 8004319473 255
211 iso_pu_bacteria 8004361976 8004368873 255
212 iso_pu_bacteria 8004695233 8004698184 255
213 iso_pu_bacteria 8004727605 8004731524 255
214 3300005981 Ga0081538_10026446 Ga0081538_100264462 256
215 3300048920 Ga0496117_0118304 Ga0496117_0118304_671_1477 256
216 iso_pu_bacteria 2509276019 2509378295 256
217 iso_pu_bacteria 2509276033 2509448441 256
218 iso_pu_bacteria 2510065019 2510136528 256
219 iso_pu_bacteria 2510461076 2510900199 256
220 iso_pu_bacteria 2510917026 2511173238 256
221 iso_pu_bacteria 2510917030 2511199857 256
222 iso_pu_bacteria 2511231052 2511503122 256
223 iso_pu_bacteria 2512047086 2512534408 256
224 iso_pu_bacteria 2512875026 2512973793 256
225 iso_pu_bacteria 2513237088 2513595077 256
226 iso_pu_bacteria 2513237089 2513606771 256
227 iso_pu_bacteria 2513237091 2513621260 256
228 iso_pu_bacteria 2513237103 2513709821 256
229 iso_pu_bacteria 2513237138 2513867427 256
230 iso_pu_bacteria 2513237140 2513887236 256
231 iso_pu_bacteria 2513237144 2513911484 256
232 iso_pu_bacteria 2513237146 2513928985 256
233 iso_pu_bacteria 2513237156 2513988461 256
234 iso_pu_bacteria 2513237160 2514008382 256
235 iso_pu_bacteria 2515075009 2515115101 256
236 iso_pu_bacteria 2516143018 2516205423 256
237 iso_pu_bacteria 2516653046 2516894530 256
238 iso_pu_bacteria 2516653077 2517041899 256
239 iso_pu_bacteria 2516653085 2517081072 256
240 iso_pu_bacteria 2517093000 2517098590 256
241 iso_pu_bacteria 2517287029 2517410863 256
242 iso_pu_bacteria 2517487022 2517571145 256
243 iso_pu_bacteria 2519899620 2520377468 256
244 iso_pu_bacteria 2529292951 2530644524 256
245 iso_pu_bacteria 2534681796 2535520020 256
246 iso_pu_bacteria 2551306085 2551686299 256
247 iso_pu_bacteria 2551306090 2551717510 256
248 iso_pu_bacteria 2558860100 2558867172 256
249 iso_pu_bacteria 2582581294 2585202749 256
250 iso_pu_bacteria 2582581298 2585221589 256
251 iso_pu_bacteria 2582581299 2585229317 256
252 iso_pu_bacteria 2582581315 2585326078 256
253 iso_pu_bacteria 2582581867 2585401668 256
254 iso_pu_bacteria 2585427529 2585544241 256
255 iso_pu_bacteria 2585427590 2585821362 256
256 iso_pu_bacteria 2585427633 2585997310 256
257 iso_pu_bacteria 2585427634 2586001918 256
258 iso_pu_bacteria 2599185170 2599414804 256
259 iso_pu_bacteria 2600254933 2600376136 256
260 iso_pu_bacteria 2615840624 2616295231 256
261 iso_pu_bacteria 2615840626 2616310311 256
262 iso_pu_bacteria 2615840698 2616553309 256
263 iso_pu_bacteria 2617270742 2617380358 256
264 iso_pu_bacteria 2643221558 2643814052 256
265 iso_pu_bacteria 2643221599 2644006677 256
266 iso_pu_bacteria 2643221618 2644109936 256
267 iso_pu_bacteria 2643221626 2644150212 256
268 iso_pu_bacteria 2643221634 2644196323 256
269 iso_pu_bacteria 2643221643 2644240853 256
270 iso_pu_bacteria 2643221655 2644312816 256
271 iso_pu_bacteria 2643221659 2644336362 256
272 iso_pu_bacteria 2643221688 2644495721 256
273 iso_pu_bacteria 2643221698 2644546010 256
274 iso_pu_bacteria 2643221712 2644618546 256
275 iso_pu_bacteria 2667528174 2671113760 256
276 iso_pu_bacteria 2690316117 2692320126 256
277 iso_pu_bacteria 2718217882 2719183792 256
278 iso_pu_bacteria 2718217927 2719388465 256
279 iso_pu_bacteria 2718217997 2719668093 256
280 iso_pu_bacteria 2718218009 2719728233 256
281 iso_pu_bacteria 2718218199 2720494856 256
282 iso_pu_bacteria 2718218232 2720611176 256
283 iso_pu_bacteria 2718218233 2720616349 256
284 iso_pu_bacteria 2718218235 2720629423 256
285 iso_pu_bacteria 2718218269 2720771994 256
286 iso_pu_bacteria 2718218363 2721145094 256
287 iso_pu_bacteria 2718218365 2721155831 256
288 iso_pu_bacteria 2718218366 2721167181 256
289 iso_pu_bacteria 2718218423 2721403088 256
290 iso_pu_bacteria 2721755514 2722838159 256
291 iso_pu_bacteria 2721755556 2723029425 256
292 iso_pu_bacteria 2721755684 2723563040 256
293 iso_pu_bacteria 2721755685 2723571021 256
294 iso_pu_bacteria 2721755809 2724035445 256
295 iso_pu_bacteria 2721755810 2724042427 256
296 iso_pu_bacteria 2721755819 2724086814 256
297 iso_pu_bacteria 2721755822 2724106972 256
298 iso_pu_bacteria 2721755823 2724107782 256
299 iso_pu_bacteria 2724679232 2725946295 256
300 iso_pu_bacteria 2728369352 2730105739 256
301 iso_pu_bacteria 2728369365 2730161932 256
302 iso_pu_bacteria 2728369397 2730300938 256
303 iso_pu_bacteria 2738541333 2739033686 256
304 iso_pu_bacteria 2775507266 2778179618 256
305 iso_pu_bacteria 2791355091 2792622116 256
306 iso_pu_bacteria 2791355092 2792628626 256
307 iso_pu_bacteria 2791355256 2793298913 256
308 iso_pu_bacteria 2791355259 2793317185 256
309 iso_pu_bacteria 2791355261 2793325667 256
310 iso_pu_bacteria 2791355262 2793333092 256
311 iso_pu_bacteria 2791355263 2793340104 256
312 iso_pu_bacteria 2791355264 2793346268 256
313 iso_pu_bacteria 2791355265 2793355485 256
314 iso_pu_bacteria 2791355266 2793357775 256
315 iso_pu_bacteria 2802428858 2802721534 256
316 iso_pu_bacteria 2802428859 2802728453 256
317 iso_pu_bacteria 2802428860 2802734420 256
318 iso_pu_bacteria 2802428861 2802741059 256
319 iso_pu_bacteria 2802428862 2802747207 256
320 iso_pu_bacteria 2802428863 2802753883 256
321 iso_pu_bacteria 2802429605 2805929077 256
322 iso_pu_bacteria 2802429606 2805937221 256
323 iso_pu_bacteria 2802429633 2806044815 256
324 iso_pu_bacteria 2802429634 2806054025 256
325 iso_pu_bacteria 2802429635 2806059883 256
326 iso_pu_bacteria 2818991448 2819608507 256
327 iso_pu_bacteria 2818991461 2819688468 256
328 iso_pu_bacteria 2821123053 2821126514 256
329 iso_pu_bacteria 2838016132 2838019488 256
330 iso_pu_bacteria 2838022645 2838027207 256
331 iso_pu_bacteria 2838035591 2838039476 256
332 iso_pu_bacteria 2838042994 2838045929 256
333 iso_pu_bacteria 2838048938 2838050593 256
334 iso_pu_bacteria 2838061910 2838062885 256
335 iso_pu_bacteria 2838068647 2838071834 256
336 iso_pu_bacteria 2838661181 2838667995 256
337 iso_pu_bacteria 2838668709 2838671515 256
338 iso_pu_bacteria 2838680041 2838684435 256
339 iso_pu_bacteria 2838686498 2838693590 256
340 iso_pu_bacteria 2838694306 2838699926 256
341 iso_pu_bacteria 2838701080 2838704218 256
342 iso_pu_bacteria 2838707686 2838711789 256
343 iso_pu_bacteria 2838729681 2838735483 256
344 iso_pu_bacteria 2838736955 2838737011 256
345 iso_pu_bacteria 2838742623 2838748385 256
346 iso_pu_bacteria 2841840854 2841842620 256
347 iso_pu_bacteria 2841864319 2841869785 256
348 iso_pu_bacteria 2842077413 2842081902 256
349 iso_pu_bacteria 2842110456 2842115787 256
350 iso_pu_bacteria 2842118031 2842122478 256
351 iso_pu_bacteria 2842140634 2842142400 256
352 iso_pu_bacteria 2842146304 2842149164 256
353 iso_pu_bacteria 2842163707 2842167068 256
354 iso_pu_bacteria 2842192696 2842195282 256
355 iso_pu_bacteria 2842198810 2842203420 256
356 iso_pu_bacteria 2842217011 2842222223 256
357 iso_pu_bacteria 2842229732 2842236076 256
358 iso_pu_bacteria 2842237096 2842241201 256
359 iso_pu_bacteria 2842250916 2842253669 256
360 iso_pu_bacteria 2842257432 2842263303 256
361 iso_pu_bacteria 2842264693 2842270254 256
362 iso_pu_bacteria 2842271015 2842278059 256
363 iso_pu_bacteria 2842285085 2842289664 256
364 iso_pu_bacteria 2842291075 2842295557 256
365 iso_pu_bacteria 2842304105 2842310019 256
366 iso_pu_bacteria 2842311132 2842311740 256
367 iso_pu_bacteria 2842317721 2842319024 256
368 iso_pu_bacteria 2842341865 2842344019 256
369 iso_pu_bacteria 2842363717 2842369668 256
370 iso_pu_bacteria 2842370503 2842376651 256
371 iso_pu_bacteria 2842377471 2842381667 256
372 iso_pu_bacteria 2842384541 2842389026 256
373 iso_pu_bacteria 2842402390 2842407195 256
374 iso_pu_bacteria 2842409023 2842414087 256
375 iso_pu_bacteria 2842415677 2842420728 256
376 iso_pu_bacteria 2842422224 2842425467 256
377 iso_pu_bacteria 2842428310 2842434076 256
378 iso_pu_bacteria 2842434925 2842440435 256
379 iso_pu_bacteria 2842441272 2842444008 256
380 iso_pu_bacteria 2842447887 2842450120 256
381 iso_pu_bacteria 2842462802 2842468495 256
382 iso_pu_bacteria 2842469257 2842475013 256
383 iso_pu_bacteria 2842482326 2842487645 256
384 iso_pu_bacteria 2842489311 2842491474 256
385 iso_pu_bacteria 2842495871 2842499542 256
386 iso_pu_bacteria 2844454524 2844461078 256
387 iso_pu_bacteria 2847417321 2847420644 256
388 iso_pu_bacteria 2848992105 2848995475 256
389 iso_pu_bacteria 2850079185 2850082455 256
390 iso_pu_bacteria 2855825444 2855827166 256
391 iso_pu_bacteria 2855839649 2855842563 256
392 iso_pu_bacteria 2855872281 2855878003 256
393 iso_pu_bacteria 2857516855 2857519209 256
394 iso_pu_bacteria 2857531043 2857533076 256
395 iso_pu_bacteria 2858800743 2858803374 256
396 iso_pu_bacteria 2899803654 2899805523 256
397 iso_pu_bacteria 2915980308 2915984925 256
398 iso_pu_bacteria 2915986958 2915989820 256
399 iso_pu_bacteria 2915993759 2915995624 256
400 iso_pu_bacteria 2916000859 2916002966 256
401 iso_pu_bacteria 2916007675 2916009567 256
402 iso_pu_bacteria 2916014648 2916016468 256
403 iso_pu_bacteria 2916021584 2916023144 256
404 iso_pu_bacteria 2916028427 2916029835 256
405 iso_pu_bacteria 2916035215 2916036264 256
406 iso_pu_bacteria 2916041962 2916045476 256
407 iso_pu_bacteria 2916048683 2916051145 256
408 iso_pu_bacteria 2916055098 2916055647 256
409 iso_pu_bacteria 2916061851 2916066864 256
410 iso_pu_bacteria 2916068649 2916072956 256
411 iso_pu_bacteria 2916076590 2916080505 256
412 iso_pu_bacteria 2919100787 2919103493 256
413 iso_pu_bacteria 2919171160 2919173604 256
414 iso_pu_bacteria 2920822456 2920825737 256
415 iso_pu_bacteria 2921201388 2921204755 256
416 iso_pu_bacteria 2921208531 2921211185 256
417 iso_pu_bacteria 2921237296 2921239412 256
418 iso_pu_bacteria 2921244191 2921245263 256
419 iso_pu_bacteria 2921250672 2921255596 256
420 iso_pu_bacteria 2921257292 2921258316 256
421 iso_pu_bacteria 2921263974 2921264921 256
422 iso_pu_bacteria 2921282425 2921284924 256
423 iso_pu_bacteria 2921289301 2921291778 256
424 iso_pu_bacteria 2921296804 2921299259 256
425 iso_pu_bacteria 2923556063 2923556747 256
426 iso_pu_bacteria 2924144063 2924144704 256
427 iso_pu_bacteria 2924150972 2924152945 256
428 iso_pu_bacteria 2924158325 2924158866 256
429 iso_pu_bacteria 2924165586 2924168040 256
430 iso_pu_bacteria 2924172951 2924174292 256
431 iso_pu_bacteria 2924179722 2924181546 256
432 iso_pu_bacteria 2924186466 2924188100 256
433 iso_pu_bacteria 2924193448 2924194613 256
434 iso_pu_bacteria 2924200457 2924200948 256
435 iso_pu_bacteria 2924207177 2924207854 256
436 iso_pu_bacteria 2924214083 2924217678 256
437 iso_pu_bacteria 2924221636 2924224058 256
438 iso_pu_bacteria 2924228884 2924229804 256
439 iso_pu_bacteria 2933016740 2933019665 256
440 iso_pu_bacteria 2933570622 2933576460 256
441 iso_pu_bacteria 2933586486 2933591753 256
442 iso_pu_bacteria 2933599457 2933602629 256
443 iso_pu_bacteria 2935894831 2935898225 256
444 iso_pu_bacteria 2935901341 2935905780 256
445 iso_pu_bacteria 2936367885 2936370216 256
446 iso_pu_bacteria 2936381700 2936384121 256
447 iso_pu_bacteria 2937002841 2937003700 256
448 iso_pu_bacteria 2937009748 2937010234 256
449 iso_pu_bacteria 2937016420 2937023092 256
450 iso_pu_bacteria 2937023124 2937029459 256
451 iso_pu_bacteria 2937029754 2937034272 256
452 iso_pu_bacteria 2937036028 2937040970 256
453 iso_pu_bacteria 2937042894 2937045636 256
454 iso_pu_bacteria 2937049772 2937052053 256
455 iso_pu_bacteria 2937056579 2937059087 256
456 iso_pu_bacteria 2937063883 2937066016 256
457 iso_pu_bacteria 2937071275 2937072986 256
458 iso_pu_bacteria 2937078374 2937083057 256
459 iso_pu_bacteria 2937084907 2937087553 256
460 iso_pu_bacteria 2937091812 2937094282 256
461 iso_pu_bacteria 2937098957 2937101024 256
462 iso_pu_bacteria 2937106411 2937108781 256
463 iso_pu_bacteria 2937113482 2937118021 256
464 iso_pu_bacteria 2937119839 2937126259 256
465 iso_pu_bacteria 2937126314 2937127074 256
466 iso_pu_bacteria 2941499720 2941501128 256
467 iso_pu_bacteria 2957375807 2957380537 256
468 iso_pu_bacteria 2957382221 2957388802 256
469 iso_pu_bacteria 2957388812 2957395118 256
470 iso_pu_bacteria 2957395598 2957397117 256
471 iso_pu_bacteria 2957402308 2957402854 256
472 iso_pu_bacteria 2957408893 2957415258 256
473 iso_pu_bacteria 2957415311 2957417907 256
474 iso_pu_bacteria 2957422303 2957427108 256
475 iso_pu_bacteria 2957430029 2957431453 256
476 iso_pu_bacteria 2957437181 2957438631 256
477 iso_pu_bacteria 2957443900 2957444529 256
478 iso_pu_bacteria 2957450854 2957452096 256
479 iso_pu_bacteria 2957457609 2957459310 256
480 iso_pu_bacteria 2957464669 2957465302 256
481 iso_pu_bacteria 2957471148 2957473112 256
482 iso_pu_bacteria 2957478035 2957478522 256
483 iso_pu_bacteria 2957484790 2957486743 256
484 iso_pu_bacteria 2957491536 2957492547 256
485 iso_pu_bacteria 2957498199 2957499923 256
486 iso_pu_bacteria 2957505466 2957507520 256
487 iso_pu_bacteria 2960584000 2960586872 256
488 iso_pu_bacteria 2960591022 2960595776 256
489 iso_pu_bacteria 2960597568 2960598317 256
490 iso_pu_bacteria 2960603979 2960605291 256
491 iso_pu_bacteria 2960610863 2960612081 256
492 iso_pu_bacteria 2960617483 2960618262 256
493 iso_pu_bacteria 2960624210 2960626469 256
494 iso_pu_bacteria 2960631154 2960634881 256
495 iso_pu_bacteria 2960637947 2960640926 256
496 iso_pu_bacteria 2960645483 2960647585 256
497 iso_pu_bacteria 2960652885 2960655907 256
498 iso_pu_bacteria 2960660292 2960661236 256
499 iso_pu_bacteria 2960667422 2960674034 256
500 iso_pu_bacteria 2960674078 2960676433 256
501 iso_pu_bacteria 2960680706 2960685480 256
502 iso_pu_bacteria 2960687367 2960693769 256
503 iso_pu_bacteria 2960693952 2960694673 256
504 iso_pu_bacteria 2964607997 2964610981 256
505 iso_pu_bacteria 2964615318 2964616522 256
506 iso_pu_bacteria 2964621998 2964624243 256
507 iso_pu_bacteria 2964628898 2964630556 256
508 iso_pu_bacteria 2964636051 2964638056 256
509 iso_pu_bacteria 2964643177 2964643751 256
510 iso_pu_bacteria 2964649959 2964650640 256
511 iso_pu_bacteria 2964656573 2964658474 256
512 iso_pu_bacteria 2964663802 2964664884 256
513 iso_pu_bacteria 2964670856 2964674406 256
514 iso_pu_bacteria 2964678106 2964680775 256
515 iso_pu_bacteria 2964685014 2964687114 256
516 iso_pu_bacteria 2964691889 2964693357 256
517 iso_pu_bacteria 2964698721 2964700469 256
518 iso_pu_bacteria 2964705432 2964706739 256
519 iso_pu_bacteria 2964712639 2964714361 256
520 iso_pu_bacteria 2964719344 2964722356 256
521 iso_pu_bacteria 2967664464 2967667542 256
522 iso_pu_bacteria 2967671571 2967673672 256
523 iso_pu_bacteria 2967678726 2967680541 256
524 iso_pu_bacteria 2967686174 2967691047 256
525 iso_pu_bacteria 2967693043 2967699744 256
526 iso_pu_bacteria 2967699805 2967703660 256
527 iso_pu_bacteria 2967706974 2967709479 256
528 iso_pu_bacteria 2967714385 2967715182 256
529 iso_pu_bacteria 2967721400 2967723050 256
530 iso_pu_bacteria 2967728569 2967733469 256
531 iso_pu_bacteria 2967735183 2967736180 256
532 iso_pu_bacteria 2967742019 2967745528 256
533 iso_pu_bacteria 2967748971 2967755662 256
534 iso_pu_bacteria 2967755722 2967756557 256
535 iso_pu_bacteria 2967762386 2967767349 256
536 iso_pu_bacteria 2967769361 2967775918 256
537 iso_pu_bacteria 2967775926 2967779407 256
538 iso_pu_bacteria 2970019648 2970021195 256
539 iso_pu_bacteria 2970026789 2970032334 256
540 iso_pu_bacteria 2970033650 2970035319 256
541 iso_pu_bacteria 2970040964 2970042572 256
542 iso_pu_bacteria 2970047711 2970049695 256
543 iso_pu_bacteria 2970054988 2970055532 256
544 iso_pu_bacteria 2970061556 2970063882 256
545 iso_pu_bacteria 2970068827 2970070060 256
546 iso_pu_bacteria 2970076120 2970076849 256
547 iso_pu_bacteria 2970082768 2970088625 256
548 iso_pu_bacteria 2970088815 2970089961 256
549 iso_pu_bacteria 2970095765 2970097627 256
550 iso_pu_bacteria 2970102677 2970109035 256
551 iso_pu_bacteria 2970109326 2970110190 256
552 iso_pu_bacteria 2970116247 2970116926 256
553 iso_pu_bacteria 2970122695 2970127467 256
554 iso_pu_bacteria 2970129317 2970135836 256
555 iso_pu_bacteria 2970136068 2970138631 256
556 iso_pu_bacteria 2970143518 2970148255 256
557 iso_pu_bacteria 2970149975 2970151091 256
558 iso_pu_bacteria 2970156795 2970159302 256
559 iso_pu_bacteria 2970164137 2970170915 256
560 iso_pu_bacteria 2970170962 2970172648 256
561 iso_pu_bacteria 2970177841 2970184137 256
562 iso_pu_bacteria 2970184632 2970186770 256
563 iso_pu_bacteria 2970191845 2970193089 256
564 iso_pu_bacteria 2977516862 2977519054 256
565 iso_pu_bacteria 2977523885 2977524610 256
566 iso_pu_bacteria 2977530762 2977535966 256
567 iso_pu_bacteria 2977537788 2977538433 256
568 iso_pu_bacteria 2977544691 2977545980 256
569 iso_pu_bacteria 2977551784 2977552418 256
570 iso_pu_bacteria 2977558990 2977560847 256
571 iso_pu_bacteria 2977565890 2977566923 256
572 iso_pu_bacteria 2977572785 2977573502 256
573 iso_pu_bacteria 2977579622 2977586091 256
574 iso_pu_bacteria 2996887358 2996888634 256
575 iso_pu_bacteria 2996893221 2996896936 256
576 iso_pu_bacteria 3005409236 3005414050 256
577 iso_pu_bacteria 3005416602 3005422907 256
578 iso_pu_bacteria 3005445848 3005451384 256
579 iso_pu_bacteria 639633055 639651750 256
580 iso_pu_bacteria 643692032 643827247 256
581 iso_pu_bacteria 8003992118 8003995104 256
582 iso_pu_bacteria 8003999396 8004002864 256
583 iso_pu_bacteria 8005258706 8005264434 256
584 iso_pu_bacteria 8005275841 8005277180 256
585 iso_pu_bacteria 8005282627 8005287810 256
586 iso_pu_bacteria 8005289223 8005289247 256
587 iso_pu_bacteria 8005301065 8005304992 256
588 iso_pu_bacteria 8005307578 8005313092 256
589 iso_pu_bacteria 8005314921 8005321557 256
590 iso_pu_bacteria 8005321885 8005323161 256
591 iso_pu_bacteria 8005382845 8005388450 256
592 iso_pu_bacteria 8005395548 8005397616 256
593 iso_pu_bacteria 8005430974 8005436965 256
594 iso_pu_bacteria 8005497431 8005503104 256
595 iso_pu_bacteria 8005542996 8005547752 256
596 iso_pu_bacteria 8005563573 8005567103 256
597 iso_pu_bacteria 8005570704 8005576325 256
598 iso_pu_bacteria 8005619151 8005625625 256
599 iso_pu_bacteria 8005626139 8005630645 256
600 iso_pu_bacteria 8005645114 8005649543 256
601 iso_pu_bacteria 8005668836 8005675022 256
602 iso_pu_bacteria 8005682033 8005685214 256
603 iso_pu_bacteria 8005688590 8005689464 256
604 iso_pu_bacteria 8005695170 8005701908 256
605 iso_pu_bacteria 8018127388 8018130423 256
606 iso_pu_bacteria 8018150411 8018150920 256
607 iso_pu_bacteria 8018163183 8018165932 256
608 iso_pu_bacteria 8018176218 8018182256 256
609 iso_pu_bacteria 8023680758 8023682394 256
610 iso_pu_bacteria 8024479707 8024483718 256
611 iso_pu_bacteria 8024486573 8024490422 256
612 iso_pu_bacteria 8024501048 8024505607 256
613 iso_pu_bacteria 8046767195 8046770803 256
614 iso_pu_bacteria 8054558443 8054561471 256
615 iso_pu_bacteria 8056382006 8056383544 256
616 iso_pu_bacteria 8056875544 8056876292 256
617 iso_pu_bacteria 8057575449 8057577735 256
618 3300006846 Ga0075430_100227304 Ga0075430_1002273042 257
619 3300031548 Ga0307408_100224731 Ga0307408_1002247312 257
620 3300031824 Ga0307413_10199635 Ga0307413_101996352 257
621 3300031903 Ga0307407_10034112 Ga0307407_100341122 257
622 3300032004 Ga0307414_10000876 Ga0307414_100008768 257
623 3300041411 Ga0439466_0082570 Ga0439466_0082570_139_954 257
624 iso_pu_bacteria 2537561587 2537875734 257
625 iso_pu_bacteria 2554235003 2554244839 257
626 iso_pu_bacteria 2558860242 2559297327 257
627 iso_pu_bacteria 2599185210 2599605876 257
628 iso_pu_bacteria 2643221582 2643921869 257
629 iso_pu_bacteria 2643221693 2644519836 257
630 iso_pu_bacteria 2808606387 2808988715 257
631 iso_pu_bacteria 2818991439 2819561422 257
632 iso_pu_bacteria 2838675328 2838679425 257
633 iso_pu_bacteria 2838714209 2838718782 257
634 iso_pu_bacteria 2838719591 2838723780 257
635 iso_pu_bacteria 2838724970 2838729103 257
636 iso_pu_bacteria 2841846520 2841851129 257
637 iso_pu_bacteria 2841859092 2841863934 257
638 iso_pu_bacteria 2842124991 2842129800 257
639 iso_pu_bacteria 2842130223 2842134456 257
640 iso_pu_bacteria 2842152218 2842156452 257
641 iso_pu_bacteria 2842170452 2842175027 257
642 iso_pu_bacteria 2842175837 2842179944 257
643 iso_pu_bacteria 2842187318 2842191638 257
644 iso_pu_bacteria 2842211629 2842215955 257
645 iso_pu_bacteria 2842224351 2842228545 257
646 iso_pu_bacteria 2842515876 2842520716 257
647 iso_pu_bacteria 2899792073 2899794669 257
648 iso_pu_bacteria 2899845264 2899850393 257
649 iso_pu_bacteria 2919114240 2919118844 257
650 iso_pu_bacteria 2926754445 2926758135 257
651 iso_pu_bacteria 2926760298 2926764297 257
652 iso_pu_bacteria 2933006813 2933011226 257
653 iso_pu_bacteria 2933011516 2933016234 257
654 iso_pu_bacteria 2979089926 2979090599 257
655 iso_pu_bacteria 2979095461 2979096125 257
656 iso_pu_bacteria 2979100975 2979101653 257
657 iso_pu_bacteria 2984509177 2984510396 257
658 iso_pu_bacteria 2984518228 2984518900 257
659 iso_pu_bacteria 2984537506 2984538744 257
660 iso_pu_bacteria 2984601300 2984605451 257
661 iso_pu_bacteria 8003570095 8003573979 257
662 3300002741 JGI25157J39369_1000714 JGI25157J39369_100071413 258
663 3300006948 Ga0099826_10001282 Ga0099826_1000128214 258
664 3300025246 Ga0209646_1009081 Ga0209646_10090812 258
665 3300025250 Ga0209026_1000071 Ga0209026_1000071116 258
666 3300025256 Ga0209759_1000620 Ga0209759_100062048 258
667 3300027666 Ga0209282_1000173 Ga0209282_100017337 258
668 3300048924 Ga0496121_0038709 Ga0496121_0038709_1327_2133 258
669 3300048928 Ga0496125_0045484 Ga0496125_0045484_179_985 258
670 iso_pu_bacteria 2937848649 2937848858 258
671 iso_pu_bacteria 2977922695 2977925496 258
672 iso_pu_bacteria 3004211236 3004217030 258
673 iso_pu_bacteria 3004218560 3004225377 258
674 iso_pu_bacteria 8055431914 8055434528 258
675 3300005539 Ga0068853_100283511 Ga0068853_1002835112 259
676 3300005548 Ga0070665_100132863 Ga0070665_1001328632 259
677 3300005563 Ga0068855_100721926 Ga0068855_1007219262 259
678 3300005614 Ga0068856_100175722 Ga0068856_1001757222 259
679 3300006038 Ga0075365_10000959 Ga0075365_100009599 259
680 3300006048 Ga0075363_100028806 Ga0075363_1000288062 259
681 3300006051 Ga0075364_10007393 Ga0075364_100073934 259
682 3300006178 Ga0075367_10017983 Ga0075367_100179832 259
683 3300013104 Ga0157370_10177769 Ga0157370_101777692 259
684 3300013296 Ga0157374_10077167 Ga0157374_100771674 259
685 3300025254 Ga0209148_1003556 Ga0209148_10035563 259
686 3300025909 Ga0207705_10106390 Ga0207705_101063902 259
687 3300025949 Ga0207667_10938729 Ga0207667_109387291 259
688 3300025981 Ga0207640_10064525 Ga0207640_100645252 259
689 3300026078 Ga0207702_10018934 Ga0207702_100189345 259
690 3300028379 Ga0268266_10468436 Ga0268266_104684362 259
691 3300033180 Ga0307510_10199050 Ga0307510_101990502 259
692 3300048922 Ga0496119_0033679 Ga0496119_0033679_2002_2781 259
693 3300048923 Ga0496120_0011718 Ga0496120_0011718_3658_4437 259
694 3300048929 Ga0496126_0322633 Ga0496126_0322633_59_838 259
695 3300050491 nmdc:mga00v17_158726_c1 nmdc:mga00v17_158726_c1_246_1025 259
696 iso_pu_bacteria 2515154114 2515642512 259
697 iso_pu_bacteria 2600255279 2601611570 259
698 iso_pu_bacteria 2600255308 2601748878 259
699 iso_pu_bacteria 2842871566 2842874237 259
700 iso_pu_bacteria 2928521798 2928525030 259
701 iso_pu_bacteria 2933594066 2933598948 259
702 iso_pu_bacteria 2937843397 2937844863 259
703 iso_pu_bacteria 2954011201 2954011357 259
704 3300001979 JGI24740J21852_10000016 JGI24740J21852_1000001639 260
705 3300002704 JGI25155J39150_1000013 JGI25155J39150_100001312 260
706 3300002705 JGI25156J39149_1000011 JGI25156J39149_100001112 260
707 3300002737 JGI25162J39368_1000169 JGI25162J39368_100016934 260
708 3300002737 JGI25162J39368_1001105 JGI25162J39368_10011059 260
709 3300002738 JGI25154J39366_1000030 JGI25154J39366_100003012 260
710 3300002739 JGI25158J39367_1000948 JGI25158J39367_10009486 260
711 3300002741 JGI25157J39369_1000013 JGI25157J39369_100001312 260
712 3300002773 JGI25152J39213_1001230 JGI25152J39213_10012305 260
713 3300002773 JGI25152J39213_1005165 JGI25152J39213_10051651 260
714 3300002773 JGI25152J39213_1012244 JGI25152J39213_10122442 260
715 3300002773 JGI25152J39213_1012447 JGI25152J39213_10124472 260
716 3300002774 JGI25150J39212_1008843 JGI25150J39212_10088433 260
717 3300002987 JGI25159J45721_1000227 JGI25159J45721_100022722 260
718 3300002987 JGI25159J45721_1000591 JGI25159J45721_10005912 260
719 3300003187 JGI25151J46595_10000632 JGI25151J46595_100006324 260
720 3300003187 JGI25151J46595_10001667 JGI25151J46595_1000166713 260
721 3300003214 JGI25165J46597_1000025 JGI25165J46597_100002555 260
722 3300003214 JGI25165J46597_1000349 JGI25165J46597_100034941 260
723 3300003214 JGI25165J46597_1000355 JGI25165J46597_100035519 260
724 3300003215 JGI25153J46596_10016054 JGI25153J46596_100160543 260
725 3300003215 JGI25153J46596_10023228 JGI25153J46596_100232282 260
726 3300003322 rootL2_10021228 rootL2_100212282 260
727 3300003354 JGI25160J50197_1000041 JGI25160J50197_100004176 260
728 3300003354 JGI25160J50197_1002019 JGI25160J50197_10020196 260
729 3300003374 JGI25161J50226_1000002 JGI25161J50226_100000276 260
730 3300003374 JGI25161J50226_1000306 JGI25161J50226_100030610 260
731 3300003578 Ga0006562J51391_1007623 Ga0006562J51391_10076232 260
732 3300003771 Ga0055526_1001289 Ga0055526_10012892 260
733 3300003771 Ga0055526_1003389 Ga0055526_100338912 260
734 3300003771 Ga0055526_1005911 Ga0055526_10059113 260
735 3300003771 Ga0055526_1006104 Ga0055526_10061045 260
736 3300003775 Ga0055524_1001745 Ga0055524_100174512 260
737 3300003775 Ga0055524_1005317 Ga0055524_10053172 260
738 3300003775 Ga0055524_1017184 Ga0055524_10171842 260
739 3300003790 Ga0055528_1000514 Ga0055528_10005142 260
740 3300003790 Ga0055528_1000943 Ga0055528_100094317 260
741 3300003790 Ga0055528_1001128 Ga0055528_10011285 260
742 3300003790 Ga0055528_1001756 Ga0055528_10017563 260
743 3300003790 Ga0055528_1005266 Ga0055528_10052666 260
744 3300003790 Ga0055528_1031768 Ga0055528_10317682 260
745 3300003792 Ga0055540_1000050 Ga0055540_1000050152 260
746 3300003792 Ga0055540_1018276 Ga0055540_10182762 260
747 3300003792 Ga0055540_1029040 Ga0055540_10290402 260
748 3300004625 Ga0055543_1000008 Ga0055543_100000840 260
749 3300004625 Ga0055543_1000021 Ga0055543_100002131 260
750 3300004625 Ga0055543_1014863 Ga0055543_10148631 260
751 3300005262 Ga0065165_1000031 Ga0065165_100003189 260
752 3300005262 Ga0065165_1012183 Ga0065165_10121832 260
753 3300005262 Ga0065165_1012996 Ga0065165_10129963 260
754 3300005262 Ga0065165_1016664 Ga0065165_10166642 260
755 3300005262 Ga0065165_1033862 Ga0065165_10338622 260
756 3300005329 Ga0070683_100558009 Ga0070683_1005580092 260
757 3300005335 Ga0070666_10403420 Ga0070666_104034201 260
758 3300005353 Ga0070669_100549279 Ga0070669_1005492792 260
759 3300005539 Ga0068853_100174852 Ga0068853_1001748523 260
760 3300005577 Ga0068857_100141418 Ga0068857_1001414183 260
761 3300005614 Ga0068856_100052105 Ga0068856_1000521054 260
762 3300005614 Ga0068856_100424527 Ga0068856_1004245272 260
763 3300006038 Ga0075365_10014902 Ga0075365_100149022 260
764 3300006038 Ga0075365_10020300 Ga0075365_100203003 260
765 3300006038 Ga0075365_10489461 Ga0075365_104894612 260
766 3300006042 Ga0075368_10001344 Ga0075368_100013445 260
767 3300006042 Ga0075368_10071957 Ga0075368_100719572 260
768 3300006048 Ga0075363_100051617 Ga0075363_1000516172 260
769 3300006051 Ga0075364_10039812 Ga0075364_100398123 260
770 3300006177 Ga0075362_10003234 Ga0075362_100032345 260
771 3300006177 Ga0075362_10004260 Ga0075362_100042603 260
772 3300006177 Ga0075362_10085558 Ga0075362_100855582 260
773 3300006178 Ga0075367_10005140 Ga0075367_100051404 260
774 3300006178 Ga0075367_10030507 Ga0075367_100305072 260
775 3300006178 Ga0075367_10205331 Ga0075367_102053312 260
776 3300006186 Ga0075369_10162961 Ga0075369_101629611 260
777 3300006195 Ga0075366_10007386 Ga0075366_100073862 260
778 3300006195 Ga0075366_10206974 Ga0075366_102069742 260
779 3300006353 Ga0075370_10003972 Ga0075370_100039726 260
780 3300006353 Ga0075370_10031999 Ga0075370_100319993 260
781 3300006353 Ga0075370_10208737 Ga0075370_102087372 260
782 3300006946 Ga0079104_1003805 Ga0079104_10038055 260
783 3300006948 Ga0099826_10013390 Ga0099826_100133905 260
784 3300009036 Ga0105244_10063044 Ga0105244_100630442 260
785 3300009177 Ga0105248_10178354 Ga0105248_101783542 260
786 3300009545 Ga0105237_10005808 Ga0105237_100058086 260
787 3300009545 Ga0105237_10035890 Ga0105237_100358906 260
788 3300009545 Ga0105237_10191329 Ga0105237_101913292 260
789 3300009553 Ga0105249_10087412 Ga0105249_100874122 260
790 3300009765 Ga0123341_1000115 Ga0123341_100011521 260
791 3300009766 Ga0123342_1016494 Ga0123342_10164943 260
792 3300010375 Ga0105239_10070535 Ga0105239_100705353 260
793 3300010375 Ga0105239_10575632 Ga0105239_105756322 260
794 3300010375 Ga0105239_10800674 Ga0105239_108006741 260
795 3300011119 Ga0105246_10319943 Ga0105246_103199432 260
796 3300013100 Ga0157373_10000761 Ga0157373_100007615 260
797 3300013100 Ga0157373_10094705 Ga0157373_100947052 260
798 3300013102 Ga0157371_10000235 Ga0157371_1000023519 260
799 3300013102 Ga0157371_10267839 Ga0157371_102678391 260
800 3300013104 Ga0157370_10002006 Ga0157370_1000200620 260
801 3300013104 Ga0157370_10247367 Ga0157370_102473672 260
802 3300013105 Ga0157369_10300389 Ga0157369_103003892 260
803 3300013249 Ga0171463_1004 Ga0171463_10043 260
804 3300013306 Ga0163162_10746923 Ga0163162_107469232 260
805 3300013307 Ga0157372_10253722 Ga0157372_102537222 260
806 3300015690 Ga0183363_1024 Ga0183363_10243 260
807 3300021327 Ga0214543_1000053 Ga0214543_10000534 260
808 3300022739 Ga0228711_1008337 Ga0228711_10083373 260
809 3300022740 Ga0228710_1008588 Ga0228710_10085889 260
810 3300025206 Ga0209435_100026 Ga0209435_10002612 260
811 3300025233 Ga0209437_100056 Ga0209437_10005672 260
812 3300025233 Ga0209437_100196 Ga0209437_10019675 260
813 3300025245 Ga0207425_1001570 Ga0207425_10015705 260
814 3300025245 Ga0207425_1004911 Ga0207425_10049115 260
815 3300025245 Ga0207425_1026251 Ga0207425_10262511 260
816 3300025245 Ga0207425_1032715 Ga0207425_10327152 260
817 3300025246 Ga0209646_1000084 Ga0209646_100008412 260
818 3300025246 Ga0209646_1010980 Ga0209646_10109801 260
819 3300025246 Ga0209646_1017879 Ga0209646_10178792 260
820 3300025250 Ga0209026_1000080 Ga0209026_100008012 260
821 3300025253 Ga0209677_100374 Ga0209677_10037419 260
822 3300025254 Ga0209148_1002561 Ga0209148_10025615 260
823 3300025256 Ga0209759_1000061 Ga0209759_100006112 260
824 3300025258 Ga0209129_1000120 Ga0209129_1000120116 260
825 3300025258 Ga0209129_1000536 Ga0209129_10005362 260
826 3300025258 Ga0209129_1000571 Ga0209129_10005715 260
827 3300025258 Ga0209129_1004628 Ga0209129_10046285 260
828 3300025258 Ga0209129_1006416 Ga0209129_10064163 260
829 3300025258 Ga0209129_1018203 Ga0209129_10182032 260
830 3300025261 Ga0209233_1000037 Ga0209233_1000037487 260
831 3300025261 Ga0209233_1000053 Ga0209233_1000053325 260
832 3300025261 Ga0209233_1000071 Ga0209233_100007172 260
833 3300025261 Ga0209233_1000243 Ga0209233_100024346 260
834 3300025273 Ga0209673_1000023 Ga0209673_1000023259 260
835 3300025273 Ga0209673_1000757 Ga0209673_100075729 260
836 3300025273 Ga0209673_1001620 Ga0209673_10016202 260
837 3300025273 Ga0209673_1001741 Ga0209673_100174115 260
838 3300025273 Ga0209673_1002370 Ga0209673_100237011 260
839 3300025284 Ga0209130_1000001 Ga0209130_1000001240 260
840 3300025284 Ga0209130_1000382 Ga0209130_10003828 260
841 3300025294 Ga0209025_1000072 Ga0209025_1000072110 260
842 3300025294 Ga0209025_1000252 Ga0209025_1000252112 260
843 3300025294 Ga0209025_1000277 Ga0209025_100027760 260
844 3300025294 Ga0209025_1003388 Ga0209025_10033888 260
845 3300025294 Ga0209025_1020739 Ga0209025_10207393 260
846 3300025294 Ga0209025_1023751 Ga0209025_10237513 260
847 3300025294 Ga0209025_1071735 Ga0209025_10717352 260
848 3300025295 Ga0209564_1000100 Ga0209564_1000100123 260
849 3300025295 Ga0209564_1001025 Ga0209564_100102520 260
850 3300025295 Ga0209564_1002118 Ga0209564_10021184 260
851 3300025295 Ga0209564_1004021 Ga0209564_10040214 260
852 3300025297 Ga0209758_1000053 Ga0209758_1000053123 260
853 3300025297 Ga0209758_1000105 Ga0209758_1000105117 260
854 3300025297 Ga0209758_1000712 Ga0209758_100071241 260
855 3300025297 Ga0209758_1000937 Ga0209758_100093732 260
856 3300025297 Ga0209758_1016480 Ga0209758_10164803 260
857 3300025297 Ga0209758_1021425 Ga0209758_10214252 260
858 3300025297 Ga0209758_1027414 Ga0209758_10274142 260
859 3300025297 Ga0209758_1049679 Ga0209758_10496792 260
860 3300025298 Ga0209050_1003885 Ga0209050_10038853 260
861 3300025298 Ga0209050_1009391 Ga0209050_10093915 260
862 3300025299 Ga0209256_1000818 Ga0209256_100081833 260
863 3300025299 Ga0209256_1001066 Ga0209256_10010664 260
864 3300025299 Ga0209256_1013141 Ga0209256_10131413 260
865 3300025302 Ga0207426_1000005 Ga0207426_1000005845 260
866 3300025302 Ga0207426_1000012 Ga0207426_1000012210 260
867 3300025302 Ga0207426_1002475 Ga0207426_10024756 260
868 3300025303 Ga0209051_1000062 Ga0209051_1000062175 260
869 3300025303 Ga0209051_1000968 Ga0209051_100096812 260
870 3300025303 Ga0209051_1001021 Ga0209051_100102116 260
871 3300025303 Ga0209051_1004132 Ga0209051_10041327 260
872 3300025303 Ga0209051_1007606 Ga0209051_10076065 260
873 3300025303 Ga0209051_1048620 Ga0209051_10486202 260
874 3300025304 Ga0209257_1002192 Ga0209257_100219217 260
875 3300025304 Ga0209257_1004328 Ga0209257_10043282 260
876 3300025904 Ga0207647_10048823 Ga0207647_100488232 260
877 3300025913 Ga0207695_10000036 Ga0207695_1000003650 260
878 3300025913 Ga0207695_10172606 Ga0207695_101726062 260
879 3300025914 Ga0207671_10002082 Ga0207671_1000208214 260
880 3300025914 Ga0207671_10051807 Ga0207671_100518072 260
881 3300025924 Ga0207694_10033380 Ga0207694_100333803 260
882 3300025925 Ga0207650_10145578 Ga0207650_101455782 260
883 3300025937 Ga0207669_10406271 Ga0207669_104062712 260
884 3300025941 Ga0207711_10091723 Ga0207711_100917233 260
885 3300025944 Ga0207661_10546636 Ga0207661_105466362 260
886 3300025961 Ga0207712_10101877 Ga0207712_101018772 260
887 3300025981 Ga0207640_10081709 Ga0207640_100817093 260
888 3300026067 Ga0207678_10125485 Ga0207678_101254852 260
889 3300026078 Ga0207702_10035872 Ga0207702_100358724 260
890 3300026078 Ga0207702_10565177 Ga0207702_105651771 260
891 3300026078 Ga0207702_10574594 Ga0207702_105745942 260
892 3300026116 Ga0207674_10184107 Ga0207674_101841072 260
893 3300026142 Ga0207698_10072392 Ga0207698_100723922 260
894 3300027111 Ga0209281_1000596 Ga0209281_10005964 260
895 3300027111 Ga0209281_1002300 Ga0209281_10023003 260
896 3300027312 Ga0209371_1000035 Ga0209371_100003552 260
897 3300027312 Ga0209371_1002757 Ga0209371_10027575 260
898 3300027312 Ga0209371_1008430 Ga0209371_10084303 260
899 3300027666 Ga0209282_1000157 Ga0209282_100015745 260
900 3300027666 Ga0209282_1033066 Ga0209282_10330663 260
901 3300027866 Ga0209813_10006996 Ga0209813_100069963 260
902 3300027866 Ga0209813_10031977 Ga0209813_100319772 260
903 3300027907 Ga0207428_10000096 Ga0207428_1000009621 260
904 3300028379 Ga0268266_10212673 Ga0268266_102126733 260
905 3300028379 Ga0268266_10584702 Ga0268266_105847021 260
906 3300030500 Ga0268256_1000037 Ga0268256_100003751 260
907 3300030500 Ga0268256_1008754 Ga0268256_10087542 260
908 3300031548 Ga0307408_100381959 Ga0307408_1003819592 260
909 3300031824 Ga0307413_10365486 Ga0307413_103654861 260
910 3300031967 Ga0315914_1000965 Ga0315914_10009653 260
911 3300031995 Ga0307409_100594148 Ga0307409_1005941482 260
912 3300032126 Ga0307415_100328642 Ga0307415_1003286422 260
913 3300033180 Ga0307510_10239906 Ga0307510_102399062 260
914 3300033430 Ga0315913_1000276 Ga0315913_100027632 260
915 3300033464 Ga0315915_1000499 Ga0315915_100049932 260
916 3300037418 Ga0395900_0152072 Ga0395900_0152072_1302_2114 260
917 3300037471 Ga0395905_0006215 Ga0395905_0006215_2515_3297 260
918 3300037471 Ga0395905_0215862 Ga0395905_0215862_389_1189 260
919 3300037471 Ga0395905_0251058 Ga0395905_0251058_216_1016 260
920 3300037471 Ga0395905_0451404 Ga0395905_0451404_79_861 260
921 3300038443 Ga0395901_0050098 Ga0395901_0050098_2001_2801 260
922 3300038443 Ga0395901_0156455 Ga0395901_0156455_331_1113 260
923 3300038443 Ga0395901_0667657 Ga0395901_0667657_61_876 260
924 3300041404 Ga0439436_0011711 Ga0439436_0011711_533_1315 260
925 3300041413 Ga0439465_0004075 Ga0439465_0004075_1333_2115 260
926 3300041413 Ga0439465_0037614 Ga0439465_0037614_500_1288 260
927 3300042007 Ga0439449_0015719 Ga0439449_0015719_1774_2562 260
928 3300044765 Ga0466970_0117416 Ga0466970_0117416_441_1223 260
929 3300044901 Ga0466960_0217002 Ga0466960_0217002_202_1002 260
930 3300045836 Ga0466958_0261262 Ga0466958_0261262_224_1006 260
931 3300046460 Ga0495638_0001300 Ga0495638_0001300_10719_11501 260
932 3300046460 Ga0495638_0089498 Ga0495638_0089498_739_1521 260
933 3300046474 Ga0495605_0112303 Ga0495605_0112303_117_899 260
934 3300046476 Ga0495662_0024666 Ga0495662_0024666_403_1185 260
935 3300046477 Ga0495664_0125800 Ga0495664_0125800_330_1112 260
936 3300046492 Ga0495585_0022101 Ga0495585_0022101_2418_3200 260
937 3300046501 Ga0495607_0044805 Ga0495607_0044805_62_844 260
938 3300046506 Ga0495583_0000748 Ga0495583_0000748_624_1406 260
939 3300046507 Ga0495606_0001591 Ga0495606_0001591_16183_16965 260
940 3300046515 Ga0495620_0153106 Ga0495620_0153106_47_829 260
941 3300046515 Ga0495620_0174774 Ga0495620_0174774_10_810 260
942 3300046518 Ga0495631_0017761 Ga0495631_0017761_547_1329 260
943 3300046519 Ga0495632_0000696 Ga0495632_0000696_24944_25726 260
944 3300046519 Ga0495632_0016377 Ga0495632_0016377_3187_3969 260
945 3300046522 Ga0495643_0025720 Ga0495643_0025720_400_1185 260
946 3300046522 Ga0495643_0058815 Ga0495643_0058815_454_1236 260
947 3300046522 Ga0495643_0065937 Ga0495643_0065937_749_1534 260
948 3300046530 Ga0495654_0000152 Ga0495654_0000152_41486_42268 260
949 3300046538 Ga0495609_0077834 Ga0495609_0077834_417_1199 260
950 3300046557 Ga0495622_0048413 Ga0495622_0048413_772_1554 260
951 3300046558 Ga0495633_0019049 Ga0495633_0019049_2019_2804 260
952 3300046616 Ga0495668_0131585 Ga0495668_0131585_556_1338 260
953 3300046660 Ga0495625_0011341 Ga0495625_0011341_657_1439 260
954 3300046660 Ga0495625_0047807 Ga0495625_0047807_222_1004 260
955 3300046660 Ga0495625_0067828 Ga0495625_0067828_188_988 260
956 3300046674 Ga0495588_0014518 Ga0495588_0014518_1970_2755 260
957 3300046692 Ga0495671_0019894 Ga0495671_0019894_1739_2524 260
958 3300046692 Ga0495671_0127701 Ga0495671_0127701_214_996 260
959 3300046809 Ga0495600_0064861 Ga0495600_0064861_776_1558 260
960 3300046810 Ga0495660_0082288 Ga0495660_0082288_609_1391 260
961 3300047317 Ga0495604_0005541 Ga0495604_0005541_3986_4768 260
962 3300047320 Ga0495672_0101995 Ga0495672_0101995_110_892 260
963 3300047470 Ga0495681_0008484 Ga0495681_0008484_2298_3083 260
964 3300047472 Ga0495686_0002544 Ga0495686_0002544_13748_14530 260
965 3300047472 Ga0495686_0108119 Ga0495686_0108119_781_1563 260
966 3300048091 Ga0495626_0044213 Ga0495626_0044213_295_1077 260
967 3300048091 Ga0495626_0081479 Ga0495626_0081479_67_849 260
968 3300048905 Ga0496102_0186729 Ga0496102_0186729_1011_1826 260
969 3300048905 Ga0496102_0276185 Ga0496102_0276185_769_1569 260
970 3300048905 Ga0496102_0554993 Ga0496102_0554993_45_827 260
971 3300048908 Ga0496105_0076652 Ga0496105_0076652_1454_2236 260
972 3300048909 Ga0496106_0039386 Ga0496106_0039386_1997_2782 260
973 3300048913 Ga0496110_0072086 Ga0496110_0072086_758_1540 260
974 3300048914 Ga0496111_0156995 Ga0496111_0156995_324_1106 260
975 3300048918 Ga0496115_0316602 Ga0496115_0316602_429_1229 260
976 3300048919 Ga0496116_0018353 Ga0496116_0018353_1278_2063 260
977 3300048919 Ga0496116_0073789 Ga0496116_0073789_1334_2116 260
978 3300048919 Ga0496116_0145547 Ga0496116_0145547_121_903 260
979 3300048920 Ga0496117_0000066 Ga0496117_0000066_59030_59815 260
980 3300048921 Ga0496118_0000231 Ga0496118_0000231_59083_59868 260
981 3300048921 Ga0496118_0112379 Ga0496118_0112379_689_1471 260
982 3300048922 Ga0496119_0024379 Ga0496119_0024379_1949_2734 260
983 3300048922 Ga0496119_0050439 Ga0496119_0050439_1443_2225 260
984 3300048923 Ga0496120_0000463 Ga0496120_0000463_19013_19798 260
985 3300048923 Ga0496120_0002893 Ga0496120_0002893_10441_11253 260
986 3300048923 Ga0496120_0017106 Ga0496120_0017106_578_1360 260
987 3300048923 Ga0496120_0123223 Ga0496120_0123223_498_1280 260
988 3300048924 Ga0496121_0022022 Ga0496121_0022022_2677_3459 260
989 3300048924 Ga0496121_0067349 Ga0496121_0067349_1527_2309 260
990 3300048924 Ga0496121_0097085 Ga0496121_0097085_252_1034 260
991 3300048924 Ga0496121_0107839 Ga0496121_0107839_595_1377 260
992 3300048924 Ga0496121_0112114 Ga0496121_0112114_719_1501 260
993 3300048924 Ga0496121_0313487 Ga0496121_0313487_244_1026 260
994 3300048925 Ga0496122_0000057 Ga0496122_0000057_193638_194423 260
995 3300048925 Ga0496122_0019450 Ga0496122_0019450_107_889 260
996 3300048925 Ga0496122_0104127 Ga0496122_0104127_364_1146 260
997 3300048925 Ga0496122_0139312 Ga0496122_0139312_631_1413 260
998 3300048925 Ga0496122_0158166 Ga0496122_0158166_133_915 260
999 3300048925 Ga0496122_0206333 Ga0496122_0206333_76_858 260
1000 3300048925 Ga0496122_0257056 Ga0496122_0257056_27_809 260
1001 3300048926 Ga0496123_0000401 Ga0496123_0000401_19851_20636 260
1002 3300048926 Ga0496123_0127002 Ga0496123_0127002_541_1323 260
1003 3300048926 Ga0496123_0194668 Ga0496123_0194668_22_804 260
1004 3300048927 Ga0496124_0004181 Ga0496124_0004181_8140_8925 260
1005 3300048927 Ga0496124_0019787 Ga0496124_0019787_578_1360 260
1006 3300048927 Ga0496124_0190220 Ga0496124_0190220_388_1170 260
1007 3300048927 Ga0496124_0197550 Ga0496124_0197550_262_1047 260
1008 3300048928 Ga0496125_0091097 Ga0496125_0091097_323_1105 260
1009 3300048929 Ga0496126_0052537 Ga0496126_0052537_2320_3102 260
1010 3300048929 Ga0496126_0093950 Ga0496126_0093950_1140_1925 260
1011 3300048929 Ga0496126_0559939 Ga0496126_0559939_92_874 260
1012 3300049569 Ga0501032_0178682 Ga0501032_0178682_32_814 260
1013 3300049570 Ga0501033_0023658 Ga0501033_0023658_885_1667 260
1014 3300049570 Ga0501033_0063731 Ga0501033_0063731_25_825 260
1015 3300049571 Ga0501034_0033440 Ga0501034_0033440_1429_2214 260
1016 3300049571 Ga0501034_0090204 Ga0501034_0090204_2019_2801 260
1017 3300049573 Ga0501037_0087442 Ga0501037_0087442_117_899 260
1018 3300049573 Ga0501037_0240192 Ga0501037_0240192_453_1238 260
1019 3300049576 Ga0501040_0099154 Ga0501040_0099154_157_957 260
1020 3300049579 Ga0501043_0034502 Ga0501043_0034502_2412_3197 260
1021 3300049581 Ga0501047_0027460 Ga0501047_0027460_3201_3983 260
1022 3300049581 Ga0501047_0030187 Ga0501047_0030187_661_1446 260
1023 3300049581 Ga0501047_0048073 Ga0501047_0048073_1891_2691 260
1024 3300049581 Ga0501047_0194449 Ga0501047_0194449_911_1693 260
1025 3300049582 Ga0501048_0030062 Ga0501048_0030062_2864_3664 260
1026 3300049584 Ga0501068_0180106 Ga0501068_0180106_309_1094 260
1027 3300049586 Ga0501070_0271963 Ga0501070_0271963_72_872 260
1028 3300049822 Ga0501035_0088575 Ga0501035_0088575_1317_2117 260
1029 3300049823 Ga0501044_0052590 Ga0501044_0052590_199_981 260
1030 3300049823 Ga0501044_0198705 Ga0501044_0198705_606_1391 260
1031 3300050489 nmdc:mga03683_152350_c1 nmdc:mga03683_152350_c1_152_934 260
1032 3300050490 nmdc:mga03n38_21859_c1 nmdc:mga03n38_21859_c1_379_1164 260
1033 3300050491 nmdc:mga00v17_16076_c1 nmdc:mga00v17_16076_c1_464_1249 260
1034 3300050492 nmdc:mga0yw44_114070_c1 nmdc:mga0yw44_114070_c1_275_1057 260
1035 3300050492 nmdc:mga0yw44_887_c1 nmdc:mga0yw44_887_c1_4503_5288 260
1036 3300050495 nmdc:mga04h51_21723_c2 nmdc:mga04h51_21723_c2_407_1192 260
1037 3300050496 nmdc:mga07m45_117635_c1 nmdc:mga07m45_117635_c1_237_1019 260
1038 3300050496 nmdc:mga07m45_61480_c1 nmdc:mga07m45_61480_c1_696_1481 260
1039 3300050511 nmdc:mga08y16_62_c1 nmdc:mga08y16_62_c1_29431_30216 260
1040 3300050516 nmdc:mga0sz30_13122_c1 nmdc:mga0sz30_13122_c1_77_862 260
1041 3300053079 Ga0500610_0031643 Ga0500610_0031643_1149_1931 260
1042 3300053079 Ga0500610_0165133 Ga0500610_0165133_244_1026 260
1043 3300053083 Ga0495655_0026994 Ga0495655_0026994_73_855 260
1044 3300053105 Ga0500557_062594 Ga0500557_062594_107_889 260
1045 3300053107 Ga0500560_003025 Ga0500560_003025_894_1679 260
1046 3300053107 Ga0500560_017143 Ga0500560_017143_109_894 260
1047 3300053118 Ga0500594_0048362 Ga0500594_0048362_267_1049 260
1048 3300053125 Ga0500618_000028 Ga0500618_000028_7729_8511 260
1049 3300053125 Ga0500618_005616 Ga0500618_005616_294_1085 260
1050 3300053125 Ga0500618_014087 Ga0500618_014087_1144_1929 260
1051 3300053134 Ga0500658_0001954 Ga0500658_0001954_558_1340 260
1052 3300053134 Ga0500658_0059571 Ga0500658_0059571_105_890 260
1053 3300053137 Ga0500561_0000056 Ga0500561_0000056_10422_11207 260
1054 3300053139 Ga0500568_0001903 Ga0500568_0001903_7833_8615 260
1055 3300053140 Ga0500573_0021214 Ga0500573_0021214_2380_3165 260
1056 3300053148 Ga0500590_075759 Ga0500590_075759_351_1133 260
1057 3300053151 Ga0500604_0004558 Ga0500604_0004558_2601_3386 260
1058 3300053151 Ga0500604_0033565 Ga0500604_0033565_217_1011 260
1059 3300053153 Ga0500616_0001321 Ga0500616_0001321_13276_14058 260
1060 3300053153 Ga0500616_0001649 Ga0500616_0001649_7662_8444 260
1061 3300053156 Ga0500622_0001224 Ga0500622_0001224_19689_20474 260
1062 3300053160 Ga0500633_0109602 Ga0500633_0109602_102_884 260
1063 3300053727 Ga0500611_005341 Ga0500611_005341_148_942 260
1064 3300059504 Ga0587082_007109 Ga0587082_007109_105_887 260
1065 3300059643 Ga0587072_013588 Ga0587072_013588_112_897 260
1066 3300060353 Ga0501082_0324748 Ga0501082_0324748_179_964 260
1067 3300061719 Ga0466962_0049409 Ga0466962_0049409_618_1400 260
1068 iso_pu_bacteria 2509276022 2509393589 260
1069 iso_pu_bacteria 2513237090 2513614008 260
1070 iso_pu_bacteria 2513237305 2514422266 260
1071 iso_pu_bacteria 2599185301 2599939305 260
1072 iso_pu_bacteria 2643221550 2643769986 260
1073 iso_pu_bacteria 2643221551 2643776229 260
1074 iso_pu_bacteria 2643221555 2643794676 260
1075 iso_pu_bacteria 2693429783 2694629333 260
1076 iso_pu_bacteria 2693429784 2694635435 260
1077 iso_pu_bacteria 2721755686 2723577016 260
1078 iso_pu_bacteria 2767802442 2770198871 260
1079 iso_pu_bacteria 2840764183 2840770328 260
1080 iso_pu_bacteria 2847670302 2847671396 260
1081 iso_pu_bacteria 2847686936 2847687551 260
1082 iso_pu_bacteria 2856314179 2856315436 260
1083 iso_pu_bacteria 2856364286 2856365679 260
1084 iso_pu_bacteria 2869162929 2869169152 260
1085 iso_pu_bacteria 2869285874 2869288854 260
1086 iso_pu_bacteria 2871429161 2871430740 260
1087 iso_pu_bacteria 2871444079 2871449124 260
1088 iso_pu_bacteria 2874102143 2874106206 260
1089 iso_pu_bacteria 2874146452 2874148260 260
1090 iso_pu_bacteria 2874155637 2874157183 260
1091 iso_pu_bacteria 2876377896 2876382668 260
1092 iso_pu_bacteria 2876392853 2876393299 260
1093 iso_pu_bacteria 2876413966 2876415140 260
1094 iso_pu_bacteria 2878035449 2878036500 260
1095 iso_pu_bacteria 2878745973 2878747377 260
1096 iso_pu_bacteria 2881147464 2881153188 260
1097 iso_pu_bacteria 2881161766 2881162395 260
1098 iso_pu_bacteria 2894652903 2894656790 260
1099 iso_pu_bacteria 2903492973 2903498503 260
1100 iso_pu_bacteria 2904659560 2904659805 260
1101 iso_pu_bacteria 2906308376 2906309546 260
1102 iso_pu_bacteria 2906321335 2906322621 260
1103 iso_pu_bacteria 2906328253 2906332435 260
1104 iso_pu_bacteria 2906414383 2906415431 260
1105 iso_pu_bacteria 2919119836 2919124005 260
1106 iso_pu_bacteria 2922158528 2922159873 260
1107 iso_pu_bacteria 2924726620 2924733223 260
1108 iso_pu_bacteria 2924762789 2924765903 260
1109 iso_pu_bacteria 2937813078 2937814598 260
1110 iso_pu_bacteria 2937822353 2937823026 260
1111 iso_pu_bacteria 2937891427 2937894784 260
1112 iso_pu_bacteria 2938014810 2938021363 260
1113 iso_pu_bacteria 2958041894 2958052246 260
1114 iso_pu_bacteria 2958115193 2958117467 260
1115 iso_pu_bacteria 2958130278 2958133250 260
1116 iso_pu_bacteria 2958179912 2958181420 260
1117 iso_pu_bacteria 2961077736 2961079255 260
1118 iso_pu_bacteria 2961114664 2961115130 260
1119 iso_pu_bacteria 2965062239 2965065624 260
1120 iso_pu_bacteria 2968091066 2968092983 260
1121 iso_pu_bacteria 2968097103 2968102493 260
1122 iso_pu_bacteria 2968110612 2968110862 260
1123 iso_pu_bacteria 2968128360 2968132088 260
1124 iso_pu_bacteria 2977843712 2977845076 260
1125 iso_pu_bacteria 2977858184 2977860995 260
1126 iso_pu_bacteria 2977864932 2977869351 260
1127 iso_pu_bacteria 2979779861 2979786133 260
1128 iso_pu_bacteria 2987666974 2987673229 260
1129 iso_pu_bacteria 2996341866 2996342969 260
1130 iso_pu_bacteria 8004387939 8004388284 260
1131 iso_pu_bacteria 8004445564 8004450951 260
1132 iso_pu_bacteria 8004640170 8004642333 260
1133 iso_pu_bacteria 8004703790 8004711352 260
1134 iso_pu_bacteria 8004714634 8004715804 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

242

268

0.96

PF00005

ABC_tran

ABC transporter

39

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9162 13 246
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.916 16 244
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9148 13 246
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9117 15 255
7e7o-assembly1.cif.gz_A cryo-em structure of human abca4 in nrpe-bound state 0.9057 9 246
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9149 11 245 3.40.50.300
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9139 14 246 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9127 10 248 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9122 16 239 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9036 14 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Q3MZI9-F1-model_v4 ATP-binding cassette domain-containing protein 0.9599 14 109 GO:0005524
GO:0005886
GO:0016887
AF-A0A239NU23-F1-model_v4 Branched-chain amino acid transport system ATP-binding protein 0.9368 12 258 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7W0T098-F1-model_v4 ATP-binding cassette domain-containing protein 0.9291 12 116 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7Z2ZL50-F1-model_v4 ATP-binding cassette domain-containing protein 0.9273 14 246 GO:0005524
GO:0016887
GO:0043215
GO:1900753
AF-A0A512DTK1-F1-model_v4 ABC transporter ATP-binding protein 0.9268 14 258 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Feature Viewer

pLDDT pTM Quality
87.88 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map