F490606
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1134 | 447 | 2266 | 262 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3007511990|3007513278 |
| Length | 312 |
| Sequence | GCEAAPNPVATLFQADRIGWFYDCFARARIGRREQAPSPQKLFSPKGLNMLALPWIHLALLSFGYGLALTYGHLGWLAGISVALLLTAGFAARQQHLRIGRYLGHALFIFMALALAMHWLPGFYNGLGINPQRFTDDAVPFSMYLNLDKPLIGFWLLLVCPWIVGRRSLRLSVFATAMGLTLSTVLALGGALLLGVIGWAPKWPDHAWLWVLNNLLLVTLVEEALFRGYIQGGLSRYFKHLPYGENLALLLASLLFGLVHLSAGWQWVLLASLAGVGYGLAYRFGGLGAAIATHFGLNLLHFGLFTYPMLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 40 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 43 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 44 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 102 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 108 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 109 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 122 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 123 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 126 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 127 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 130 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 131 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 132 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 133 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 134 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 135 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 136 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 137 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 138 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 139 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 140 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 141 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 142 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 143 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 144 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 145 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 146 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 147 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 148 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 149 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 150 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 151 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 152 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 153 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 154 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 249 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 255 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 256 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 257 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 258 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 259 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 260 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 261 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 262 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 263 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 264 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 265 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 266 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 267 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 268 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 269 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 270 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 271 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 272 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 273 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 274 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 275 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 276 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 277 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 278 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 279 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 280 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 281 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 282 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 283 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 284 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 285 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 286 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 287 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 288 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 289 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 290 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 291 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 292 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 293 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 294 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 295 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 296 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 297 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 298 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 299 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 300 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 301 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 302 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 303 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 304 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 305 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 306 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 307 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 308 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 309 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 310 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 311 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 312 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 313 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 314 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 315 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 316 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 317 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 318 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 319 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 320 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 321 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 322 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 323 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 324 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 325 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 326 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 327 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 328 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 329 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 330 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 331 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 332 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 333 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 334 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 335 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 336 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 337 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 338 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 339 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 340 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 341 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 342 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 343 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 344 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 345 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 346 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 347 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 348 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 349 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 350 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 351 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 352 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 353 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 354 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 355 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 356 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 357 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 358 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 359 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 360 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 361 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 362 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 363 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 364 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 365 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 366 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 367 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 368 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 369 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 370 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 371 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 372 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 373 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 374 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 375 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 376 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 377 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 378 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 379 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 380 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 381 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 382 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 383 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 384 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 385 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 386 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 387 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 388 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 389 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 390 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 391 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 392 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 393 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 394 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 395 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 396 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 397 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 398 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 399 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 400 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 401 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 402 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 403 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 404 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 405 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 406 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 407 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 408 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 409 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 410 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 411 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 412 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 413 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 414 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 415 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 416 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 417 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 418 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 419 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 420 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 421 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 422 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 423 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 424 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 425 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 426 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 427 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 428 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 429 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 430 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 431 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 432 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 433 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 434 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 435 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 436 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 437 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 438 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 439 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 440 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 441 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 442 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 443 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 444 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 445 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 446 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 447 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.98 |
| Metatranscriptomes | 0 |
| Isolates | 17.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.58 |
| Nodule | 1.85 |
| Rhizoplane | 5.82 |
| Rhizosphere | 74.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_7 | 2124908027 | Bacteria | 72867 |
| 2 | SwRhRL2b_contig_3586591 | 2162886007 | Bacteria | 2057 |
| 3 | JGI24739J22299_10033415 | 3300001989 | Bacteria | 1760 |
| 4 | JGI25162J39368_1000667 | 3300002737 | Bacteria | 24256 |
| 5 | JGI25162J39368_1000717 | 3300002737 | Bacteria | 22916 |
| 6 | JGI25154J39366_1003793 | 3300002738 | Bacteria | 2982 |
| 7 | JGI25163J39215_1000323 | 3300002771 | Bacteria | 15993 |
| 8 | JGI25163J39215_1002068 | 3300002771 | Bacteria | 2378 |
| 9 | JGI25164J39214_1000414 | 3300002772 | Bacteria | 24256 |
| 10 | JGI25164J39214_1000434 | 3300002772 | Bacteria | 22916 |
| 11 | JGI25165J46597_1000779 | 3300003214 | Bacteria | 24256 |
| 12 | JGI25165J46597_1000834 | 3300003214 | Bacteria | 22916 |
| 13 | rootH2_10015044 | 3300003320 | Bacteria | 6108 |
| 14 | rootL2_10045930 | 3300003322 | Bacteria | 3288 |
| 15 | rootH1_10179446 | 3300003323 | Bacteria | 2186 |
| 16 | Ga0055538_1000027 | 3300003751 | Bacteria | 216576 |
| 17 | Ga0055539_1000036 | 3300003752 | Bacteria | 216576 |
| 18 | Ga0055533_1000046 | 3300003756 | Bacteria | 216576 |
| 19 | Ga0055532_1000032 | 3300003758 | Bacteria | 216568 |
| 20 | Ga0055532_1000439 | 3300003758 | Bacteria | 19619 |
| 21 | Ga0055532_1001883 | 3300003758 | Bacteria | 5064 |
| 22 | Ga0055532_1001900 | 3300003758 | Bacteria | 5022 |
| 23 | Ga0055525_1000217 | 3300003759 | Bacteria | 62978 |
| 24 | Ga0055527_1000247 | 3300003760 | Bacteria | 33484 |
| 25 | Ga0055535_1000723 | 3300003761 | Bacteria | 25027 |
| 26 | Ga0055535_1000812 | 3300003761 | Bacteria | 22576 |
| 27 | Ga0055542_1000817 | 3300003762 | Bacteria | 22576 |
| 28 | Ga0055542_1001638 | 3300003762 | Bacteria | 10072 |
| 29 | Ga0055529_1000700 | 3300003763 | Bacteria | 22576 |
| 30 | Ga0055536_1000464 | 3300003781 | Bacteria | 28443 |
| 31 | Ga0055536_1000612 | 3300003781 | Bacteria | 24315 |
| 32 | Ga0055536_1000725 | 3300003781 | Bacteria | 22135 |
| 33 | Ga0055528_1002070 | 3300003790 | Bacteria | 11180 |
| 34 | Ga0055530_10001093 | 3300003791 | Bacteria | 21270 |
| 35 | Ga0055530_10005853 | 3300003791 | Bacteria | 5689 |
| 36 | Ga0055540_1000124 | 3300003792 | Bacteria | 80047 |
| 37 | Ga0055540_1000839 | 3300003792 | Bacteria | 20650 |
| 38 | Ga0055540_1000934 | 3300003792 | Bacteria | 19048 |
| 39 | Ga0055531_10001619 | 3300003794 | Bacteria | 16321 |
| 40 | Ga0055541_1000024 | 3300003841 | Bacteria | 216576 |
| 41 | Ga0065714_10001070 | 3300005288 | Bacteria | 1642 |
| 42 | Ga0065714_10004819 | 3300005288 | Bacteria | 4432 |
| 43 | Ga0065714_10005124 | 3300005288 | Bacteria | 5569 |
| 44 | Ga0065714_10012241 | 3300005288 | Bacteria | 2575 |
| 45 | Ga0065714_10067363 | 3300005288 | Bacteria | 5603 |
| 46 | Ga0065714_10068391 | 3300005288 | Bacteria | 4758 |
| 47 | Ga0065714_10072920 | 3300005288 | Bacteria | 3276 |
| 48 | Ga0065714_10112504 | 3300005288 | Bacteria | 1455 |
| 49 | Ga0065704_10021132 | 3300005289 | Bacteria | 1512 |
| 50 | Ga0065704_10106401 | 3300005289 | Bacteria | 2084 |
| 51 | Ga0065712_10002774 | 3300005290 | Bacteria | 13095 |
| 52 | Ga0065712_10070818 | 3300005290 | Bacteria | 5686 |
| 53 | Ga0070670_100005473 | 3300005331 | Bacteria | 10714 |
| 54 | Ga0070661_100000008 | 3300005344 | Bacteria | 183494 |
| 55 | Ga0070661_100112392 | 3300005344 | Bacteria | 2035 |
| 56 | Ga0070669_100000579 | 3300005353 | Bacteria | 27197 |
| 57 | Ga0070669_100377950 | 3300005353 | Bacteria | 1155 |
| 58 | Ga0070662_100000388 | 3300005457 | Bacteria | 26210 |
| 59 | Ga0068853_100005522 | 3300005539 | Bacteria | 9916 |
| 60 | Ga0070665_100154479 | 3300005548 | Bacteria | 2297 |
| 61 | Ga0070664_100000028 | 3300005564 | Bacteria | 90414 |
| 62 | Ga0070664_100139919 | 3300005564 | Bacteria | 2131 |
| 63 | Ga0068851_10000068 | 3300005834 | Bacteria | 58513 |
| 64 | Ga0075364_10112888 | 3300006051 | Bacteria | 1814 |
| 65 | Ga0075432_10011936 | 3300006058 | Bacteria | 2952 |
| 66 | Ga0075432_10015402 | 3300006058 | Bacteria | 2607 |
| 67 | Ga0075432_10020176 | 3300006058 | Bacteria | 2279 |
| 68 | Ga0075362_10034749 | 3300006177 | Bacteria | 2198 |
| 69 | Ga0075436_100279908 | 3300006914 | Bacteria | 1192 |
| 70 | Ga0079104_1001782 | 3300006946 | Bacteria | 13452 |
| 71 | Ga0079104_1014625 | 3300006946 | Bacteria | 2360 |
| 72 | Ga0099826_10017518 | 3300006948 | Bacteria | 5411 |
| 73 | Ga0105251_10002352 | 3300009011 | Bacteria | 14951 |
| 74 | Ga0105251_10010653 | 3300009011 | Bacteria | 5310 |
| 75 | Ga0105251_10016153 | 3300009011 | Bacteria | 4045 |
| 76 | Ga0105251_10030040 | 3300009011 | Bacteria | 2732 |
| 77 | Ga0105251_10034152 | 3300009011 | Bacteria | 2520 |
| 78 | Ga0105251_10053190 | 3300009011 | Bacteria | 1925 |
| 79 | Ga0105244_10004336 | 3300009036 | Bacteria | 9793 |
| 80 | Ga0105244_10008243 | 3300009036 | Bacteria | 6527 |
| 81 | Ga0105244_10010228 | 3300009036 | Bacteria | 5699 |
| 82 | Ga0105244_10016009 | 3300009036 | Bacteria | 4285 |
| 83 | Ga0105244_10035566 | 3300009036 | Bacteria | 2616 |
| 84 | Ga0105244_10038662 | 3300009036 | Bacteria | 2487 |
| 85 | Ga0105244_10058153 | 3300009036 | Bacteria | 1952 |
| 86 | Ga0105244_10065236 | 3300009036 | Bacteria | 1824 |
| 87 | Ga0105244_10080225 | 3300009036 | Bacteria | 1616 |
| 88 | Ga0105244_10087377 | 3300009036 | Bacteria | 1536 |
| 89 | Ga0105244_10158658 | 3300009036 | Bacteria | 1081 |
| 90 | Ga0105250_10000514 | 3300009092 | Bacteria | 27053 |
| 91 | Ga0105250_10001741 | 3300009092 | Bacteria | 11476 |
| 92 | Ga0105250_10003382 | 3300009092 | Bacteria | 7568 |
| 93 | Ga0105250_10040031 | 3300009092 | Bacteria | 1879 |
| 94 | Ga0105250_10056936 | 3300009092 | Bacteria | 1569 |
| 95 | Ga0105250_10064086 | 3300009092 | Bacteria | 1480 |
| 96 | Ga0105243_10000161 | 3300009148 | Bacteria | 76138 |
| 97 | Ga0105243_10091004 | 3300009148 | Bacteria | 2512 |
| 98 | Ga0105242_10000024 | 3300009176 | Bacteria | 111115 |
| 99 | Ga0105237_10000180 | 3300009545 | Bacteria | 89559 |
| 100 | Ga0105237_10343814 | 3300009545 | Bacteria | 1496 |
| 101 | Ga0105246_10002400 | 3300011119 | Bacteria | 11312 |
| 102 | Ga0105246_10005198 | 3300011119 | Bacteria | 7913 |
| 103 | Ga0105246_10027063 | 3300011119 | Bacteria | 3754 |
| 104 | Ga0105246_10131854 | 3300011119 | Bacteria | 1867 |
| 105 | Ga0157345_1000011 | 3300012498 | Bacteria | 52911 |
| 106 | Ga0157373_10000846 | 3300013100 | Bacteria | 23782 |
| 107 | Ga0157373_10001211 | 3300013100 | Bacteria | 19708 |
| 108 | Ga0157373_10003711 | 3300013100 | Bacteria | 11558 |
| 109 | Ga0157373_10020125 | 3300013100 | Bacteria | 4855 |
| 110 | Ga0157373_10023404 | 3300013100 | Bacteria | 4479 |
| 111 | Ga0157373_10184328 | 3300013100 | Bacteria | 1470 |
| 112 | Ga0157373_10493844 | 3300013100 | Bacteria | 884 |
| 113 | Ga0157371_10000714 | 3300013102 | Bacteria | 38837 |
| 114 | Ga0157371_10005454 | 3300013102 | Bacteria | 10722 |
| 115 | Ga0157371_10298822 | 3300013102 | Bacteria | 1165 |
| 116 | Ga0157370_10056938 | 3300013104 | Bacteria | 3719 |
| 117 | Ga0157370_10113607 | 3300013104 | Bacteria | 2531 |
| 118 | Ga0157369_10002767 | 3300013105 | Bacteria | 20948 |
| 119 | Ga0157369_10011208 | 3300013105 | Bacteria | 10190 |
| 120 | Ga0157369_10014989 | 3300013105 | Bacteria | 8749 |
| 121 | Ga0157369_10255634 | 3300013105 | Bacteria | 1828 |
| 122 | Ga0157369_10323682 | 3300013105 | Bacteria | 1602 |
| 123 | Ga0157369_10333299 | 3300013105 | Bacteria | 1576 |
| 124 | Ga0157369_10384058 | 3300013105 | Bacteria | 1457 |
| 125 | Ga0163162_10000385 | 3300013306 | Bacteria | 40280 |
| 126 | Ga0163162_10411865 | 3300013306 | Bacteria | 1484 |
| 127 | Ga0157372_10002200 | 3300013307 | Bacteria | 21199 |
| 128 | Ga0157375_10009788 | 3300013308 | Bacteria | 8426 |
| 129 | Ga0157375_10086362 | 3300013308 | Bacteria | 3188 |
| 130 | Ga0157375_10564933 | 3300013308 | Bacteria | 1298 |
| 131 | Ga0182008_10002026 | 3300014497 | Bacteria | 12994 |
| 132 | Ga0182008_10009343 | 3300014497 | Bacteria | 5297 |
| 133 | Ga0182008_10016696 | 3300014497 | Bacteria | 3811 |
| 134 | Ga0182008_10024290 | 3300014497 | Bacteria | 3087 |
| 135 | Ga0182008_10027518 | 3300014497 | Bacteria | 2879 |
| 136 | Ga0182008_10032189 | 3300014497 | Bacteria | 2635 |
| 137 | Ga0182008_10042038 | 3300014497 | Bacteria | 2277 |
| 138 | Ga0182008_10238580 | 3300014497 | Bacteria | 935 |
| 139 | Ga0182006_1000750 | 3300015261 | Bacteria | 22221 |
| 140 | Ga0182006_1003202 | 3300015261 | Bacteria | 8520 |
| 141 | Ga0182006_1006820 | 3300015261 | Bacteria | 5269 |
| 142 | Ga0182006_1007061 | 3300015261 | Bacteria | 5167 |
| 143 | Ga0182006_1013936 | 3300015261 | Bacteria | 3474 |
| 144 | Ga0182006_1033408 | 3300015261 | Bacteria | 2063 |
| 145 | Ga0182007_10001015 | 3300015262 | Bacteria | 15379 |
| 146 | Ga0182007_10002499 | 3300015262 | Bacteria | 9087 |
| 147 | Ga0182007_10091466 | 3300015262 | Bacteria | 1002 |
| 148 | Ga0182005_1001933 | 3300015265 | Bacteria | 7838 |
| 149 | Ga0182005_1002471 | 3300015265 | Bacteria | 6580 |
| 150 | Ga0182005_1006843 | 3300015265 | Bacteria | 3455 |
| 151 | Ga0182005_1009726 | 3300015265 | Bacteria | 2785 |
| 152 | Ga0182005_1013357 | 3300015265 | Bacteria | 2309 |
| 153 | Ga0182005_1015696 | 3300015265 | Bacteria | 2111 |
| 154 | Ga0163161_10000618 | 3300017792 | Bacteria | 28498 |
| 155 | Ga0163161_10002540 | 3300017792 | Bacteria | 13023 |
| 156 | Ga0163161_10004603 | 3300017792 | Bacteria | 9599 |
| 157 | Ga0163161_10004684 | 3300017792 | Bacteria | 9510 |
| 158 | Ga0163161_10007942 | 3300017792 | Bacteria | 7345 |
| 159 | Ga0163161_10047067 | 3300017792 | Bacteria | 3114 |
| 160 | Ga0163161_10128667 | 3300017792 | Bacteria | 1908 |
| 161 | Ga0163161_10314028 | 3300017792 | Bacteria | 1237 |
| 162 | Ga0163161_10316714 | 3300017792 | Bacteria | 1232 |
| 163 | Ga0163161_10361071 | 3300017792 | Bacteria | 1157 |
| 164 | Ga0209760_100130 | 3300025207 | Bacteria | 49371 |
| 165 | Ga0209760_100143 | 3300025207 | Bacteria | 45169 |
| 166 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 167 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 168 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 169 | Ga0209672_100067 | 3300025228 | Bacteria | 180819 |
| 170 | Ga0209672_100079 | 3300025228 | Bacteria | 156875 |
| 171 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 172 | Ga0209147_100038 | 3300025229 | Bacteria | 314497 |
| 173 | Ga0209147_100061 | 3300025229 | Bacteria | 248809 |
| 174 | Ga0209147_100107 | 3300025229 | Bacteria | 156875 |
| 175 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 176 | Ga0209563_102640 | 3300025230 | Bacteria | 3974 |
| 177 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 178 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 179 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 180 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 181 | Ga0209437_103726 | 3300025233 | Bacteria | 2726 |
| 182 | Ga0209258_100107 | 3300025242 | Bacteria | 206572 |
| 183 | Ga0209258_100197 | 3300025242 | Bacteria | 124028 |
| 184 | Ga0209258_100273 | 3300025242 | Bacteria | 87726 |
| 185 | Ga0209646_1000903 | 3300025246 | Bacteria | 9636 |
| 186 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 187 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 188 | Ga0209148_1000593 | 3300025254 | Bacteria | 32854 |
| 189 | Ga0209759_1002079 | 3300025256 | Bacteria | 9361 |
| 190 | Ga0209759_1007542 | 3300025256 | Bacteria | 3486 |
| 191 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 192 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 193 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 194 | Ga0209455_1000935 | 3300025272 | Bacteria | 14977 |
| 195 | Ga0209673_1000021 | 3300025273 | Bacteria | 422978 |
| 196 | Ga0209675_1026439 | 3300025291 | Bacteria | 1444 |
| 197 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 198 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 199 | Ga0209676_1000127 | 3300025292 | Bacteria | 189701 |
| 200 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 201 | Ga0209050_1000120 | 3300025298 | Bacteria | 198658 |
| 202 | Ga0209050_1000395 | 3300025298 | Bacteria | 81719 |
| 203 | Ga0209050_1000972 | 3300025298 | Bacteria | 36685 |
| 204 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 205 | Ga0209051_1000083 | 3300025303 | Bacteria | 192732 |
| 206 | Ga0209051_1000745 | 3300025303 | Bacteria | 34964 |
| 207 | Ga0209051_1021928 | 3300025303 | Bacteria | 2702 |
| 208 | Ga0209257_1000175 | 3300025304 | Bacteria | 165070 |
| 209 | Ga0209257_1007669 | 3300025304 | Bacteria | 6451 |
| 210 | Ga0207656_10000089 | 3300025321 | Bacteria | 33748 |
| 211 | Ga0207696_1000025 | 3300025711 | Bacteria | 418650 |
| 212 | Ga0207696_1000043 | 3300025711 | Bacteria | 307112 |
| 213 | Ga0207696_1005252 | 3300025711 | Bacteria | 5407 |
| 214 | Ga0207696_1012776 | 3300025711 | Bacteria | 2956 |
| 215 | Ga0207655_1000035 | 3300025728 | Bacteria | 359016 |
| 216 | Ga0207655_1000095 | 3300025728 | Bacteria | 195899 |
| 217 | Ga0207655_1000187 | 3300025728 | Bacteria | 109886 |
| 218 | Ga0207655_1003312 | 3300025728 | Bacteria | 12073 |
| 219 | Ga0207655_1003631 | 3300025728 | Bacteria | 11395 |
| 220 | Ga0207655_1008110 | 3300025728 | Bacteria | 6719 |
| 221 | Ga0207655_1016024 | 3300025728 | Bacteria | 4126 |
| 222 | Ga0207655_1039244 | 3300025728 | Bacteria | 2060 |
| 223 | Ga0207655_1100820 | 3300025728 | Bacteria | 995 |
| 224 | Ga0207713_1000176 | 3300025735 | Bacteria | 92148 |
| 225 | Ga0207713_1000365 | 3300025735 | Bacteria | 49199 |
| 226 | Ga0207713_1001669 | 3300025735 | Bacteria | 17198 |
| 227 | Ga0207713_1002544 | 3300025735 | Bacteria | 13192 |
| 228 | Ga0207713_1004705 | 3300025735 | Bacteria | 8787 |
| 229 | Ga0207713_1005992 | 3300025735 | Bacteria | 7496 |
| 230 | Ga0207713_1007047 | 3300025735 | Bacteria | 6733 |
| 231 | Ga0207713_1009077 | 3300025735 | Bacteria | 5648 |
| 232 | Ga0207713_1012309 | 3300025735 | Bacteria | 4584 |
| 233 | Ga0207713_1026967 | 3300025735 | Bacteria | 2618 |
| 234 | Ga0207713_1069714 | 3300025735 | Bacteria | 1302 |
| 235 | Ga0207671_10000035 | 3300025914 | Bacteria | 237603 |
| 236 | Ga0207649_10000013 | 3300025920 | Bacteria | 255009 |
| 237 | Ga0207681_10011098 | 3300025923 | Bacteria | 5533 |
| 238 | Ga0207650_10001330 | 3300025925 | Bacteria | 17884 |
| 239 | Ga0207706_10000170 | 3300025933 | Bacteria | 72208 |
| 240 | Ga0207686_10001020 | 3300025934 | Bacteria | 16578 |
| 241 | Ga0207709_10000089 | 3300025935 | Bacteria | 149139 |
| 242 | Ga0207711_10329603 | 3300025941 | Bacteria | 1412 |
| 243 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 244 | Ga0207667_10230034 | 3300025949 | Bacteria | 1899 |
| 245 | Ga0207639_10004455 | 3300026041 | Bacteria | 9452 |
| 246 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 247 | Ga0209281_1000090 | 3300027111 | Bacteria | 242950 |
| 248 | Ga0209281_1011939 | 3300027111 | Bacteria | 1927 |
| 249 | Ga0209371_1000982 | 3300027312 | Bacteria | 21992 |
| 250 | Ga0209282_1022771 | 3300027666 | Bacteria | 3942 |
| 251 | Ga0207428_10073898 | 3300027907 | Bacteria | 2674 |
| 252 | Ga0207428_10118831 | 3300027907 | Bacteria | 2029 |
| 253 | Ga0207428_10233571 | 3300027907 | Bacteria | 1376 |
| 254 | Ga0207428_10306959 | 3300027907 | Bacteria | 1174 |
| 255 | Ga0207428_10431881 | 3300027907 | Bacteria | 962 |
| 256 | Ga0268266_10013640 | 3300028379 | Bacteria | 6999 |
| 257 | Ga0268256_1000830 | 3300030500 | Bacteria | 21995 |
| 258 | Ga0314311_1076632 | 3300030733 | Bacteria | 2594 |
| 259 | Ga0316179_1094404 | 3300030734 | Bacteria | 2300 |
| 260 | Ga0316178_1038486 | 3300030735 | Bacteria | 8120 |
| 261 | Ga0307408_100012352 | 3300031548 | Bacteria | 5654 |
| 262 | Ga0307408_100030385 | 3300031548 | Bacteria | 3751 |
| 263 | Ga0307408_100078879 | 3300031548 | Bacteria | 2455 |
| 264 | Ga0307408_100134052 | 3300031548 | Bacteria | 1935 |
| 265 | Ga0307408_100655239 | 3300031548 | Bacteria | 939 |
| 266 | Ga0307405_10000148 | 3300031731 | Bacteria | 26698 |
| 267 | Ga0307405_10014970 | 3300031731 | Bacteria | 4187 |
| 268 | Ga0307405_10020525 | 3300031731 | Bacteria | 3694 |
| 269 | Ga0307413_10012815 | 3300031824 | Bacteria | 4187 |
| 270 | Ga0307413_10025520 | 3300031824 | Bacteria | 3240 |
| 271 | Ga0307406_10007496 | 3300031901 | Bacteria | 6052 |
| 272 | Ga0307406_10033479 | 3300031901 | Bacteria | 3146 |
| 273 | Ga0307406_10163694 | 3300031901 | Bacteria | 1602 |
| 274 | Ga0307407_10012317 | 3300031903 | Bacteria | 4106 |
| 275 | Ga0307412_10007418 | 3300031911 | Bacteria | 6222 |
| 276 | Ga0307412_10007529 | 3300031911 | Bacteria | 6182 |
| 277 | Ga0307412_10147544 | 3300031911 | Bacteria | 1731 |
| 278 | Ga0307412_10444710 | 3300031911 | Bacteria | 1066 |
| 279 | Ga0307409_100030842 | 3300031995 | Bacteria | 3859 |
| 280 | Ga0307414_10257336 | 3300032004 | Bacteria | 1454 |
| 281 | Ga0307411_10019453 | 3300032005 | Bacteria | 3922 |
| 282 | Ga0307411_10475907 | 3300032005 | Bacteria | 1050 |
| 283 | Ga0307510_10023150 | 3300033180 | Bacteria | 7206 |
| 284 | Ga0395898_0367344 | 3300037466 | Bacteria | 1372 |
| 285 | Ga0237819_05620 | 3300038705 | Bacteria | 1952 |
| 286 | Ga0439438_000047 | 3300041405 | Bacteria | 58963 |
| 287 | Ga0439438_001671 | 3300041405 | Bacteria | 9740 |
| 288 | Ga0439438_004171 | 3300041405 | Bacteria | 5631 |
| 289 | Ga0439438_004194 | 3300041405 | Bacteria | 5605 |
| 290 | Ga0439438_004440 | 3300041405 | Bacteria | 5376 |
| 291 | Ga0439438_004716 | 3300041405 | Bacteria | 5169 |
| 292 | Ga0439438_009750 | 3300041405 | Bacteria | 3087 |
| 293 | Ga0439438_009903 | 3300041405 | Bacteria | 3055 |
| 294 | Ga0439447_002873 | 3300041407 | Bacteria | 6177 |
| 295 | Ga0439447_005572 | 3300041407 | Bacteria | 4168 |
| 296 | Ga0439447_006712 | 3300041407 | Bacteria | 3707 |
| 297 | Ga0439447_011528 | 3300041407 | Bacteria | 2572 |
| 298 | Ga0439447_018735 | 3300041407 | Bacteria | 1858 |
| 299 | Ga0439447_021988 | 3300041407 | Bacteria | 1674 |
| 300 | Ga0439447_028541 | 3300041407 | Bacteria | 1417 |
| 301 | Ga0439447_046719 | 3300041407 | Bacteria | 1041 |
| 302 | Ga0439466_0001445 | 3300041411 | Bacteria | 9268 |
| 303 | Ga0439466_0004658 | 3300041411 | Bacteria | 5267 |
| 304 | Ga0439466_0021809 | 3300041411 | Bacteria | 2265 |
| 305 | Ga0439466_0022674 | 3300041411 | Bacteria | 2213 |
| 306 | Ga0439466_0024412 | 3300041411 | Bacteria | 2119 |
| 307 | Ga0439466_0033330 | 3300041411 | Bacteria | 1750 |
| 308 | Ga0439466_0036062 | 3300041411 | Bacteria | 1670 |
| 309 | Ga0439466_0043494 | 3300041411 | Bacteria | 1491 |
| 310 | Ga0439466_0046169 | 3300041411 | Bacteria | 1439 |
| 311 | Ga0439466_0056058 | 3300041411 | Bacteria | 1279 |
| 312 | Ga0439466_0061441 | 3300041411 | Bacteria | 1209 |
| 313 | Ga0439465_0031304 | 3300041413 | Bacteria | 1694 |
| 314 | Ga0439431_0008222 | 3300041997 | Bacteria | 2342 |
| 315 | Ga0439445_0019296 | 3300042004 | Bacteria | 1698 |
| 316 | Ga0439445_0030989 | 3300042004 | Bacteria | 1388 |
| 317 | Ga0439432_000947 | 3300042006 | Bacteria | 10942 |
| 318 | Ga0439432_001594 | 3300042006 | Bacteria | 8492 |
| 319 | Ga0439432_009678 | 3300042006 | Bacteria | 3354 |
| 320 | Ga0439432_010217 | 3300042006 | Bacteria | 3256 |
| 321 | Ga0439432_020006 | 3300042006 | Bacteria | 2227 |
| 322 | Ga0439432_041613 | 3300042006 | Bacteria | 1454 |
| 323 | Ga0439432_063510 | 3300042006 | Bacteria | 1135 |
| 324 | Ga0439432_082737 | 3300042006 | Bacteria | 971 |
| 325 | Ga0439451_000073 | 3300042009 | Bacteria | 18421 |
| 326 | Ga0439451_000123 | 3300042009 | Bacteria | 14179 |
| 327 | Ga0439451_006138 | 3300042009 | Bacteria | 2456 |
| 328 | Ga0439451_018469 | 3300042009 | Bacteria | 1407 |
| 329 | Ga0439452_000340 | 3300042010 | Bacteria | 28963 |
| 330 | Ga0439452_001423 | 3300042010 | Bacteria | 9839 |
| 331 | Ga0439452_002563 | 3300042010 | Bacteria | 6667 |
| 332 | Ga0439452_010412 | 3300042010 | Bacteria | 2705 |
| 333 | Ga0439452_013961 | 3300042010 | Bacteria | 2242 |
| 334 | Ga0439452_013971 | 3300042010 | Bacteria | 2240 |
| 335 | Ga0439452_021508 | 3300042010 | Bacteria | 1679 |
| 336 | Ga0439452_034545 | 3300042010 | Bacteria | 1221 |
| 337 | Ga0439456_002221 | 3300042013 | Bacteria | 3907 |
| 338 | Ga0439456_008427 | 3300042013 | Bacteria | 2128 |
| 339 | Ga0439456_015036 | 3300042013 | Bacteria | 1614 |
| 340 | Ga0439456_021478 | 3300042013 | Bacteria | 1365 |
| 341 | Ga0439456_022815 | 3300042013 | Bacteria | 1326 |
| 342 | Ga0439456_024919 | 3300042013 | Bacteria | 1270 |
| 343 | Ga0439463_000847 | 3300042016 | Bacteria | 8393 |
| 344 | Ga0439463_004797 | 3300042016 | Bacteria | 3377 |
| 345 | Ga0439463_006761 | 3300042016 | Bacteria | 2836 |
| 346 | Ga0439463_018823 | 3300042016 | Bacteria | 1719 |
| 347 | Ga0439463_027666 | 3300042016 | Bacteria | 1428 |
| 348 | Ga0450911_000029 | 3300042115 | Bacteria | 77010 |
| 349 | Ga0450911_001240 | 3300042115 | Bacteria | 6150 |
| 350 | Ga0450911_005165 | 3300042115 | Bacteria | 2053 |
| 351 | Ga0450911_013332 | 3300042115 | Bacteria | 1100 |
| 352 | Ga0450919_004342 | 3300042121 | Bacteria | 1737 |
| 353 | Ga0450922_001175 | 3300042124 | Bacteria | 2586 |
| 354 | Ga0450922_005095 | 3300042124 | Bacteria | 1213 |
| 355 | Ga0450923_016772 | 3300042125 | Bacteria | 1383 |
| 356 | Ga0450923_027207 | 3300042125 | Bacteria | 1149 |
| 357 | Ga0450890_001266 | 3300042127 | Bacteria | 3658 |
| 358 | Ga0450899_005962 | 3300042135 | Bacteria | 1314 |
| 359 | Ga0450900_007596 | 3300042136 | Bacteria | 1339 |
| 360 | Ga0450903_003012 | 3300042138 | Bacteria | 2939 |
| 361 | Ga0450903_009256 | 3300042138 | Bacteria | 1606 |
| 362 | Ga0450903_020823 | 3300042138 | Bacteria | 1014 |
| 363 | Ga0450905_005383 | 3300042142 | Bacteria | 1718 |
| 364 | Ga0450906_000366 | 3300042145 | Bacteria | 9145 |
| 365 | Ga0450906_000835 | 3300042145 | Bacteria | 6786 |
| 366 | Ga0450906_005862 | 3300042145 | Bacteria | 2505 |
| 367 | Ga0450907_000169 | 3300042146 | Bacteria | 23912 |
| 368 | Ga0450907_002809 | 3300042146 | Bacteria | 3222 |
| 369 | Ga0450910_007740 | 3300042147 | Bacteria | 1502 |
| 370 | Ga0450910_007902 | 3300042147 | Bacteria | 1490 |
| 371 | Ga0439446_0012870 | 3300042156 | Bacteria | 2289 |
| 372 | Ga0439446_0025379 | 3300042156 | Bacteria | 1694 |
| 373 | Ga0450908_005042 | 3300042184 | Bacteria | 2533 |
| 374 | Ga0450908_020707 | 3300042184 | Bacteria | 1155 |
| 375 | Ga0450909_001999 | 3300042185 | Bacteria | 2874 |
| 376 | Ga0450909_004137 | 3300042185 | Bacteria | 2067 |
| 377 | Ga0450909_006077 | 3300042185 | Bacteria | 1741 |
| 378 | Ga0439434_0000043 | 3300042435 | Bacteria | 30685 |
| 379 | Ga0439434_0033207 | 3300042435 | Bacteria | 1572 |
| 380 | Ga0439464_0020098 | 3300042439 | Bacteria | 1827 |
| 381 | Ga0439460_0001061 | 3300042461 | Bacteria | 6395 |
| 382 | Ga0439460_0008258 | 3300042461 | Bacteria | 2627 |
| 383 | Ga0439460_0021498 | 3300042461 | Bacteria | 1763 |
| 384 | Ga0450918_015640 | 3300042531 | Bacteria | 1319 |
| 385 | Ga0450893_0013785 | 3300042532 | Bacteria | 1350 |
| 386 | Ga0450893_0025076 | 3300042532 | Bacteria | 1043 |
| 387 | Ga0439440_0000018 | 3300042993 | Bacteria | 19406 |
| 388 | Ga0439440_0010939 | 3300042993 | Bacteria | 1906 |
| 389 | Ga0439440_0022144 | 3300042993 | Bacteria | 1438 |
| 390 | Ga0495617_000261 | 3300046452 | Bacteria | 30458 |
| 391 | Ga0495617_000723 | 3300046452 | Bacteria | 16351 |
| 392 | Ga0495617_007485 | 3300046452 | Bacteria | 3788 |
| 393 | Ga0495617_016242 | 3300046452 | Bacteria | 2517 |
| 394 | Ga0495617_039229 | 3300046452 | Bacteria | 1583 |
| 395 | Ga0495617_047385 | 3300046452 | Bacteria | 1431 |
| 396 | Ga0495617_052515 | 3300046452 | Bacteria | 1354 |
| 397 | Ga0495617_056419 | 3300046452 | Bacteria | 1302 |
| 398 | Ga0495617_090682 | 3300046452 | Bacteria | 997 |
| 399 | Ga0495627_000435 | 3300046453 | Bacteria | 36309 |
| 400 | Ga0495627_000539 | 3300046453 | Bacteria | 31198 |
| 401 | Ga0495627_000945 | 3300046453 | Bacteria | 19964 |
| 402 | Ga0495627_002111 | 3300046453 | Bacteria | 10061 |
| 403 | Ga0495627_005449 | 3300046453 | Bacteria | 5128 |
| 404 | Ga0495603_0006846 | 3300046455 | Bacteria | 6838 |
| 405 | Ga0495603_0151647 | 3300046455 | Bacteria | 1346 |
| 406 | Ga0495590_0003477 | 3300046457 | Bacteria | 6427 |
| 407 | Ga0495590_0005953 | 3300046457 | Bacteria | 4781 |
| 408 | Ga0495590_0029351 | 3300046457 | Bacteria | 1928 |
| 409 | Ga0495590_0038696 | 3300046457 | Bacteria | 1663 |
| 410 | Ga0495590_0043564 | 3300046457 | Bacteria | 1565 |
| 411 | Ga0495590_0106339 | 3300046457 | Bacteria | 999 |
| 412 | Ga0495590_0130957 | 3300046457 | Bacteria | 902 |
| 413 | Ga0495591_000178 | 3300046458 | Bacteria | 65815 |
| 414 | Ga0495591_000201 | 3300046458 | Bacteria | 61162 |
| 415 | Ga0495591_000321 | 3300046458 | Bacteria | 43461 |
| 416 | Ga0495591_000420 | 3300046458 | Bacteria | 35259 |
| 417 | Ga0495591_003661 | 3300046458 | Bacteria | 7820 |
| 418 | Ga0495591_005054 | 3300046458 | Bacteria | 6202 |
| 419 | Ga0495591_005423 | 3300046458 | Bacteria | 5914 |
| 420 | Ga0495591_011360 | 3300046458 | Bacteria | 3377 |
| 421 | Ga0495591_021179 | 3300046458 | Bacteria | 2128 |
| 422 | Ga0495591_022066 | 3300046458 | Bacteria | 2063 |
| 423 | Ga0495591_025141 | 3300046458 | Bacteria | 1873 |
| 424 | Ga0495591_030198 | 3300046458 | Bacteria | 1638 |
| 425 | Ga0495591_036912 | 3300046458 | Bacteria | 1418 |
| 426 | Ga0495591_053774 | 3300046458 | Bacteria | 1090 |
| 427 | Ga0495591_060763 | 3300046458 | Bacteria | 1004 |
| 428 | Ga0495638_0000291 | 3300046460 | Bacteria | 65847 |
| 429 | Ga0495638_0001817 | 3300046460 | Bacteria | 18518 |
| 430 | Ga0495638_0014505 | 3300046460 | Bacteria | 5321 |
| 431 | Ga0495638_0049726 | 3300046460 | Bacteria | 2620 |
| 432 | Ga0495638_0073985 | 3300046460 | Bacteria | 2078 |
| 433 | Ga0495638_0082151 | 3300046460 | Bacteria | 1954 |
| 434 | Ga0495638_0096233 | 3300046460 | Bacteria | 1777 |
| 435 | Ga0495638_0099474 | 3300046460 | Bacteria | 1740 |
| 436 | Ga0495638_0136681 | 3300046460 | Bacteria | 1434 |
| 437 | Ga0495638_0183905 | 3300046460 | Bacteria | 1190 |
| 438 | Ga0495638_0217221 | 3300046460 | Bacteria | 1070 |
| 439 | Ga0495653_0018957 | 3300046463 | Bacteria | 5584 |
| 440 | Ga0495653_0058482 | 3300046463 | Bacteria | 2929 |
| 441 | Ga0495650_0003672 | 3300046471 | Bacteria | 11001 |
| 442 | Ga0495650_0013233 | 3300046471 | Bacteria | 4378 |
| 443 | Ga0495650_0015119 | 3300046471 | Bacteria | 3976 |
| 444 | Ga0495650_0018693 | 3300046471 | Bacteria | 3437 |
| 445 | Ga0495650_0018733 | 3300046471 | Bacteria | 3432 |
| 446 | Ga0495650_0022921 | 3300046471 | Bacteria | 2984 |
| 447 | Ga0495650_0073908 | 3300046471 | Bacteria | 1330 |
| 448 | Ga0495580_0410257 | 3300046472 | Bacteria | 912 |
| 449 | Ga0495582_0072886 | 3300046473 | Bacteria | 1901 |
| 450 | Ga0495605_0000925 | 3300046474 | Bacteria | 20102 |
| 451 | Ga0495605_0002066 | 3300046474 | Bacteria | 12658 |
| 452 | Ga0495605_0011446 | 3300046474 | Bacteria | 4943 |
| 453 | Ga0495605_0033043 | 3300046474 | Bacteria | 2630 |
| 454 | Ga0495605_0035664 | 3300046474 | Bacteria | 2512 |
| 455 | Ga0495605_0052551 | 3300046474 | Bacteria | 1979 |
| 456 | Ga0495605_0055921 | 3300046474 | Bacteria | 1904 |
| 457 | Ga0495605_0109861 | 3300046474 | Bacteria | 1259 |
| 458 | Ga0495639_0004268 | 3300046475 | Bacteria | 6130 |
| 459 | Ga0495639_0033366 | 3300046475 | Bacteria | 2299 |
| 460 | Ga0495584_0000289 | 3300046491 | Bacteria | 35537 |
| 461 | Ga0495584_0001390 | 3300046491 | Bacteria | 14572 |
| 462 | Ga0495584_0006060 | 3300046491 | Bacteria | 6365 |
| 463 | Ga0495584_0007118 | 3300046491 | Bacteria | 5844 |
| 464 | Ga0495584_0008338 | 3300046491 | Bacteria | 5366 |
| 465 | Ga0495584_0031143 | 3300046491 | Bacteria | 2700 |
| 466 | Ga0495584_0034843 | 3300046491 | Bacteria | 2545 |
| 467 | Ga0495584_0179751 | 3300046491 | Bacteria | 1075 |
| 468 | Ga0495584_0196533 | 3300046491 | Bacteria | 1025 |
| 469 | Ga0495585_0000361 | 3300046492 | Bacteria | 44106 |
| 470 | Ga0495585_0000787 | 3300046492 | Bacteria | 27988 |
| 471 | Ga0495585_0006449 | 3300046492 | Bacteria | 7278 |
| 472 | Ga0495585_0010630 | 3300046492 | Bacteria | 5469 |
| 473 | Ga0495585_0028685 | 3300046492 | Bacteria | 3172 |
| 474 | Ga0495585_0033550 | 3300046492 | Bacteria | 2905 |
| 475 | Ga0495585_0033801 | 3300046492 | Bacteria | 2892 |
| 476 | Ga0495585_0038835 | 3300046492 | Bacteria | 2678 |
| 477 | Ga0495585_0049039 | 3300046492 | Bacteria | 2346 |
| 478 | Ga0495585_0123328 | 3300046492 | Bacteria | 1369 |
| 479 | Ga0495594_0138170 | 3300046499 | Bacteria | 1381 |
| 480 | Ga0495596_0002541 | 3300046500 | Bacteria | 9752 |
| 481 | Ga0495596_0030126 | 3300046500 | Bacteria | 2173 |
| 482 | Ga0495607_0000203 | 3300046501 | Bacteria | 63159 |
| 483 | Ga0495607_0000825 | 3300046501 | Bacteria | 29326 |
| 484 | Ga0495607_0001379 | 3300046501 | Bacteria | 21608 |
| 485 | Ga0495607_0002157 | 3300046501 | Bacteria | 16392 |
| 486 | Ga0495607_0002620 | 3300046501 | Bacteria | 14463 |
| 487 | Ga0495607_0009287 | 3300046501 | Bacteria | 6669 |
| 488 | Ga0495607_0029424 | 3300046501 | Bacteria | 3380 |
| 489 | Ga0495607_0032269 | 3300046501 | Bacteria | 3199 |
| 490 | Ga0495607_0035258 | 3300046501 | Bacteria | 3028 |
| 491 | Ga0495607_0044081 | 3300046501 | Bacteria | 2632 |
| 492 | Ga0495607_0044495 | 3300046501 | Bacteria | 2617 |
| 493 | Ga0495607_0058211 | 3300046501 | Bacteria | 2210 |
| 494 | Ga0495607_0061719 | 3300046501 | Bacteria | 2129 |
| 495 | Ga0495607_0104143 | 3300046501 | Bacteria | 1514 |
| 496 | Ga0495607_0154914 | 3300046501 | Bacteria | 1169 |
| 497 | Ga0495607_0173838 | 3300046501 | Bacteria | 1085 |
| 498 | Ga0495583_0001393 | 3300046506 | Bacteria | 24724 |
| 499 | Ga0495583_0001561 | 3300046506 | Bacteria | 22653 |
| 500 | Ga0495583_0004609 | 3300046506 | Bacteria | 9752 |
| 501 | Ga0495583_0007556 | 3300046506 | Bacteria | 6801 |
| 502 | Ga0495583_0023118 | 3300046506 | Bacteria | 3151 |
| 503 | Ga0495583_0038122 | 3300046506 | Bacteria | 2273 |
| 504 | Ga0495583_0093402 | 3300046506 | Bacteria | 1292 |
| 505 | Ga0495606_0000538 | 3300046507 | Bacteria | 60967 |
| 506 | Ga0495606_0003905 | 3300046507 | Bacteria | 15349 |
| 507 | Ga0495606_0007086 | 3300046507 | Bacteria | 10139 |
| 508 | Ga0495606_0009451 | 3300046507 | Bacteria | 8249 |
| 509 | Ga0495606_0011725 | 3300046507 | Bacteria | 7113 |
| 510 | Ga0495606_0018894 | 3300046507 | Bacteria | 5152 |
| 511 | Ga0495606_0085089 | 3300046507 | Bacteria | 1956 |
| 512 | Ga0495606_0227377 | 3300046507 | Bacteria | 1047 |
| 513 | Ga0495610_0000608 | 3300046512 | Bacteria | 35442 |
| 514 | Ga0495610_0005301 | 3300046512 | Bacteria | 9216 |
| 515 | Ga0495610_0008647 | 3300046512 | Bacteria | 6560 |
| 516 | Ga0495610_0010004 | 3300046512 | Bacteria | 5927 |
| 517 | Ga0495610_0033569 | 3300046512 | Bacteria | 2651 |
| 518 | Ga0495610_0058217 | 3300046512 | Bacteria | 1850 |
| 519 | Ga0495610_0079095 | 3300046512 | Bacteria | 1514 |
| 520 | Ga0495610_0141242 | 3300046512 | Bacteria | 1036 |
| 521 | Ga0495616_0000124 | 3300046513 | Bacteria | 66939 |
| 522 | Ga0495616_0000141 | 3300046513 | Bacteria | 62889 |
| 523 | Ga0495616_0000356 | 3300046513 | Bacteria | 35881 |
| 524 | Ga0495616_0000387 | 3300046513 | Bacteria | 34314 |
| 525 | Ga0495616_0015465 | 3300046513 | Bacteria | 4245 |
| 526 | Ga0495616_0018863 | 3300046513 | Bacteria | 3773 |
| 527 | Ga0495616_0022001 | 3300046513 | Bacteria | 3446 |
| 528 | Ga0495616_0057814 | 3300046513 | Bacteria | 1911 |
| 529 | Ga0495616_0132283 | 3300046513 | Bacteria | 1142 |
| 530 | Ga0495620_0000084 | 3300046515 | Bacteria | 78328 |
| 531 | Ga0495620_0002239 | 3300046515 | Bacteria | 11208 |
| 532 | Ga0495620_0010882 | 3300046515 | Bacteria | 4777 |
| 533 | Ga0495620_0030708 | 3300046515 | Bacteria | 2470 |
| 534 | Ga0495620_0030958 | 3300046515 | Bacteria | 2456 |
| 535 | Ga0495630_0079019 | 3300046517 | Bacteria | 2481 |
| 536 | Ga0495630_0098016 | 3300046517 | Bacteria | 2217 |
| 537 | Ga0495631_0000062 | 3300046518 | Bacteria | 66560 |
| 538 | Ga0495631_0000754 | 3300046518 | Bacteria | 20744 |
| 539 | Ga0495631_0009210 | 3300046518 | Bacteria | 4944 |
| 540 | Ga0495632_0000526 | 3300046519 | Bacteria | 36135 |
| 541 | Ga0495632_0000751 | 3300046519 | Bacteria | 29260 |
| 542 | Ga0495632_0002897 | 3300046519 | Bacteria | 12612 |
| 543 | Ga0495632_0004651 | 3300046519 | Bacteria | 9271 |
| 544 | Ga0495632_0010368 | 3300046519 | Bacteria | 5524 |
| 545 | Ga0495632_0012487 | 3300046519 | Bacteria | 4898 |
| 546 | Ga0495632_0020576 | 3300046519 | Bacteria | 3569 |
| 547 | Ga0495632_0024787 | 3300046519 | Bacteria | 3181 |
| 548 | Ga0495632_0067790 | 3300046519 | Bacteria | 1720 |
| 549 | Ga0495632_0071699 | 3300046519 | Bacteria | 1663 |
| 550 | Ga0495632_0089579 | 3300046519 | Bacteria | 1460 |
| 551 | Ga0495632_0106560 | 3300046519 | Bacteria | 1318 |
| 552 | Ga0495632_0145916 | 3300046519 | Bacteria | 1095 |
| 553 | Ga0495632_0151102 | 3300046519 | Bacteria | 1073 |
| 554 | Ga0495632_0166647 | 3300046519 | Bacteria | 1013 |
| 555 | Ga0495632_0172698 | 3300046519 | Bacteria | 992 |
| 556 | Ga0495637_0000337 | 3300046520 | Bacteria | 36263 |
| 557 | Ga0495637_0000370 | 3300046520 | Bacteria | 33899 |
| 558 | Ga0495637_0001137 | 3300046520 | Bacteria | 16289 |
| 559 | Ga0495637_0001160 | 3300046520 | Bacteria | 16137 |
| 560 | Ga0495637_0002224 | 3300046520 | Bacteria | 10823 |
| 561 | Ga0495637_0005363 | 3300046520 | Bacteria | 6548 |
| 562 | Ga0495637_0017433 | 3300046520 | Bacteria | 3347 |
| 563 | Ga0495637_0021434 | 3300046520 | Bacteria | 2963 |
| 564 | Ga0495637_0047881 | 3300046520 | Bacteria | 1802 |
| 565 | Ga0495637_0049121 | 3300046520 | Bacteria | 1773 |
| 566 | Ga0495637_0050746 | 3300046520 | Bacteria | 1739 |
| 567 | Ga0495637_0062230 | 3300046520 | Bacteria | 1528 |
| 568 | Ga0495643_0001498 | 3300046522 | Bacteria | 21173 |
| 569 | Ga0495643_0001563 | 3300046522 | Bacteria | 20396 |
| 570 | Ga0495643_0054211 | 3300046522 | Bacteria | 2147 |
| 571 | Ga0495643_0061035 | 3300046522 | Bacteria | 2000 |
| 572 | Ga0495643_0062484 | 3300046522 | Bacteria | 1971 |
| 573 | Ga0495643_0097076 | 3300046522 | Bacteria | 1514 |
| 574 | Ga0495643_0106819 | 3300046522 | Bacteria | 1428 |
| 575 | Ga0495643_0158789 | 3300046522 | Bacteria | 1114 |
| 576 | Ga0495643_0189504 | 3300046522 | Bacteria | 994 |
| 577 | Ga0495644_0000203 | 3300046523 | Bacteria | 27983 |
| 578 | Ga0495644_0017602 | 3300046523 | Bacteria | 2732 |
| 579 | Ga0495644_0022179 | 3300046523 | Bacteria | 2420 |
| 580 | Ga0495644_0036870 | 3300046523 | Bacteria | 1844 |
| 581 | Ga0495648_0000912 | 3300046524 | Bacteria | 30826 |
| 582 | Ga0495648_0001556 | 3300046524 | Bacteria | 22411 |
| 583 | Ga0495648_0002985 | 3300046524 | Bacteria | 15173 |
| 584 | Ga0495648_0003261 | 3300046524 | Bacteria | 14374 |
| 585 | Ga0495648_0020384 | 3300046524 | Bacteria | 4624 |
| 586 | Ga0495648_0030426 | 3300046524 | Bacteria | 3569 |
| 587 | Ga0495648_0037455 | 3300046524 | Bacteria | 3116 |
| 588 | Ga0495648_0086293 | 3300046524 | Bacteria | 1770 |
| 589 | Ga0495648_0133393 | 3300046524 | Bacteria | 1317 |
| 590 | Ga0495648_0173387 | 3300046524 | Bacteria | 1103 |
| 591 | Ga0495648_0180560 | 3300046524 | Bacteria | 1073 |
| 592 | Ga0495648_0205503 | 3300046524 | Bacteria | 982 |
| 593 | Ga0495666_0000034 | 3300046526 | Bacteria | 52071 |
| 594 | Ga0495666_0052433 | 3300046526 | Bacteria | 1958 |
| 595 | Ga0495666_0080689 | 3300046526 | Bacteria | 1539 |
| 596 | Ga0495666_0125668 | 3300046526 | Bacteria | 1199 |
| 597 | Ga0495642_0001788 | 3300046528 | Bacteria | 9256 |
| 598 | Ga0495642_0014074 | 3300046528 | Bacteria | 3100 |
| 599 | Ga0495654_0000175 | 3300046530 | Bacteria | 62884 |
| 600 | Ga0495654_0000870 | 3300046530 | Bacteria | 22703 |
| 601 | Ga0495654_0001163 | 3300046530 | Bacteria | 18777 |
| 602 | Ga0495654_0001446 | 3300046530 | Bacteria | 16307 |
| 603 | Ga0495654_0001592 | 3300046530 | Bacteria | 15396 |
| 604 | Ga0495654_0001629 | 3300046530 | Bacteria | 15214 |
| 605 | Ga0495654_0002019 | 3300046530 | Bacteria | 13358 |
| 606 | Ga0495654_0019582 | 3300046530 | Bacteria | 3539 |
| 607 | Ga0495654_0048361 | 3300046530 | Bacteria | 2087 |
| 608 | Ga0495654_0049948 | 3300046530 | Bacteria | 2046 |
| 609 | Ga0495654_0056762 | 3300046530 | Bacteria | 1892 |
| 610 | Ga0495654_0066708 | 3300046530 | Bacteria | 1715 |
| 611 | Ga0495654_0069348 | 3300046530 | Bacteria | 1674 |
| 612 | Ga0495654_0070057 | 3300046530 | Bacteria | 1663 |
| 613 | Ga0495654_0085805 | 3300046530 | Bacteria | 1468 |
| 614 | Ga0495609_0000011 | 3300046538 | Bacteria | 334377 |
| 615 | Ga0495609_0000179 | 3300046538 | Bacteria | 64090 |
| 616 | Ga0495609_0011787 | 3300046538 | Bacteria | 4156 |
| 617 | Ga0495609_0014463 | 3300046538 | Bacteria | 3707 |
| 618 | Ga0495609_0125511 | 3300046538 | Bacteria | 1101 |
| 619 | Ga0495609_0131718 | 3300046538 | Bacteria | 1070 |
| 620 | Ga0495609_0135843 | 3300046538 | Bacteria | 1051 |
| 621 | Ga0495597_0000136 | 3300046542 | Bacteria | 65668 |
| 622 | Ga0495597_0000873 | 3300046542 | Bacteria | 23441 |
| 623 | Ga0495597_0007549 | 3300046542 | Bacteria | 5513 |
| 624 | Ga0495597_0010015 | 3300046542 | Bacteria | 4653 |
| 625 | Ga0495597_0012973 | 3300046542 | Bacteria | 4001 |
| 626 | Ga0495597_0021403 | 3300046542 | Bacteria | 3006 |
| 627 | Ga0495597_0026838 | 3300046542 | Bacteria | 2644 |
| 628 | Ga0495597_0029068 | 3300046542 | Bacteria | 2525 |
| 629 | Ga0495597_0032451 | 3300046542 | Bacteria | 2370 |
| 630 | Ga0495597_0057794 | 3300046542 | Bacteria | 1696 |
| 631 | Ga0495597_0060844 | 3300046542 | Bacteria | 1646 |
| 632 | Ga0495597_0080926 | 3300046542 | Bacteria | 1389 |
| 633 | Ga0495597_0103712 | 3300046542 | Bacteria | 1197 |
| 634 | Ga0495597_0139410 | 3300046542 | Bacteria | 1001 |
| 635 | Ga0495645_0015724 | 3300046543 | Bacteria | 5386 |
| 636 | Ga0495622_0007811 | 3300046557 | Bacteria | 4967 |
| 637 | Ga0495622_0013229 | 3300046557 | Bacteria | 3829 |
| 638 | Ga0495622_0023259 | 3300046557 | Bacteria | 2888 |
| 639 | Ga0495622_0186764 | 3300046557 | Bacteria | 928 |
| 640 | Ga0495633_0000259 | 3300046558 | Bacteria | 62637 |
| 641 | Ga0495633_0008011 | 3300046558 | Bacteria | 6018 |
| 642 | Ga0495633_0117451 | 3300046558 | Bacteria | 1232 |
| 643 | Ga0495656_0174664 | 3300046615 | Bacteria | 1052 |
| 644 | Ga0495668_0001534 | 3300046616 | Bacteria | 21930 |
| 645 | Ga0495668_0001602 | 3300046616 | Bacteria | 21209 |
| 646 | Ga0495668_0013185 | 3300046616 | Bacteria | 4886 |
| 647 | Ga0495668_0078728 | 3300046616 | Bacteria | 1809 |
| 648 | Ga0495668_0140954 | 3300046616 | Bacteria | 1319 |
| 649 | Ga0495668_0174257 | 3300046616 | Bacteria | 1178 |
| 650 | Ga0495634_0018569 | 3300046642 | Bacteria | 4948 |
| 651 | Ga0495611_0000263 | 3300046648 | Bacteria | 36124 |
| 652 | Ga0495611_0016889 | 3300046648 | Bacteria | 3120 |
| 653 | Ga0495611_0027190 | 3300046648 | Bacteria | 2499 |
| 654 | Ga0495611_0036191 | 3300046648 | Bacteria | 2189 |
| 655 | Ga0495611_0051575 | 3300046648 | Bacteria | 1854 |
| 656 | Ga0495611_0173290 | 3300046648 | Bacteria | 1008 |
| 657 | Ga0495625_0030850 | 3300046660 | Bacteria | 3994 |
| 658 | Ga0495625_0048909 | 3300046660 | Bacteria | 3041 |
| 659 | Ga0495625_0051324 | 3300046660 | Bacteria | 2957 |
| 660 | Ga0495625_0097154 | 3300046660 | Bacteria | 2027 |
| 661 | Ga0495625_0233914 | 3300046660 | Bacteria | 1199 |
| 662 | Ga0495625_0236983 | 3300046660 | Bacteria | 1189 |
| 663 | Ga0495625_0272097 | 3300046660 | Bacteria | 1093 |
| 664 | Ga0495635_0001705 | 3300046663 | Bacteria | 14785 |
| 665 | Ga0495659_0001826 | 3300046664 | Bacteria | 7062 |
| 666 | Ga0495659_0095022 | 3300046664 | Bacteria | 1148 |
| 667 | Ga0495661_0002150 | 3300046665 | Bacteria | 15433 |
| 668 | Ga0495661_0002358 | 3300046665 | Bacteria | 14570 |
| 669 | Ga0495661_0030394 | 3300046665 | Bacteria | 3440 |
| 670 | Ga0495661_0043819 | 3300046665 | Bacteria | 2747 |
| 671 | Ga0495661_0047726 | 3300046665 | Bacteria | 2606 |
| 672 | Ga0495661_0060941 | 3300046665 | Bacteria | 2240 |
| 673 | Ga0495661_0091445 | 3300046665 | Bacteria | 1730 |
| 674 | Ga0495661_0104155 | 3300046665 | Bacteria | 1591 |
| 675 | Ga0495661_0121399 | 3300046665 | Bacteria | 1443 |
| 676 | Ga0495661_0174146 | 3300046665 | Bacteria | 1145 |
| 677 | Ga0495661_0257743 | 3300046665 | Unclassified | 887 |
| 678 | Ga0495588_0022571 | 3300046674 | Bacteria | 3110 |
| 679 | Ga0495588_0024478 | 3300046674 | Bacteria | 2999 |
| 680 | Ga0495588_0106267 | 3300046674 | Bacteria | 1477 |
| 681 | Ga0495588_0131295 | 3300046674 | Bacteria | 1321 |
| 682 | Ga0495657_0021750 | 3300046675 | Bacteria | 4601 |
| 683 | Ga0495646_0053160 | 3300046680 | Bacteria | 2443 |
| 684 | Ga0495646_0124184 | 3300046680 | Bacteria | 1458 |
| 685 | Ga0495669_0004597 | 3300046684 | Bacteria | 5717 |
| 686 | Ga0495669_0049326 | 3300046684 | Bacteria | 1884 |
| 687 | Ga0495613_0072239 | 3300046689 | Bacteria | 2515 |
| 688 | Ga0495624_0000102 | 3300046690 | Bacteria | 57805 |
| 689 | Ga0495670_0000113 | 3300046691 | Bacteria | 35889 |
| 690 | Ga0495670_0000264 | 3300046691 | Bacteria | 24433 |
| 691 | Ga0495670_0008881 | 3300046691 | Bacteria | 4945 |
| 692 | Ga0495670_0032866 | 3300046691 | Bacteria | 2580 |
| 693 | Ga0495670_0114576 | 3300046691 | Bacteria | 1397 |
| 694 | Ga0495670_0165470 | 3300046691 | Bacteria | 1163 |
| 695 | Ga0495670_0190087 | 3300046691 | Bacteria | 1085 |
| 696 | Ga0495670_0192276 | 3300046691 | Bacteria | 1079 |
| 697 | Ga0495671_0000876 | 3300046692 | Bacteria | 21476 |
| 698 | Ga0495671_0000967 | 3300046692 | Bacteria | 20117 |
| 699 | Ga0495671_0002006 | 3300046692 | Bacteria | 13088 |
| 700 | Ga0495671_0003790 | 3300046692 | Bacteria | 9193 |
| 701 | Ga0495671_0006136 | 3300046692 | Bacteria | 6975 |
| 702 | Ga0495671_0008399 | 3300046692 | Bacteria | 5813 |
| 703 | Ga0495671_0010630 | 3300046692 | Bacteria | 5091 |
| 704 | Ga0495671_0012274 | 3300046692 | Bacteria | 4682 |
| 705 | Ga0495671_0018094 | 3300046692 | Bacteria | 3746 |
| 706 | Ga0495671_0032742 | 3300046692 | Bacteria | 2652 |
| 707 | Ga0495671_0034909 | 3300046692 | Bacteria | 2555 |
| 708 | Ga0495671_0037792 | 3300046692 | Bacteria | 2440 |
| 709 | Ga0495671_0050253 | 3300046692 | Bacteria | 2076 |
| 710 | Ga0495649_0001677 | 3300046694 | Bacteria | 16452 |
| 711 | Ga0495649_0002935 | 3300046694 | Bacteria | 11776 |
| 712 | Ga0495649_0003481 | 3300046694 | Bacteria | 10609 |
| 713 | Ga0495649_0012462 | 3300046694 | Bacteria | 4942 |
| 714 | Ga0495649_0013802 | 3300046694 | Bacteria | 4649 |
| 715 | Ga0495649_0025651 | 3300046694 | Bacteria | 3282 |
| 716 | Ga0495649_0030551 | 3300046694 | Bacteria | 2975 |
| 717 | Ga0495649_0040719 | 3300046694 | Bacteria | 2542 |
| 718 | Ga0495649_0062270 | 3300046694 | Bacteria | 2005 |
| 719 | Ga0495649_0195230 | 3300046694 | Bacteria | 1052 |
| 720 | Ga0495649_0201748 | 3300046694 | Bacteria | 1032 |
| 721 | Ga0495589_0000160 | 3300046794 | Bacteria | 62225 |
| 722 | Ga0495589_0000787 | 3300046794 | Bacteria | 20118 |
| 723 | Ga0495589_0004639 | 3300046794 | Bacteria | 7304 |
| 724 | Ga0495589_0010382 | 3300046794 | Bacteria | 4838 |
| 725 | Ga0495589_0010720 | 3300046794 | Bacteria | 4764 |
| 726 | Ga0495589_0016016 | 3300046794 | Bacteria | 3852 |
| 727 | Ga0495589_0049095 | 3300046794 | Bacteria | 2088 |
| 728 | Ga0495589_0063628 | 3300046794 | Bacteria | 1809 |
| 729 | Ga0495589_0091107 | 3300046794 | Bacteria | 1480 |
| 730 | Ga0495600_0098192 | 3300046809 | Bacteria | 1909 |
| 731 | Ga0495600_0325208 | 3300046809 | Bacteria | 966 |
| 732 | Ga0495660_0000579 | 3300046810 | Bacteria | 29315 |
| 733 | Ga0495660_0001592 | 3300046810 | Bacteria | 15241 |
| 734 | Ga0495660_0002883 | 3300046810 | Bacteria | 10811 |
| 735 | Ga0495660_0014788 | 3300046810 | Bacteria | 4513 |
| 736 | Ga0495660_0025829 | 3300046810 | Bacteria | 3333 |
| 737 | Ga0495660_0043389 | 3300046810 | Bacteria | 2481 |
| 738 | Ga0495660_0052300 | 3300046810 | Bacteria | 2219 |
| 739 | Ga0495660_0053157 | 3300046810 | Bacteria | 2199 |
| 740 | Ga0495660_0073727 | 3300046810 | Bacteria | 1804 |
| 741 | Ga0495660_0095933 | 3300046810 | Bacteria | 1533 |
| 742 | Ga0495660_0125801 | 3300046810 | Bacteria | 1291 |
| 743 | Ga0495660_0129166 | 3300046810 | Bacteria | 1269 |
| 744 | Ga0495581_0103672 | 3300047315 | Bacteria | 1653 |
| 745 | Ga0495581_0140862 | 3300047315 | Bacteria | 1406 |
| 746 | Ga0495604_0050549 | 3300047317 | Bacteria | 3227 |
| 747 | Ga0495604_0098606 | 3300047317 | Bacteria | 2152 |
| 748 | Ga0495604_0332269 | 3300047317 | Bacteria | 1013 |
| 749 | Ga0495636_0000571 | 3300047318 | Bacteria | 13572 |
| 750 | Ga0495672_0000935 | 3300047320 | Bacteria | 30484 |
| 751 | Ga0495672_0001497 | 3300047320 | Bacteria | 22911 |
| 752 | Ga0495672_0002637 | 3300047320 | Bacteria | 16190 |
| 753 | Ga0495672_0005176 | 3300047320 | Bacteria | 10408 |
| 754 | Ga0495672_0005506 | 3300047320 | Bacteria | 10029 |
| 755 | Ga0495672_0010844 | 3300047320 | Bacteria | 6465 |
| 756 | Ga0495672_0027614 | 3300047320 | Bacteria | 3603 |
| 757 | Ga0495672_0029719 | 3300047320 | Bacteria | 3437 |
| 758 | Ga0495672_0035976 | 3300047320 | Bacteria | 3044 |
| 759 | Ga0495676_0021774 | 3300047321 | Bacteria | 5590 |
| 760 | Ga0495676_0294651 | 3300047321 | Bacteria | 1095 |
| 761 | Ga0495680_0001024 | 3300047322 | Bacteria | 31000 |
| 762 | Ga0495680_0085512 | 3300047322 | Bacteria | 2374 |
| 763 | Ga0495680_0093511 | 3300047322 | Bacteria | 2250 |
| 764 | Ga0495680_0166936 | 3300047322 | Bacteria | 1595 |
| 765 | Ga0495683_0003146 | 3300047323 | Bacteria | 9652 |
| 766 | Ga0495683_0003997 | 3300047323 | Bacteria | 8476 |
| 767 | Ga0495683_0022528 | 3300047323 | Bacteria | 3239 |
| 768 | Ga0495683_0046748 | 3300047323 | Bacteria | 2172 |
| 769 | Ga0495683_0068614 | 3300047323 | Bacteria | 1743 |
| 770 | Ga0495683_0136893 | 3300047323 | Bacteria | 1150 |
| 771 | Ga0495683_0174212 | 3300047323 | Bacteria | 987 |
| 772 | Ga0495687_001039 | 3300047443 | Bacteria | 27582 |
| 773 | Ga0495687_006228 | 3300047443 | Bacteria | 7362 |
| 774 | Ga0495687_008551 | 3300047443 | Bacteria | 5848 |
| 775 | Ga0495687_071088 | 3300047443 | Bacteria | 1395 |
| 776 | Ga0495687_105224 | 3300047443 | Bacteria | 1049 |
| 777 | Ga0495675_0008442 | 3300047444 | Bacteria | 6381 |
| 778 | Ga0495675_0094424 | 3300047444 | Bacteria | 1875 |
| 779 | Ga0495675_0243594 | 3300047444 | Bacteria | 1081 |
| 780 | Ga0495677_0011702 | 3300047445 | Bacteria | 3207 |
| 781 | Ga0495679_000568 | 3300047446 | Bacteria | 25655 |
| 782 | Ga0495679_007324 | 3300047446 | Bacteria | 4614 |
| 783 | Ga0495679_014172 | 3300047446 | Bacteria | 2965 |
| 784 | Ga0495679_018880 | 3300047446 | Bacteria | 2436 |
| 785 | Ga0495679_060912 | 3300047446 | Bacteria | 1106 |
| 786 | Ga0495685_021827 | 3300047447 | Bacteria | 2204 |
| 787 | Ga0495685_022329 | 3300047447 | Bacteria | 2178 |
| 788 | Ga0495673_0000580 | 3300047469 | Bacteria | 36821 |
| 789 | Ga0495673_0000658 | 3300047469 | Bacteria | 33990 |
| 790 | Ga0495673_0002501 | 3300047469 | Bacteria | 12869 |
| 791 | Ga0495673_0002686 | 3300047469 | Bacteria | 12250 |
| 792 | Ga0495673_0003471 | 3300047469 | Bacteria | 10370 |
| 793 | Ga0495673_0004670 | 3300047469 | Bacteria | 8505 |
| 794 | Ga0495673_0011397 | 3300047469 | Bacteria | 4781 |
| 795 | Ga0495673_0011515 | 3300047469 | Bacteria | 4751 |
| 796 | Ga0495673_0023445 | 3300047469 | Bacteria | 3001 |
| 797 | Ga0495673_0027038 | 3300047469 | Bacteria | 2734 |
| 798 | Ga0495673_0037688 | 3300047469 | Bacteria | 2206 |
| 799 | Ga0495673_0052303 | 3300047469 | Bacteria | 1785 |
| 800 | Ga0495673_0057893 | 3300047469 | Bacteria | 1672 |
| 801 | Ga0495673_0060736 | 3300047469 | Bacteria | 1620 |
| 802 | Ga0495673_0067401 | 3300047469 | Bacteria | 1515 |
| 803 | Ga0495673_0098962 | 3300047469 | Bacteria | 1181 |
| 804 | Ga0495673_0102570 | 3300047469 | Bacteria | 1154 |
| 805 | Ga0495673_0120306 | 3300047469 | Bacteria | 1040 |
| 806 | Ga0495681_0000136 | 3300047470 | Bacteria | 63327 |
| 807 | Ga0495681_0000348 | 3300047470 | Bacteria | 36120 |
| 808 | Ga0495681_0001792 | 3300047470 | Bacteria | 15825 |
| 809 | Ga0495681_0003100 | 3300047470 | Bacteria | 11660 |
| 810 | Ga0495681_0003763 | 3300047470 | Bacteria | 10519 |
| 811 | Ga0495681_0009786 | 3300047470 | Bacteria | 5867 |
| 812 | Ga0495681_0010209 | 3300047470 | Bacteria | 5701 |
| 813 | Ga0495681_0020103 | 3300047470 | Bacteria | 3630 |
| 814 | Ga0495681_0024097 | 3300047470 | Bacteria | 3216 |
| 815 | Ga0495681_0037155 | 3300047470 | Bacteria | 2402 |
| 816 | Ga0495681_0043625 | 3300047470 | Bacteria | 2160 |
| 817 | Ga0495681_0062348 | 3300047470 | Bacteria | 1715 |
| 818 | Ga0495681_0064159 | 3300047470 | Bacteria | 1683 |
| 819 | Ga0495681_0075900 | 3300047470 | Bacteria | 1511 |
| 820 | Ga0495681_0087529 | 3300047470 | Bacteria | 1380 |
| 821 | Ga0495681_0101067 | 3300047470 | Bacteria | 1260 |
| 822 | Ga0495681_0106083 | 3300047470 | Bacteria | 1222 |
| 823 | Ga0495681_0117457 | 3300047470 | Bacteria | 1145 |
| 824 | Ga0495684_0014672 | 3300047471 | Bacteria | 6029 |
| 825 | Ga0495686_0000496 | 3300047472 | Bacteria | 57784 |
| 826 | Ga0495686_0079755 | 3300047472 | Bacteria | 2001 |
| 827 | Ga0495686_0174115 | 3300047472 | Bacteria | 1250 |
| 828 | Ga0495593_0007432 | 3300047673 | Bacteria | 6411 |
| 829 | Ga0495593_0111517 | 3300047673 | Bacteria | 1396 |
| 830 | Ga0495593_0146357 | 3300047673 | Bacteria | 1195 |
| 831 | Ga0495602_0000192 | 3300048088 | Bacteria | 57639 |
| 832 | Ga0495626_0001842 | 3300048091 | Bacteria | 15932 |
| 833 | Ga0495626_0002225 | 3300048091 | Bacteria | 13910 |
| 834 | Ga0495626_0003990 | 3300048091 | Bacteria | 9220 |
| 835 | Ga0495626_0006044 | 3300048091 | Bacteria | 6956 |
| 836 | Ga0495626_0007796 | 3300048091 | Bacteria | 5930 |
| 837 | Ga0495626_0008142 | 3300048091 | Bacteria | 5778 |
| 838 | Ga0495626_0009959 | 3300048091 | Bacteria | 5106 |
| 839 | Ga0495626_0014840 | 3300048091 | Bacteria | 4004 |
| 840 | Ga0495626_0026926 | 3300048091 | Bacteria | 2797 |
| 841 | Ga0495626_0029960 | 3300048091 | Bacteria | 2626 |
| 842 | Ga0495626_0116316 | 3300048091 | Bacteria | 1153 |
| 843 | Ga0495626_0124637 | 3300048091 | Bacteria | 1104 |
| 844 | Ga0495626_0126923 | 3300048091 | Bacteria | 1092 |
| 845 | Ga0496102_0637885 | 3300048905 | Bacteria | 988 |
| 846 | Ga0496103_0304275 | 3300048906 | Bacteria | 1026 |
| 847 | Ga0496105_0200914 | 3300048908 | Bacteria | 1627 |
| 848 | Ga0496106_0412491 | 3300048909 | Bacteria | 1085 |
| 849 | Ga0496112_0392400 | 3300048915 | Bacteria | 1328 |
| 850 | Ga0496116_0000417 | 3300048919 | Bacteria | 60205 |
| 851 | Ga0496116_0012807 | 3300048919 | Bacteria | 6814 |
| 852 | Ga0496116_0021462 | 3300048919 | Bacteria | 4870 |
| 853 | Ga0496117_0002190 | 3300048920 | Bacteria | 25452 |
| 854 | Ga0496117_0002337 | 3300048920 | Bacteria | 24254 |
| 855 | Ga0496117_0003824 | 3300048920 | Bacteria | 17124 |
| 856 | Ga0496117_0014732 | 3300048920 | Bacteria | 6713 |
| 857 | Ga0496117_0014891 | 3300048920 | Bacteria | 6670 |
| 858 | Ga0496117_0047930 | 3300048920 | Bacteria | 3058 |
| 859 | Ga0496117_0117331 | 3300048920 | Bacteria | 1643 |
| 860 | Ga0496117_0143188 | 3300048920 | Bacteria | 1428 |
| 861 | Ga0496118_0002512 | 3300048921 | Bacteria | 24623 |
| 862 | Ga0496118_0002580 | 3300048921 | Bacteria | 24199 |
| 863 | Ga0496118_0013049 | 3300048921 | Bacteria | 7899 |
| 864 | Ga0496118_0024093 | 3300048921 | Bacteria | 5264 |
| 865 | Ga0496118_0025410 | 3300048921 | Bacteria | 5080 |
| 866 | Ga0496118_0070527 | 3300048921 | Bacteria | 2522 |
| 867 | Ga0496118_0130562 | 3300048921 | Bacteria | 1614 |
| 868 | Ga0496118_0160551 | 3300048921 | Bacteria | 1390 |
| 869 | Ga0496118_0182845 | 3300048921 | Bacteria | 1264 |
| 870 | Ga0496119_0035763 | 3300048922 | Bacteria | 3249 |
| 871 | Ga0496119_0054063 | 3300048922 | Bacteria | 2448 |
| 872 | Ga0496119_0178478 | 3300048922 | Bacteria | 1115 |
| 873 | Ga0496120_0011144 | 3300048923 | Bacteria | 6203 |
| 874 | Ga0496120_0029254 | 3300048923 | Bacteria | 3365 |
| 875 | Ga0496120_0047416 | 3300048923 | Bacteria | 2477 |
| 876 | Ga0496121_0001921 | 3300048924 | Bacteria | 33178 |
| 877 | Ga0496121_0003088 | 3300048924 | Bacteria | 24103 |
| 878 | Ga0496121_0003360 | 3300048924 | Bacteria | 22946 |
| 879 | Ga0496121_0055292 | 3300048924 | Bacteria | 3308 |
| 880 | Ga0496121_0065026 | 3300048924 | Bacteria | 2970 |
| 881 | Ga0496121_0115530 | 3300048924 | Bacteria | 2037 |
| 882 | Ga0496121_0120428 | 3300048924 | Bacteria | 1983 |
| 883 | Ga0496122_0017317 | 3300048925 | Bacteria | 6747 |
| 884 | Ga0496122_0017591 | 3300048925 | Bacteria | 6670 |
| 885 | Ga0496122_0045825 | 3300048925 | Bacteria | 3393 |
| 886 | Ga0496122_0070415 | 3300048925 | Bacteria | 2499 |
| 887 | Ga0496122_0076630 | 3300048925 | Bacteria | 2352 |
| 888 | Ga0496122_0155013 | 3300048925 | Bacteria | 1407 |
| 889 | Ga0496122_0270523 | 3300048925 | Bacteria | 936 |
| 890 | Ga0496123_0004248 | 3300048926 | Bacteria | 15254 |
| 891 | Ga0496123_0022547 | 3300048926 | Bacteria | 4848 |
| 892 | Ga0496123_0027311 | 3300048926 | Bacteria | 4253 |
| 893 | Ga0496123_0041417 | 3300048926 | Bacteria | 3193 |
| 894 | Ga0496123_0161059 | 3300048926 | Bacteria | 1196 |
| 895 | Ga0496124_0005034 | 3300048927 | Bacteria | 15106 |
| 896 | Ga0496124_0075088 | 3300048927 | Bacteria | 2793 |
| 897 | Ga0496124_0310385 | 3300048927 | Bacteria | 1134 |
| 898 | Ga0496124_0330401 | 3300048927 | Bacteria | 1087 |
| 899 | Ga0496124_0407446 | 3300048927 | Bacteria | 942 |
| 900 | Ga0496125_0002268 | 3300048928 | Bacteria | 25521 |
| 901 | Ga0496125_0002804 | 3300048928 | Bacteria | 22019 |
| 902 | Ga0496125_0004817 | 3300048928 | Bacteria | 15339 |
| 903 | Ga0496125_0004927 | 3300048928 | Bacteria | 15113 |
| 904 | Ga0496125_0053047 | 3300048928 | Bacteria | 3328 |
| 905 | Ga0496125_0079771 | 3300048928 | Bacteria | 2508 |
| 906 | Ga0496125_0143129 | 3300048928 | Bacteria | 1658 |
| 907 | Ga0496125_0149714 | 3300048928 | Bacteria | 1605 |
| 908 | Ga0496126_0002601 | 3300048929 | Bacteria | 24059 |
| 909 | Ga0496126_0036309 | 3300048929 | Bacteria | 4608 |
| 910 | Ga0496126_0059431 | 3300048929 | Bacteria | 3442 |
| 911 | Ga0495678_000302 | 3300049459 | Bacteria | 53782 |
| 912 | Ga0495678_001297 | 3300049459 | Bacteria | 20187 |
| 913 | Ga0495678_001533 | 3300049459 | Bacteria | 17839 |
| 914 | Ga0495678_002893 | 3300049459 | Bacteria | 11060 |
| 915 | Ga0495678_003059 | 3300049459 | Bacteria | 10618 |
| 916 | Ga0495678_004731 | 3300049459 | Bacteria | 7764 |
| 917 | Ga0495678_014010 | 3300049459 | Bacteria | 3741 |
| 918 | Ga0495678_016692 | 3300049459 | Bacteria | 3348 |
| 919 | Ga0495678_026599 | 3300049459 | Bacteria | 2466 |
| 920 | Ga0495678_054127 | 3300049459 | Bacteria | 1537 |
| 921 | Ga0495678_100794 | 3300049459 | Bacteria | 1000 |
| 922 | Ga0495682_0000165 | 3300049460 | Bacteria | 55934 |
| 923 | Ga0495682_0004900 | 3300049460 | Bacteria | 5640 |
| 924 | Ga0495682_0008364 | 3300049460 | Bacteria | 4078 |
| 925 | Ga0495682_0014357 | 3300049460 | Bacteria | 3005 |
| 926 | Ga0495682_0016454 | 3300049460 | Bacteria | 2799 |
| 927 | Ga0495682_0024270 | 3300049460 | Bacteria | 2261 |
| 928 | Ga0495682_0055594 | 3300049460 | Bacteria | 1435 |
| 929 | Ga0495682_0055965 | 3300049460 | Bacteria | 1430 |
| 930 | Ga0495682_0086614 | 3300049460 | Bacteria | 1125 |
| 931 | Ga0501241_000272 | 3300049758 | Bacteria | 11417 |
| 932 | nmdc:mga03683_33674_c1 | 3300050489 | Bacteria | 2070 |
| 933 | nmdc:mga03683_87115_c1 | 3300050489 | Bacteria | 1357 |
| 934 | nmdc:mga00v17_138705_c1 | 3300050491 | Bacteria | 1558 |
| 935 | nmdc:mga00v17_142582_c1 | 3300050491 | Bacteria | 1537 |
| 936 | nmdc:mga00v17_318003_c1 | 3300050491 | Bacteria | 1011 |
| 937 | nmdc:mga08x19_108206_c1 | 3300050514 | Bacteria | 1851 |
| 938 | Ga0500572_066664 | 3300053111 | Bacteria | 1104 |
| 939 | Ga0500568_0095324 | 3300053139 | Bacteria | 1120 |
| 940 | Ga0500634_0000380 | 3300053161 | Bacteria | 14216 |
| 941 | 3007513278 | 3007511990 | Bacteria | 6481491 |
| 942 | 2511258037 | 2511231004 | Bacteria | 6669789 |
| 943 | 2511263335 | 2511231006 | Bacteria | 6794709 |
| 944 | 2511274904 | 2511231007 | Bacteria | 6306603 |
| 945 | 2511290940 | 2511231010 | Bacteria | 6373152 |
| 946 | 2511298436 | 2511231011 | Bacteria | 6149768 |
| 947 | 2511301415 | 2511231012 | Bacteria | 6738011 |
| 948 | 2511314192 | 2511231014 | Bacteria | 6462302 |
| 949 | 2511320886 | 2511231015 | Bacteria | 6598026 |
| 950 | 2511324687 | 2511231016 | Bacteria | 6704427 |
| 951 | 2511342924 | 2511231019 | Bacteria | 6520662 |
| 952 | 2511363855 | 2511231022 | Bacteria | 6719296 |
| 953 | 2511369199 | 2511231023 | Bacteria | 6808468 |
| 954 | 2511414998 | 2511231031 | Bacteria | 6558529 |
| 955 | 2511825986 | 2511231156 | Bacteria | 6845832 |
| 956 | 2512326922 | 2512047018 | Bacteria | 6663241 |
| 957 | 2555668925 | 2554235341 | Bacteria | 6867980 |
| 958 | 2583793528 | 2582580891 | Bacteria | 6800976 |
| 959 | 2597857114 | 2597489887 | Bacteria | 6666321 |
| 960 | 2597865243 | 2597489888 | Bacteria | 6179543 |
| 961 | 2597871097 | 2597489889 | Bacteria | 6297495 |
| 962 | 2599357282 | 2599185160 | Bacteria | 6844013 |
| 963 | 2599361906 | 2599185161 | Bacteria | 6960462 |
| 964 | 2599368227 | 2599185162 | Bacteria | 6957254 |
| 965 | 2599375016 | 2599185163 | Bacteria | 6995158 |
| 966 | 2599382387 | 2599185164 | Bacteria | 6841688 |
| 967 | 2599388834 | 2599185165 | Bacteria | 6843250 |
| 968 | 2599393874 | 2599185166 | Bacteria | 6959206 |
| 969 | 2599400380 | 2599185167 | Bacteria | 6353609 |
| 970 | 2599405639 | 2599185168 | Bacteria | 6997636 |
| 971 | 2599451292 | 2599185179 | Bacteria | 6611171 |
| 972 | 2599464217 | 2599185181 | Bacteria | 6844519 |
| 973 | 2599468513 | 2599185182 | Bacteria | 6883168 |
| 974 | 2599484136 | 2599185185 | Bacteria | 6652270 |
| 975 | 2599493236 | 2599185186 | Bacteria | 6831633 |
| 976 | 2599504613 | 2599185188 | Bacteria | 6164180 |
| 977 | 2599508613 | 2599185189 | Bacteria | 5862825 |
| 978 | 2599512467 | 2599185190 | Bacteria | 6285678 |
| 979 | 2599519813 | 2599185191 | Bacteria | 6297582 |
| 980 | 2599611453 | 2599185212 | Bacteria | 6765997 |
| 981 | 2599770437 | 2599185248 | Bacteria | 6696816 |
| 982 | 2599801787 | 2599185257 | Bacteria | 6492581 |
| 983 | 2599878588 | 2599185288 | Bacteria | 6666191 |
| 984 | 2599889550 | 2599185289 | Bacteria | 6778765 |
| 985 | 2599891143 | 2599185290 | Bacteria | 6289611 |
| 986 | 2599901078 | 2599185291 | Bacteria | 6775623 |
| 987 | 2599934937 | 2599185300 | Bacteria | 6062622 |
| 988 | 2599947791 | 2599185303 | Bacteria | 6512725 |
| 989 | 2599952823 | 2599185304 | Bacteria | 5951361 |
| 990 | 2599963138 | 2599185305 | Bacteria | 6748700 |
| 991 | 2599968718 | 2599185306 | Bacteria | 6637356 |
| 992 | 2599976975 | 2599185308 | Bacteria | 6621546 |
| 993 | 2599981826 | 2599185309 | Bacteria | 5969593 |
| 994 | 2599987735 | 2599185310 | Bacteria | 6014457 |
| 995 | 2599995226 | 2599185311 | Bacteria | 6354990 |
| 996 | 2599998373 | 2599185312 | Bacteria | 5912071 |
| 997 | 2600005566 | 2599185313 | Bacteria | 6658188 |
| 998 | 2600011144 | 2599185314 | Bacteria | 6621749 |
| 999 | 2600019965 | 2599185315 | Bacteria | 6771107 |
| 1000 | 2600022441 | 2599185316 | Bacteria | 6320029 |
| 1001 | 2600027461 | 2599185317 | Bacteria | 6435722 |
| 1002 | 2600034233 | 2599185318 | Bacteria | 6961590 |
| 1003 | 2600039741 | 2599185319 | Bacteria | 6637840 |
| 1004 | 2600046065 | 2599185320 | Bacteria | 5963263 |
| 1005 | 2600054610 | 2599185321 | Bacteria | 6764560 |
| 1006 | 2600057401 | 2599185322 | Bacteria | 6763055 |
| 1007 | 2600064579 | 2599185323 | Bacteria | 6688755 |
| 1008 | 2600072261 | 2599185324 | Bacteria | 6590677 |
| 1009 | 2600075716 | 2599185325 | Bacteria | 6324919 |
| 1010 | 2600216492 | 2599185356 | Bacteria | 6843884 |
| 1011 | 2600356830 | 2600254930 | Bacteria | 6431253 |
| 1012 | 2600365528 | 2600254931 | Bacteria | 6734225 |
| 1013 | 2601689504 | 2600255296 | Bacteria | 5784754 |
| 1014 | 2601776915 | 2600255313 | Bacteria | 6842543 |
| 1015 | 2601795754 | 2600255318 | Bacteria | 6383414 |
| 1016 | 2606075399 | 2603880185 | Bacteria | 6379190 |
| 1017 | 2606128262 | 2603880199 | Bacteria | 6377649 |
| 1018 | 2621298205 | 2619619299 | Bacteria | 6649820 |
| 1019 | 2624479692 | 2623620443 | Bacteria | 6427864 |
| 1020 | 2624493294 | 2623620446 | Bacteria | 6500345 |
| 1021 | 2643846292 | 2643221565 | Bacteria | 6216018 |
| 1022 | 2643869353 | 2643221571 | Bacteria | 6228673 |
| 1023 | 2643952813 | 2643221589 | Bacteria | 6250934 |
| 1024 | 2644022575 | 2643221602 | Bacteria | 6249926 |
| 1025 | 2644188788 | 2643221633 | Bacteria | 6733554 |
| 1026 | 2644286799 | 2643221650 | Bacteria | 7029547 |
| 1027 | 2644622076 | 2643221713 | Bacteria | 6554480 |
| 1028 | 2652546902 | 2651869719 | Bacteria | 6047974 |
| 1029 | 2671093724 | 2667528170 | Bacteria | 6786960 |
| 1030 | 2671098545 | 2667528171 | Bacteria | 6900659 |
| 1031 | 2671126171 | 2667528176 | Bacteria | 6724917 |
| 1032 | 2671768736 | 2671180172 | Bacteria | 6495783 |
| 1033 | 2677900026 | 2675903420 | Bacteria | 6247433 |
| 1034 | 2678262751 | 2675903515 | Bacteria | 6580491 |
| 1035 | 2715753328 | 2713897148 | Bacteria | 5883533 |
| 1036 | 2715757961 | 2713897149 | Bacteria | 6506249 |
| 1037 | 2723249997 | 2721755607 | Bacteria | 5841722 |
| 1038 | 2738671412 | 2738541265 | Bacteria | 6594665 |
| 1039 | 2738749806 | 2738541282 | Bacteria | 6593925 |
| 1040 | 2738808327 | 2738541294 | Bacteria | 6925949 |
| 1041 | 2738858846 | 2738541303 | Bacteria | 6591772 |
| 1042 | 2738895687 | 2738541309 | Bacteria | 6926455 |
| 1043 | 2739201406 | 2738543004 | Bacteria | 6381073 |
| 1044 | 2739259554 | 2738543015 | Bacteria | 6750701 |
| 1045 | 2739315634 | 2738543025 | Bacteria | 6600348 |
| 1046 | 2743736534 | 2740892503 | Bacteria | 6855563 |
| 1047 | 2745009089 | 2744054620 | Bacteria | 6551379 |
| 1048 | 2774121102 | 2773857670 | Bacteria | 6407454 |
| 1049 | 2774135354 | 2773857673 | Bacteria | 6513460 |
| 1050 | 2784265395 | 2784132063 | Bacteria | 6262788 |
| 1051 | 2784314176 | 2784132072 | Bacteria | 6596533 |
| 1052 | 2794598229 | 2791355520 | Bacteria | 5948615 |
| 1053 | 2808854455 | 2808606361 | Bacteria | 6136259 |
| 1054 | 2808926628 | 2808606376 | Bacteria | 6248667 |
| 1055 | 2808927621 | 2808606377 | Bacteria | 6646337 |
| 1056 | 2808934535 | 2808606378 | Bacteria | 6177535 |
| 1057 | 2808948795 | 2808606380 | Bacteria | 6248705 |
| 1058 | 2808949839 | 2808606381 | Bacteria | 6646461 |
| 1059 | 2808957902 | 2808606382 | Bacteria | 6841132 |
| 1060 | 2808962960 | 2808606383 | Bacteria | 6138645 |
| 1061 | 2808977953 | 2808606385 | Bacteria | 6711065 |
| 1062 | 2808993433 | 2808606388 | Bacteria | 6706662 |
| 1063 | 2808997623 | 2808606389 | Bacteria | 6138126 |
| 1064 | 2817492652 | 2816332298 | Bacteria | 6852809 |
| 1065 | 2819657495 | 2818991456 | Bacteria | 6123676 |
| 1066 | 2819703624 | 2818991464 | Bacteria | 6907494 |
| 1067 | 2825652888 | 2825651385 | Bacteria | 6715909 |
| 1068 | 2834031743 | 2834028612 | Bacteria | 6354979 |
| 1069 | 2842827534 | 2842826826 | Bacteria | 5974129 |
| 1070 | 2842832431 | 2842832357 | Bacteria | 5959113 |
| 1071 | 2842841358 | 2842837860 | Bacteria | 6066181 |
| 1072 | 2842848589 | 2842843487 | Bacteria | 6004777 |
| 1073 | 2842857463 | 2842854478 | Bacteria | 6143501 |
| 1074 | 2844669413 | 2844665904 | Bacteria | 6817974 |
| 1075 | 2852612975 | 2852612431 | Bacteria | 6885235 |
| 1076 | 2852659182 | 2852657418 | Bacteria | 6472974 |
| 1077 | 2852669290 | 2852667396 | Bacteria | 6885555 |
| 1078 | 2878031702 | 2878029506 | Bacteria | 6418441 |
| 1079 | 2880232574 | 2880230671 | Bacteria | 6140320 |
| 1080 | 2904524045 | 2904518522 | Bacteria | 6068986 |
| 1081 | 2904552653 | 2904550169 | Bacteria | 6221258 |
| 1082 | 2908451154 | 2908446538 | Bacteria | 6829095 |
| 1083 | 2913038726 | 2913036834 | Bacteria | 6704877 |
| 1084 | 2917072713 | 2917070673 | Bacteria | 6868303 |
| 1085 | 2919068176 | 2919063839 | Bacteria | 6302690 |
| 1086 | 2919386675 | 2919385768 | Bacteria | 5897293 |
| 1087 | 2919456845 | 2919456309 | Bacteria | 6586567 |
| 1088 | 2919482000 | 2919481497 | Bacteria | 6907839 |
| 1089 | 2919493095 | 2919487758 | Bacteria | 5929766 |
| 1090 | 2919530425 | 2919527303 | Bacteria | 7718827 |
| 1091 | 2919699431 | 2919697872 | Bacteria | 6553725 |
| 1092 | 2923155548 | 2923153595 | Bacteria | 6870622 |
| 1093 | 2923587131 | 2923586266 | Bacteria | 6565975 |
| 1094 | 2929146179 | 2929144301 | Bacteria | 6622272 |
| 1095 | 2929193818 | 2929189879 | Bacteria | 5930554 |
| 1096 | 2931370453 | 2931369376 | Bacteria | 6847892 |
| 1097 | 2931395118 | 2931390751 | Bacteria | 6273349 |
| 1098 | 2931400347 | 2931396565 | Bacteria | 7251677 |
| 1099 | 2935354876 | 2935353572 | Unclassified | 6955622 |
| 1100 | 2939639495 | 2939636861 | Bacteria | 6297853 |
| 1101 | 2945962005 | 2945961074 | Bacteria | 7342064 |
| 1102 | 2946008373 | 2946006987 | Bacteria | 6705746 |
| 1103 | 2946032255 | 2946027586 | Bacteria | 6049274 |
| 1104 | 2947239077 | 2947233263 | Bacteria | 6439278 |
| 1105 | 2969306492 | 2969304461 | Bacteria | 6601805 |
| 1106 | 2974291813 | 2974289157 | Bacteria | 6080362 |
| 1107 | 2984290475 | 2984286254 | Bacteria | 6702062 |
| 1108 | 2988733704 | 2988728565 | Bacteria | 6124362 |
| 1109 | 2998141886 | 2998139840 | Bacteria | 6073514 |
| 1110 | 3007401087 | 3007395558 | Bacteria | 6755444 |
| 1111 | 3007424214 | 3007419365 | Bacteria | 7026924 |
| 1112 | 3007617377 | 3007614139 | Bacteria | 6053559 |
| 1113 | 3007720760 | 3007718800 | Bacteria | 5971527 |
| 1114 | 3007860742 | 3007855910 | Bacteria | 5637581 |
| 1115 | 3007862886 | 3007861166 | Bacteria | 6045338 |
| 1116 | 637319267 | 637000220 | Bacteria | 7074893 |
| 1117 | 8015689771 | 8015687852 | Bacteria | 6613826 |
| 1118 | 8019772856 | 8019769354 | Bacteria | 6924660 |
| 1119 | 8019776297 | 8019775933 | Bacteria | 6858656 |
| 1120 | 8029998813 | 8029995093 | Bacteria | 5990776 |
| 1121 | 8054285522 | 8054285046 | Bacteria | 6919322 |
| 1122 | 8054350636 | 8054347763 | Bacteria | 5901107 |
| 1123 | 8055772911 | 8055770955 | Bacteria | 6827675 |
| 1124 | 8055822553 | 8055817908 | Bacteria | 6609162 |
| 1125 | 8056127806 | 8056125926 | Bacteria | 6228218 |
| 1126 | 8056145118 | 8056143049 | Bacteria | 6307666 |
| 1127 | 8056150330 | 8056148874 | Bacteria | 6479865 |
| 1128 | 8056156566 | 8056155041 | Bacteria | 6486948 |
| 1129 | 8056169113 | 8056166840 | Bacteria | 5820959 |
| 1130 | 8056175261 | 8056172158 | Bacteria | 6133900 |
| 1131 | 8056183650 | 8056177738 | Bacteria | 6748268 |
| 1132 | 8056571608 | 8056569372 | Bacteria | 5997322 |
| 1133 | 8057799336 | 8057798959 | Bacteria | 6713499 |
| 1134 | MRS2a_Contig_7 | |||
| 1135 | SwRhRL2b_contig_3586591 | |||
| 1136 | JGI24739J22299_10033415 | |||
| 1137 | JGI25162J39368_1000667 | |||
| 1138 | JGI25162J39368_1000717 | |||
| 1139 | JGI25154J39366_1003793 | |||
| 1140 | JGI25163J39215_1000323 | |||
| 1141 | JGI25163J39215_1002068 | |||
| 1142 | JGI25164J39214_1000414 | |||
| 1143 | JGI25164J39214_1000434 | |||
| 1144 | JGI25165J46597_1000779 | |||
| 1145 | JGI25165J46597_1000834 | |||
| 1146 | rootH2_10015044 | |||
| 1147 | rootL2_10045930 | |||
| 1148 | rootH1_10179446 | |||
| 1149 | Ga0055538_1000027 | |||
| 1150 | Ga0055539_1000036 | |||
| 1151 | Ga0055533_1000046 | |||
| 1152 | Ga0055532_1000032 | |||
| 1153 | Ga0055532_1000439 | |||
| 1154 | Ga0055532_1001883 | |||
| 1155 | Ga0055532_1001900 | |||
| 1156 | Ga0055525_1000217 | |||
| 1157 | Ga0055527_1000247 | |||
| 1158 | Ga0055535_1000723 | |||
| 1159 | Ga0055535_1000812 | |||
| 1160 | Ga0055542_1000817 | |||
| 1161 | Ga0055542_1001638 | |||
| 1162 | Ga0055529_1000700 | |||
| 1163 | Ga0055536_1000464 | |||
| 1164 | Ga0055536_1000612 | |||
| 1165 | Ga0055536_1000725 | |||
| 1166 | Ga0055528_1002070 | |||
| 1167 | Ga0055530_10001093 | |||
| 1168 | Ga0055530_10005853 | |||
| 1169 | Ga0055540_1000124 | |||
| 1170 | Ga0055540_1000839 | |||
| 1171 | Ga0055540_1000934 | |||
| 1172 | Ga0055531_10001619 | |||
| 1173 | Ga0055541_1000024 | |||
| 1174 | Ga0065714_10001070 | |||
| 1175 | Ga0065714_10004819 | |||
| 1176 | Ga0065714_10005124 | |||
| 1177 | Ga0065714_10012241 | |||
| 1178 | Ga0065714_10067363 | |||
| 1179 | Ga0065714_10068391 | |||
| 1180 | Ga0065714_10072920 | |||
| 1181 | Ga0065714_10112504 | |||
| 1182 | Ga0065704_10021132 | |||
| 1183 | Ga0065704_10106401 | |||
| 1184 | Ga0065712_10002774 | |||
| 1185 | Ga0065712_10070818 | |||
| 1186 | Ga0070670_100005473 | |||
| 1187 | Ga0070661_100000008 | |||
| 1188 | Ga0070661_100112392 | |||
| 1189 | Ga0070669_100000579 | |||
| 1190 | Ga0070669_100377950 | |||
| 1191 | Ga0070662_100000388 | |||
| 1192 | Ga0068853_100005522 | |||
| 1193 | Ga0070665_100154479 | |||
| 1194 | Ga0070664_100000028 | |||
| 1195 | Ga0070664_100139919 | |||
| 1196 | Ga0068851_10000068 | |||
| 1197 | Ga0075364_10112888 | |||
| 1198 | Ga0075432_10011936 | |||
| 1199 | Ga0075432_10015402 | |||
| 1200 | Ga0075432_10020176 | |||
| 1201 | Ga0075362_10034749 | |||
| 1202 | Ga0075436_100279908 | |||
| 1203 | Ga0079104_1001782 | |||
| 1204 | Ga0079104_1014625 | |||
| 1205 | Ga0099826_10017518 | |||
| 1206 | Ga0105251_10002352 | |||
| 1207 | Ga0105251_10010653 | |||
| 1208 | Ga0105251_10016153 | |||
| 1209 | Ga0105251_10030040 | |||
| 1210 | Ga0105251_10034152 | |||
| 1211 | Ga0105251_10053190 | |||
| 1212 | Ga0105244_10004336 | |||
| 1213 | Ga0105244_10008243 | |||
| 1214 | Ga0105244_10010228 | |||
| 1215 | Ga0105244_10016009 | |||
| 1216 | Ga0105244_10035566 | |||
| 1217 | Ga0105244_10038662 | |||
| 1218 | Ga0105244_10058153 | |||
| 1219 | Ga0105244_10065236 | |||
| 1220 | Ga0105244_10080225 | |||
| 1221 | Ga0105244_10087377 | |||
| 1222 | Ga0105244_10158658 | |||
| 1223 | Ga0105250_10000514 | |||
| 1224 | Ga0105250_10001741 | |||
| 1225 | Ga0105250_10003382 | |||
| 1226 | Ga0105250_10040031 | |||
| 1227 | Ga0105250_10056936 | |||
| 1228 | Ga0105250_10064086 | |||
| 1229 | Ga0105243_10000161 | |||
| 1230 | Ga0105243_10091004 | |||
| 1231 | Ga0105242_10000024 | |||
| 1232 | Ga0105237_10000180 | |||
| 1233 | Ga0105237_10343814 | |||
| 1234 | Ga0105246_10002400 | |||
| 1235 | Ga0105246_10005198 | |||
| 1236 | Ga0105246_10027063 | |||
| 1237 | Ga0105246_10131854 | |||
| 1238 | Ga0157345_1000011 | |||
| 1239 | Ga0157373_10000846 | |||
| 1240 | Ga0157373_10001211 | |||
| 1241 | Ga0157373_10003711 | |||
| 1242 | Ga0157373_10020125 | |||
| 1243 | Ga0157373_10023404 | |||
| 1244 | Ga0157373_10184328 | |||
| 1245 | Ga0157373_10493844 | |||
| 1246 | Ga0157371_10000714 | |||
| 1247 | Ga0157371_10005454 | |||
| 1248 | Ga0157371_10298822 | |||
| 1249 | Ga0157370_10056938 | |||
| 1250 | Ga0157370_10113607 | |||
| 1251 | Ga0157369_10002767 | |||
| 1252 | Ga0157369_10011208 | |||
| 1253 | Ga0157369_10014989 | |||
| 1254 | Ga0157369_10255634 | |||
| 1255 | Ga0157369_10323682 | |||
| 1256 | Ga0157369_10333299 | |||
| 1257 | Ga0157369_10384058 | |||
| 1258 | Ga0163162_10000385 | |||
| 1259 | Ga0163162_10411865 | |||
| 1260 | Ga0157372_10002200 | |||
| 1261 | Ga0157375_10009788 | |||
| 1262 | Ga0157375_10086362 | |||
| 1263 | Ga0157375_10564933 | |||
| 1264 | Ga0182008_10002026 | |||
| 1265 | Ga0182008_10009343 | |||
| 1266 | Ga0182008_10016696 | |||
| 1267 | Ga0182008_10024290 | |||
| 1268 | Ga0182008_10027518 | |||
| 1269 | Ga0182008_10032189 | |||
| 1270 | Ga0182008_10042038 | |||
| 1271 | Ga0182008_10238580 | |||
| 1272 | Ga0182006_1000750 | |||
| 1273 | Ga0182006_1003202 | |||
| 1274 | Ga0182006_1006820 | |||
| 1275 | Ga0182006_1007061 | |||
| 1276 | Ga0182006_1013936 | |||
| 1277 | Ga0182006_1033408 | |||
| 1278 | Ga0182007_10001015 | |||
| 1279 | Ga0182007_10002499 | |||
| 1280 | Ga0182007_10091466 | |||
| 1281 | Ga0182005_1001933 | |||
| 1282 | Ga0182005_1002471 | |||
| 1283 | Ga0182005_1006843 | |||
| 1284 | Ga0182005_1009726 | |||
| 1285 | Ga0182005_1013357 | |||
| 1286 | Ga0182005_1015696 | |||
| 1287 | Ga0163161_10000618 | |||
| 1288 | Ga0163161_10002540 | |||
| 1289 | Ga0163161_10004603 | |||
| 1290 | Ga0163161_10004684 | |||
| 1291 | Ga0163161_10007942 | |||
| 1292 | Ga0163161_10047067 | |||
| 1293 | Ga0163161_10128667 | |||
| 1294 | Ga0163161_10314028 | |||
| 1295 | Ga0163161_10316714 | |||
| 1296 | Ga0163161_10361071 | |||
| 1297 | Ga0209760_100130 | |||
| 1298 | Ga0209760_100143 | |||
| 1299 | Ga0209784_100017 | |||
| 1300 | Ga0209566_100014 | |||
| 1301 | Ga0209674_100028 | |||
| 1302 | Ga0209672_100067 | |||
| 1303 | Ga0209672_100079 | |||
| 1304 | Ga0209147_100012 | |||
| 1305 | Ga0209147_100038 | |||
| 1306 | Ga0209147_100061 | |||
| 1307 | Ga0209147_100107 | |||
| 1308 | Ga0209563_100032 | |||
| 1309 | Ga0209563_102640 | |||
| 1310 | Ga0207427_100001 | |||
| 1311 | Ga0207427_100008 | |||
| 1312 | Ga0209437_100003 | |||
| 1313 | Ga0209437_100014 | |||
| 1314 | Ga0209437_103726 | |||
| 1315 | Ga0209258_100107 | |||
| 1316 | Ga0209258_100197 | |||
| 1317 | Ga0209258_100273 | |||
| 1318 | Ga0209646_1000903 | |||
| 1319 | Ga0209677_100018 | |||
| 1320 | Ga0209148_1000022 | |||
| 1321 | Ga0209148_1000593 | |||
| 1322 | Ga0209759_1002079 | |||
| 1323 | Ga0209759_1007542 | |||
| 1324 | Ga0209233_1000007 | |||
| 1325 | Ga0209233_1000008 | |||
| 1326 | Ga0209455_1000024 | |||
| 1327 | Ga0209455_1000935 | |||
| 1328 | Ga0209673_1000021 | |||
| 1329 | Ga0209675_1026439 | |||
| 1330 | Ga0209676_1000021 | |||
| 1331 | Ga0209676_1000055 | |||
| 1332 | Ga0209676_1000127 | |||
| 1333 | Ga0209050_1000009 | |||
| 1334 | Ga0209050_1000120 | |||
| 1335 | Ga0209050_1000395 | |||
| 1336 | Ga0209050_1000972 | |||
| 1337 | Ga0209051_1000008 | |||
| 1338 | Ga0209051_1000083 | |||
| 1339 | Ga0209051_1000745 | |||
| 1340 | Ga0209051_1021928 | |||
| 1341 | Ga0209257_1000175 | |||
| 1342 | Ga0209257_1007669 | |||
| 1343 | Ga0207656_10000089 | |||
| 1344 | Ga0207696_1000025 | |||
| 1345 | Ga0207696_1000043 | |||
| 1346 | Ga0207696_1005252 | |||
| 1347 | Ga0207696_1012776 | |||
| 1348 | Ga0207655_1000035 | |||
| 1349 | Ga0207655_1000095 | |||
| 1350 | Ga0207655_1000187 | |||
| 1351 | Ga0207655_1003312 | |||
| 1352 | Ga0207655_1003631 | |||
| 1353 | Ga0207655_1008110 | |||
| 1354 | Ga0207655_1016024 | |||
| 1355 | Ga0207655_1039244 | |||
| 1356 | Ga0207655_1100820 | |||
| 1357 | Ga0207713_1000176 | |||
| 1358 | Ga0207713_1000365 | |||
| 1359 | Ga0207713_1001669 | |||
| 1360 | Ga0207713_1002544 | |||
| 1361 | Ga0207713_1004705 | |||
| 1362 | Ga0207713_1005992 | |||
| 1363 | Ga0207713_1007047 | |||
| 1364 | Ga0207713_1009077 | |||
| 1365 | Ga0207713_1012309 | |||
| 1366 | Ga0207713_1026967 | |||
| 1367 | Ga0207713_1069714 | |||
| 1368 | Ga0207671_10000035 | |||
| 1369 | Ga0207649_10000013 | |||
| 1370 | Ga0207681_10011098 | |||
| 1371 | Ga0207650_10001330 | |||
| 1372 | Ga0207706_10000170 | |||
| 1373 | Ga0207686_10001020 | |||
| 1374 | Ga0207709_10000089 | |||
| 1375 | Ga0207711_10329603 | |||
| 1376 | Ga0207679_10000005 | |||
| 1377 | Ga0207667_10230034 | |||
| 1378 | Ga0207639_10004455 | |||
| 1379 | Ga0209281_1000011 | |||
| 1380 | Ga0209281_1000090 | |||
| 1381 | Ga0209281_1011939 | |||
| 1382 | Ga0209371_1000982 | |||
| 1383 | Ga0209282_1022771 | |||
| 1384 | Ga0207428_10073898 | |||
| 1385 | Ga0207428_10118831 | |||
| 1386 | Ga0207428_10233571 | |||
| 1387 | Ga0207428_10306959 | |||
| 1388 | Ga0207428_10431881 | |||
| 1389 | Ga0268266_10013640 | |||
| 1390 | Ga0268256_1000830 | |||
| 1391 | Ga0314311_1076632 | |||
| 1392 | Ga0316179_1094404 | |||
| 1393 | Ga0316178_1038486 | |||
| 1394 | Ga0307408_100012352 | |||
| 1395 | Ga0307408_100030385 | |||
| 1396 | Ga0307408_100078879 | |||
| 1397 | Ga0307408_100134052 | |||
| 1398 | Ga0307408_100655239 | |||
| 1399 | Ga0307405_10000148 | |||
| 1400 | Ga0307405_10014970 | |||
| 1401 | Ga0307405_10020525 | |||
| 1402 | Ga0307413_10012815 | |||
| 1403 | Ga0307413_10025520 | |||
| 1404 | Ga0307406_10007496 | |||
| 1405 | Ga0307406_10033479 | |||
| 1406 | Ga0307406_10163694 | |||
| 1407 | Ga0307407_10012317 | |||
| 1408 | Ga0307412_10007418 | |||
| 1409 | Ga0307412_10007529 | |||
| 1410 | Ga0307412_10147544 | |||
| 1411 | Ga0307412_10444710 | |||
| 1412 | Ga0307409_100030842 | |||
| 1413 | Ga0307414_10257336 | |||
| 1414 | Ga0307411_10019453 | |||
| 1415 | Ga0307411_10475907 | |||
| 1416 | Ga0307510_10023150 | |||
| 1417 | Ga0395898_0367344 | |||
| 1418 | Ga0237819_05620 | |||
| 1419 | Ga0439438_000047 | |||
| 1420 | Ga0439438_001671 | |||
| 1421 | Ga0439438_004171 | |||
| 1422 | Ga0439438_004194 | |||
| 1423 | Ga0439438_004440 | |||
| 1424 | Ga0439438_004716 | |||
| 1425 | Ga0439438_009750 | |||
| 1426 | Ga0439438_009903 | |||
| 1427 | Ga0439447_002873 | |||
| 1428 | Ga0439447_005572 | |||
| 1429 | Ga0439447_006712 | |||
| 1430 | Ga0439447_011528 | |||
| 1431 | Ga0439447_018735 | |||
| 1432 | Ga0439447_021988 | |||
| 1433 | Ga0439447_028541 | |||
| 1434 | Ga0439447_046719 | |||
| 1435 | Ga0439466_0001445 | |||
| 1436 | Ga0439466_0004658 | |||
| 1437 | Ga0439466_0021809 | |||
| 1438 | Ga0439466_0022674 | |||
| 1439 | Ga0439466_0024412 | |||
| 1440 | Ga0439466_0033330 | |||
| 1441 | Ga0439466_0036062 | |||
| 1442 | Ga0439466_0043494 | |||
| 1443 | Ga0439466_0046169 | |||
| 1444 | Ga0439466_0056058 | |||
| 1445 | Ga0439466_0061441 | |||
| 1446 | Ga0439465_0031304 | |||
| 1447 | Ga0439431_0008222 | |||
| 1448 | Ga0439445_0019296 | |||
| 1449 | Ga0439445_0030989 | |||
| 1450 | Ga0439432_000947 | |||
| 1451 | Ga0439432_001594 | |||
| 1452 | Ga0439432_009678 | |||
| 1453 | Ga0439432_010217 | |||
| 1454 | Ga0439432_020006 | |||
| 1455 | Ga0439432_041613 | |||
| 1456 | Ga0439432_063510 | |||
| 1457 | Ga0439432_082737 | |||
| 1458 | Ga0439451_000073 | |||
| 1459 | Ga0439451_000123 | |||
| 1460 | Ga0439451_006138 | |||
| 1461 | Ga0439451_018469 | |||
| 1462 | Ga0439452_000340 | |||
| 1463 | Ga0439452_001423 | |||
| 1464 | Ga0439452_002563 | |||
| 1465 | Ga0439452_010412 | |||
| 1466 | Ga0439452_013961 | |||
| 1467 | Ga0439452_013971 | |||
| 1468 | Ga0439452_021508 | |||
| 1469 | Ga0439452_034545 | |||
| 1470 | Ga0439456_002221 | |||
| 1471 | Ga0439456_008427 | |||
| 1472 | Ga0439456_015036 | |||
| 1473 | Ga0439456_021478 | |||
| 1474 | Ga0439456_022815 | |||
| 1475 | Ga0439456_024919 | |||
| 1476 | Ga0439463_000847 | |||
| 1477 | Ga0439463_004797 | |||
| 1478 | Ga0439463_006761 | |||
| 1479 | Ga0439463_018823 | |||
| 1480 | Ga0439463_027666 | |||
| 1481 | Ga0450911_000029 | |||
| 1482 | Ga0450911_001240 | |||
| 1483 | Ga0450911_005165 | |||
| 1484 | Ga0450911_013332 | |||
| 1485 | Ga0450919_004342 | |||
| 1486 | Ga0450922_001175 | |||
| 1487 | Ga0450922_005095 | |||
| 1488 | Ga0450923_016772 | |||
| 1489 | Ga0450923_027207 | |||
| 1490 | Ga0450890_001266 | |||
| 1491 | Ga0450899_005962 | |||
| 1492 | Ga0450900_007596 | |||
| 1493 | Ga0450903_003012 | |||
| 1494 | Ga0450903_009256 | |||
| 1495 | Ga0450903_020823 | |||
| 1496 | Ga0450905_005383 | |||
| 1497 | Ga0450906_000366 | |||
| 1498 | Ga0450906_000835 | |||
| 1499 | Ga0450906_005862 | |||
| 1500 | Ga0450907_000169 | |||
| 1501 | Ga0450907_002809 | |||
| 1502 | Ga0450910_007740 | |||
| 1503 | Ga0450910_007902 | |||
| 1504 | Ga0439446_0012870 | |||
| 1505 | Ga0439446_0025379 | |||
| 1506 | Ga0450908_005042 | |||
| 1507 | Ga0450908_020707 | |||
| 1508 | Ga0450909_001999 | |||
| 1509 | Ga0450909_004137 | |||
| 1510 | Ga0450909_006077 | |||
| 1511 | Ga0439434_0000043 | |||
| 1512 | Ga0439434_0033207 | |||
| 1513 | Ga0439464_0020098 | |||
| 1514 | Ga0439460_0001061 | |||
| 1515 | Ga0439460_0008258 | |||
| 1516 | Ga0439460_0021498 | |||
| 1517 | Ga0450918_015640 | |||
| 1518 | Ga0450893_0013785 | |||
| 1519 | Ga0450893_0025076 | |||
| 1520 | Ga0439440_0000018 | |||
| 1521 | Ga0439440_0010939 | |||
| 1522 | Ga0439440_0022144 | |||
| 1523 | Ga0495617_000261 | |||
| 1524 | Ga0495617_000723 | |||
| 1525 | Ga0495617_007485 | |||
| 1526 | Ga0495617_016242 | |||
| 1527 | Ga0495617_039229 | |||
| 1528 | Ga0495617_047385 | |||
| 1529 | Ga0495617_052515 | |||
| 1530 | Ga0495617_056419 | |||
| 1531 | Ga0495617_090682 | |||
| 1532 | Ga0495627_000435 | |||
| 1533 | Ga0495627_000539 | |||
| 1534 | Ga0495627_000945 | |||
| 1535 | Ga0495627_002111 | |||
| 1536 | Ga0495627_005449 | |||
| 1537 | Ga0495603_0006846 | |||
| 1538 | Ga0495603_0151647 | |||
| 1539 | Ga0495590_0003477 | |||
| 1540 | Ga0495590_0005953 | |||
| 1541 | Ga0495590_0029351 | |||
| 1542 | Ga0495590_0038696 | |||
| 1543 | Ga0495590_0043564 | |||
| 1544 | Ga0495590_0106339 | |||
| 1545 | Ga0495590_0130957 | |||
| 1546 | Ga0495591_000178 | |||
| 1547 | Ga0495591_000201 | |||
| 1548 | Ga0495591_000321 | |||
| 1549 | Ga0495591_000420 | |||
| 1550 | Ga0495591_003661 | |||
| 1551 | Ga0495591_005054 | |||
| 1552 | Ga0495591_005423 | |||
| 1553 | Ga0495591_011360 | |||
| 1554 | Ga0495591_021179 | |||
| 1555 | Ga0495591_022066 | |||
| 1556 | Ga0495591_025141 | |||
| 1557 | Ga0495591_030198 | |||
| 1558 | Ga0495591_036912 | |||
| 1559 | Ga0495591_053774 | |||
| 1560 | Ga0495591_060763 | |||
| 1561 | Ga0495638_0000291 | |||
| 1562 | Ga0495638_0001817 | |||
| 1563 | Ga0495638_0014505 | |||
| 1564 | Ga0495638_0049726 | |||
| 1565 | Ga0495638_0073985 | |||
| 1566 | Ga0495638_0082151 | |||
| 1567 | Ga0495638_0096233 | |||
| 1568 | Ga0495638_0099474 | |||
| 1569 | Ga0495638_0136681 | |||
| 1570 | Ga0495638_0183905 | |||
| 1571 | Ga0495638_0217221 | |||
| 1572 | Ga0495653_0018957 | |||
| 1573 | Ga0495653_0058482 | |||
| 1574 | Ga0495650_0003672 | |||
| 1575 | Ga0495650_0013233 | |||
| 1576 | Ga0495650_0015119 | |||
| 1577 | Ga0495650_0018693 | |||
| 1578 | Ga0495650_0018733 | |||
| 1579 | Ga0495650_0022921 | |||
| 1580 | Ga0495650_0073908 | |||
| 1581 | Ga0495580_0410257 | |||
| 1582 | Ga0495582_0072886 | |||
| 1583 | Ga0495605_0000925 | |||
| 1584 | Ga0495605_0002066 | |||
| 1585 | Ga0495605_0011446 | |||
| 1586 | Ga0495605_0033043 | |||
| 1587 | Ga0495605_0035664 | |||
| 1588 | Ga0495605_0052551 | |||
| 1589 | Ga0495605_0055921 | |||
| 1590 | Ga0495605_0109861 | |||
| 1591 | Ga0495639_0004268 | |||
| 1592 | Ga0495639_0033366 | |||
| 1593 | Ga0495584_0000289 | |||
| 1594 | Ga0495584_0001390 | |||
| 1595 | Ga0495584_0006060 | |||
| 1596 | Ga0495584_0007118 | |||
| 1597 | Ga0495584_0008338 | |||
| 1598 | Ga0495584_0031143 | |||
| 1599 | Ga0495584_0034843 | |||
| 1600 | Ga0495584_0179751 | |||
| 1601 | Ga0495584_0196533 | |||
| 1602 | Ga0495585_0000361 | |||
| 1603 | Ga0495585_0000787 | |||
| 1604 | Ga0495585_0006449 | |||
| 1605 | Ga0495585_0010630 | |||
| 1606 | Ga0495585_0028685 | |||
| 1607 | Ga0495585_0033550 | |||
| 1608 | Ga0495585_0033801 | |||
| 1609 | Ga0495585_0038835 | |||
| 1610 | Ga0495585_0049039 | |||
| 1611 | Ga0495585_0123328 | |||
| 1612 | Ga0495594_0138170 | |||
| 1613 | Ga0495596_0002541 | |||
| 1614 | Ga0495596_0030126 | |||
| 1615 | Ga0495607_0000203 | |||
| 1616 | Ga0495607_0000825 | |||
| 1617 | Ga0495607_0001379 | |||
| 1618 | Ga0495607_0002157 | |||
| 1619 | Ga0495607_0002620 | |||
| 1620 | Ga0495607_0009287 | |||
| 1621 | Ga0495607_0029424 | |||
| 1622 | Ga0495607_0032269 | |||
| 1623 | Ga0495607_0035258 | |||
| 1624 | Ga0495607_0044081 | |||
| 1625 | Ga0495607_0044495 | |||
| 1626 | Ga0495607_0058211 | |||
| 1627 | Ga0495607_0061719 | |||
| 1628 | Ga0495607_0104143 | |||
| 1629 | Ga0495607_0154914 | |||
| 1630 | Ga0495607_0173838 | |||
| 1631 | Ga0495583_0001393 | |||
| 1632 | Ga0495583_0001561 | |||
| 1633 | Ga0495583_0004609 | |||
| 1634 | Ga0495583_0007556 | |||
| 1635 | Ga0495583_0023118 | |||
| 1636 | Ga0495583_0038122 | |||
| 1637 | Ga0495583_0093402 | |||
| 1638 | Ga0495606_0000538 | |||
| 1639 | Ga0495606_0003905 | |||
| 1640 | Ga0495606_0007086 | |||
| 1641 | Ga0495606_0009451 | |||
| 1642 | Ga0495606_0011725 | |||
| 1643 | Ga0495606_0018894 | |||
| 1644 | Ga0495606_0085089 | |||
| 1645 | Ga0495606_0227377 | |||
| 1646 | Ga0495610_0000608 | |||
| 1647 | Ga0495610_0005301 | |||
| 1648 | Ga0495610_0008647 | |||
| 1649 | Ga0495610_0010004 | |||
| 1650 | Ga0495610_0033569 | |||
| 1651 | Ga0495610_0058217 | |||
| 1652 | Ga0495610_0079095 | |||
| 1653 | Ga0495610_0141242 | |||
| 1654 | Ga0495616_0000124 | |||
| 1655 | Ga0495616_0000141 | |||
| 1656 | Ga0495616_0000356 | |||
| 1657 | Ga0495616_0000387 | |||
| 1658 | Ga0495616_0015465 | |||
| 1659 | Ga0495616_0018863 | |||
| 1660 | Ga0495616_0022001 | |||
| 1661 | Ga0495616_0057814 | |||
| 1662 | Ga0495616_0132283 | |||
| 1663 | Ga0495620_0000084 | |||
| 1664 | Ga0495620_0002239 | |||
| 1665 | Ga0495620_0010882 | |||
| 1666 | Ga0495620_0030708 | |||
| 1667 | Ga0495620_0030958 | |||
| 1668 | Ga0495630_0079019 | |||
| 1669 | Ga0495630_0098016 | |||
| 1670 | Ga0495631_0000062 | |||
| 1671 | Ga0495631_0000754 | |||
| 1672 | Ga0495631_0009210 | |||
| 1673 | Ga0495632_0000526 | |||
| 1674 | Ga0495632_0000751 | |||
| 1675 | Ga0495632_0002897 | |||
| 1676 | Ga0495632_0004651 | |||
| 1677 | Ga0495632_0010368 | |||
| 1678 | Ga0495632_0012487 | |||
| 1679 | Ga0495632_0020576 | |||
| 1680 | Ga0495632_0024787 | |||
| 1681 | Ga0495632_0067790 | |||
| 1682 | Ga0495632_0071699 | |||
| 1683 | Ga0495632_0089579 | |||
| 1684 | Ga0495632_0106560 | |||
| 1685 | Ga0495632_0145916 | |||
| 1686 | Ga0495632_0151102 | |||
| 1687 | Ga0495632_0166647 | |||
| 1688 | Ga0495632_0172698 | |||
| 1689 | Ga0495637_0000337 | |||
| 1690 | Ga0495637_0000370 | |||
| 1691 | Ga0495637_0001137 | |||
| 1692 | Ga0495637_0001160 | |||
| 1693 | Ga0495637_0002224 | |||
| 1694 | Ga0495637_0005363 | |||
| 1695 | Ga0495637_0017433 | |||
| 1696 | Ga0495637_0021434 | |||
| 1697 | Ga0495637_0047881 | |||
| 1698 | Ga0495637_0049121 | |||
| 1699 | Ga0495637_0050746 | |||
| 1700 | Ga0495637_0062230 | |||
| 1701 | Ga0495643_0001498 | |||
| 1702 | Ga0495643_0001563 | |||
| 1703 | Ga0495643_0054211 | |||
| 1704 | Ga0495643_0061035 | |||
| 1705 | Ga0495643_0062484 | |||
| 1706 | Ga0495643_0097076 | |||
| 1707 | Ga0495643_0106819 | |||
| 1708 | Ga0495643_0158789 | |||
| 1709 | Ga0495643_0189504 | |||
| 1710 | Ga0495644_0000203 | |||
| 1711 | Ga0495644_0017602 | |||
| 1712 | Ga0495644_0022179 | |||
| 1713 | Ga0495644_0036870 | |||
| 1714 | Ga0495648_0000912 | |||
| 1715 | Ga0495648_0001556 | |||
| 1716 | Ga0495648_0002985 | |||
| 1717 | Ga0495648_0003261 | |||
| 1718 | Ga0495648_0020384 | |||
| 1719 | Ga0495648_0030426 | |||
| 1720 | Ga0495648_0037455 | |||
| 1721 | Ga0495648_0086293 | |||
| 1722 | Ga0495648_0133393 | |||
| 1723 | Ga0495648_0173387 | |||
| 1724 | Ga0495648_0180560 | |||
| 1725 | Ga0495648_0205503 | |||
| 1726 | Ga0495666_0000034 | |||
| 1727 | Ga0495666_0052433 | |||
| 1728 | Ga0495666_0080689 | |||
| 1729 | Ga0495666_0125668 | |||
| 1730 | Ga0495642_0001788 | |||
| 1731 | Ga0495642_0014074 | |||
| 1732 | Ga0495654_0000175 | |||
| 1733 | Ga0495654_0000870 | |||
| 1734 | Ga0495654_0001163 | |||
| 1735 | Ga0495654_0001446 | |||
| 1736 | Ga0495654_0001592 | |||
| 1737 | Ga0495654_0001629 | |||
| 1738 | Ga0495654_0002019 | |||
| 1739 | Ga0495654_0019582 | |||
| 1740 | Ga0495654_0048361 | |||
| 1741 | Ga0495654_0049948 | |||
| 1742 | Ga0495654_0056762 | |||
| 1743 | Ga0495654_0066708 | |||
| 1744 | Ga0495654_0069348 | |||
| 1745 | Ga0495654_0070057 | |||
| 1746 | Ga0495654_0085805 | |||
| 1747 | Ga0495609_0000011 | |||
| 1748 | Ga0495609_0000179 | |||
| 1749 | Ga0495609_0011787 | |||
| 1750 | Ga0495609_0014463 | |||
| 1751 | Ga0495609_0125511 | |||
| 1752 | Ga0495609_0131718 | |||
| 1753 | Ga0495609_0135843 | |||
| 1754 | Ga0495597_0000136 | |||
| 1755 | Ga0495597_0000873 | |||
| 1756 | Ga0495597_0007549 | |||
| 1757 | Ga0495597_0010015 | |||
| 1758 | Ga0495597_0012973 | |||
| 1759 | Ga0495597_0021403 | |||
| 1760 | Ga0495597_0026838 | |||
| 1761 | Ga0495597_0029068 | |||
| 1762 | Ga0495597_0032451 | |||
| 1763 | Ga0495597_0057794 | |||
| 1764 | Ga0495597_0060844 | |||
| 1765 | Ga0495597_0080926 | |||
| 1766 | Ga0495597_0103712 | |||
| 1767 | Ga0495597_0139410 | |||
| 1768 | Ga0495645_0015724 | |||
| 1769 | Ga0495622_0007811 | |||
| 1770 | Ga0495622_0013229 | |||
| 1771 | Ga0495622_0023259 | |||
| 1772 | Ga0495622_0186764 | |||
| 1773 | Ga0495633_0000259 | |||
| 1774 | Ga0495633_0008011 | |||
| 1775 | Ga0495633_0117451 | |||
| 1776 | Ga0495656_0174664 | |||
| 1777 | Ga0495668_0001534 | |||
| 1778 | Ga0495668_0001602 | |||
| 1779 | Ga0495668_0013185 | |||
| 1780 | Ga0495668_0078728 | |||
| 1781 | Ga0495668_0140954 | |||
| 1782 | Ga0495668_0174257 | |||
| 1783 | Ga0495634_0018569 | |||
| 1784 | Ga0495611_0000263 | |||
| 1785 | Ga0495611_0016889 | |||
| 1786 | Ga0495611_0027190 | |||
| 1787 | Ga0495611_0036191 | |||
| 1788 | Ga0495611_0051575 | |||
| 1789 | Ga0495611_0173290 | |||
| 1790 | Ga0495625_0030850 | |||
| 1791 | Ga0495625_0048909 | |||
| 1792 | Ga0495625_0051324 | |||
| 1793 | Ga0495625_0097154 | |||
| 1794 | Ga0495625_0233914 | |||
| 1795 | Ga0495625_0236983 | |||
| 1796 | Ga0495625_0272097 | |||
| 1797 | Ga0495635_0001705 | |||
| 1798 | Ga0495659_0001826 | |||
| 1799 | Ga0495659_0095022 | |||
| 1800 | Ga0495661_0002150 | |||
| 1801 | Ga0495661_0002358 | |||
| 1802 | Ga0495661_0030394 | |||
| 1803 | Ga0495661_0043819 | |||
| 1804 | Ga0495661_0047726 | |||
| 1805 | Ga0495661_0060941 | |||
| 1806 | Ga0495661_0091445 | |||
| 1807 | Ga0495661_0104155 | |||
| 1808 | Ga0495661_0121399 | |||
| 1809 | Ga0495661_0174146 | |||
| 1810 | Ga0495661_0257743 | |||
| 1811 | Ga0495588_0022571 | |||
| 1812 | Ga0495588_0024478 | |||
| 1813 | Ga0495588_0106267 | |||
| 1814 | Ga0495588_0131295 | |||
| 1815 | Ga0495657_0021750 | |||
| 1816 | Ga0495646_0053160 | |||
| 1817 | Ga0495646_0124184 | |||
| 1818 | Ga0495669_0004597 | |||
| 1819 | Ga0495669_0049326 | |||
| 1820 | Ga0495613_0072239 | |||
| 1821 | Ga0495624_0000102 | |||
| 1822 | Ga0495670_0000113 | |||
| 1823 | Ga0495670_0000264 | |||
| 1824 | Ga0495670_0008881 | |||
| 1825 | Ga0495670_0032866 | |||
| 1826 | Ga0495670_0114576 | |||
| 1827 | Ga0495670_0165470 | |||
| 1828 | Ga0495670_0190087 | |||
| 1829 | Ga0495670_0192276 | |||
| 1830 | Ga0495671_0000876 | |||
| 1831 | Ga0495671_0000967 | |||
| 1832 | Ga0495671_0002006 | |||
| 1833 | Ga0495671_0003790 | |||
| 1834 | Ga0495671_0006136 | |||
| 1835 | Ga0495671_0008399 | |||
| 1836 | Ga0495671_0010630 | |||
| 1837 | Ga0495671_0012274 | |||
| 1838 | Ga0495671_0018094 | |||
| 1839 | Ga0495671_0032742 | |||
| 1840 | Ga0495671_0034909 | |||
| 1841 | Ga0495671_0037792 | |||
| 1842 | Ga0495671_0050253 | |||
| 1843 | Ga0495649_0001677 | |||
| 1844 | Ga0495649_0002935 | |||
| 1845 | Ga0495649_0003481 | |||
| 1846 | Ga0495649_0012462 | |||
| 1847 | Ga0495649_0013802 | |||
| 1848 | Ga0495649_0025651 | |||
| 1849 | Ga0495649_0030551 | |||
| 1850 | Ga0495649_0040719 | |||
| 1851 | Ga0495649_0062270 | |||
| 1852 | Ga0495649_0195230 | |||
| 1853 | Ga0495649_0201748 | |||
| 1854 | Ga0495589_0000160 | |||
| 1855 | Ga0495589_0000787 | |||
| 1856 | Ga0495589_0004639 | |||
| 1857 | Ga0495589_0010382 | |||
| 1858 | Ga0495589_0010720 | |||
| 1859 | Ga0495589_0016016 | |||
| 1860 | Ga0495589_0049095 | |||
| 1861 | Ga0495589_0063628 | |||
| 1862 | Ga0495589_0091107 | |||
| 1863 | Ga0495600_0098192 | |||
| 1864 | Ga0495600_0325208 | |||
| 1865 | Ga0495660_0000579 | |||
| 1866 | Ga0495660_0001592 | |||
| 1867 | Ga0495660_0002883 | |||
| 1868 | Ga0495660_0014788 | |||
| 1869 | Ga0495660_0025829 | |||
| 1870 | Ga0495660_0043389 | |||
| 1871 | Ga0495660_0052300 | |||
| 1872 | Ga0495660_0053157 | |||
| 1873 | Ga0495660_0073727 | |||
| 1874 | Ga0495660_0095933 | |||
| 1875 | Ga0495660_0125801 | |||
| 1876 | Ga0495660_0129166 | |||
| 1877 | Ga0495581_0103672 | |||
| 1878 | Ga0495581_0140862 | |||
| 1879 | Ga0495604_0050549 | |||
| 1880 | Ga0495604_0098606 | |||
| 1881 | Ga0495604_0332269 | |||
| 1882 | Ga0495636_0000571 | |||
| 1883 | Ga0495672_0000935 | |||
| 1884 | Ga0495672_0001497 | |||
| 1885 | Ga0495672_0002637 | |||
| 1886 | Ga0495672_0005176 | |||
| 1887 | Ga0495672_0005506 | |||
| 1888 | Ga0495672_0010844 | |||
| 1889 | Ga0495672_0027614 | |||
| 1890 | Ga0495672_0029719 | |||
| 1891 | Ga0495672_0035976 | |||
| 1892 | Ga0495676_0021774 | |||
| 1893 | Ga0495676_0294651 | |||
| 1894 | Ga0495680_0001024 | |||
| 1895 | Ga0495680_0085512 | |||
| 1896 | Ga0495680_0093511 | |||
| 1897 | Ga0495680_0166936 | |||
| 1898 | Ga0495683_0003146 | |||
| 1899 | Ga0495683_0003997 | |||
| 1900 | Ga0495683_0022528 | |||
| 1901 | Ga0495683_0046748 | |||
| 1902 | Ga0495683_0068614 | |||
| 1903 | Ga0495683_0136893 | |||
| 1904 | Ga0495683_0174212 | |||
| 1905 | Ga0495687_001039 | |||
| 1906 | Ga0495687_006228 | |||
| 1907 | Ga0495687_008551 | |||
| 1908 | Ga0495687_071088 | |||
| 1909 | Ga0495687_105224 | |||
| 1910 | Ga0495675_0008442 | |||
| 1911 | Ga0495675_0094424 | |||
| 1912 | Ga0495675_0243594 | |||
| 1913 | Ga0495677_0011702 | |||
| 1914 | Ga0495679_000568 | |||
| 1915 | Ga0495679_007324 | |||
| 1916 | Ga0495679_014172 | |||
| 1917 | Ga0495679_018880 | |||
| 1918 | Ga0495679_060912 | |||
| 1919 | Ga0495685_021827 | |||
| 1920 | Ga0495685_022329 | |||
| 1921 | Ga0495673_0000580 | |||
| 1922 | Ga0495673_0000658 | |||
| 1923 | Ga0495673_0002501 | |||
| 1924 | Ga0495673_0002686 | |||
| 1925 | Ga0495673_0003471 | |||
| 1926 | Ga0495673_0004670 | |||
| 1927 | Ga0495673_0011397 | |||
| 1928 | Ga0495673_0011515 | |||
| 1929 | Ga0495673_0023445 | |||
| 1930 | Ga0495673_0027038 | |||
| 1931 | Ga0495673_0037688 | |||
| 1932 | Ga0495673_0052303 | |||
| 1933 | Ga0495673_0057893 | |||
| 1934 | Ga0495673_0060736 | |||
| 1935 | Ga0495673_0067401 | |||
| 1936 | Ga0495673_0098962 | |||
| 1937 | Ga0495673_0102570 | |||
| 1938 | Ga0495673_0120306 | |||
| 1939 | Ga0495681_0000136 | |||
| 1940 | Ga0495681_0000348 | |||
| 1941 | Ga0495681_0001792 | |||
| 1942 | Ga0495681_0003100 | |||
| 1943 | Ga0495681_0003763 | |||
| 1944 | Ga0495681_0009786 | |||
| 1945 | Ga0495681_0010209 | |||
| 1946 | Ga0495681_0020103 | |||
| 1947 | Ga0495681_0024097 | |||
| 1948 | Ga0495681_0037155 | |||
| 1949 | Ga0495681_0043625 | |||
| 1950 | Ga0495681_0062348 | |||
| 1951 | Ga0495681_0064159 | |||
| 1952 | Ga0495681_0075900 | |||
| 1953 | Ga0495681_0087529 | |||
| 1954 | Ga0495681_0101067 | |||
| 1955 | Ga0495681_0106083 | |||
| 1956 | Ga0495681_0117457 | |||
| 1957 | Ga0495684_0014672 | |||
| 1958 | Ga0495686_0000496 | |||
| 1959 | Ga0495686_0079755 | |||
| 1960 | Ga0495686_0174115 | |||
| 1961 | Ga0495593_0007432 | |||
| 1962 | Ga0495593_0111517 | |||
| 1963 | Ga0495593_0146357 | |||
| 1964 | Ga0495602_0000192 | |||
| 1965 | Ga0495626_0001842 | |||
| 1966 | Ga0495626_0002225 | |||
| 1967 | Ga0495626_0003990 | |||
| 1968 | Ga0495626_0006044 | |||
| 1969 | Ga0495626_0007796 | |||
| 1970 | Ga0495626_0008142 | |||
| 1971 | Ga0495626_0009959 | |||
| 1972 | Ga0495626_0014840 | |||
| 1973 | Ga0495626_0026926 | |||
| 1974 | Ga0495626_0029960 | |||
| 1975 | Ga0495626_0116316 | |||
| 1976 | Ga0495626_0124637 | |||
| 1977 | Ga0495626_0126923 | |||
| 1978 | Ga0496102_0637885 | |||
| 1979 | Ga0496103_0304275 | |||
| 1980 | Ga0496105_0200914 | |||
| 1981 | Ga0496106_0412491 | |||
| 1982 | Ga0496112_0392400 | |||
| 1983 | Ga0496116_0000417 | |||
| 1984 | Ga0496116_0012807 | |||
| 1985 | Ga0496116_0021462 | |||
| 1986 | Ga0496117_0002190 | |||
| 1987 | Ga0496117_0002337 | |||
| 1988 | Ga0496117_0003824 | |||
| 1989 | Ga0496117_0014732 | |||
| 1990 | Ga0496117_0014891 | |||
| 1991 | Ga0496117_0047930 | |||
| 1992 | Ga0496117_0117331 | |||
| 1993 | Ga0496117_0143188 | |||
| 1994 | Ga0496118_0002512 | |||
| 1995 | Ga0496118_0002580 | |||
| 1996 | Ga0496118_0013049 | |||
| 1997 | Ga0496118_0024093 | |||
| 1998 | Ga0496118_0025410 | |||
| 1999 | Ga0496118_0070527 | |||
| 2000 | Ga0496118_0130562 | |||
| 2001 | Ga0496118_0160551 | |||
| 2002 | Ga0496118_0182845 | |||
| 2003 | Ga0496119_0035763 | |||
| 2004 | Ga0496119_0054063 | |||
| 2005 | Ga0496119_0178478 | |||
| 2006 | Ga0496120_0011144 | |||
| 2007 | Ga0496120_0029254 | |||
| 2008 | Ga0496120_0047416 | |||
| 2009 | Ga0496121_0001921 | |||
| 2010 | Ga0496121_0003088 | |||
| 2011 | Ga0496121_0003360 | |||
| 2012 | Ga0496121_0055292 | |||
| 2013 | Ga0496121_0065026 | |||
| 2014 | Ga0496121_0115530 | |||
| 2015 | Ga0496121_0120428 | |||
| 2016 | Ga0496122_0017317 | |||
| 2017 | Ga0496122_0017591 | |||
| 2018 | Ga0496122_0045825 | |||
| 2019 | Ga0496122_0070415 | |||
| 2020 | Ga0496122_0076630 | |||
| 2021 | Ga0496122_0155013 | |||
| 2022 | Ga0496122_0270523 | |||
| 2023 | Ga0496123_0004248 | |||
| 2024 | Ga0496123_0022547 | |||
| 2025 | Ga0496123_0027311 | |||
| 2026 | Ga0496123_0041417 | |||
| 2027 | Ga0496123_0161059 | |||
| 2028 | Ga0496124_0005034 | |||
| 2029 | Ga0496124_0075088 | |||
| 2030 | Ga0496124_0310385 | |||
| 2031 | Ga0496124_0330401 | |||
| 2032 | Ga0496124_0407446 | |||
| 2033 | Ga0496125_0002268 | |||
| 2034 | Ga0496125_0002804 | |||
| 2035 | Ga0496125_0004817 | |||
| 2036 | Ga0496125_0004927 | |||
| 2037 | Ga0496125_0053047 | |||
| 2038 | Ga0496125_0079771 | |||
| 2039 | Ga0496125_0143129 | |||
| 2040 | Ga0496125_0149714 | |||
| 2041 | Ga0496126_0002601 | |||
| 2042 | Ga0496126_0036309 | |||
| 2043 | Ga0496126_0059431 | |||
| 2044 | Ga0495678_000302 | |||
| 2045 | Ga0495678_001297 | |||
| 2046 | Ga0495678_001533 | |||
| 2047 | Ga0495678_002893 | |||
| 2048 | Ga0495678_003059 | |||
| 2049 | Ga0495678_004731 | |||
| 2050 | Ga0495678_014010 | |||
| 2051 | Ga0495678_016692 | |||
| 2052 | Ga0495678_026599 | |||
| 2053 | Ga0495678_054127 | |||
| 2054 | Ga0495678_100794 | |||
| 2055 | Ga0495682_0000165 | |||
| 2056 | Ga0495682_0004900 | |||
| 2057 | Ga0495682_0008364 | |||
| 2058 | Ga0495682_0014357 | |||
| 2059 | Ga0495682_0016454 | |||
| 2060 | Ga0495682_0024270 | |||
| 2061 | Ga0495682_0055594 | |||
| 2062 | Ga0495682_0055965 | |||
| 2063 | Ga0495682_0086614 | |||
| 2064 | Ga0501241_000272 | |||
| 2065 | nmdc:mga03683_33674_c1 | |||
| 2066 | nmdc:mga03683_87115_c1 | |||
| 2067 | nmdc:mga00v17_138705_c1 | |||
| 2068 | nmdc:mga00v17_142582_c1 | |||
| 2069 | nmdc:mga00v17_318003_c1 | |||
| 2070 | nmdc:mga08x19_108206_c1 | |||
| 2071 | Ga0500572_066664 | |||
| 2072 | Ga0500568_0095324 | |||
| 2073 | Ga0500634_0000380 | |||
| 2074 | 3007513278 | |||
| 2075 | 2511258037 | |||
| 2076 | 2511263335 | |||
| 2077 | 2511274904 | |||
| 2078 | 2511290940 | |||
| 2079 | 2511298436 | |||
| 2080 | 2511301415 | |||
| 2081 | 2511314192 | |||
| 2082 | 2511320886 | |||
| 2083 | 2511324687 | |||
| 2084 | 2511342924 | |||
| 2085 | 2511363855 | |||
| 2086 | 2511369199 | |||
| 2087 | 2511414998 | |||
| 2088 | 2511825986 | |||
| 2089 | 2512326922 | |||
| 2090 | 2555668925 | |||
| 2091 | 2583793528 | |||
| 2092 | 2597857114 | |||
| 2093 | 2597865243 | |||
| 2094 | 2597871097 | |||
| 2095 | 2599357282 | |||
| 2096 | 2599361906 | |||
| 2097 | 2599368227 | |||
| 2098 | 2599375016 | |||
| 2099 | 2599382387 | |||
| 2100 | 2599388834 | |||
| 2101 | 2599393874 | |||
| 2102 | 2599400380 | |||
| 2103 | 2599405639 | |||
| 2104 | 2599451292 | |||
| 2105 | 2599464217 | |||
| 2106 | 2599468513 | |||
| 2107 | 2599484136 | |||
| 2108 | 2599493236 | |||
| 2109 | 2599504613 | |||
| 2110 | 2599508613 | |||
| 2111 | 2599512467 | |||
| 2112 | 2599519813 | |||
| 2113 | 2599611453 | |||
| 2114 | 2599770437 | |||
| 2115 | 2599801787 | |||
| 2116 | 2599878588 | |||
| 2117 | 2599889550 | |||
| 2118 | 2599891143 | |||
| 2119 | 2599901078 | |||
| 2120 | 2599934937 | |||
| 2121 | 2599947791 | |||
| 2122 | 2599952823 | |||
| 2123 | 2599963138 | |||
| 2124 | 2599968718 | |||
| 2125 | 2599976975 | |||
| 2126 | 2599981826 | |||
| 2127 | 2599987735 | |||
| 2128 | 2599995226 | |||
| 2129 | 2599998373 | |||
| 2130 | 2600005566 | |||
| 2131 | 2600011144 | |||
| 2132 | 2600019965 | |||
| 2133 | 2600022441 | |||
| 2134 | 2600027461 | |||
| 2135 | 2600034233 | |||
| 2136 | 2600039741 | |||
| 2137 | 2600046065 | |||
| 2138 | 2600054610 | |||
| 2139 | 2600057401 | |||
| 2140 | 2600064579 | |||
| 2141 | 2600072261 | |||
| 2142 | 2600075716 | |||
| 2143 | 2600216492 | |||
| 2144 | 2600356830 | |||
| 2145 | 2600365528 | |||
| 2146 | 2601689504 | |||
| 2147 | 2601776915 | |||
| 2148 | 2601795754 | |||
| 2149 | 2606075399 | |||
| 2150 | 2606128262 | |||
| 2151 | 2621298205 | |||
| 2152 | 2624479692 | |||
| 2153 | 2624493294 | |||
| 2154 | 2643846292 | |||
| 2155 | 2643869353 | |||
| 2156 | 2643952813 | |||
| 2157 | 2644022575 | |||
| 2158 | 2644188788 | |||
| 2159 | 2644286799 | |||
| 2160 | 2644622076 | |||
| 2161 | 2652546902 | |||
| 2162 | 2671093724 | |||
| 2163 | 2671098545 | |||
| 2164 | 2671126171 | |||
| 2165 | 2671768736 | |||
| 2166 | 2677900026 | |||
| 2167 | 2678262751 | |||
| 2168 | 2715753328 | |||
| 2169 | 2715757961 | |||
| 2170 | 2723249997 | |||
| 2171 | 2738671412 | |||
| 2172 | 2738749806 | |||
| 2173 | 2738808327 | |||
| 2174 | 2738858846 | |||
| 2175 | 2738895687 | |||
| 2176 | 2739201406 | |||
| 2177 | 2739259554 | |||
| 2178 | 2739315634 | |||
| 2179 | 2743736534 | |||
| 2180 | 2745009089 | |||
| 2181 | 2774121102 | |||
| 2182 | 2774135354 | |||
| 2183 | 2784265395 | |||
| 2184 | 2784314176 | |||
| 2185 | 2794598229 | |||
| 2186 | 2808854455 | |||
| 2187 | 2808926628 | |||
| 2188 | 2808927621 | |||
| 2189 | 2808934535 | |||
| 2190 | 2808948795 | |||
| 2191 | 2808949839 | |||
| 2192 | 2808957902 | |||
| 2193 | 2808962960 | |||
| 2194 | 2808977953 | |||
| 2195 | 2808993433 | |||
| 2196 | 2808997623 | |||
| 2197 | 2817492652 | |||
| 2198 | 2819657495 | |||
| 2199 | 2819703624 | |||
| 2200 | 2825652888 | |||
| 2201 | 2834031743 | |||
| 2202 | 2842827534 | |||
| 2203 | 2842832431 | |||
| 2204 | 2842841358 | |||
| 2205 | 2842848589 | |||
| 2206 | 2842857463 | |||
| 2207 | 2844669413 | |||
| 2208 | 2852612975 | |||
| 2209 | 2852659182 | |||
| 2210 | 2852669290 | |||
| 2211 | 2878031702 | |||
| 2212 | 2880232574 | |||
| 2213 | 2904524045 | |||
| 2214 | 2904552653 | |||
| 2215 | 2908451154 | |||
| 2216 | 2913038726 | |||
| 2217 | 2917072713 | |||
| 2218 | 2919068176 | |||
| 2219 | 2919386675 | |||
| 2220 | 2919456845 | |||
| 2221 | 2919482000 | |||
| 2222 | 2919493095 | |||
| 2223 | 2919530425 | |||
| 2224 | 2919699431 | |||
| 2225 | 2923155548 | |||
| 2226 | 2923587131 | |||
| 2227 | 2929146179 | |||
| 2228 | 2929193818 | |||
| 2229 | 2931370453 | |||
| 2230 | 2931395118 | |||
| 2231 | 2931400347 | |||
| 2232 | 2935354876 | |||
| 2233 | 2939639495 | |||
| 2234 | 2945962005 | |||
| 2235 | 2946008373 | |||
| 2236 | 2946032255 | |||
| 2237 | 2947239077 | |||
| 2238 | 2969306492 | |||
| 2239 | 2974291813 | |||
| 2240 | 2984290475 | |||
| 2241 | 2988733704 | |||
| 2242 | 2998141886 | |||
| 2243 | 3007401087 | |||
| 2244 | 3007424214 | |||
| 2245 | 3007617377 | |||
| 2246 | 3007720760 | |||
| 2247 | 3007860742 | |||
| 2248 | 3007862886 | |||
| 2249 | 637319267 | |||
| 2250 | 8015689771 | |||
| 2251 | 8019772856 | |||
| 2252 | 8019776297 | |||
| 2253 | 8029998813 | |||
| 2254 | 8054285522 | |||
| 2255 | 8054350636 | |||
| 2256 | 8055772911 | |||
| 2257 | 8055822553 | |||
| 2258 | 8056127806 | |||
| 2259 | 8056145118 | |||
| 2260 | 8056150330 | |||
| 2261 | 8056156566 | |||
| 2262 | 8056169113 | |||
| 2263 | 8056175261 | |||
| 2264 | 8056183650 | |||
| 2265 | 8056571608 | |||
| 2266 | 8057799336 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hfq-assembly1.cif.gz_B | crystal structure of udp-x diphosphatase | 0.8459 | 29 | 68 |
| 3jc2-assembly1.cif.gz_1 | the structure of the mammalian sec61 channel opened by a signal sequence | 0.3599 | 116 | 236 |
| 3o2r-assembly2.cif.gz_D | structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni | 0.352 | 151 | 255 |
| 4ja3-assembly2.cif.gz_B | partially occluded inward open conformation of the xylose transporter xyle from e. coli | 0.3089 | 112 | 254 |
| 5jdq-assembly1.cif.gz_A | structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 100 mm na+ and 10mm sr2+ | 0.3035 | 120 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZN5_100_194_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.821 | 151 | 251 | 1.10.1760.20 |
| af_Q2FZN5_100_194_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8132 | 151 | 251 | 1.10.1760.20 |
| af_Q54SW8_245_342_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6581 | 155 | 250 | 1.10.1760.20 |
| af_Q54SW8_245_342_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6416 | 155 | 250 | 1.10.1760.20 |
| af_Q2G1K5_1_137_1.10.287.1260 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4468 | 117 | 227 | 1.10.287.1260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8E0P9-F1-model_v4 | deleted | 0.9342 | 123 | 263 |
|
| AF-A0A7Y2L2X3-F1-model_v4 | CPBP family intramembrane metalloprotease | 0.9325 | 121 | 263 |
GO:0004222
GO:0016020 GO:0071586 |
| AF-A0A836NTL5-F1-model_v4 | deleted | 0.9238 | 118 | 262 |
|
| AF-A0A7Y8E0P9-F1-model_v4 | deleted | 0.9216 | 123 | 263 |
|
| AF-A0A2S6J2D2-F1-model_v4 | deleted | 0.9189 | 94 | 263 |
|