F490610
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1135 | 447 | 1127 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10000377|Ga0070717_1000037715 |
| Length | 323 |
| Sequence | MDKAMDEVPRNEPYGPLHSRVCHPTLDETLAELSIEYGYLNLLRRILNFGHKVSDRTGTGTMSLFGAQLRHDLSDGFPLLTTKKVFFRGVAEELLWMLEGETNVKPLQAKGIKIWDQWADEKGDLGPVYGKQWRRWEAPVTDTDDYMEQPGGERGETGMDYYYKLKYIDQIANVIARIKSNPNCRRLIVSAWNPADVDQMKLPPCHCFFQFKVYDGKLSCQLYQRSADMFLGVPFNIASYALLTTMIAHVCDLVPGEFIHTFGDAHIYLNHLDAVKEQLSRTPRPLPTLVLNQAKKDIFAFTFEDFEIKNYSPHDAIRAEVSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 2 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 3 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 4 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 5 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 6 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 237 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 250 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 272 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 278 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 279 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 280 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 281 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 282 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 283 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 284 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 285 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 286 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 287 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 288 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 289 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 290 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 369 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 415 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 425 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 431 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 432 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 433 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 436 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 437 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 438 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 439 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 440 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 443 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 446 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 447 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 0 |
| Rhizoplane | 5.2 |
| Rhizosphere | 87.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_101541 | 3300001430 | Bacteria | 939 |
| 2 | JGI24743J22301_10003350 | 3300001991 | Bacteria | 2525 |
| 3 | JGI24744J21845_10027098 | 3300002077 | Bacteria | 1109 |
| 4 | JGI25151J46595_10011269 | 3300003187 | Bacteria | 4117 |
| 5 | JGI25406J46586_10004150 | 3300003203 | Bacteria | 6759 |
| 6 | JGI25153J46596_10008999 | 3300003215 | Bacteria | 4700 |
| 7 | Ga0055537_1000928 | 3300003773 | Bacteria | 13696 |
| 8 | Ga0055524_1000173 | 3300003775 | Bacteria | 73388 |
| 9 | Ga0055536_1008604 | 3300003781 | Bacteria | 4355 |
| 10 | Ga0055534_1000077 | 3300003784 | Bacteria | 76400 |
| 11 | Ga0055528_1000085 | 3300003790 | Bacteria | 73426 |
| 12 | Ga0055531_10025153 | 3300003794 | Bacteria | 2172 |
| 13 | JGI25405J52794_10009844 | 3300003911 | Bacteria | 1811 |
| 14 | Ga0065712_10233304 | 3300005290 | Bacteria | 1005 |
| 15 | Ga0065707_10227956 | 3300005295 | Bacteria | 1199 |
| 16 | Ga0065707_10273660 | 3300005295 | Bacteria | 1065 |
| 17 | Ga0070658_10464784 | 3300005327 | Bacteria | 1091 |
| 18 | Ga0070676_10044744 | 3300005328 | Bacteria | 2577 |
| 19 | Ga0070676_10103735 | 3300005328 | Bacteria | 1761 |
| 20 | Ga0070683_100116818 | 3300005329 | Bacteria | 2519 |
| 21 | Ga0070683_100835748 | 3300005329 | Bacteria | 883 |
| 22 | Ga0070690_100075312 | 3300005330 | Bacteria | 2200 |
| 23 | Ga0070670_100000020 | 3300005331 | Bacteria | 215458 |
| 24 | Ga0070670_100196606 | 3300005331 | Bacteria | 1752 |
| 25 | Ga0070666_10034750 | 3300005335 | Bacteria | 3340 |
| 26 | Ga0070666_10136634 | 3300005335 | Bacteria | 1706 |
| 27 | Ga0070680_100017664 | 3300005336 | Bacteria | 5627 |
| 28 | Ga0070680_100033335 | 3300005336 | Bacteria | 4150 |
| 29 | Ga0070680_100129049 | 3300005336 | Bacteria | 2114 |
| 30 | Ga0070680_100197636 | 3300005336 | Bacteria | 1695 |
| 31 | Ga0070680_100349733 | 3300005336 | Bacteria | 1257 |
| 32 | Ga0070682_100034717 | 3300005337 | Bacteria | 3074 |
| 33 | Ga0070682_100112629 | 3300005337 | Bacteria | 1816 |
| 34 | Ga0068868_100103869 | 3300005338 | Bacteria | 2302 |
| 35 | Ga0070660_100087391 | 3300005339 | Bacteria | 2454 |
| 36 | Ga0070691_10083801 | 3300005341 | Bacteria | 1565 |
| 37 | Ga0070687_100072886 | 3300005343 | Bacteria | 1849 |
| 38 | Ga0070661_100016573 | 3300005344 | Bacteria | 5213 |
| 39 | Ga0070668_100000108 | 3300005347 | Bacteria | 50828 |
| 40 | Ga0070668_100005164 | 3300005347 | Bacteria | 9682 |
| 41 | Ga0070668_100031879 | 3300005347 | Bacteria | 4011 |
| 42 | Ga0070668_100051963 | 3300005347 | Bacteria | 3158 |
| 43 | Ga0070668_100054717 | 3300005347 | Bacteria | 3078 |
| 44 | Ga0070669_100031028 | 3300005353 | Bacteria | 3859 |
| 45 | Ga0070669_100111133 | 3300005353 | Bacteria | 2080 |
| 46 | Ga0070669_100172808 | 3300005353 | Bacteria | 1686 |
| 47 | Ga0070669_100209041 | 3300005353 | Bacteria | 1538 |
| 48 | Ga0070671_100031462 | 3300005355 | Bacteria | 4383 |
| 49 | Ga0070674_100000199 | 3300005356 | Bacteria | 28875 |
| 50 | Ga0070674_100023567 | 3300005356 | Bacteria | 3985 |
| 51 | Ga0070674_100142244 | 3300005356 | Bacteria | 1801 |
| 52 | Ga0070674_100176460 | 3300005356 | Bacteria | 1633 |
| 53 | Ga0070673_100055154 | 3300005364 | Bacteria | 3130 |
| 54 | Ga0070688_100005892 | 3300005365 | Bacteria | 6490 |
| 55 | Ga0070659_100215214 | 3300005366 | Bacteria | 1584 |
| 56 | Ga0070667_100000163 | 3300005367 | Bacteria | 83059 |
| 57 | Ga0070667_100006909 | 3300005367 | Bacteria | 9429 |
| 58 | Ga0070667_100044689 | 3300005367 | Bacteria | 3721 |
| 59 | Ga0070667_100056374 | 3300005367 | Bacteria | 3319 |
| 60 | Ga0070667_100070477 | 3300005367 | Bacteria | 2975 |
| 61 | Ga0070667_100106981 | 3300005367 | Bacteria | 2421 |
| 62 | Ga0070703_10063983 | 3300005406 | Bacteria | 1211 |
| 63 | Ga0070709_10003792 | 3300005434 | Bacteria | 8129 |
| 64 | Ga0070709_10005111 | 3300005434 | Bacteria | 7095 |
| 65 | Ga0070709_10133038 | 3300005434 | Bacteria | 1700 |
| 66 | Ga0070714_100017499 | 3300005435 | Bacteria | 5807 |
| 67 | Ga0070714_100018468 | 3300005435 | Bacteria | 5664 |
| 68 | Ga0070714_100092841 | 3300005435 | Bacteria | 2646 |
| 69 | Ga0070713_100063437 | 3300005436 | Bacteria | 3098 |
| 70 | Ga0070713_100230005 | 3300005436 | Bacteria | 1685 |
| 71 | Ga0070710_10019445 | 3300005437 | Bacteria | 3509 |
| 72 | Ga0070710_10034297 | 3300005437 | Bacteria | 2761 |
| 73 | Ga0070711_100038107 | 3300005439 | Bacteria | 3230 |
| 74 | Ga0070711_100040957 | 3300005439 | Bacteria | 3127 |
| 75 | Ga0070705_100117902 | 3300005440 | Bacteria | 1709 |
| 76 | Ga0070705_100387523 | 3300005440 | Bacteria | 1031 |
| 77 | Ga0070700_100100255 | 3300005441 | Bacteria | 1906 |
| 78 | Ga0070694_100003602 | 3300005444 | Bacteria | 9255 |
| 79 | Ga0070694_100005990 | 3300005444 | Bacteria | 7375 |
| 80 | Ga0070694_100050445 | 3300005444 | Bacteria | 2805 |
| 81 | Ga0070694_100067704 | 3300005444 | Bacteria | 2452 |
| 82 | Ga0070708_100203175 | 3300005445 | Bacteria | 1855 |
| 83 | Ga0070663_100062360 | 3300005455 | Bacteria | 2687 |
| 84 | Ga0070678_100065070 | 3300005456 | Bacteria | 2705 |
| 85 | Ga0070678_100073852 | 3300005456 | Bacteria | 2561 |
| 86 | Ga0070662_100042085 | 3300005457 | Bacteria | 3262 |
| 87 | Ga0070662_100096919 | 3300005457 | Bacteria | 2225 |
| 88 | Ga0070681_10054464 | 3300005458 | Bacteria | 3986 |
| 89 | Ga0070681_10094196 | 3300005458 | Bacteria | 2944 |
| 90 | Ga0070685_10039446 | 3300005466 | Bacteria | 2683 |
| 91 | Ga0070707_100010077 | 3300005468 | Bacteria | 8797 |
| 92 | Ga0070707_100154715 | 3300005468 | Bacteria | 2234 |
| 93 | Ga0070707_100313387 | 3300005468 | Bacteria | 1525 |
| 94 | Ga0070698_100025218 | 3300005471 | Bacteria | 6194 |
| 95 | Ga0070699_100037375 | 3300005518 | Bacteria | 4201 |
| 96 | Ga0070679_100003679 | 3300005530 | Bacteria | 14043 |
| 97 | Ga0070679_100028116 | 3300005530 | Bacteria | 5541 |
| 98 | Ga0070679_100083534 | 3300005530 | Bacteria | 3182 |
| 99 | Ga0070684_100135254 | 3300005535 | Bacteria | 2226 |
| 100 | Ga0070684_100390989 | 3300005535 | Bacteria | 1282 |
| 101 | Ga0068853_100196757 | 3300005539 | Bacteria | 1833 |
| 102 | Ga0070672_100026429 | 3300005543 | Bacteria | 4319 |
| 103 | Ga0070672_100374689 | 3300005543 | Bacteria | 1217 |
| 104 | Ga0070686_100010959 | 3300005544 | Bacteria | 5132 |
| 105 | Ga0070695_100033072 | 3300005545 | Bacteria | 3234 |
| 106 | Ga0070695_100059949 | 3300005545 | Bacteria | 2466 |
| 107 | Ga0070696_100030433 | 3300005546 | Bacteria | 3695 |
| 108 | Ga0070696_100059096 | 3300005546 | Bacteria | 2679 |
| 109 | Ga0070696_100132587 | 3300005546 | Bacteria | 1814 |
| 110 | Ga0070696_100187704 | 3300005546 | Bacteria | 1537 |
| 111 | Ga0070665_100001115 | 3300005548 | Bacteria | 33073 |
| 112 | Ga0070665_100033530 | 3300005548 | Bacteria | 5166 |
| 113 | Ga0070665_100477460 | 3300005548 | Bacteria | 1257 |
| 114 | Ga0070665_100558640 | 3300005548 | Bacteria | 1157 |
| 115 | Ga0070704_100018115 | 3300005549 | Bacteria | 4494 |
| 116 | Ga0070704_100066620 | 3300005549 | Bacteria | 2598 |
| 117 | Ga0070704_100126390 | 3300005549 | Bacteria | 1974 |
| 118 | Ga0070704_100337942 | 3300005549 | Bacteria | 1267 |
| 119 | Ga0068855_100121272 | 3300005563 | Bacteria | 2992 |
| 120 | Ga0068855_100284816 | 3300005563 | Bacteria | 1834 |
| 121 | Ga0068855_100398885 | 3300005563 | Bacteria | 1508 |
| 122 | Ga0068857_100219650 | 3300005577 | Bacteria | 1736 |
| 123 | Ga0068856_100120790 | 3300005614 | Bacteria | 2621 |
| 124 | Ga0070702_100070029 | 3300005615 | Bacteria | 2069 |
| 125 | Ga0068852_100320780 | 3300005616 | Bacteria | 1504 |
| 126 | Ga0068859_100016961 | 3300005617 | Bacteria | 7310 |
| 127 | Ga0068859_100048343 | 3300005617 | Bacteria | 4274 |
| 128 | Ga0068859_100157584 | 3300005617 | Bacteria | 2348 |
| 129 | Ga0068859_100194668 | 3300005617 | Bacteria | 2111 |
| 130 | Ga0068859_100360565 | 3300005617 | Bacteria | 1549 |
| 131 | Ga0068864_100000071 | 3300005618 | Bacteria | 111481 |
| 132 | Ga0068864_100017888 | 3300005618 | Bacteria | 5913 |
| 133 | Ga0068864_100190574 | 3300005618 | Bacteria | 1879 |
| 134 | Ga0068864_100403288 | 3300005618 | Bacteria | 1300 |
| 135 | Ga0068866_10074376 | 3300005718 | Bacteria | 1806 |
| 136 | Ga0068866_10128258 | 3300005718 | Bacteria | 1439 |
| 137 | Ga0068861_100039322 | 3300005719 | Bacteria | 3529 |
| 138 | Ga0068851_10000120 | 3300005834 | Bacteria | 42246 |
| 139 | Ga0068870_10220435 | 3300005840 | Bacteria | 1161 |
| 140 | Ga0068863_100000451 | 3300005841 | Bacteria | 41841 |
| 141 | Ga0068863_100064702 | 3300005841 | Bacteria | 3459 |
| 142 | Ga0068863_100123515 | 3300005841 | Bacteria | 2470 |
| 143 | Ga0068863_100217489 | 3300005841 | Bacteria | 1840 |
| 144 | Ga0068863_100790968 | 3300005841 | Bacteria | 946 |
| 145 | Ga0068858_100000029 | 3300005842 | Bacteria | 144691 |
| 146 | Ga0068858_100002275 | 3300005842 | Bacteria | 19425 |
| 147 | Ga0068858_100033224 | 3300005842 | Bacteria | 4790 |
| 148 | Ga0068858_100245385 | 3300005842 | Bacteria | 1700 |
| 149 | Ga0068860_100142638 | 3300005843 | Bacteria | 2303 |
| 150 | Ga0068860_100208863 | 3300005843 | Bacteria | 1893 |
| 151 | Ga0068862_100001526 | 3300005844 | Bacteria | 21211 |
| 152 | Ga0068862_100009403 | 3300005844 | Bacteria | 8086 |
| 153 | Ga0068862_100012637 | 3300005844 | Bacteria | 6988 |
| 154 | Ga0068862_100162210 | 3300005844 | Bacteria | 1996 |
| 155 | Ga0081455_10011386 | 3300005937 | Bacteria | 8941 |
| 156 | Ga0081455_10108197 | 3300005937 | Bacteria | 2215 |
| 157 | Ga0081455_10183322 | 3300005937 | Bacteria | 1583 |
| 158 | Ga0081538_10040288 | 3300005981 | Bacteria | 2982 |
| 159 | Ga0081540_1000869 | 3300005983 | Bacteria | 27365 |
| 160 | Ga0081540_1000925 | 3300005983 | Bacteria | 26377 |
| 161 | Ga0081540_1020032 | 3300005983 | Bacteria | 4039 |
| 162 | Ga0081540_1024207 | 3300005983 | Bacteria | 3528 |
| 163 | Ga0081540_1137282 | 3300005983 | Bacteria | 988 |
| 164 | Ga0081539_10007161 | 3300005985 | Bacteria | 10285 |
| 165 | Ga0070717_10000377 | 3300006028 | Bacteria | 28454 |
| 166 | Ga0075365_10018424 | 3300006038 | Bacteria | 4293 |
| 167 | Ga0075365_10028585 | 3300006038 | Bacteria | 3557 |
| 168 | Ga0075363_100034239 | 3300006048 | Bacteria | 2650 |
| 169 | Ga0075363_100045718 | 3300006048 | Bacteria | 2322 |
| 170 | Ga0075364_10024862 | 3300006051 | Bacteria | 3808 |
| 171 | Ga0075364_10341842 | 3300006051 | Bacteria | 1020 |
| 172 | Ga0070715_10026458 | 3300006163 | Bacteria | 2309 |
| 173 | Ga0070715_10057430 | 3300006163 | Bacteria | 1695 |
| 174 | Ga0070716_100002527 | 3300006173 | Bacteria | 8473 |
| 175 | Ga0070716_100094885 | 3300006173 | Bacteria | 1815 |
| 176 | Ga0070712_100082962 | 3300006175 | Bacteria | 2326 |
| 177 | Ga0075362_10017105 | 3300006177 | Bacteria | 2982 |
| 178 | Ga0075369_10001871 | 3300006186 | Bacteria | 7355 |
| 179 | Ga0097621_100033091 | 3300006237 | Bacteria | 4114 |
| 180 | Ga0097621_100078746 | 3300006237 | Bacteria | 2738 |
| 181 | Ga0097621_100222433 | 3300006237 | Bacteria | 1645 |
| 182 | Ga0097621_100295236 | 3300006237 | Bacteria | 1430 |
| 183 | Ga0068871_100035625 | 3300006358 | Bacteria | 3956 |
| 184 | Ga0068871_100163007 | 3300006358 | Bacteria | 1907 |
| 185 | Ga0068871_100485698 | 3300006358 | Bacteria | 1112 |
| 186 | Ga0068871_100526784 | 3300006358 | Bacteria | 1068 |
| 187 | Ga0075428_100077850 | 3300006844 | Bacteria | 3619 |
| 188 | Ga0075428_100088833 | 3300006844 | Bacteria | 3371 |
| 189 | Ga0075430_100000617 | 3300006846 | Bacteria | 27125 |
| 190 | Ga0075430_100003539 | 3300006846 | Bacteria | 13076 |
| 191 | Ga0075430_100025309 | 3300006846 | Bacteria | 5049 |
| 192 | Ga0075431_100003819 | 3300006847 | Bacteria | 14638 |
| 193 | Ga0075431_100021855 | 3300006847 | Bacteria | 6541 |
| 194 | Ga0075431_100047714 | 3300006847 | Bacteria | 4416 |
| 195 | Ga0075431_100296804 | 3300006847 | Bacteria | 1633 |
| 196 | Ga0075431_100618393 | 3300006847 | Bacteria | 1066 |
| 197 | Ga0075431_100663013 | 3300006847 | Bacteria | 1023 |
| 198 | Ga0075433_10125584 | 3300006852 | Bacteria | 2278 |
| 199 | Ga0075433_10181745 | 3300006852 | Bacteria | 1872 |
| 200 | Ga0075434_100006453 | 3300006871 | Bacteria | 10750 |
| 201 | Ga0075434_100055718 | 3300006871 | Bacteria | 3928 |
| 202 | Ga0075434_100689859 | 3300006871 | Bacteria | 1039 |
| 203 | Ga0075429_100000019 | 3300006880 | Bacteria | 70971 |
| 204 | Ga0068865_100018172 | 3300006881 | Bacteria | 4534 |
| 205 | Ga0068865_100074017 | 3300006881 | Bacteria | 2424 |
| 206 | Ga0068865_100142583 | 3300006881 | Bacteria | 1808 |
| 207 | Ga0075436_100026004 | 3300006914 | Bacteria | 4030 |
| 208 | Ga0097620_100016961 | 3300006931 | Bacteria | 7310 |
| 209 | Ga0097620_100048344 | 3300006931 | Bacteria | 4274 |
| 210 | Ga0097620_100157582 | 3300006931 | Bacteria | 2348 |
| 211 | Ga0097620_100194667 | 3300006931 | Bacteria | 2111 |
| 212 | Ga0097620_100360558 | 3300006931 | Bacteria | 1549 |
| 213 | Ga0075435_100034059 | 3300007076 | Bacteria | 4032 |
| 214 | Ga0075435_100035744 | 3300007076 | Bacteria | 3943 |
| 215 | Ga0105240_10007706 | 3300009093 | Bacteria | 15578 |
| 216 | Ga0105240_10067540 | 3300009093 | Bacteria | 4431 |
| 217 | Ga0105240_10579805 | 3300009093 | Bacteria | 1237 |
| 218 | Ga0105240_10599855 | 3300009093 | Bacteria | 1213 |
| 219 | Ga0111539_10035620 | 3300009094 | Bacteria | 6024 |
| 220 | Ga0111539_10220872 | 3300009094 | Bacteria | 2207 |
| 221 | Ga0111539_10443705 | 3300009094 | Bacteria | 1511 |
| 222 | Ga0111539_10516128 | 3300009094 | Bacteria | 1392 |
| 223 | Ga0111539_10710599 | 3300009094 | Bacteria | 1170 |
| 224 | Ga0105245_10016102 | 3300009098 | Bacteria | 6515 |
| 225 | Ga0105245_10081242 | 3300009098 | Bacteria | 2963 |
| 226 | Ga0105247_10073339 | 3300009101 | Bacteria | 2144 |
| 227 | Ga0105247_10132744 | 3300009101 | Bacteria | 1624 |
| 228 | Ga0114129_10040477 | 3300009147 | Bacteria | 6569 |
| 229 | Ga0114129_10092045 | 3300009147 | Bacteria | 4201 |
| 230 | Ga0114129_10245526 | 3300009147 | Bacteria | 2405 |
| 231 | Ga0105243_10642671 | 3300009148 | Bacteria | 1027 |
| 232 | Ga0105243_10674974 | 3300009148 | Bacteria | 1004 |
| 233 | Ga0105241_10083262 | 3300009174 | Bacteria | 2509 |
| 234 | Ga0105241_10202785 | 3300009174 | Bacteria | 1658 |
| 235 | Ga0105242_10007510 | 3300009176 | Bacteria | 8387 |
| 236 | Ga0105242_10222522 | 3300009176 | Bacteria | 1687 |
| 237 | Ga0105242_10416572 | 3300009176 | Bacteria | 1258 |
| 238 | Ga0105242_10872090 | 3300009176 | Bacteria | 897 |
| 239 | Ga0105248_10005446 | 3300009177 | Bacteria | 13989 |
| 240 | Ga0105248_10016560 | 3300009177 | Bacteria | 8118 |
| 241 | Ga0105248_10020734 | 3300009177 | Bacteria | 7281 |
| 242 | Ga0105248_10046795 | 3300009177 | Bacteria | 4851 |
| 243 | Ga0105248_10083691 | 3300009177 | Bacteria | 3589 |
| 244 | Ga0105237_10166457 | 3300009545 | Bacteria | 2204 |
| 245 | Ga0105237_10643771 | 3300009545 | Bacteria | 1067 |
| 246 | Ga0105238_10011476 | 3300009551 | Bacteria | 8924 |
| 247 | Ga0105238_10100191 | 3300009551 | Bacteria | 2880 |
| 248 | Ga0105238_10184774 | 3300009551 | Bacteria | 2061 |
| 249 | Ga0105238_10695149 | 3300009551 | Bacteria | 1029 |
| 250 | Ga0105249_10000792 | 3300009553 | Bacteria | 28363 |
| 251 | Ga0105249_10135218 | 3300009553 | Bacteria | 2358 |
| 252 | Ga0105249_10137200 | 3300009553 | Bacteria | 2342 |
| 253 | Ga0105249_10138854 | 3300009553 | Bacteria | 2328 |
| 254 | Ga0105032_100258 | 3300009979 | Bacteria | 5476 |
| 255 | Ga0105239_10007278 | 3300010375 | Bacteria | 12708 |
| 256 | Ga0105239_10075495 | 3300010375 | Bacteria | 3706 |
| 257 | Ga0105246_10064378 | 3300011119 | Bacteria | 2561 |
| 258 | Ga0105246_10421822 | 3300011119 | Bacteria | 1114 |
| 259 | Ga0157371_10014815 | 3300013102 | Bacteria | 5869 |
| 260 | Ga0157370_10147531 | 3300013104 | Bacteria | 2190 |
| 261 | Ga0157369_10000077 | 3300013105 | Viruses | 136165 |
| 262 | Ga0157374_10149095 | 3300013296 | Bacteria | 2273 |
| 263 | Ga0157378_10095979 | 3300013297 | Bacteria | 2701 |
| 264 | Ga0157378_10172376 | 3300013297 | Bacteria | 2030 |
| 265 | Ga0157378_10334615 | 3300013297 | Bacteria | 1475 |
| 266 | Ga0157378_10455304 | 3300013297 | Bacteria | 1271 |
| 267 | Ga0157378_10912542 | 3300013297 | Bacteria | 909 |
| 268 | Ga0163162_10035839 | 3300013306 | Bacteria | 4942 |
| 269 | Ga0157372_10264568 | 3300013307 | Bacteria | 1997 |
| 270 | Ga0157372_10656342 | 3300013307 | Bacteria | 1222 |
| 271 | Ga0157372_10830136 | 3300013307 | Bacteria | 1073 |
| 272 | Ga0157375_10104866 | 3300013308 | Bacteria | 2916 |
| 273 | Ga0157377_10350609 | 3300014745 | Bacteria | 990 |
| 274 | Ga0157379_10009298 | 3300014968 | Bacteria | 8559 |
| 275 | Ga0157376_10051396 | 3300014969 | Bacteria | 3423 |
| 276 | Ga0163161_10167318 | 3300017792 | Bacteria | 1679 |
| 277 | Ga0213872_10000497 | 3300021361 | Bacteria | 31473 |
| 278 | Ga0213872_10000696 | 3300021361 | Bacteria | 25247 |
| 279 | Ga0213872_10002088 | 3300021361 | Bacteria | 12051 |
| 280 | Ga0213872_10014355 | 3300021361 | Bacteria | 3696 |
| 281 | Ga0213872_10045115 | 3300021361 | Bacteria | 2005 |
| 282 | Ga0213876_10015170 | 3300021384 | Bacteria | 4082 |
| 283 | Ga0213876_10060688 | 3300021384 | Bacteria | 1995 |
| 284 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 285 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 286 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 287 | Ga0209676_1000046 | 3300025292 | Bacteria | 409173 |
| 288 | Ga0209676_1000436 | 3300025292 | Bacteria | 72143 |
| 289 | Ga0209676_1004756 | 3300025292 | Bacteria | 7409 |
| 290 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 291 | Ga0209758_1000139 | 3300025297 | Bacteria | 175148 |
| 292 | Ga0209050_1019572 | 3300025298 | Bacteria | 2564 |
| 293 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 294 | Ga0209257_1000505 | 3300025304 | Bacteria | 68565 |
| 295 | Ga0207656_10000165 | 3300025321 | Bacteria | 24447 |
| 296 | Ga0207653_10051551 | 3300025885 | Bacteria | 1371 |
| 297 | Ga0207682_10000171 | 3300025893 | Bacteria | 29817 |
| 298 | Ga0207692_10026289 | 3300025898 | Bacteria | 2729 |
| 299 | Ga0207692_10125308 | 3300025898 | Bacteria | 1444 |
| 300 | Ga0207688_10079370 | 3300025901 | Bacteria | 1872 |
| 301 | Ga0207688_10128291 | 3300025901 | Bacteria | 1485 |
| 302 | Ga0207680_10189154 | 3300025903 | Bacteria | 1396 |
| 303 | Ga0207685_10015243 | 3300025905 | Bacteria | 2431 |
| 304 | Ga0207699_10000553 | 3300025906 | Bacteria | 18426 |
| 305 | Ga0207699_10020681 | 3300025906 | Bacteria | 3532 |
| 306 | Ga0207699_10052584 | 3300025906 | Bacteria | 2412 |
| 307 | Ga0207699_10143305 | 3300025906 | Bacteria | 1572 |
| 308 | Ga0207705_10011301 | 3300025909 | Bacteria | 6468 |
| 309 | Ga0207705_10452832 | 3300025909 | Bacteria | 995 |
| 310 | Ga0207684_10028554 | 3300025910 | Bacteria | 4753 |
| 311 | Ga0207654_10060252 | 3300025911 | Bacteria | 2217 |
| 312 | Ga0207654_10153188 | 3300025911 | Bacteria | 1482 |
| 313 | Ga0207654_10229968 | 3300025911 | Bacteria | 1234 |
| 314 | Ga0207707_10015959 | 3300025912 | Bacteria | 6550 |
| 315 | Ga0207707_10141471 | 3300025912 | Bacteria | 2104 |
| 316 | Ga0207695_10005429 | 3300025913 | Bacteria | 16916 |
| 317 | Ga0207695_10110311 | 3300025913 | Bacteria | 2732 |
| 318 | Ga0207695_10159371 | 3300025913 | Bacteria | 2189 |
| 319 | Ga0207695_10287790 | 3300025913 | Bacteria | 1536 |
| 320 | Ga0207671_10113007 | 3300025914 | Bacteria | 2068 |
| 321 | Ga0207693_10035526 | 3300025915 | Bacteria | 3929 |
| 322 | Ga0207693_10069351 | 3300025915 | Bacteria | 2759 |
| 323 | Ga0207693_10316041 | 3300025915 | Bacteria | 1223 |
| 324 | Ga0207663_10028986 | 3300025916 | Bacteria | 3246 |
| 325 | Ga0207660_10014525 | 3300025917 | Bacteria | 5180 |
| 326 | Ga0207660_10096567 | 3300025917 | Bacteria | 2200 |
| 327 | Ga0207660_10113101 | 3300025917 | Bacteria | 2046 |
| 328 | Ga0207660_10123551 | 3300025917 | Bacteria | 1963 |
| 329 | Ga0207660_10183505 | 3300025917 | Bacteria | 1626 |
| 330 | Ga0207662_10033608 | 3300025918 | Bacteria | 2990 |
| 331 | Ga0207662_10051144 | 3300025918 | Bacteria | 2457 |
| 332 | Ga0207657_10035581 | 3300025919 | Bacteria | 4464 |
| 333 | Ga0207657_10053807 | 3300025919 | Bacteria | 3484 |
| 334 | Ga0207652_10018220 | 3300025921 | Bacteria | 5757 |
| 335 | Ga0207652_10024455 | 3300025921 | Bacteria | 5011 |
| 336 | Ga0207652_10036093 | 3300025921 | Bacteria | 4178 |
| 337 | Ga0207652_10067062 | 3300025921 | Bacteria | 3111 |
| 338 | Ga0207646_10069984 | 3300025922 | Bacteria | 3134 |
| 339 | Ga0207646_10095220 | 3300025922 | Bacteria | 2667 |
| 340 | Ga0207681_10013529 | 3300025923 | Bacteria | 5053 |
| 341 | Ga0207681_10018147 | 3300025923 | Bacteria | 4430 |
| 342 | Ga0207681_10337569 | 3300025923 | Bacteria | 1203 |
| 343 | Ga0207694_10039122 | 3300025924 | Bacteria | 3648 |
| 344 | Ga0207694_10069298 | 3300025924 | Bacteria | 2755 |
| 345 | Ga0207694_10387872 | 3300025924 | Bacteria | 1160 |
| 346 | Ga0207694_10494041 | 3300025924 | Bacteria | 1024 |
| 347 | Ga0207650_10000175 | 3300025925 | Bacteria | 75521 |
| 348 | Ga0207650_10065717 | 3300025925 | Bacteria | 2719 |
| 349 | Ga0207687_10060600 | 3300025927 | Bacteria | 2670 |
| 350 | Ga0207687_10308475 | 3300025927 | Bacteria | 1277 |
| 351 | Ga0207700_10000974 | 3300025928 | Bacteria | 16532 |
| 352 | Ga0207700_10027171 | 3300025928 | Bacteria | 4003 |
| 353 | Ga0207700_10056100 | 3300025928 | Bacteria | 2964 |
| 354 | Ga0207700_10082062 | 3300025928 | Bacteria | 2520 |
| 355 | Ga0207700_10147162 | 3300025928 | Bacteria | 1943 |
| 356 | Ga0207664_10025181 | 3300025929 | Bacteria | 4478 |
| 357 | Ga0207664_10069459 | 3300025929 | Bacteria | 2833 |
| 358 | Ga0207664_10069929 | 3300025929 | Bacteria | 2823 |
| 359 | Ga0207644_10004087 | 3300025931 | Bacteria | 9462 |
| 360 | Ga0207644_10007589 | 3300025931 | Bacteria | 7073 |
| 361 | Ga0207706_10009732 | 3300025933 | Bacteria | 8821 |
| 362 | Ga0207706_10071563 | 3300025933 | Bacteria | 3050 |
| 363 | Ga0207686_10038270 | 3300025934 | Bacteria | 2901 |
| 364 | Ga0207686_10051864 | 3300025934 | Bacteria | 2557 |
| 365 | Ga0207686_10087052 | 3300025934 | Bacteria | 2054 |
| 366 | Ga0207670_10024728 | 3300025936 | Bacteria | 3758 |
| 367 | Ga0207670_10073924 | 3300025936 | Bacteria | 2365 |
| 368 | Ga0207670_10455386 | 3300025936 | Bacteria | 1032 |
| 369 | Ga0207704_10044627 | 3300025938 | Bacteria | 2627 |
| 370 | Ga0207704_10167045 | 3300025938 | Bacteria | 1573 |
| 371 | Ga0207704_10324622 | 3300025938 | Bacteria | 1189 |
| 372 | Ga0207665_10008397 | 3300025939 | Bacteria | 6813 |
| 373 | Ga0207665_10084392 | 3300025939 | Bacteria | 2192 |
| 374 | Ga0207665_10099668 | 3300025939 | Bacteria | 2026 |
| 375 | Ga0207665_10116867 | 3300025939 | Bacteria | 1880 |
| 376 | Ga0207665_10258911 | 3300025939 | Bacteria | 1288 |
| 377 | Ga0207691_10004900 | 3300025940 | Bacteria | 12937 |
| 378 | Ga0207691_10378582 | 3300025940 | Bacteria | 1208 |
| 379 | Ga0207711_10001642 | 3300025941 | Bacteria | 20636 |
| 380 | Ga0207711_10208102 | 3300025941 | Bacteria | 1787 |
| 381 | Ga0207689_10057574 | 3300025942 | Bacteria | 3197 |
| 382 | Ga0207689_10230424 | 3300025942 | Bacteria | 1531 |
| 383 | Ga0207689_10252882 | 3300025942 | Bacteria | 1457 |
| 384 | Ga0207661_10038326 | 3300025944 | Bacteria | 3756 |
| 385 | Ga0207667_10050320 | 3300025949 | Bacteria | 4397 |
| 386 | Ga0207667_10149652 | 3300025949 | Bacteria | 2403 |
| 387 | Ga0207651_10067000 | 3300025960 | Bacteria | 2525 |
| 388 | Ga0207712_10000376 | 3300025961 | Bacteria | 39304 |
| 389 | Ga0207712_10065685 | 3300025961 | Bacteria | 2590 |
| 390 | Ga0207712_10078711 | 3300025961 | Bacteria | 2393 |
| 391 | Ga0207712_10262516 | 3300025961 | Bacteria | 1401 |
| 392 | Ga0207712_10278504 | 3300025961 | Bacteria | 1364 |
| 393 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 394 | Ga0207668_10000123 | 3300025972 | Bacteria | 54467 |
| 395 | Ga0207668_10003923 | 3300025972 | Bacteria | 8772 |
| 396 | Ga0207668_10016411 | 3300025972 | Bacteria | 4621 |
| 397 | Ga0207658_10000118 | 3300025986 | Bacteria | 87228 |
| 398 | Ga0207658_10009958 | 3300025986 | Bacteria | 6460 |
| 399 | Ga0207658_10090613 | 3300025986 | Bacteria | 2370 |
| 400 | Ga0207658_10484306 | 3300025986 | Bacteria | 1100 |
| 401 | Ga0207658_10649969 | 3300025986 | Bacteria | 950 |
| 402 | Ga0207658_10722571 | 3300025986 | Bacteria | 901 |
| 403 | Ga0207677_10043892 | 3300026023 | Bacteria | 2975 |
| 404 | Ga0207703_10002470 | 3300026035 | Bacteria | 16035 |
| 405 | Ga0207703_10129636 | 3300026035 | Bacteria | 2176 |
| 406 | Ga0207639_10295327 | 3300026041 | Bacteria | 1430 |
| 407 | Ga0207678_10021192 | 3300026067 | Bacteria | 5697 |
| 408 | Ga0207678_10021441 | 3300026067 | Bacteria | 5664 |
| 409 | Ga0207678_10083115 | 3300026067 | Bacteria | 2739 |
| 410 | Ga0207708_10060407 | 3300026075 | Bacteria | 2893 |
| 411 | Ga0207708_10167170 | 3300026075 | Bacteria | 1739 |
| 412 | Ga0207641_10001419 | 3300026088 | Bacteria | 23630 |
| 413 | Ga0207641_10018297 | 3300026088 | Bacteria | 5743 |
| 414 | Ga0207641_10053054 | 3300026088 | Bacteria | 3435 |
| 415 | Ga0207648_10388456 | 3300026089 | Bacteria | 1263 |
| 416 | Ga0207676_10001782 | 3300026095 | Bacteria | 15788 |
| 417 | Ga0207676_10182782 | 3300026095 | Bacteria | 1837 |
| 418 | Ga0207676_10307420 | 3300026095 | Bacteria | 1450 |
| 419 | Ga0207674_10188718 | 3300026116 | Bacteria | 2011 |
| 420 | Ga0207675_100037302 | 3300026118 | Bacteria | 4534 |
| 421 | Ga0207675_100331768 | 3300026118 | Bacteria | 1487 |
| 422 | Ga0207683_10000902 | 3300026121 | Bacteria | 27333 |
| 423 | Ga0207683_10050440 | 3300026121 | Bacteria | 3645 |
| 424 | Ga0207683_10092348 | 3300026121 | Bacteria | 2697 |
| 425 | Ga0209969_1004755 | 3300027360 | Bacteria | 1899 |
| 426 | Ga0209996_1008531 | 3300027395 | Bacteria | 1343 |
| 427 | Ga0209966_1018921 | 3300027695 | Bacteria | 1323 |
| 428 | Ga0207428_10064223 | 3300027907 | Bacteria | 2899 |
| 429 | Ga0207428_10406540 | 3300027907 | Bacteria | 996 |
| 430 | Ga0268266_10001669 | 3300028379 | Bacteria | 25581 |
| 431 | Ga0268266_10022103 | 3300028379 | Bacteria | 5422 |
| 432 | Ga0268266_10236137 | 3300028379 | Bacteria | 1685 |
| 433 | Ga0268266_10252841 | 3300028379 | Bacteria | 1630 |
| 434 | Ga0268266_10269888 | 3300028379 | Bacteria | 1579 |
| 435 | Ga0268265_10000901 | 3300028380 | Bacteria | 27588 |
| 436 | Ga0268265_10007451 | 3300028380 | Bacteria | 7391 |
| 437 | Ga0268265_10008301 | 3300028380 | Bacteria | 7015 |
| 438 | Ga0268265_10261546 | 3300028380 | Bacteria | 1539 |
| 439 | Ga0268264_10000481 | 3300028381 | Bacteria | 53088 |
| 440 | Ga0268264_10066058 | 3300028381 | Bacteria | 3050 |
| 441 | Ga0265337_1003784 | 3300028556 | Bacteria | 6453 |
| 442 | Ga0265319_1015151 | 3300028563 | Bacteria | 2999 |
| 443 | Ga0265334_10000143 | 3300028573 | Bacteria | 44504 |
| 444 | Ga0265334_10007008 | 3300028573 | Bacteria | 4839 |
| 445 | Ga0265334_10009472 | 3300028573 | Bacteria | 4119 |
| 446 | Ga0265318_10003937 | 3300028577 | Bacteria | 7319 |
| 447 | Ga0265318_10017959 | 3300028577 | Bacteria | 2895 |
| 448 | Ga0265338_10000043 | 3300028800 | Bacteria | 226293 |
| 449 | Ga0265338_10012357 | 3300028800 | Bacteria | 9737 |
| 450 | Ga0265338_10022519 | 3300028800 | Bacteria | 6520 |
| 451 | Ga0265338_10027204 | 3300028800 | Bacteria | 5743 |
| 452 | Ga0265338_10076391 | 3300028800 | Bacteria | 2837 |
| 453 | Ga0265338_10109174 | 3300028800 | Bacteria | 2233 |
| 454 | Ga0265324_10041806 | 3300029957 | Bacteria | 1585 |
| 455 | Ga0265330_10005644 | 3300031235 | Bacteria | 6220 |
| 456 | Ga0265330_10083821 | 3300031235 | Bacteria | 1372 |
| 457 | Ga0265332_10004974 | 3300031238 | Bacteria | 6179 |
| 458 | Ga0265332_10030001 | 3300031238 | Bacteria | 2376 |
| 459 | Ga0265328_10008731 | 3300031239 | Bacteria | 4160 |
| 460 | Ga0265328_10009813 | 3300031239 | Bacteria | 3880 |
| 461 | Ga0265320_10004052 | 3300031240 | Bacteria | 9632 |
| 462 | Ga0265325_10000002 | 3300031241 | Bacteria | 396758 |
| 463 | Ga0265325_10000036 | 3300031241 | Bacteria | 96858 |
| 464 | Ga0265325_10000464 | 3300031241 | Bacteria | 29365 |
| 465 | Ga0265325_10012515 | 3300031241 | Bacteria | 4850 |
| 466 | Ga0265329_10006598 | 3300031242 | Bacteria | 4591 |
| 467 | Ga0265340_10000952 | 3300031247 | Bacteria | 16474 |
| 468 | Ga0265340_10007138 | 3300031247 | Bacteria | 6086 |
| 469 | Ga0265340_10017926 | 3300031247 | Bacteria | 3660 |
| 470 | Ga0265340_10032994 | 3300031247 | Bacteria | 2580 |
| 471 | Ga0265340_10165645 | 3300031247 | Bacteria | 1003 |
| 472 | Ga0265339_10000625 | 3300031249 | Bacteria | 27424 |
| 473 | Ga0265339_10001612 | 3300031249 | Bacteria | 16687 |
| 474 | Ga0265339_10009163 | 3300031249 | Bacteria | 6245 |
| 475 | Ga0265331_10001902 | 3300031250 | Bacteria | 14645 |
| 476 | Ga0265331_10030827 | 3300031250 | Bacteria | 2667 |
| 477 | Ga0265331_10091730 | 3300031250 | Bacteria | 1403 |
| 478 | Ga0265316_10006610 | 3300031344 | Bacteria | 11045 |
| 479 | Ga0265316_10008327 | 3300031344 | Bacteria | 9627 |
| 480 | Ga0265316_10205196 | 3300031344 | Bacteria | 1460 |
| 481 | Ga0307513_10046517 | 3300031456 | Bacteria | 4729 |
| 482 | Ga0265313_10000513 | 3300031595 | Bacteria | 40580 |
| 483 | Ga0265313_10001147 | 3300031595 | Bacteria | 25315 |
| 484 | Ga0265313_10001243 | 3300031595 | Bacteria | 24298 |
| 485 | Ga0265313_10001570 | 3300031595 | Bacteria | 21191 |
| 486 | Ga0265313_10011866 | 3300031595 | Bacteria | 5382 |
| 487 | Ga0265313_10015324 | 3300031595 | Bacteria | 4472 |
| 488 | Ga0265313_10077748 | 3300031595 | Bacteria | 1514 |
| 489 | Ga0265313_10129214 | 3300031595 | Bacteria | 1096 |
| 490 | Ga0316579_10022141 | 3300031691 | Bacteria | 2839 |
| 491 | Ga0265314_10005001 | 3300031711 | Bacteria | 12077 |
| 492 | Ga0265342_10000715 | 3300031712 | Bacteria | 34304 |
| 493 | Ga0265342_10007638 | 3300031712 | Bacteria | 7882 |
| 494 | Ga0265342_10010075 | 3300031712 | Bacteria | 6590 |
| 495 | Ga0265342_10090585 | 3300031712 | Bacteria | 1753 |
| 496 | Ga0307516_10000020 | 3300031730 | Bacteria | 195931 |
| 497 | Ga0307410_10178059 | 3300031852 | Bacteria | 1608 |
| 498 | Ga0307406_10002705 | 3300031901 | Bacteria | 9664 |
| 499 | Ga0307406_10083660 | 3300031901 | Bacteria | 2129 |
| 500 | Ga0307409_100481546 | 3300031995 | Bacteria | 1204 |
| 501 | Ga0307414_10083810 | 3300032004 | Bacteria | 2342 |
| 502 | Ga0307414_10195618 | 3300032004 | Bacteria | 1640 |
| 503 | Ga0373930_0049990 | 3300034816 | Bacteria | 911 |
| 504 | Ga0373938_0000453 | 3300034957 | Bacteria | 6689 |
| 505 | Ga0373926_0095560 | 3300035083 | Bacteria | 1108 |
| 506 | Ga0373928_0054743 | 3300035084 | Bacteria | 951 |
| 507 | Ga0373940_0009414 | 3300035088 | Bacteria | 2272 |
| 508 | Ga0373940_0059527 | 3300035088 | Bacteria | 1090 |
| 509 | Ga0373944_0066480 | 3300035089 | Bacteria | 1166 |
| 510 | Ga0373949_0023914 | 3300035090 | Bacteria | 1418 |
| 511 | Ga0373923_0031497 | 3300035111 | Bacteria | 2138 |
| 512 | Ga0373936_0048609 | 3300035113 | Bacteria | 1712 |
| 513 | Ga0373936_0122426 | 3300035113 | Bacteria | 1112 |
| 514 | Ga0373939_0019310 | 3300035114 | Bacteria | 1837 |
| 515 | Ga0373939_0053327 | 3300035114 | Bacteria | 1263 |
| 516 | Ga0373941_0049605 | 3300035115 | Bacteria | 1329 |
| 517 | Ga0373945_0003237 | 3300035116 | Bacteria | 5112 |
| 518 | Ga0373945_0029563 | 3300035116 | Bacteria | 1926 |
| 519 | Ga0373945_0041680 | 3300035116 | Bacteria | 1661 |
| 520 | Ga0373953_0003538 | 3300035117 | Bacteria | 4879 |
| 521 | Ga0373953_0004967 | 3300035117 | Bacteria | 4283 |
| 522 | Ga0373953_0034560 | 3300035117 | Bacteria | 1982 |
| 523 | Ga0373953_0103293 | 3300035117 | Bacteria | 1201 |
| 524 | Ga0373954_0000020 | 3300035118 | Bacteria | 60211 |
| 525 | Ga0373954_0005850 | 3300035118 | Bacteria | 5341 |
| 526 | Ga0373954_0010400 | 3300035118 | Bacteria | 4106 |
| 527 | Ga0373954_0049628 | 3300035118 | Bacteria | 1968 |
| 528 | Ga0373956_0009309 | 3300035119 | Bacteria | 3993 |
| 529 | Ga0373956_0018550 | 3300035119 | Bacteria | 2947 |
| 530 | Ga0373956_0030175 | 3300035119 | Bacteria | 2368 |
| 531 | Ga0373956_0079868 | 3300035119 | Bacteria | 1500 |
| 532 | Ga0373956_0106861 | 3300035119 | Bacteria | 1301 |
| 533 | Ga0373957_0014040 | 3300035120 | Bacteria | 2731 |
| 534 | Ga0373957_0020115 | 3300035120 | Bacteria | 2356 |
| 535 | Ga0373957_0076370 | 3300035120 | Bacteria | 1317 |
| 536 | Ga0373960_0012957 | 3300035121 | Bacteria | 2082 |
| 537 | Ga0373943_0001299 | 3300035170 | Bacteria | 11220 |
| 538 | Ga0373943_0083922 | 3300035170 | Bacteria | 1638 |
| 539 | Ga0373946_0001129 | 3300035171 | Bacteria | 9232 |
| 540 | Ga0373955_0001159 | 3300035172 | Bacteria | 11195 |
| 541 | Ga0373955_0002257 | 3300035172 | Bacteria | 8373 |
| 542 | Ga0373955_0016631 | 3300035172 | Bacteria | 3624 |
| 543 | Ga0373955_0016708 | 3300035172 | Bacteria | 3616 |
| 544 | Ga0373962_0002352 | 3300035242 | Bacteria | 4513 |
| 545 | Ga0373962_0042640 | 3300035242 | Bacteria | 1284 |
| 546 | Ga0316574_0118410 | 3300035398 | Bacteria | 1699 |
| 547 | Ga0373924_0000412 | 3300035410 | Bacteria | 13128 |
| 548 | Ga0373924_0149782 | 3300035410 | Bacteria | 1020 |
| 549 | Ga0373924_0185718 | 3300035410 | Bacteria | 915 |
| 550 | Ga0373931_0017584 | 3300035691 | Bacteria | 3540 |
| 551 | Ga0373931_0112714 | 3300035691 | Bacteria | 1545 |
| 552 | Ga0373935_0000100 | 3300035692 | Bacteria | 38385 |
| 553 | Ga0373935_0003876 | 3300035692 | Bacteria | 8728 |
| 554 | Ga0373935_0012884 | 3300035692 | Bacteria | 5037 |
| 555 | Ga0373935_0018083 | 3300035692 | Bacteria | 4285 |
| 556 | Ga0373935_0753671 | 3300035692 | Bacteria | 717 |
| 557 | Ga0373927_0027983 | 3300035695 | Bacteria | 3679 |
| 558 | Ga0373927_0028096 | 3300035695 | Bacteria | 3670 |
| 559 | Ga0373927_0037835 | 3300035695 | Bacteria | 3135 |
| 560 | Ga0373927_0168007 | 3300035695 | Bacteria | 1437 |
| 561 | Ga0373927_0170787 | 3300035695 | Bacteria | 1425 |
| 562 | Ga0373933_0004387 | 3300035724 | Bacteria | 7746 |
| 563 | Ga0373933_0004411 | 3300035724 | Bacteria | 7729 |
| 564 | Ga0373933_0005938 | 3300035724 | Bacteria | 6643 |
| 565 | Ga0373933_0020540 | 3300035724 | Bacteria | 3744 |
| 566 | Ga0373933_0021741 | 3300035724 | Bacteria | 3647 |
| 567 | Ga0373933_0116327 | 3300035724 | Bacteria | 1671 |
| 568 | Ga0373933_0437972 | 3300035724 | Bacteria | 854 |
| 569 | Ga0373947_0002174 | 3300035725 | Bacteria | 11912 |
| 570 | Ga0373947_0026727 | 3300035725 | Bacteria | 3375 |
| 571 | Ga0373947_0059346 | 3300035725 | Bacteria | 2319 |
| 572 | Ga0373947_0062153 | 3300035725 | Bacteria | 2271 |
| 573 | Ga0373937_0000028 | 3300036401 | Bacteria | 123801 |
| 574 | Ga0373937_0000179 | 3300036401 | Bacteria | 62280 |
| 575 | Ga0373937_0002145 | 3300036401 | Bacteria | 16512 |
| 576 | Ga0373937_0006979 | 3300036401 | Bacteria | 9748 |
| 577 | Ga0373937_0023517 | 3300036401 | Bacteria | 5549 |
| 578 | Ga0373937_0030415 | 3300036401 | Bacteria | 4891 |
| 579 | Ga0373937_0104503 | 3300036401 | Bacteria | 2631 |
| 580 | Ga0373937_0115720 | 3300036401 | Bacteria | 2497 |
| 581 | Ga0373937_0290809 | 3300036401 | Bacteria | 1544 |
| 582 | Ga0316582_0003714 | 3300036647 | Bacteria | 7555 |
| 583 | Ga0316584_0235608 | 3300036712 | Bacteria | 1341 |
| 584 | Ga0373925_0000034 | 3300037068 | Bacteria | 144257 |
| 585 | Ga0373925_0012776 | 3300037068 | Bacteria | 6083 |
| 586 | Ga0373925_0045366 | 3300037068 | Bacteria | 3265 |
| 587 | Ga0373925_0094430 | 3300037068 | Bacteria | 2290 |
| 588 | Ga0373925_0337837 | 3300037068 | Bacteria | 1221 |
| 589 | Ga0395899_0000026 | 3300037312 | Bacteria | 345291 |
| 590 | Ga0395899_0000095 | 3300037312 | Bacteria | 152790 |
| 591 | Ga0395899_0110496 | 3300037312 | Bacteria | 1977 |
| 592 | Ga0395900_0000006 | 3300037418 | Bacteria | 495364 |
| 593 | Ga0395900_0076901 | 3300037418 | Bacteria | 3430 |
| 594 | Ga0395900_0123668 | 3300037418 | Bacteria | 2653 |
| 595 | Ga0395898_0006778 | 3300037466 | Bacteria | 12192 |
| 596 | Ga0395898_0125850 | 3300037466 | Bacteria | 2455 |
| 597 | Ga0395905_0003726 | 3300037471 | Bacteria | 16150 |
| 598 | Ga0395905_0358913 | 3300037471 | Bacteria | 1350 |
| 599 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 600 | Ga0395901_0012651 | 3300038443 | Bacteria | 8562 |
| 601 | Ga0395901_0213403 | 3300038443 | Bacteria | 2019 |
| 602 | Ga0400489_69310 | 3300039093 | Bacteria | 1779 |
| 603 | Ga0400487_24057 | 3300039110 | Bacteria | 9098 |
| 604 | Ga0400487_45503 | 3300039110 | Bacteria | 4078 |
| 605 | Ga0436365_1244993 | 3300039437 | Bacteria | 6072 |
| 606 | Ga0436365_1695948 | 3300039437 | Bacteria | 1364 |
| 607 | Ga0436360_0848133 | 3300039438 | Bacteria | 1046 |
| 608 | Ga0436361_0221120 | 3300039447 | Bacteria | 24197 |
| 609 | Ga0436361_0313975 | 3300039447 | Bacteria | 1005 |
| 610 | Ga0436361_0553129 | 3300039447 | Bacteria | 5298 |
| 611 | Ga0436361_1049174 | 3300039447 | Bacteria | 12703 |
| 612 | Ga0436363_0447376 | 3300039450 | Bacteria | 2768 |
| 613 | Ga0436362_0078503 | 3300039453 | Bacteria | 952 |
| 614 | Ga0436362_0273120 | 3300039453 | Bacteria | 1708 |
| 615 | Ga0436362_0663757 | 3300039453 | Bacteria | 1177 |
| 616 | Ga0439438_000009 | 3300041405 | Viruses | 172104 |
| 617 | Ga0439447_005540 | 3300041407 | Viruses | 4183 |
| 618 | Ga0439453_0000183 | 3300041408 | Bacteria | 5931 |
| 619 | Ga0451847_0639349 | 3300041503 | Bacteria | 743 |
| 620 | Ga0451853_0783681 | 3300041512 | Bacteria | 2137 |
| 621 | Ga0439431_0024899 | 3300041997 | Bacteria | 1459 |
| 622 | Ga0439441_014256 | 3300042001 | Bacteria | 1391 |
| 623 | Ga0439443_000502 | 3300042003 | Bacteria | 3516 |
| 624 | Ga0439445_0012334 | 3300042004 | Bacteria | 2052 |
| 625 | Ga0439446_0094539 | 3300042156 | Bacteria | 939 |
| 626 | Ga0439435_0000213 | 3300042436 | Bacteria | 8167 |
| 627 | Ga0439464_0046068 | 3300042439 | Bacteria | 1253 |
| 628 | Ga0439460_0000061 | 3300042461 | Bacteria | 15979 |
| 629 | Ga0466961_0326459 | 3300044693 | Bacteria | 935 |
| 630 | Ga0466963_0239373 | 3300044694 | Bacteria | 1272 |
| 631 | Ga0466971_0194603 | 3300044719 | Bacteria | 956 |
| 632 | Ga0466957_0025478 | 3300044842 | Bacteria | 3506 |
| 633 | Ga0466957_0050775 | 3300044842 | Bacteria | 2524 |
| 634 | Ga0466959_0029082 | 3300045049 | Bacteria | 4094 |
| 635 | Ga0466959_0044534 | 3300045049 | Bacteria | 3270 |
| 636 | Ga0451576_0088468 | 3300045051 | Bacteria | 3222 |
| 637 | Ga0451576_0106334 | 3300045051 | Bacteria | 2920 |
| 638 | Ga0466958_0136957 | 3300045836 | Bacteria | 1540 |
| 639 | Ga0495592_0000031 | 3300046454 | Bacteria | 128596 |
| 640 | Ga0495592_0007672 | 3300046454 | Bacteria | 8076 |
| 641 | Ga0495592_0041995 | 3300046454 | Bacteria | 3425 |
| 642 | Ga0495592_0052265 | 3300046454 | Bacteria | 3034 |
| 643 | Ga0495592_0056631 | 3300046454 | Bacteria | 2896 |
| 644 | Ga0495603_0016117 | 3300046455 | Bacteria | 4518 |
| 645 | Ga0495629_0001240 | 3300046459 | Bacteria | 20042 |
| 646 | Ga0495629_0019959 | 3300046459 | Bacteria | 4782 |
| 647 | Ga0495629_0253437 | 3300046459 | Bacteria | 1210 |
| 648 | Ga0495638_0150837 | 3300046460 | Bacteria | 1348 |
| 649 | Ga0495641_0021394 | 3300046461 | Bacteria | 3255 |
| 650 | Ga0495651_0001979 | 3300046462 | Bacteria | 15875 |
| 651 | Ga0495651_0004229 | 3300046462 | Bacteria | 10999 |
| 652 | Ga0495651_0006317 | 3300046462 | Bacteria | 9063 |
| 653 | Ga0495651_0114725 | 3300046462 | Bacteria | 1987 |
| 654 | Ga0495651_0132270 | 3300046462 | Bacteria | 1820 |
| 655 | Ga0495651_0186838 | 3300046462 | Bacteria | 1462 |
| 656 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 657 | Ga0495653_0010825 | 3300046463 | Bacteria | 7465 |
| 658 | Ga0495653_0309723 | 3300046463 | Bacteria | 1027 |
| 659 | Ga0495582_0003108 | 3300046473 | Bacteria | 9307 |
| 660 | Ga0495605_0026401 | 3300046474 | Bacteria | 3020 |
| 661 | Ga0495639_0013265 | 3300046475 | Bacteria | 3556 |
| 662 | Ga0495639_0064018 | 3300046475 | Bacteria | 1689 |
| 663 | Ga0495662_0006996 | 3300046476 | Bacteria | 5603 |
| 664 | Ga0495662_0008758 | 3300046476 | Bacteria | 4977 |
| 665 | Ga0495662_0009212 | 3300046476 | Bacteria | 4843 |
| 666 | Ga0495662_0015753 | 3300046476 | Bacteria | 3669 |
| 667 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 668 | Ga0495664_0028098 | 3300046477 | Bacteria | 3283 |
| 669 | Ga0495584_0010598 | 3300046491 | Bacteria | 4735 |
| 670 | Ga0495584_0136978 | 3300046491 | Bacteria | 1243 |
| 671 | Ga0495584_0173548 | 3300046491 | Bacteria | 1096 |
| 672 | Ga0495594_0010943 | 3300046499 | Bacteria | 4707 |
| 673 | Ga0495594_0230064 | 3300046499 | Bacteria | 1057 |
| 674 | Ga0495608_0000005 | 3300046511 | Bacteria | 350726 |
| 675 | Ga0495608_0001028 | 3300046511 | Bacteria | 19566 |
| 676 | Ga0495608_0001415 | 3300046511 | Bacteria | 17058 |
| 677 | Ga0495608_0173488 | 3300046511 | Bacteria | 1367 |
| 678 | Ga0495610_0008107 | 3300046512 | Bacteria | 6872 |
| 679 | Ga0495618_0000024 | 3300046514 | Bacteria | 122536 |
| 680 | Ga0495618_0017306 | 3300046514 | Bacteria | 4417 |
| 681 | Ga0495618_0092460 | 3300046514 | Bacteria | 1934 |
| 682 | Ga0495618_0110584 | 3300046514 | Bacteria | 1759 |
| 683 | Ga0495618_0147484 | 3300046514 | Bacteria | 1504 |
| 684 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 685 | Ga0495628_0004556 | 3300046516 | Bacteria | 12274 |
| 686 | Ga0495628_0023939 | 3300046516 | Bacteria | 5005 |
| 687 | Ga0495628_0044540 | 3300046516 | Bacteria | 3529 |
| 688 | Ga0495630_0000433 | 3300046517 | Bacteria | 31976 |
| 689 | Ga0495630_0011916 | 3300046517 | Bacteria | 6304 |
| 690 | Ga0495630_0012901 | 3300046517 | Bacteria | 6071 |
| 691 | Ga0495632_0107467 | 3300046519 | Bacteria | 1312 |
| 692 | Ga0495666_0013635 | 3300046526 | Bacteria | 4053 |
| 693 | Ga0495666_0029050 | 3300046526 | Bacteria | 2720 |
| 694 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 695 | Ga0495652_0042527 | 3300046529 | Bacteria | 3917 |
| 696 | Ga0495652_0056457 | 3300046529 | Bacteria | 3334 |
| 697 | Ga0495652_0126864 | 3300046529 | Bacteria | 2026 |
| 698 | Ga0495652_0190876 | 3300046529 | Bacteria | 1563 |
| 699 | Ga0495652_0248607 | 3300046529 | Bacteria | 1319 |
| 700 | Ga0495652_0298610 | 3300046529 | Bacteria | 1172 |
| 701 | Ga0495654_0146640 | 3300046530 | Bacteria | 1047 |
| 702 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 703 | Ga0495640_0024283 | 3300046533 | Bacteria | 4411 |
| 704 | Ga0495640_0034312 | 3300046533 | Bacteria | 3599 |
| 705 | Ga0495640_0042302 | 3300046533 | Bacteria | 3180 |
| 706 | Ga0495640_0090859 | 3300046533 | Bacteria | 2015 |
| 707 | Ga0495640_0099776 | 3300046533 | Bacteria | 1907 |
| 708 | Ga0495586_0001347 | 3300046535 | Bacteria | 13630 |
| 709 | Ga0495586_0035461 | 3300046535 | Bacteria | 2680 |
| 710 | Ga0495587_0000016 | 3300046536 | Bacteria | 185585 |
| 711 | Ga0495587_0004603 | 3300046536 | Bacteria | 9067 |
| 712 | Ga0495587_0072055 | 3300046536 | Bacteria | 2009 |
| 713 | Ga0495587_0081447 | 3300046536 | Bacteria | 1876 |
| 714 | Ga0495598_0001762 | 3300046537 | Bacteria | 4349 |
| 715 | Ga0495598_0001867 | 3300046537 | Bacteria | 4247 |
| 716 | Ga0495598_0026127 | 3300046537 | Bacteria | 1598 |
| 717 | Ga0495621_0005502 | 3300046539 | Bacteria | 3644 |
| 718 | Ga0495621_0050622 | 3300046539 | Bacteria | 1485 |
| 719 | Ga0495621_0137281 | 3300046539 | Bacteria | 955 |
| 720 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 721 | Ga0495645_0028875 | 3300046543 | Bacteria | 4031 |
| 722 | Ga0495645_0052308 | 3300046543 | Bacteria | 2971 |
| 723 | Ga0495667_0000007 | 3300046559 | Bacteria | 234736 |
| 724 | Ga0495667_0000709 | 3300046559 | Bacteria | 21330 |
| 725 | Ga0495667_0001645 | 3300046559 | Bacteria | 14801 |
| 726 | Ga0495667_0011650 | 3300046559 | Bacteria | 5953 |
| 727 | Ga0495667_0020703 | 3300046559 | Bacteria | 4439 |
| 728 | Ga0495667_0040356 | 3300046559 | Bacteria | 3099 |
| 729 | Ga0495667_0072754 | 3300046559 | Bacteria | 2240 |
| 730 | Ga0495667_0092108 | 3300046559 | Bacteria | 1963 |
| 731 | Ga0495656_0083713 | 3300046615 | Bacteria | 1445 |
| 732 | Ga0495634_0000637 | 3300046642 | Bacteria | 34135 |
| 733 | Ga0495634_0002751 | 3300046642 | Bacteria | 14465 |
| 734 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 735 | Ga0495635_0024338 | 3300046663 | Bacteria | 4220 |
| 736 | Ga0495635_0032827 | 3300046663 | Bacteria | 3601 |
| 737 | Ga0495635_0058993 | 3300046663 | Bacteria | 2639 |
| 738 | Ga0495635_0080766 | 3300046663 | Bacteria | 2225 |
| 739 | Ga0495635_0534565 | 3300046663 | Bacteria | 770 |
| 740 | Ga0495657_0000628 | 3300046675 | Bacteria | 31950 |
| 741 | Ga0495657_0020211 | 3300046675 | Bacteria | 4789 |
| 742 | Ga0495657_0062494 | 3300046675 | Bacteria | 2460 |
| 743 | Ga0495657_0095234 | 3300046675 | Bacteria | 1903 |
| 744 | Ga0495657_0098029 | 3300046675 | Bacteria | 1871 |
| 745 | Ga0495599_0000005 | 3300046678 | Bacteria | 300169 |
| 746 | Ga0495599_0013019 | 3300046678 | Bacteria | 5133 |
| 747 | Ga0495599_0042650 | 3300046678 | Bacteria | 2847 |
| 748 | Ga0495599_0089351 | 3300046678 | Bacteria | 1923 |
| 749 | Ga0495623_0000016 | 3300046679 | Bacteria | 113454 |
| 750 | Ga0495623_0000629 | 3300046679 | Bacteria | 23493 |
| 751 | Ga0495623_0080766 | 3300046679 | Bacteria | 2012 |
| 752 | Ga0495646_0000002 | 3300046680 | Bacteria | 310568 |
| 753 | Ga0495646_0012772 | 3300046680 | Bacteria | 5338 |
| 754 | Ga0495647_0005629 | 3300046681 | Bacteria | 4116 |
| 755 | Ga0495658_0000745 | 3300046683 | Bacteria | 17569 |
| 756 | Ga0495658_0004885 | 3300046683 | Bacteria | 6577 |
| 757 | Ga0495658_0141604 | 3300046683 | Bacteria | 1471 |
| 758 | Ga0495658_0184226 | 3300046683 | Bacteria | 1296 |
| 759 | Ga0495624_0199103 | 3300046690 | Bacteria | 1217 |
| 760 | Ga0495670_0141521 | 3300046691 | Bacteria | 1258 |
| 761 | Ga0495589_0016051 | 3300046794 | Bacteria | 3847 |
| 762 | Ga0495600_0000279 | 3300046809 | Bacteria | 27700 |
| 763 | Ga0495600_0004235 | 3300046809 | Bacteria | 8567 |
| 764 | Ga0495600_0005190 | 3300046809 | Bacteria | 7830 |
| 765 | Ga0495600_0023211 | 3300046809 | Bacteria | 3990 |
| 766 | Ga0495600_0029019 | 3300046809 | Bacteria | 3581 |
| 767 | Ga0495604_0000020 | 3300047317 | Bacteria | 171989 |
| 768 | Ga0495604_0008684 | 3300047317 | Bacteria | 8030 |
| 769 | Ga0495604_0013367 | 3300047317 | Bacteria | 6537 |
| 770 | Ga0495604_0116986 | 3300047317 | Bacteria | 1934 |
| 771 | Ga0495604_0182428 | 3300047317 | Bacteria | 1467 |
| 772 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 773 | Ga0495674_0020681 | 3300047319 | Bacteria | 6094 |
| 774 | Ga0495674_0034881 | 3300047319 | Bacteria | 4545 |
| 775 | Ga0495672_0000374 | 3300047320 | Bacteria | 55795 |
| 776 | Ga0495676_0068957 | 3300047321 | Bacteria | 2730 |
| 777 | Ga0495676_0099911 | 3300047321 | Bacteria | 2149 |
| 778 | Ga0495676_0273221 | 3300047321 | Bacteria | 1146 |
| 779 | Ga0495680_0001158 | 3300047322 | Bacteria | 29075 |
| 780 | Ga0495680_0005762 | 3300047322 | Bacteria | 11598 |
| 781 | Ga0495680_0019375 | 3300047322 | Bacteria | 5742 |
| 782 | Ga0495680_0020742 | 3300047322 | Bacteria | 5518 |
| 783 | Ga0495680_0041210 | 3300047322 | Bacteria | 3673 |
| 784 | Ga0495680_0068677 | 3300047322 | Bacteria | 2706 |
| 785 | Ga0495675_0000284 | 3300047444 | Bacteria | 36681 |
| 786 | Ga0495675_0002358 | 3300047444 | Bacteria | 11271 |
| 787 | Ga0495675_0131952 | 3300047444 | Bacteria | 1552 |
| 788 | Ga0495675_0177805 | 3300047444 | Bacteria | 1304 |
| 789 | Ga0495684_0000017 | 3300047471 | Bacteria | 160663 |
| 790 | Ga0495684_0034978 | 3300047471 | Bacteria | 3854 |
| 791 | Ga0495686_0048541 | 3300047472 | Bacteria | 2676 |
| 792 | Ga0495593_0001934 | 3300047673 | Bacteria | 12353 |
| 793 | Ga0495593_0055496 | 3300047673 | Bacteria | 2085 |
| 794 | Ga0495593_0173669 | 3300047673 | Bacteria | 1086 |
| 795 | Ga0495602_0000040 | 3300048088 | Bacteria | 127280 |
| 796 | Ga0495602_0003684 | 3300048088 | Bacteria | 15893 |
| 797 | Ga0495602_0028395 | 3300048088 | Bacteria | 5354 |
| 798 | Ga0495602_0122392 | 3300048088 | Bacteria | 2091 |
| 799 | Ga0495615_0053442 | 3300048090 | Bacteria | 1046 |
| 800 | Ga0496100_0010939 | 3300048903 | Bacteria | 5148 |
| 801 | Ga0496100_0012203 | 3300048903 | Bacteria | 4918 |
| 802 | Ga0496100_0057851 | 3300048903 | Bacteria | 2541 |
| 803 | Ga0496100_0389050 | 3300048903 | Bacteria | 1060 |
| 804 | Ga0496101_0006634 | 3300048904 | Bacteria | 7459 |
| 805 | Ga0496101_0287152 | 3300048904 | Bacteria | 1287 |
| 806 | Ga0496101_0637759 | 3300048904 | Bacteria | 842 |
| 807 | Ga0496102_0046509 | 3300048905 | Bacteria | 3941 |
| 808 | Ga0496102_0058075 | 3300048905 | Bacteria | 3534 |
| 809 | Ga0496102_0195065 | 3300048905 | Bacteria | 1908 |
| 810 | Ga0496102_0216264 | 3300048905 | Bacteria | 1806 |
| 811 | Ga0496103_0067000 | 3300048906 | Bacteria | 2241 |
| 812 | Ga0496103_0070323 | 3300048906 | Bacteria | 2189 |
| 813 | Ga0496104_0000055 | 3300048907 | Bacteria | 124267 |
| 814 | Ga0496104_0005521 | 3300048907 | Bacteria | 11076 |
| 815 | Ga0496104_0011174 | 3300048907 | Bacteria | 8035 |
| 816 | Ga0496104_0083240 | 3300048907 | Bacteria | 3051 |
| 817 | Ga0496104_0122731 | 3300048907 | Bacteria | 2494 |
| 818 | Ga0496104_0135365 | 3300048907 | Bacteria | 2367 |
| 819 | Ga0496104_0192776 | 3300048907 | Bacteria | 1950 |
| 820 | Ga0496104_0409884 | 3300048907 | Bacteria | 1267 |
| 821 | Ga0496105_0001352 | 3300048908 | Bacteria | 17218 |
| 822 | Ga0496105_0006498 | 3300048908 | Bacteria | 8988 |
| 823 | Ga0496105_0013053 | 3300048908 | Bacteria | 6584 |
| 824 | Ga0496105_0043251 | 3300048908 | Bacteria | 3715 |
| 825 | Ga0496105_0182787 | 3300048908 | Bacteria | 1716 |
| 826 | Ga0496106_0044490 | 3300048909 | Bacteria | 3332 |
| 827 | Ga0496106_0059439 | 3300048909 | Bacteria | 2896 |
| 828 | Ga0496106_0079112 | 3300048909 | Bacteria | 2524 |
| 829 | Ga0496106_0330578 | 3300048909 | Bacteria | 1224 |
| 830 | Ga0496107_0005300 | 3300048910 | Bacteria | 8812 |
| 831 | Ga0496107_0058525 | 3300048910 | Bacteria | 2786 |
| 832 | Ga0496107_0109787 | 3300048910 | Bacteria | 2026 |
| 833 | Ga0496108_0037806 | 3300048911 | Bacteria | 4021 |
| 834 | Ga0496109_0039967 | 3300048912 | Bacteria | 4247 |
| 835 | Ga0496109_0051612 | 3300048912 | Bacteria | 3746 |
| 836 | Ga0496109_0063721 | 3300048912 | Bacteria | 3372 |
| 837 | Ga0496109_0167017 | 3300048912 | Bacteria | 2063 |
| 838 | Ga0496110_0043384 | 3300048913 | Bacteria | 3927 |
| 839 | Ga0496110_0231798 | 3300048913 | Bacteria | 1679 |
| 840 | Ga0496110_0246779 | 3300048913 | Bacteria | 1625 |
| 841 | Ga0496110_0348310 | 3300048913 | Bacteria | 1349 |
| 842 | Ga0496111_0029169 | 3300048914 | Bacteria | 3917 |
| 843 | Ga0496111_0033488 | 3300048914 | Bacteria | 3665 |
| 844 | Ga0496111_0182544 | 3300048914 | Bacteria | 1560 |
| 845 | Ga0496111_0260399 | 3300048914 | Bacteria | 1287 |
| 846 | Ga0496112_0263871 | 3300048915 | Bacteria | 1671 |
| 847 | Ga0496113_0121596 | 3300048916 | Bacteria | 2041 |
| 848 | Ga0496114_0000007 | 3300048917 | Bacteria | 463098 |
| 849 | Ga0496114_0011561 | 3300048917 | Bacteria | 7053 |
| 850 | Ga0496114_0045542 | 3300048917 | Bacteria | 3644 |
| 851 | Ga0496114_0373459 | 3300048917 | Bacteria | 1262 |
| 852 | Ga0496114_0409186 | 3300048917 | Bacteria | 1201 |
| 853 | Ga0496115_0014395 | 3300048918 | Bacteria | 5987 |
| 854 | Ga0496115_0022410 | 3300048918 | Bacteria | 4893 |
| 855 | Ga0496115_0062175 | 3300048918 | Bacteria | 3012 |
| 856 | Ga0496115_0089827 | 3300048918 | Bacteria | 2509 |
| 857 | Ga0496115_0170415 | 3300048918 | Bacteria | 1800 |
| 858 | Ga0496115_0302958 | 3300048918 | Bacteria | 1309 |
| 859 | Ga0496117_0017711 | 3300048920 | Bacteria | 5941 |
| 860 | Ga0496119_0000314 | 3300048922 | Bacteria | 67717 |
| 861 | Ga0496121_0000130 | 3300048924 | Bacteria | 168094 |
| 862 | Ga0496121_0000445 | 3300048924 | Bacteria | 81575 |
| 863 | Ga0496121_0020845 | 3300048924 | Bacteria | 6458 |
| 864 | Ga0496121_0112803 | 3300048924 | Bacteria | 2070 |
| 865 | Ga0496122_0000190 | 3300048925 | Bacteria | 140376 |
| 866 | Ga0496122_0001527 | 3300048925 | Bacteria | 36858 |
| 867 | Ga0496122_0003891 | 3300048925 | Bacteria | 19134 |
| 868 | Ga0496123_0001016 | 3300048926 | Bacteria | 42813 |
| 869 | Ga0496123_0001252 | 3300048926 | Bacteria | 36667 |
| 870 | Ga0496125_0000273 | 3300048928 | Bacteria | 104663 |
| 871 | Ga0496125_0231617 | 3300048928 | Bacteria | 1181 |
| 872 | Ga0496126_0225961 | 3300048929 | Bacteria | 1570 |
| 873 | Ga0496126_0364327 | 3300048929 | Bacteria | 1180 |
| 874 | Ga0501335_006568 | 3300049551 | Bacteria | 1062 |
| 875 | Ga0501031_0008676 | 3300049568 | Bacteria | 6609 |
| 876 | Ga0501031_0012430 | 3300049568 | Bacteria | 5553 |
| 877 | Ga0501031_0033868 | 3300049568 | Bacteria | 3334 |
| 878 | Ga0501032_0002877 | 3300049569 | Bacteria | 13391 |
| 879 | Ga0501032_0007634 | 3300049569 | Bacteria | 7886 |
| 880 | Ga0501032_0178977 | 3300049569 | Bacteria | 1389 |
| 881 | Ga0501033_0057319 | 3300049570 | Bacteria | 2879 |
| 882 | Ga0501033_0191280 | 3300049570 | Bacteria | 1464 |
| 883 | Ga0501034_0000442 | 3300049571 | Bacteria | 68550 |
| 884 | Ga0501034_0019479 | 3300049571 | Bacteria | 6940 |
| 885 | Ga0501034_0058526 | 3300049571 | Bacteria | 3873 |
| 886 | Ga0501034_0067565 | 3300049571 | Bacteria | 3586 |
| 887 | Ga0501034_0086158 | 3300049571 | Bacteria | 3142 |
| 888 | Ga0501034_0236274 | 3300049571 | Bacteria | 1775 |
| 889 | Ga0501034_0530442 | 3300049571 | Bacteria | 1088 |
| 890 | Ga0501034_0591878 | 3300049571 | Bacteria | 1015 |
| 891 | Ga0501036_0000984 | 3300049572 | Bacteria | 21517 |
| 892 | Ga0501036_0001853 | 3300049572 | Bacteria | 16386 |
| 893 | Ga0501036_0002374 | 3300049572 | Bacteria | 14720 |
| 894 | Ga0501036_0039661 | 3300049572 | Bacteria | 3985 |
| 895 | Ga0501036_0147876 | 3300049572 | Bacteria | 1982 |
| 896 | Ga0501036_0196679 | 3300049572 | Bacteria | 1696 |
| 897 | Ga0501037_0002212 | 3300049573 | Bacteria | 14046 |
| 898 | Ga0501037_0002785 | 3300049573 | Bacteria | 12664 |
| 899 | Ga0501037_0008691 | 3300049573 | Bacteria | 7443 |
| 900 | Ga0501038_0002844 | 3300049574 | Bacteria | 16106 |
| 901 | Ga0501038_0044931 | 3300049574 | Bacteria | 3836 |
| 902 | Ga0501038_0046946 | 3300049574 | Bacteria | 3742 |
| 903 | Ga0501038_0074453 | 3300049574 | Bacteria | 2873 |
| 904 | Ga0501038_0076376 | 3300049574 | Bacteria | 2829 |
| 905 | Ga0501039_0000661 | 3300049575 | Bacteria | 24914 |
| 906 | Ga0501039_0008637 | 3300049575 | Bacteria | 7762 |
| 907 | Ga0501039_0010027 | 3300049575 | Bacteria | 7224 |
| 908 | Ga0501039_0019866 | 3300049575 | Bacteria | 5149 |
| 909 | Ga0501039_0083587 | 3300049575 | Bacteria | 2486 |
| 910 | Ga0501039_0315050 | 3300049575 | Bacteria | 1230 |
| 911 | Ga0501039_0367618 | 3300049575 | Bacteria | 1130 |
| 912 | Ga0501040_0000759 | 3300049576 | Bacteria | 20016 |
| 913 | Ga0501040_0009670 | 3300049576 | Bacteria | 6295 |
| 914 | Ga0501040_0028681 | 3300049576 | Bacteria | 3753 |
| 915 | Ga0501040_0078736 | 3300049576 | Bacteria | 2281 |
| 916 | Ga0501040_0319335 | 3300049576 | Bacteria | 1111 |
| 917 | Ga0501040_0445253 | 3300049576 | Bacteria | 932 |
| 918 | Ga0501041_0000109 | 3300049577 | Bacteria | 34463 |
| 919 | Ga0501041_0005052 | 3300049577 | Bacteria | 7684 |
| 920 | Ga0501041_0138550 | 3300049577 | Bacteria | 1517 |
| 921 | Ga0501042_0001562 | 3300049578 | Bacteria | 13545 |
| 922 | Ga0501042_0008667 | 3300049578 | Bacteria | 6739 |
| 923 | Ga0501042_0102642 | 3300049578 | Bacteria | 2057 |
| 924 | Ga0501042_0175466 | 3300049578 | Bacteria | 1546 |
| 925 | Ga0501042_0497761 | 3300049578 | Bacteria | 885 |
| 926 | Ga0501043_0000539 | 3300049579 | Bacteria | 34110 |
| 927 | Ga0501043_0003859 | 3300049579 | Bacteria | 12318 |
| 928 | Ga0501043_0044627 | 3300049579 | Bacteria | 3486 |
| 929 | Ga0501043_0129961 | 3300049579 | Bacteria | 1974 |
| 930 | Ga0501046_0001303 | 3300049580 | Bacteria | 24159 |
| 931 | Ga0501046_0002082 | 3300049580 | Bacteria | 18977 |
| 932 | Ga0501046_0014507 | 3300049580 | Bacteria | 6645 |
| 933 | Ga0501046_0055809 | 3300049580 | Bacteria | 3102 |
| 934 | Ga0501047_0004626 | 3300049581 | Bacteria | 12950 |
| 935 | Ga0501047_0006570 | 3300049581 | Bacteria | 10947 |
| 936 | Ga0501047_0039197 | 3300049581 | Bacteria | 4584 |
| 937 | Ga0501047_0077876 | 3300049581 | Bacteria | 3188 |
| 938 | Ga0501047_0092118 | 3300049581 | Bacteria | 2909 |
| 939 | Ga0501047_0432279 | 3300049581 | Bacteria | 1147 |
| 940 | Ga0501048_0000190 | 3300049582 | Bacteria | 39467 |
| 941 | Ga0501048_0003398 | 3300049582 | Bacteria | 12097 |
| 942 | Ga0501048_0006966 | 3300049582 | Bacteria | 8589 |
| 943 | Ga0501048_0223802 | 3300049582 | Bacteria | 1335 |
| 944 | Ga0501067_0001787 | 3300049583 | Bacteria | 11809 |
| 945 | Ga0501067_0022641 | 3300049583 | Bacteria | 3477 |
| 946 | Ga0501067_0032759 | 3300049583 | Bacteria | 2884 |
| 947 | Ga0501067_0074035 | 3300049583 | Bacteria | 1887 |
| 948 | Ga0501067_0143110 | 3300049583 | Bacteria | 1332 |
| 949 | Ga0501067_0217860 | 3300049583 | Bacteria | 1063 |
| 950 | Ga0501068_0005962 | 3300049584 | Bacteria | 6688 |
| 951 | Ga0501068_0009173 | 3300049584 | Bacteria | 5525 |
| 952 | Ga0501069_0000649 | 3300049585 | Bacteria | 16136 |
| 953 | Ga0501070_0168390 | 3300049586 | Bacteria | 1805 |
| 954 | Ga0501070_0312434 | 3300049586 | Bacteria | 1279 |
| 955 | Ga0501070_0348883 | 3300049586 | Bacteria | 1201 |
| 956 | Ga0501070_0794730 | 3300049586 | Bacteria | 743 |
| 957 | Ga0501071_0007762 | 3300049587 | Bacteria | 7076 |
| 958 | Ga0501071_0032363 | 3300049587 | Bacteria | 3713 |
| 959 | Ga0501071_0070158 | 3300049587 | Bacteria | 2552 |
| 960 | Ga0501072_0000763 | 3300049588 | Bacteria | 23454 |
| 961 | Ga0501072_0019901 | 3300049588 | Bacteria | 5194 |
| 962 | Ga0501072_0022921 | 3300049588 | Bacteria | 4847 |
| 963 | Ga0501072_0052388 | 3300049588 | Bacteria | 3213 |
| 964 | Ga0501072_0101793 | 3300049588 | Bacteria | 2283 |
| 965 | Ga0501072_0378673 | 3300049588 | Bacteria | 1123 |
| 966 | Ga0501072_0622962 | 3300049588 | Bacteria | 850 |
| 967 | Ga0501073_0004760 | 3300049589 | Bacteria | 10185 |
| 968 | Ga0501073_0031779 | 3300049589 | Bacteria | 3766 |
| 969 | Ga0501073_0312535 | 3300049589 | Bacteria | 1084 |
| 970 | Ga0501074_0006570 | 3300049590 | Bacteria | 8406 |
| 971 | Ga0501074_0009706 | 3300049590 | Bacteria | 6990 |
| 972 | Ga0501074_0012006 | 3300049590 | Bacteria | 6296 |
| 973 | Ga0501074_0049980 | 3300049590 | Bacteria | 3018 |
| 974 | Ga0501074_0256381 | 3300049590 | Bacteria | 1244 |
| 975 | Ga0501075_0000840 | 3300049591 | Bacteria | 19361 |
| 976 | Ga0501075_0000926 | 3300049591 | Bacteria | 18608 |
| 977 | Ga0501075_0055651 | 3300049591 | Bacteria | 2977 |
| 978 | Ga0501076_0038992 | 3300049592 | Bacteria | 3729 |
| 979 | Ga0501076_0106733 | 3300049592 | Bacteria | 2261 |
| 980 | Ga0501076_0451054 | 3300049592 | Bacteria | 1059 |
| 981 | Ga0501077_0000262 | 3300049593 | Bacteria | 30957 |
| 982 | Ga0501077_0096453 | 3300049593 | Bacteria | 1874 |
| 983 | Ga0501077_0118055 | 3300049593 | Bacteria | 1681 |
| 984 | Ga0501079_0000684 | 3300049741 | Bacteria | 22742 |
| 985 | Ga0501079_0013866 | 3300049741 | Bacteria | 6147 |
| 986 | Ga0501079_0022746 | 3300049741 | Bacteria | 4810 |
| 987 | Ga0501079_0106273 | 3300049741 | Bacteria | 2178 |
| 988 | Ga0501079_0269594 | 3300049741 | Bacteria | 1331 |
| 989 | Ga0501080_0003003 | 3300049742 | Bacteria | 14872 |
| 990 | Ga0501080_0049027 | 3300049742 | Bacteria | 3930 |
| 991 | Ga0501080_0160287 | 3300049742 | Bacteria | 2078 |
| 992 | Ga0501080_0193161 | 3300049742 | Bacteria | 1870 |
| 993 | Ga0501080_0388380 | 3300049742 | Bacteria | 1257 |
| 994 | Ga0501081_0000356 | 3300049743 | Bacteria | 24749 |
| 995 | Ga0501081_0008011 | 3300049743 | Bacteria | 6856 |
| 996 | Ga0501081_0044767 | 3300049743 | Bacteria | 3039 |
| 997 | Ga0501081_0281770 | 3300049743 | Bacteria | 1217 |
| 998 | Ga0501083_0002240 | 3300049744 | Bacteria | 13217 |
| 999 | Ga0501083_0004092 | 3300049744 | Bacteria | 10261 |
| 1000 | Ga0501083_0007258 | 3300049744 | Bacteria | 7869 |
| 1001 | Ga0501083_0017016 | 3300049744 | Bacteria | 5076 |
| 1002 | Ga0501083_0139129 | 3300049744 | Bacteria | 1590 |
| 1003 | Ga0501035_0005532 | 3300049822 | Bacteria | 11940 |
| 1004 | Ga0501035_0007363 | 3300049822 | Bacteria | 10284 |
| 1005 | Ga0501035_0072868 | 3300049822 | Bacteria | 3039 |
| 1006 | Ga0501035_0089404 | 3300049822 | Bacteria | 2713 |
| 1007 | Ga0501035_0207227 | 3300049822 | Bacteria | 1679 |
| 1008 | Ga0501035_0299608 | 3300049822 | Bacteria | 1355 |
| 1009 | Ga0501044_0000708 | 3300049823 | Bacteria | 40261 |
| 1010 | Ga0501044_0013935 | 3300049823 | Bacteria | 8685 |
| 1011 | Ga0501044_0017975 | 3300049823 | Bacteria | 7580 |
| 1012 | Ga0501044_0021310 | 3300049823 | Bacteria | 6917 |
| 1013 | Ga0501044_0079433 | 3300049823 | Bacteria | 3324 |
| 1014 | Ga0501044_0110623 | 3300049823 | Bacteria | 2756 |
| 1015 | Ga0501044_0170371 | 3300049823 | Bacteria | 2149 |
| 1016 | Ga0501044_0382197 | 3300049823 | Bacteria | 1323 |
| 1017 | Ga0501044_0446815 | 3300049823 | Bacteria | 1200 |
| 1018 | Ga0501045_0000221 | 3300049824 | Bacteria | 32865 |
| 1019 | Ga0501045_0000749 | 3300049824 | Bacteria | 20755 |
| 1020 | Ga0501045_0008385 | 3300049824 | Bacteria | 7200 |
| 1021 | Ga0501045_0054276 | 3300049824 | Bacteria | 2929 |
| 1022 | Ga0501045_0480801 | 3300049824 | Bacteria | 923 |
| 1023 | nmdc:mga03683_110340_c1 | 3300050489 | Bacteria | 1216 |
| 1024 | nmdc:mga03683_169851_c1 | 3300050489 | Bacteria | 990 |
| 1025 | nmdc:mga03683_38247_c1 | 3300050489 | Bacteria | 1959 |
| 1026 | nmdc:mga03n38_5525_c1 | 3300050490 | Bacteria | 4310 |
| 1027 | nmdc:mga03n38_74596_c1 | 3300050490 | Bacteria | 1578 |
| 1028 | nmdc:mga00v17_139030_c1 | 3300050491 | Bacteria | 1556 |
| 1029 | nmdc:mga00v17_20753_c1 | 3300050491 | Bacteria | 3768 |
| 1030 | nmdc:mga0yw44_11143_c1 | 3300050492 | Bacteria | 4625 |
| 1031 | nmdc:mga06z11_102986_c1 | 3300050494 | Bacteria | 1569 |
| 1032 | nmdc:mga06z11_155414_c1 | 3300050494 | Bacteria | 1304 |
| 1033 | nmdc:mga04h51_6961_c1 | 3300050495 | Bacteria | 2962 |
| 1034 | nmdc:mga05p37_30139_c1 | 3300050507 | Bacteria | 6620 |
| 1035 | nmdc:mga05p37_56283_c1 | 3300050507 | Bacteria | 4842 |
| 1036 | nmdc:mga05p37_67_c1 | 3300050507 | Bacteria | 91619 |
| 1037 | nmdc:mga05p37_79966_c1 | 3300050507 | Bacteria | 4026 |
| 1038 | nmdc:mga09592_137419_c1 | 3300050508 | Bacteria | 2105 |
| 1039 | nmdc:mga09592_173345_c1 | 3300050508 | Bacteria | 1866 |
| 1040 | nmdc:mga09592_289322_c1 | 3300050508 | Bacteria | 1421 |
| 1041 | nmdc:mga09592_45_c1 | 3300050508 | Bacteria | 69144 |
| 1042 | nmdc:mga0qj67_107060_c1 | 3300050509 | Bacteria | 2255 |
| 1043 | nmdc:mga0qj67_175746_c1 | 3300050509 | Bacteria | 1739 |
| 1044 | nmdc:mga0qj67_267_c1 | 3300050509 | Bacteria | 35925 |
| 1045 | nmdc:mga0qj67_35658_c1 | 3300050509 | Bacteria | 3890 |
| 1046 | nmdc:mga0qj67_46113_c1 | 3300050509 | Bacteria | 3441 |
| 1047 | nmdc:mga0qj67_96444_c1 | 3300050509 | Bacteria | 2381 |
| 1048 | nmdc:mga06r32_10930_c1 | 3300050510 | Bacteria | 8174 |
| 1049 | nmdc:mga06r32_544367_c1 | 3300050510 | Bacteria | 1135 |
| 1050 | nmdc:mga06r32_62934_c1 | 3300050510 | Bacteria | 3575 |
| 1051 | nmdc:mga08y16_126338_c1 | 3300050511 | Bacteria | 2660 |
| 1052 | nmdc:mga08y16_196092_c1 | 3300050511 | Bacteria | 2093 |
| 1053 | nmdc:mga08y16_219568_c1 | 3300050511 | Bacteria | 1968 |
| 1054 | nmdc:mga08y16_252069_c1 | 3300050511 | Bacteria | 1824 |
| 1055 | nmdc:mga08y16_51087_c1 | 3300050511 | Bacteria | 4325 |
| 1056 | nmdc:mga0n895_63492_c1 | 3300050512 | Bacteria | 3652 |
| 1057 | nmdc:mga0n895_695456_c1 | 3300050512 | Bacteria | 1013 |
| 1058 | nmdc:mga0rr50_30813_c1 | 3300050513 | Bacteria | 3803 |
| 1059 | nmdc:mga0rr50_51956_c1 | 3300050513 | Bacteria | 3043 |
| 1060 | nmdc:mga0rr50_662451_c1 | 3300050513 | Bacteria | 891 |
| 1061 | nmdc:mga08x19_3363_c1 | 3300050514 | Bacteria | 4239 |
| 1062 | nmdc:mga0a205_338726_c1 | 3300050515 | Bacteria | 1373 |
| 1063 | nmdc:mga0a205_372926_c1 | 3300050515 | Bacteria | 1293 |
| 1064 | nmdc:mga0a205_413053_c1 | 3300050515 | Bacteria | 1212 |
| 1065 | nmdc:mga0a205_435087_c1 | 3300050515 | Bacteria | 1173 |
| 1066 | nmdc:mga0a205_52693_c1 | 3300050515 | Bacteria | 3927 |
| 1067 | nmdc:mga0sz30_133465_c1 | 3300050516 | Bacteria | 1095 |
| 1068 | Ga0495601_0000018 | 3300053077 | Bacteria | 171665 |
| 1069 | Ga0495601_0000352 | 3300053077 | Bacteria | 24145 |
| 1070 | Ga0495601_0000357 | 3300053077 | Bacteria | 23996 |
| 1071 | Ga0495601_0008676 | 3300053077 | Bacteria | 5997 |
| 1072 | Ga0495601_0010571 | 3300053077 | Bacteria | 5496 |
| 1073 | Ga0495601_0048033 | 3300053077 | Bacteria | 2688 |
| 1074 | Ga0495601_0049828 | 3300053077 | Bacteria | 2641 |
| 1075 | Ga0495601_0311990 | 3300053077 | Bacteria | 1024 |
| 1076 | Ga0495612_0000011 | 3300053078 | Bacteria | 224729 |
| 1077 | Ga0495612_0003841 | 3300053078 | Bacteria | 6236 |
| 1078 | Ga0495612_0014220 | 3300053078 | Bacteria | 3201 |
| 1079 | Ga0495612_0026130 | 3300053078 | Bacteria | 2347 |
| 1080 | Ga0495612_0033348 | 3300053078 | Bacteria | 2083 |
| 1081 | Ga0495595_0000016 | 3300053084 | Bacteria | 134329 |
| 1082 | Ga0495595_0000405 | 3300053084 | Bacteria | 16418 |
| 1083 | Ga0495595_0001531 | 3300053084 | Bacteria | 9014 |
| 1084 | Ga0495595_0002126 | 3300053084 | Bacteria | 7698 |
| 1085 | Ga0495595_0010289 | 3300053084 | Bacteria | 3885 |
| 1086 | Ga0495619_0000014 | 3300053085 | Bacteria | 261449 |
| 1087 | Ga0495619_0000085 | 3300053085 | Bacteria | 70073 |
| 1088 | Ga0495619_0000536 | 3300053085 | Bacteria | 25079 |
| 1089 | Ga0495619_0002650 | 3300053085 | Bacteria | 11698 |
| 1090 | Ga0495619_0008387 | 3300053085 | Bacteria | 6533 |
| 1091 | Ga0495619_0011351 | 3300053085 | Bacteria | 5609 |
| 1092 | Ga0495619_0013199 | 3300053085 | Bacteria | 5206 |
| 1093 | Ga0495619_0023812 | 3300053085 | Bacteria | 3924 |
| 1094 | Ga0495619_0157984 | 3300053085 | Bacteria | 1565 |
| 1095 | Ga0500643_004745 | 3300053087 | Bacteria | 6032 |
| 1096 | Ga0500647_0027125 | 3300053091 | Bacteria | 2706 |
| 1097 | Ga0500583_0142668 | 3300053092 | Bacteria | 1190 |
| 1098 | Ga0500651_0002083 | 3300053093 | Bacteria | 10388 |
| 1099 | Ga0500641_0033918 | 3300053096 | Bacteria | 2029 |
| 1100 | Ga0500556_0000099 | 3300053104 | Bacteria | 79263 |
| 1101 | Ga0500593_012112 | 3300053117 | Bacteria | 3648 |
| 1102 | Ga0500594_0014290 | 3300053118 | Bacteria | 1899 |
| 1103 | Ga0500595_072629 | 3300053119 | Bacteria | 1019 |
| 1104 | Ga0500608_135308 | 3300053122 | Bacteria | 1099 |
| 1105 | Ga0500642_0037358 | 3300053130 | Bacteria | 2075 |
| 1106 | Ga0500616_0044871 | 3300053153 | Bacteria | 2357 |
| 1107 | Ga0500616_0185107 | 3300053153 | Bacteria | 935 |
| 1108 | Ga0500627_0062992 | 3300053158 | Bacteria | 1634 |
| 1109 | Ga0500611_023857 | 3300053727 | Bacteria | 1195 |
| 1110 | Ga0501084_0000355 | 3300054114 | Bacteria | 34952 |
| 1111 | Ga0501084_0000758 | 3300054114 | Bacteria | 24600 |
| 1112 | Ga0501084_0013622 | 3300054114 | Bacteria | 6730 |
| 1113 | Ga0501084_0034669 | 3300054114 | Bacteria | 4219 |
| 1114 | Ga0501084_0041915 | 3300054114 | Bacteria | 3828 |
| 1115 | Ga0501084_0127934 | 3300054114 | Bacteria | 2138 |
| 1116 | Ga0501082_0000032 | 3300060353 | Bacteria | 99261 |
| 1117 | Ga0501082_0003835 | 3300060353 | Bacteria | 13147 |
| 1118 | Ga0501082_0004982 | 3300060353 | Bacteria | 11595 |
| 1119 | Ga0501082_0056277 | 3300060353 | Bacteria | 3388 |
| 1120 | Ga0501082_0126679 | 3300060353 | Bacteria | 2215 |
| 1121 | Ga0501082_0208152 | 3300060353 | Bacteria | 1702 |
| 1122 | Ga0501082_0284777 | 3300060353 | Bacteria | 1439 |
| 1123 | Ga0501082_0299606 | 3300060353 | Bacteria | 1400 |
| 1124 | Ga0466962_0148311 | 3300061719 | Bacteria | 1138 |
| 1125 | Ga0530510_0000542 | 3300061734 | Bacteria | 24234 |
| 1126 | Ga0530510_0001016 | 3300061734 | Bacteria | 18589 |
| 1127 | Ga0530510_0092420 | 3300061734 | Bacteria | 2208 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053122 | Ga0500608_135308 | Ga0500608_135308_18_680 | 213 |
| 2 | 3300005834 | Ga0068851_10000120 | Ga0068851_1000012029 | 220 |
| 3 | 3300025321 | Ga0207656_10000165 | Ga0207656_1000016518 | 220 |
| 4 | 3300048903 | Ga0496100_0389050 | Ga0496100_0389050_384_1046 | 220 |
| 5 | 3300013297 | Ga0157378_10912542 | Ga0157378_109125422 | 221 |
| 6 | 3300035692 | Ga0373935_0753671 | Ga0373935_0753671_38_703 | 221 |
| 7 | 3300046491 | Ga0495584_0136978 | Ga0495584_0136978_10_675 | 221 |
| 8 | 3300046530 | Ga0495654_0146640 | Ga0495654_0146640_29_694 | 221 |
| 9 | 3300046537 | Ga0495598_0026127 | Ga0495598_0026127_28_693 | 221 |
| 10 | 3300048924 | Ga0496121_0020845 | Ga0496121_0020845_5773_6438 | 221 |
| 11 | 3300049576 | Ga0501040_0319335 | Ga0501040_0319335_22_687 | 221 |
| 12 | 3300049583 | Ga0501067_0143110 | Ga0501067_0143110_22_687 | 221 |
| 13 | 3300050511 | nmdc:mga08y16_252069_c1 | nmdc:mga08y16_252069_c1_29_694 | 221 |
| 14 | 3300053118 | Ga0500594_0014290 | Ga0500594_0014290_12_677 | 221 |
| 15 | 3300053158 | Ga0500627_0062992 | Ga0500627_0062992_944_1609 | 221 |
| 16 | 3300049590 | Ga0501074_0009706 | Ga0501074_0009706_5151_5840 | 225 |
| 17 | 3300049586 | Ga0501070_0794730 | Ga0501070_0794730_37_720 | 227 |
| 18 | 3300048904 | Ga0496101_0637759 | Ga0496101_0637759_119_826 | 230 |
| 19 | 3300035088 | Ga0373940_0059527 | Ga0373940_0059527_376_1071 | 231 |
| 20 | 3300036712 | Ga0316584_0235608 | Ga0316584_0235608_632_1327 | 231 |
| 21 | 3300041503 | Ga0451847_0639349 | Ga0451847_0639349_20_715 | 231 |
| 22 | 3300046535 | Ga0495586_0035461 | Ga0495586_0035461_1946_2641 | 231 |
| 23 | 3300046663 | Ga0495635_0534565 | Ga0495635_0534565_21_716 | 231 |
| 24 | 3300046681 | Ga0495647_0005629 | Ga0495647_0005629_21_716 | 231 |
| 25 | 3300047673 | Ga0495593_0173669 | Ga0495593_0173669_377_1072 | 231 |
| 26 | 3300048904 | Ga0496101_0287152 | Ga0496101_0287152_17_712 | 231 |
| 27 | 3300048912 | Ga0496109_0063721 | Ga0496109_0063721_24_719 | 231 |
| 28 | 3300048924 | Ga0496121_0112803 | Ga0496121_0112803_673_1368 | 231 |
| 29 | 3300049571 | Ga0501034_0530442 | Ga0501034_0530442_327_1022 | 231 |
| 30 | 3300049583 | Ga0501067_0217860 | Ga0501067_0217860_343_1038 | 231 |
| 31 | 3300049592 | Ga0501076_0451054 | Ga0501076_0451054_338_1033 | 231 |
| 32 | 3300050491 | nmdc:mga00v17_139030_c1 | nmdc:mga00v17_139030_c1_41_736 | 231 |
| 33 | 3300053077 | Ga0495601_0049828 | Ga0495601_0049828_23_718 | 231 |
| 34 | 3300053085 | Ga0495619_0157984 | Ga0495619_0157984_845_1540 | 231 |
| 35 | 3300053153 | Ga0500616_0185107 | Ga0500616_0185107_28_723 | 231 |
| 36 | iso_pu_bacteria | 2643221699 | 2644547710 | 241 |
| 37 | 3300046794 | Ga0495589_0016051 | Ga0495589_0016051_138_980 | 251 |
| 38 | 3300005295 | Ga0065707_10227956 | Ga0065707_102279562 | 252 |
| 39 | 3300005331 | Ga0070670_100196606 | Ga0070670_1001966062 | 252 |
| 40 | 3300005347 | Ga0070668_100005164 | Ga0070668_1000051642 | 252 |
| 41 | 3300005353 | Ga0070669_100172808 | Ga0070669_1001728081 | 252 |
| 42 | 3300005367 | Ga0070667_100106981 | Ga0070667_1001069812 | 252 |
| 43 | 3300005444 | Ga0070694_100050445 | Ga0070694_1000504453 | 252 |
| 44 | 3300005468 | Ga0070707_100154715 | Ga0070707_1001547153 | 252 |
| 45 | 3300005546 | Ga0070696_100132587 | Ga0070696_1001325873 | 252 |
| 46 | 3300005617 | Ga0068859_100048343 | Ga0068859_1000483435 | 252 |
| 47 | 3300005719 | Ga0068861_100039322 | Ga0068861_1000393224 | 252 |
| 48 | 3300005841 | Ga0068863_100064702 | Ga0068863_1000647025 | 252 |
| 49 | 3300005841 | Ga0068863_100123515 | Ga0068863_1001235152 | 252 |
| 50 | 3300005844 | Ga0068862_100012637 | Ga0068862_1000126376 | 252 |
| 51 | 3300006931 | Ga0097620_100048344 | Ga0097620_1000483445 | 252 |
| 52 | 3300009553 | Ga0105249_10138854 | Ga0105249_101388542 | 252 |
| 53 | 3300025922 | Ga0207646_10095220 | Ga0207646_100952203 | 252 |
| 54 | 3300025923 | Ga0207681_10013529 | Ga0207681_100135299 | 252 |
| 55 | 3300025936 | Ga0207670_10073924 | Ga0207670_100739243 | 252 |
| 56 | 3300025961 | Ga0207712_10078711 | Ga0207712_100787114 | 252 |
| 57 | 3300025972 | Ga0207668_10016411 | Ga0207668_100164112 | 252 |
| 58 | 3300025986 | Ga0207658_10090613 | Ga0207658_100906134 | 252 |
| 59 | 3300026088 | Ga0207641_10053054 | Ga0207641_100530545 | 252 |
| 60 | 3300026095 | Ga0207676_10307420 | Ga0207676_103074202 | 252 |
| 61 | 3300026118 | Ga0207675_100037302 | Ga0207675_1000373024 | 252 |
| 62 | 3300028379 | Ga0268266_10269888 | Ga0268266_102698882 | 252 |
| 63 | 3300028380 | Ga0268265_10008301 | Ga0268265_100083016 | 252 |
| 64 | 3300028381 | Ga0268264_10066058 | Ga0268264_100660585 | 252 |
| 65 | 3300031730 | Ga0307516_10000020 | Ga0307516_1000002099 | 252 |
| 66 | 3300005549 | Ga0070704_100018115 | Ga0070704_1000181155 | 253 |
| 67 | 3300005617 | Ga0068859_100360565 | Ga0068859_1003605652 | 253 |
| 68 | 3300006931 | Ga0097620_100360558 | Ga0097620_1003605582 | 253 |
| 69 | 3300042004 | Ga0439445_0012334 | Ga0439445_0012334_126_974 | 253 |
| 70 | 3300046512 | Ga0495610_0008107 | Ga0495610_0008107_3029_3871 | 253 |
| 71 | 3300049575 | Ga0501039_0019866 | Ga0501039_0019866_3635_4444 | 253 |
| 72 | 3300049578 | Ga0501042_0497761 | Ga0501042_0497761_63_872 | 253 |
| 73 | 3300049741 | Ga0501079_0106273 | Ga0501079_0106273_471_1280 | 253 |
| 74 | 3300049743 | Ga0501081_0044767 | Ga0501081_0044767_1371_2180 | 253 |
| 75 | 3300053119 | Ga0500595_072629 | Ga0500595_072629_199_993 | 253 |
| 76 | 3300053153 | Ga0500616_0044871 | Ga0500616_0044871_551_1345 | 253 |
| 77 | 3300005842 | Ga0068858_100000029 | Ga0068858_10000002951 | 254 |
| 78 | 3300009177 | Ga0105248_10016560 | Ga0105248_100165607 | 254 |
| 79 | 3300010375 | Ga0105239_10007278 | Ga0105239_100072787 | 254 |
| 80 | 3300025941 | Ga0207711_10001642 | Ga0207711_1000164217 | 254 |
| 81 | 3300037312 | Ga0395899_0000026 | Ga0395899_0000026_282426_283298 | 254 |
| 82 | 3300046460 | Ga0495638_0150837 | Ga0495638_0150837_377_1219 | 254 |
| 83 | 3300048905 | Ga0496102_0216264 | Ga0496102_0216264_240_1097 | 254 |
| 84 | 3300048909 | Ga0496106_0079112 | Ga0496106_0079112_1116_1973 | 254 |
| 85 | 3300048920 | Ga0496117_0017711 | Ga0496117_0017711_2264_3121 | 254 |
| 86 | 3300048924 | Ga0496121_0000130 | Ga0496121_0000130_253_1110 | 254 |
| 87 | 3300053087 | Ga0500643_004745 | Ga0500643_004745_2369_3223 | 254 |
| 88 | 3300053091 | Ga0500647_0027125 | Ga0500647_0027125_1577_2416 | 254 |
| 89 | 3300005546 | Ga0070696_100187704 | Ga0070696_1001877042 | 256 |
| 90 | 3300006847 | Ga0075431_100047714 | Ga0075431_1000477143 | 256 |
| 91 | 3300048929 | Ga0496126_0225961 | Ga0496126_0225961_736_1530 | 256 |
| 92 | 3300050510 | nmdc:mga06r32_10930_c1 | nmdc:mga06r32_10930_c1_5183_5995 | 256 |
| 93 | 3300006847 | Ga0075431_100003819 | Ga0075431_10000381910 | 257 |
| 94 | 3300034816 | Ga0373930_0049990 | Ga0373930_0049990_11_784 | 257 |
| 95 | 3300035121 | Ga0373960_0012957 | Ga0373960_0012957_1295_2068 | 257 |
| 96 | 3300039437 | Ga0436365_1695948 | Ga0436365_1695948_223_996 | 257 |
| 97 | 3300048905 | Ga0496102_0058075 | Ga0496102_0058075_2741_3514 | 257 |
| 98 | 3300048916 | Ga0496113_0121596 | Ga0496113_0121596_13_786 | 257 |
| 99 | 3300049581 | Ga0501047_0039197 | Ga0501047_0039197_569_1417 | 257 |
| 100 | 3300049823 | Ga0501044_0446815 | Ga0501044_0446815_227_1075 | 257 |
| 101 | 3300053078 | Ga0495612_0026130 | Ga0495612_0026130_1561_2334 | 257 |
| 102 | 3300003781 | Ga0055536_1008604 | Ga0055536_10086044 | 258 |
| 103 | 3300003794 | Ga0055531_10025153 | Ga0055531_100251533 | 258 |
| 104 | 3300013105 | Ga0157369_10000077 | Ga0157369_1000007761 | 258 |
| 105 | 3300025292 | Ga0209676_1000046 | Ga0209676_1000046124 | 258 |
| 106 | 3300025298 | Ga0209050_1019572 | Ga0209050_10195723 | 258 |
| 107 | 3300025304 | Ga0209257_1000505 | Ga0209257_100050573 | 258 |
| 108 | 3300031901 | Ga0307406_10002705 | Ga0307406_1000270511 | 258 |
| 109 | 3300041405 | Ga0439438_000009 | Ga0439438_000009_135183_136073 | 258 |
| 110 | 3300041407 | Ga0439447_005540 | Ga0439447_005540_3157_4047 | 258 |
| 111 | iso_pu_bacteria | 2554235469 | 2556064267 | 260 |
| 112 | iso_pu_bacteria | 2891048133 | 2891052166 | 260 |
| 113 | iso_pu_bacteria | 3003665799 | 3003668799 | 260 |
| 114 | iso_pu_bacteria | 8001845381 | 8001846101 | 260 |
| 115 | 3300025986 | Ga0207658_10484306 | Ga0207658_104843061 | 261 |
| 116 | 3300009093 | Ga0105240_10007706 | Ga0105240_100077069 | 262 |
| 117 | 3300021361 | Ga0213872_10000696 | Ga0213872_1000069624 | 262 |
| 118 | 3300025913 | Ga0207695_10005429 | Ga0207695_1000542911 | 262 |
| 119 | 3300039447 | Ga0436361_0221120 | Ga0436361_0221120_19714_20571 | 262 |
| 120 | 3300005331 | Ga0070670_100000020 | Ga0070670_100000020150 | 263 |
| 121 | 3300005347 | Ga0070668_100000108 | Ga0070668_10000010842 | 263 |
| 122 | 3300005347 | Ga0070668_100031879 | Ga0070668_1000318793 | 263 |
| 123 | 3300005367 | Ga0070667_100000163 | Ga0070667_10000016347 | 263 |
| 124 | 3300005367 | Ga0070667_100006909 | Ga0070667_10000690910 | 263 |
| 125 | 3300005548 | Ga0070665_100001115 | Ga0070665_10000111518 | 263 |
| 126 | 3300005548 | Ga0070665_100033530 | Ga0070665_1000335302 | 263 |
| 127 | 3300005617 | Ga0068859_100016961 | Ga0068859_1000169612 | 263 |
| 128 | 3300005618 | Ga0068864_100000071 | Ga0068864_10000007122 | 263 |
| 129 | 3300005841 | Ga0068863_100000451 | Ga0068863_10000045130 | 263 |
| 130 | 3300005842 | Ga0068858_100002275 | Ga0068858_1000022757 | 263 |
| 131 | 3300005843 | Ga0068860_100142638 | Ga0068860_1001426381 | 263 |
| 132 | 3300005844 | Ga0068862_100001526 | Ga0068862_10000152619 | 263 |
| 133 | 3300005844 | Ga0068862_100009403 | Ga0068862_1000094034 | 263 |
| 134 | 3300006931 | Ga0097620_100016961 | Ga0097620_1000169612 | 263 |
| 135 | 3300007076 | Ga0075435_100035744 | Ga0075435_1000357444 | 263 |
| 136 | 3300009101 | Ga0105247_10073339 | Ga0105247_100733392 | 263 |
| 137 | 3300009177 | Ga0105248_10083691 | Ga0105248_100836912 | 263 |
| 138 | 3300009553 | Ga0105249_10000792 | Ga0105249_1000079211 | 263 |
| 139 | 3300013296 | Ga0157374_10149095 | Ga0157374_101490953 | 263 |
| 140 | 3300013306 | Ga0163162_10035839 | Ga0163162_100358395 | 263 |
| 141 | 3300014968 | Ga0157379_10009298 | Ga0157379_100092988 | 263 |
| 142 | 3300021361 | Ga0213872_10000497 | Ga0213872_1000049720 | 263 |
| 143 | 3300021361 | Ga0213872_10002088 | Ga0213872_100020888 | 263 |
| 144 | 3300021361 | Ga0213872_10045115 | Ga0213872_100451152 | 263 |
| 145 | 3300025292 | Ga0209676_1004756 | Ga0209676_10047562 | 263 |
| 146 | 3300025925 | Ga0207650_10000175 | Ga0207650_1000017546 | 263 |
| 147 | 3300025941 | Ga0207711_10208102 | Ga0207711_102081022 | 263 |
| 148 | 3300025961 | Ga0207712_10000376 | Ga0207712_1000037629 | 263 |
| 149 | 3300025972 | Ga0207668_10000001 | Ga0207668_10000001217 | 263 |
| 150 | 3300025972 | Ga0207668_10000123 | Ga0207668_1000012332 | 263 |
| 151 | 3300025986 | Ga0207658_10000118 | Ga0207658_1000011861 | 263 |
| 152 | 3300025986 | Ga0207658_10009958 | Ga0207658_100099584 | 263 |
| 153 | 3300026035 | Ga0207703_10002470 | Ga0207703_100024707 | 263 |
| 154 | 3300026088 | Ga0207641_10001419 | Ga0207641_1000141910 | 263 |
| 155 | 3300026095 | Ga0207676_10001782 | Ga0207676_1000178221 | 263 |
| 156 | 3300028379 | Ga0268266_10001669 | Ga0268266_1000166910 | 263 |
| 157 | 3300028379 | Ga0268266_10236137 | Ga0268266_102361371 | 263 |
| 158 | 3300028380 | Ga0268265_10000901 | Ga0268265_100009019 | 263 |
| 159 | 3300028380 | Ga0268265_10007451 | Ga0268265_100074512 | 263 |
| 160 | 3300028381 | Ga0268264_10000481 | Ga0268264_1000048113 | 263 |
| 161 | 3300028800 | Ga0265338_10027204 | Ga0265338_100272045 | 263 |
| 162 | 3300028800 | Ga0265338_10109174 | Ga0265338_101091742 | 263 |
| 163 | 3300031247 | Ga0265340_10165645 | Ga0265340_101656451 | 263 |
| 164 | 3300032004 | Ga0307414_10083810 | Ga0307414_100838102 | 263 |
| 165 | 3300032004 | Ga0307414_10195618 | Ga0307414_101956181 | 263 |
| 166 | 3300037312 | Ga0395899_0000095 | Ga0395899_0000095_83469_84317 | 263 |
| 167 | 3300037418 | Ga0395900_0000006 | Ga0395900_0000006_308953_309801 | 263 |
| 168 | 3300037466 | Ga0395898_0006778 | Ga0395898_0006778_5935_6783 | 263 |
| 169 | 3300037471 | Ga0395905_0003726 | Ga0395905_0003726_3071_3919 | 263 |
| 170 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_352201_353049 | 263 |
| 171 | 3300039447 | Ga0436361_1049174 | Ga0436361_1049174_7099_7890 | 263 |
| 172 | 3300048918 | Ga0496115_0089827 | Ga0496115_0089827_92_937 | 263 |
| 173 | 3300048925 | Ga0496122_0003891 | Ga0496122_0003891_16277_17134 | 263 |
| 174 | iso_pu_bacteria | 2643221574 | 2643883767 | 263 |
| 175 | iso_pu_bacteria | 2643221583 | 2643926762 | 263 |
| 176 | iso_pu_bacteria | 2643221699 | 2644548193 | 263 |
| 177 | 3300001430 | JGI24032J14994_101541 | JGI24032J14994_1015411 | 264 |
| 178 | 3300001991 | JGI24743J22301_10003350 | JGI24743J22301_100033502 | 264 |
| 179 | 3300002077 | JGI24744J21845_10027098 | JGI24744J21845_100270982 | 264 |
| 180 | 3300003187 | JGI25151J46595_10011269 | JGI25151J46595_100112691 | 264 |
| 181 | 3300003203 | JGI25406J46586_10004150 | JGI25406J46586_100041503 | 264 |
| 182 | 3300003215 | JGI25153J46596_10008999 | JGI25153J46596_100089993 | 264 |
| 183 | 3300003773 | Ga0055537_1000928 | Ga0055537_100092811 | 264 |
| 184 | 3300003775 | Ga0055524_1000173 | Ga0055524_100017332 | 264 |
| 185 | 3300003784 | Ga0055534_1000077 | Ga0055534_100007721 | 264 |
| 186 | 3300003790 | Ga0055528_1000085 | Ga0055528_100008532 | 264 |
| 187 | 3300003911 | JGI25405J52794_10009844 | JGI25405J52794_100098442 | 264 |
| 188 | 3300005290 | Ga0065712_10233304 | Ga0065712_102333042 | 264 |
| 189 | 3300005295 | Ga0065707_10273660 | Ga0065707_102736601 | 264 |
| 190 | 3300005327 | Ga0070658_10464784 | Ga0070658_104647841 | 264 |
| 191 | 3300005328 | Ga0070676_10044744 | Ga0070676_100447444 | 264 |
| 192 | 3300005328 | Ga0070676_10103735 | Ga0070676_101037353 | 264 |
| 193 | 3300005329 | Ga0070683_100116818 | Ga0070683_1001168184 | 264 |
| 194 | 3300005329 | Ga0070683_100835748 | Ga0070683_1008357481 | 264 |
| 195 | 3300005330 | Ga0070690_100075312 | Ga0070690_1000753121 | 264 |
| 196 | 3300005335 | Ga0070666_10034750 | Ga0070666_100347501 | 264 |
| 197 | 3300005335 | Ga0070666_10136634 | Ga0070666_101366342 | 264 |
| 198 | 3300005336 | Ga0070680_100017664 | Ga0070680_1000176643 | 264 |
| 199 | 3300005336 | Ga0070680_100033335 | Ga0070680_1000333355 | 264 |
| 200 | 3300005336 | Ga0070680_100129049 | Ga0070680_1001290493 | 264 |
| 201 | 3300005336 | Ga0070680_100197636 | Ga0070680_1001976362 | 264 |
| 202 | 3300005336 | Ga0070680_100349733 | Ga0070680_1003497331 | 264 |
| 203 | 3300005337 | Ga0070682_100034717 | Ga0070682_1000347172 | 264 |
| 204 | 3300005337 | Ga0070682_100112629 | Ga0070682_1001126291 | 264 |
| 205 | 3300005338 | Ga0068868_100103869 | Ga0068868_1001038691 | 264 |
| 206 | 3300005339 | Ga0070660_100087391 | Ga0070660_1000873912 | 264 |
| 207 | 3300005341 | Ga0070691_10083801 | Ga0070691_100838012 | 264 |
| 208 | 3300005343 | Ga0070687_100072886 | Ga0070687_1000728862 | 264 |
| 209 | 3300005344 | Ga0070661_100016573 | Ga0070661_1000165731 | 264 |
| 210 | 3300005347 | Ga0070668_100051963 | Ga0070668_1000519634 | 264 |
| 211 | 3300005347 | Ga0070668_100054717 | Ga0070668_1000547173 | 264 |
| 212 | 3300005353 | Ga0070669_100031028 | Ga0070669_1000310282 | 264 |
| 213 | 3300005353 | Ga0070669_100111133 | Ga0070669_1001111332 | 264 |
| 214 | 3300005353 | Ga0070669_100209041 | Ga0070669_1002090412 | 264 |
| 215 | 3300005355 | Ga0070671_100031462 | Ga0070671_1000314621 | 264 |
| 216 | 3300005356 | Ga0070674_100000199 | Ga0070674_10000019917 | 264 |
| 217 | 3300005356 | Ga0070674_100023567 | Ga0070674_1000235673 | 264 |
| 218 | 3300005356 | Ga0070674_100142244 | Ga0070674_1001422442 | 264 |
| 219 | 3300005356 | Ga0070674_100176460 | Ga0070674_1001764602 | 264 |
| 220 | 3300005364 | Ga0070673_100055154 | Ga0070673_1000551543 | 264 |
| 221 | 3300005365 | Ga0070688_100005892 | Ga0070688_1000058923 | 264 |
| 222 | 3300005366 | Ga0070659_100215214 | Ga0070659_1002152141 | 264 |
| 223 | 3300005367 | Ga0070667_100044689 | Ga0070667_1000446893 | 264 |
| 224 | 3300005367 | Ga0070667_100056374 | Ga0070667_1000563743 | 264 |
| 225 | 3300005367 | Ga0070667_100070477 | Ga0070667_1000704774 | 264 |
| 226 | 3300005406 | Ga0070703_10063983 | Ga0070703_100639832 | 264 |
| 227 | 3300005434 | Ga0070709_10003792 | Ga0070709_100037926 | 264 |
| 228 | 3300005434 | Ga0070709_10005111 | Ga0070709_100051113 | 264 |
| 229 | 3300005434 | Ga0070709_10133038 | Ga0070709_101330381 | 264 |
| 230 | 3300005435 | Ga0070714_100017499 | Ga0070714_1000174996 | 264 |
| 231 | 3300005435 | Ga0070714_100018468 | Ga0070714_1000184683 | 264 |
| 232 | 3300005435 | Ga0070714_100092841 | Ga0070714_1000928414 | 264 |
| 233 | 3300005436 | Ga0070713_100063437 | Ga0070713_1000634373 | 264 |
| 234 | 3300005436 | Ga0070713_100230005 | Ga0070713_1002300052 | 264 |
| 235 | 3300005437 | Ga0070710_10019445 | Ga0070710_100194451 | 264 |
| 236 | 3300005437 | Ga0070710_10034297 | Ga0070710_100342972 | 264 |
| 237 | 3300005439 | Ga0070711_100038107 | Ga0070711_1000381074 | 264 |
| 238 | 3300005439 | Ga0070711_100040957 | Ga0070711_1000409573 | 264 |
| 239 | 3300005440 | Ga0070705_100117902 | Ga0070705_1001179022 | 264 |
| 240 | 3300005440 | Ga0070705_100387523 | Ga0070705_1003875231 | 264 |
| 241 | 3300005441 | Ga0070700_100100255 | Ga0070700_1001002553 | 264 |
| 242 | 3300005444 | Ga0070694_100003602 | Ga0070694_1000036022 | 264 |
| 243 | 3300005444 | Ga0070694_100005990 | Ga0070694_1000059906 | 264 |
| 244 | 3300005444 | Ga0070694_100067704 | Ga0070694_1000677042 | 264 |
| 245 | 3300005445 | Ga0070708_100203175 | Ga0070708_1002031753 | 264 |
| 246 | 3300005455 | Ga0070663_100062360 | Ga0070663_1000623603 | 264 |
| 247 | 3300005456 | Ga0070678_100065070 | Ga0070678_1000650702 | 264 |
| 248 | 3300005456 | Ga0070678_100073852 | Ga0070678_1000738522 | 264 |
| 249 | 3300005457 | Ga0070662_100042085 | Ga0070662_1000420853 | 264 |
| 250 | 3300005457 | Ga0070662_100096919 | Ga0070662_1000969192 | 264 |
| 251 | 3300005458 | Ga0070681_10054464 | Ga0070681_100544641 | 264 |
| 252 | 3300005458 | Ga0070681_10094196 | Ga0070681_100941961 | 264 |
| 253 | 3300005466 | Ga0070685_10039446 | Ga0070685_100394463 | 264 |
| 254 | 3300005468 | Ga0070707_100010077 | Ga0070707_1000100778 | 264 |
| 255 | 3300005468 | Ga0070707_100313387 | Ga0070707_1003133872 | 264 |
| 256 | 3300005471 | Ga0070698_100025218 | Ga0070698_1000252184 | 264 |
| 257 | 3300005518 | Ga0070699_100037375 | Ga0070699_1000373753 | 264 |
| 258 | 3300005530 | Ga0070679_100003679 | Ga0070679_1000036797 | 264 |
| 259 | 3300005530 | Ga0070679_100028116 | Ga0070679_1000281165 | 264 |
| 260 | 3300005530 | Ga0070679_100083534 | Ga0070679_1000835343 | 264 |
| 261 | 3300005535 | Ga0070684_100135254 | Ga0070684_1001352542 | 264 |
| 262 | 3300005535 | Ga0070684_100390989 | Ga0070684_1003909892 | 264 |
| 263 | 3300005539 | Ga0068853_100196757 | Ga0068853_1001967572 | 264 |
| 264 | 3300005543 | Ga0070672_100026429 | Ga0070672_1000264293 | 264 |
| 265 | 3300005543 | Ga0070672_100374689 | Ga0070672_1003746892 | 264 |
| 266 | 3300005544 | Ga0070686_100010959 | Ga0070686_1000109594 | 264 |
| 267 | 3300005545 | Ga0070695_100033072 | Ga0070695_1000330722 | 264 |
| 268 | 3300005545 | Ga0070695_100059949 | Ga0070695_1000599492 | 264 |
| 269 | 3300005546 | Ga0070696_100030433 | Ga0070696_1000304334 | 264 |
| 270 | 3300005546 | Ga0070696_100059096 | Ga0070696_1000590963 | 264 |
| 271 | 3300005548 | Ga0070665_100477460 | Ga0070665_1004774602 | 264 |
| 272 | 3300005548 | Ga0070665_100558640 | Ga0070665_1005586402 | 264 |
| 273 | 3300005549 | Ga0070704_100066620 | Ga0070704_1000666203 | 264 |
| 274 | 3300005549 | Ga0070704_100126390 | Ga0070704_1001263903 | 264 |
| 275 | 3300005549 | Ga0070704_100337942 | Ga0070704_1003379422 | 264 |
| 276 | 3300005563 | Ga0068855_100121272 | Ga0068855_1001212722 | 264 |
| 277 | 3300005563 | Ga0068855_100284816 | Ga0068855_1002848162 | 264 |
| 278 | 3300005563 | Ga0068855_100398885 | Ga0068855_1003988852 | 264 |
| 279 | 3300005577 | Ga0068857_100219650 | Ga0068857_1002196502 | 264 |
| 280 | 3300005614 | Ga0068856_100120790 | Ga0068856_1001207902 | 264 |
| 281 | 3300005615 | Ga0070702_100070029 | Ga0070702_1000700292 | 264 |
| 282 | 3300005616 | Ga0068852_100320780 | Ga0068852_1003207802 | 264 |
| 283 | 3300005617 | Ga0068859_100157584 | Ga0068859_1001575843 | 264 |
| 284 | 3300005617 | Ga0068859_100194668 | Ga0068859_1001946683 | 264 |
| 285 | 3300005618 | Ga0068864_100017888 | Ga0068864_1000178884 | 264 |
| 286 | 3300005618 | Ga0068864_100190574 | Ga0068864_1001905742 | 264 |
| 287 | 3300005618 | Ga0068864_100403288 | Ga0068864_1004032882 | 264 |
| 288 | 3300005718 | Ga0068866_10074376 | Ga0068866_100743762 | 264 |
| 289 | 3300005718 | Ga0068866_10128258 | Ga0068866_101282582 | 264 |
| 290 | 3300005840 | Ga0068870_10220435 | Ga0068870_102204352 | 264 |
| 291 | 3300005841 | Ga0068863_100217489 | Ga0068863_1002174892 | 264 |
| 292 | 3300005841 | Ga0068863_100790968 | Ga0068863_1007909681 | 264 |
| 293 | 3300005842 | Ga0068858_100033224 | Ga0068858_1000332242 | 264 |
| 294 | 3300005842 | Ga0068858_100245385 | Ga0068858_1002453851 | 264 |
| 295 | 3300005843 | Ga0068860_100208863 | Ga0068860_1002088633 | 264 |
| 296 | 3300005844 | Ga0068862_100162210 | Ga0068862_1001622101 | 264 |
| 297 | 3300005937 | Ga0081455_10011386 | Ga0081455_100113863 | 264 |
| 298 | 3300005937 | Ga0081455_10108197 | Ga0081455_101081972 | 264 |
| 299 | 3300005937 | Ga0081455_10183322 | Ga0081455_101833221 | 264 |
| 300 | 3300005981 | Ga0081538_10040288 | Ga0081538_100402883 | 264 |
| 301 | 3300005983 | Ga0081540_1000869 | Ga0081540_100086921 | 264 |
| 302 | 3300005983 | Ga0081540_1000925 | Ga0081540_100092517 | 264 |
| 303 | 3300005983 | Ga0081540_1020032 | Ga0081540_10200324 | 264 |
| 304 | 3300005983 | Ga0081540_1024207 | Ga0081540_10242074 | 264 |
| 305 | 3300005983 | Ga0081540_1137282 | Ga0081540_11372822 | 264 |
| 306 | 3300005985 | Ga0081539_10007161 | Ga0081539_100071617 | 264 |
| 307 | 3300006028 | Ga0070717_10000377 | Ga0070717_1000037715 | 264 |
| 308 | 3300006038 | Ga0075365_10018424 | Ga0075365_100184243 | 264 |
| 309 | 3300006038 | Ga0075365_10028585 | Ga0075365_100285852 | 264 |
| 310 | 3300006048 | Ga0075363_100034239 | Ga0075363_1000342393 | 264 |
| 311 | 3300006048 | Ga0075363_100045718 | Ga0075363_1000457182 | 264 |
| 312 | 3300006051 | Ga0075364_10024862 | Ga0075364_100248623 | 264 |
| 313 | 3300006051 | Ga0075364_10341842 | Ga0075364_103418421 | 264 |
| 314 | 3300006163 | Ga0070715_10026458 | Ga0070715_100264582 | 264 |
| 315 | 3300006163 | Ga0070715_10057430 | Ga0070715_100574302 | 264 |
| 316 | 3300006173 | Ga0070716_100002527 | Ga0070716_1000025272 | 264 |
| 317 | 3300006173 | Ga0070716_100094885 | Ga0070716_1000948852 | 264 |
| 318 | 3300006175 | Ga0070712_100082962 | Ga0070712_1000829622 | 264 |
| 319 | 3300006177 | Ga0075362_10017105 | Ga0075362_100171054 | 264 |
| 320 | 3300006186 | Ga0075369_10001871 | Ga0075369_100018711 | 264 |
| 321 | 3300006237 | Ga0097621_100033091 | Ga0097621_1000330913 | 264 |
| 322 | 3300006237 | Ga0097621_100078746 | Ga0097621_1000787462 | 264 |
| 323 | 3300006237 | Ga0097621_100222433 | Ga0097621_1002224332 | 264 |
| 324 | 3300006237 | Ga0097621_100295236 | Ga0097621_1002952362 | 264 |
| 325 | 3300006358 | Ga0068871_100035625 | Ga0068871_1000356254 | 264 |
| 326 | 3300006358 | Ga0068871_100163007 | Ga0068871_1001630072 | 264 |
| 327 | 3300006358 | Ga0068871_100485698 | Ga0068871_1004856982 | 264 |
| 328 | 3300006358 | Ga0068871_100526784 | Ga0068871_1005267842 | 264 |
| 329 | 3300006844 | Ga0075428_100077850 | Ga0075428_1000778504 | 264 |
| 330 | 3300006844 | Ga0075428_100088833 | Ga0075428_1000888333 | 264 |
| 331 | 3300006846 | Ga0075430_100000617 | Ga0075430_10000061714 | 264 |
| 332 | 3300006846 | Ga0075430_100003539 | Ga0075430_1000035393 | 264 |
| 333 | 3300006846 | Ga0075430_100025309 | Ga0075430_1000253094 | 264 |
| 334 | 3300006847 | Ga0075431_100021855 | Ga0075431_1000218555 | 264 |
| 335 | 3300006847 | Ga0075431_100296804 | Ga0075431_1002968042 | 264 |
| 336 | 3300006847 | Ga0075431_100618393 | Ga0075431_1006183932 | 264 |
| 337 | 3300006847 | Ga0075431_100663013 | Ga0075431_1006630131 | 264 |
| 338 | 3300006852 | Ga0075433_10125584 | Ga0075433_101255842 | 264 |
| 339 | 3300006852 | Ga0075433_10181745 | Ga0075433_101817453 | 264 |
| 340 | 3300006871 | Ga0075434_100006453 | Ga0075434_1000064534 | 264 |
| 341 | 3300006871 | Ga0075434_100055718 | Ga0075434_1000557184 | 264 |
| 342 | 3300006871 | Ga0075434_100689859 | Ga0075434_1006898592 | 264 |
| 343 | 3300006880 | Ga0075429_100000019 | Ga0075429_10000001958 | 264 |
| 344 | 3300006881 | Ga0068865_100018172 | Ga0068865_1000181725 | 264 |
| 345 | 3300006881 | Ga0068865_100074017 | Ga0068865_1000740172 | 264 |
| 346 | 3300006881 | Ga0068865_100142583 | Ga0068865_1001425833 | 264 |
| 347 | 3300006914 | Ga0075436_100026004 | Ga0075436_1000260045 | 264 |
| 348 | 3300006931 | Ga0097620_100157582 | Ga0097620_1001575823 | 264 |
| 349 | 3300006931 | Ga0097620_100194667 | Ga0097620_1001946673 | 264 |
| 350 | 3300007076 | Ga0075435_100034059 | Ga0075435_1000340595 | 264 |
| 351 | 3300009093 | Ga0105240_10067540 | Ga0105240_100675404 | 264 |
| 352 | 3300009093 | Ga0105240_10579805 | Ga0105240_105798051 | 264 |
| 353 | 3300009093 | Ga0105240_10599855 | Ga0105240_105998552 | 264 |
| 354 | 3300009094 | Ga0111539_10035620 | Ga0111539_100356203 | 264 |
| 355 | 3300009094 | Ga0111539_10220872 | Ga0111539_102208722 | 264 |
| 356 | 3300009094 | Ga0111539_10443705 | Ga0111539_104437052 | 264 |
| 357 | 3300009094 | Ga0111539_10516128 | Ga0111539_105161281 | 264 |
| 358 | 3300009094 | Ga0111539_10710599 | Ga0111539_107105992 | 264 |
| 359 | 3300009098 | Ga0105245_10016102 | Ga0105245_100161025 | 264 |
| 360 | 3300009098 | Ga0105245_10081242 | Ga0105245_100812422 | 264 |
| 361 | 3300009101 | Ga0105247_10132744 | Ga0105247_101327441 | 264 |
| 362 | 3300009147 | Ga0114129_10040477 | Ga0114129_100404777 | 264 |
| 363 | 3300009147 | Ga0114129_10092045 | Ga0114129_100920456 | 264 |
| 364 | 3300009147 | Ga0114129_10245526 | Ga0114129_102455263 | 264 |
| 365 | 3300009148 | Ga0105243_10642671 | Ga0105243_106426712 | 264 |
| 366 | 3300009148 | Ga0105243_10674974 | Ga0105243_106749741 | 264 |
| 367 | 3300009174 | Ga0105241_10083262 | Ga0105241_100832623 | 264 |
| 368 | 3300009174 | Ga0105241_10202785 | Ga0105241_102027852 | 264 |
| 369 | 3300009176 | Ga0105242_10007510 | Ga0105242_100075108 | 264 |
| 370 | 3300009176 | Ga0105242_10222522 | Ga0105242_102225222 | 264 |
| 371 | 3300009176 | Ga0105242_10416572 | Ga0105242_104165722 | 264 |
| 372 | 3300009176 | Ga0105242_10872090 | Ga0105242_108720901 | 264 |
| 373 | 3300009177 | Ga0105248_10005446 | Ga0105248_100054464 | 264 |
| 374 | 3300009177 | Ga0105248_10020734 | Ga0105248_100207346 | 264 |
| 375 | 3300009177 | Ga0105248_10046795 | Ga0105248_100467952 | 264 |
| 376 | 3300009545 | Ga0105237_10166457 | Ga0105237_101664571 | 264 |
| 377 | 3300009545 | Ga0105237_10643771 | Ga0105237_106437711 | 264 |
| 378 | 3300009551 | Ga0105238_10011476 | Ga0105238_100114765 | 264 |
| 379 | 3300009551 | Ga0105238_10100191 | Ga0105238_101001913 | 264 |
| 380 | 3300009551 | Ga0105238_10184774 | Ga0105238_101847742 | 264 |
| 381 | 3300009551 | Ga0105238_10695149 | Ga0105238_106951491 | 264 |
| 382 | 3300009553 | Ga0105249_10135218 | Ga0105249_101352182 | 264 |
| 383 | 3300009553 | Ga0105249_10137200 | Ga0105249_101372001 | 264 |
| 384 | 3300009979 | Ga0105032_100258 | Ga0105032_1002587 | 264 |
| 385 | 3300010375 | Ga0105239_10075495 | Ga0105239_100754952 | 264 |
| 386 | 3300011119 | Ga0105246_10064378 | Ga0105246_100643783 | 264 |
| 387 | 3300011119 | Ga0105246_10421822 | Ga0105246_104218222 | 264 |
| 388 | 3300013102 | Ga0157371_10014815 | Ga0157371_100148158 | 264 |
| 389 | 3300013104 | Ga0157370_10147531 | Ga0157370_101475312 | 264 |
| 390 | 3300013297 | Ga0157378_10095979 | Ga0157378_100959793 | 264 |
| 391 | 3300013297 | Ga0157378_10172376 | Ga0157378_101723762 | 264 |
| 392 | 3300013297 | Ga0157378_10334615 | Ga0157378_103346153 | 264 |
| 393 | 3300013297 | Ga0157378_10455304 | Ga0157378_104553042 | 264 |
| 394 | 3300013307 | Ga0157372_10264568 | Ga0157372_102645683 | 264 |
| 395 | 3300013307 | Ga0157372_10656342 | Ga0157372_106563422 | 264 |
| 396 | 3300013307 | Ga0157372_10830136 | Ga0157372_108301361 | 264 |
| 397 | 3300013308 | Ga0157375_10104866 | Ga0157375_101048662 | 264 |
| 398 | 3300014745 | Ga0157377_10350609 | Ga0157377_103506092 | 264 |
| 399 | 3300014969 | Ga0157376_10051396 | Ga0157376_100513963 | 264 |
| 400 | 3300017792 | Ga0163161_10167318 | Ga0163161_101673181 | 264 |
| 401 | 3300021361 | Ga0213872_10014355 | Ga0213872_100143553 | 264 |
| 402 | 3300021384 | Ga0213876_10015170 | Ga0213876_100151703 | 264 |
| 403 | 3300021384 | Ga0213876_10060688 | Ga0213876_100606882 | 264 |
| 404 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011030 | 264 |
| 405 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011030 | 264 |
| 406 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011504 | 264 |
| 407 | 3300025292 | Ga0209676_1000436 | Ga0209676_100043684 | 264 |
| 408 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011666 | 264 |
| 409 | 3300025297 | Ga0209758_1000139 | Ga0209758_10001399 | 264 |
| 410 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006102 | 264 |
| 411 | 3300025885 | Ga0207653_10051551 | Ga0207653_100515512 | 264 |
| 412 | 3300025893 | Ga0207682_10000171 | Ga0207682_1000017126 | 264 |
| 413 | 3300025898 | Ga0207692_10026289 | Ga0207692_100262892 | 264 |
| 414 | 3300025898 | Ga0207692_10125308 | Ga0207692_101253081 | 264 |
| 415 | 3300025901 | Ga0207688_10079370 | Ga0207688_100793703 | 264 |
| 416 | 3300025901 | Ga0207688_10128291 | Ga0207688_101282911 | 264 |
| 417 | 3300025903 | Ga0207680_10189154 | Ga0207680_101891541 | 264 |
| 418 | 3300025905 | Ga0207685_10015243 | Ga0207685_100152433 | 264 |
| 419 | 3300025906 | Ga0207699_10000553 | Ga0207699_1000055311 | 264 |
| 420 | 3300025906 | Ga0207699_10020681 | Ga0207699_100206813 | 264 |
| 421 | 3300025906 | Ga0207699_10052584 | Ga0207699_100525843 | 264 |
| 422 | 3300025906 | Ga0207699_10143305 | Ga0207699_101433051 | 264 |
| 423 | 3300025909 | Ga0207705_10011301 | Ga0207705_100113017 | 264 |
| 424 | 3300025909 | Ga0207705_10452832 | Ga0207705_104528322 | 264 |
| 425 | 3300025910 | Ga0207684_10028554 | Ga0207684_100285546 | 264 |
| 426 | 3300025911 | Ga0207654_10060252 | Ga0207654_100602521 | 264 |
| 427 | 3300025911 | Ga0207654_10153188 | Ga0207654_101531882 | 264 |
| 428 | 3300025911 | Ga0207654_10229968 | Ga0207654_102299682 | 264 |
| 429 | 3300025912 | Ga0207707_10015959 | Ga0207707_100159598 | 264 |
| 430 | 3300025912 | Ga0207707_10141471 | Ga0207707_101414711 | 264 |
| 431 | 3300025913 | Ga0207695_10110311 | Ga0207695_101103111 | 264 |
| 432 | 3300025913 | Ga0207695_10159371 | Ga0207695_101593711 | 264 |
| 433 | 3300025913 | Ga0207695_10287790 | Ga0207695_102877903 | 264 |
| 434 | 3300025914 | Ga0207671_10113007 | Ga0207671_101130072 | 264 |
| 435 | 3300025915 | Ga0207693_10035526 | Ga0207693_100355264 | 264 |
| 436 | 3300025915 | Ga0207693_10069351 | Ga0207693_100693514 | 264 |
| 437 | 3300025915 | Ga0207693_10316041 | Ga0207693_103160412 | 264 |
| 438 | 3300025916 | Ga0207663_10028986 | Ga0207663_100289863 | 264 |
| 439 | 3300025917 | Ga0207660_10014525 | Ga0207660_100145253 | 264 |
| 440 | 3300025917 | Ga0207660_10096567 | Ga0207660_100965673 | 264 |
| 441 | 3300025917 | Ga0207660_10113101 | Ga0207660_101131012 | 264 |
| 442 | 3300025917 | Ga0207660_10123551 | Ga0207660_101235513 | 264 |
| 443 | 3300025917 | Ga0207660_10183505 | Ga0207660_101835052 | 264 |
| 444 | 3300025918 | Ga0207662_10033608 | Ga0207662_100336083 | 264 |
| 445 | 3300025918 | Ga0207662_10051144 | Ga0207662_100511441 | 264 |
| 446 | 3300025919 | Ga0207657_10035581 | Ga0207657_100355813 | 264 |
| 447 | 3300025919 | Ga0207657_10053807 | Ga0207657_100538071 | 264 |
| 448 | 3300025921 | Ga0207652_10018220 | Ga0207652_100182206 | 264 |
| 449 | 3300025921 | Ga0207652_10024455 | Ga0207652_100244553 | 264 |
| 450 | 3300025921 | Ga0207652_10036093 | Ga0207652_100360934 | 264 |
| 451 | 3300025921 | Ga0207652_10067062 | Ga0207652_100670623 | 264 |
| 452 | 3300025922 | Ga0207646_10069984 | Ga0207646_100699844 | 264 |
| 453 | 3300025923 | Ga0207681_10018147 | Ga0207681_100181473 | 264 |
| 454 | 3300025923 | Ga0207681_10337569 | Ga0207681_103375692 | 264 |
| 455 | 3300025924 | Ga0207694_10039122 | Ga0207694_100391223 | 264 |
| 456 | 3300025924 | Ga0207694_10069298 | Ga0207694_100692983 | 264 |
| 457 | 3300025924 | Ga0207694_10387872 | Ga0207694_103878722 | 264 |
| 458 | 3300025924 | Ga0207694_10494041 | Ga0207694_104940411 | 264 |
| 459 | 3300025925 | Ga0207650_10065717 | Ga0207650_100657173 | 264 |
| 460 | 3300025927 | Ga0207687_10060600 | Ga0207687_100606002 | 264 |
| 461 | 3300025927 | Ga0207687_10308475 | Ga0207687_103084752 | 264 |
| 462 | 3300025928 | Ga0207700_10000974 | Ga0207700_1000097413 | 264 |
| 463 | 3300025928 | Ga0207700_10027171 | Ga0207700_100271713 | 264 |
| 464 | 3300025928 | Ga0207700_10056100 | Ga0207700_100561002 | 264 |
| 465 | 3300025928 | Ga0207700_10082062 | Ga0207700_100820622 | 264 |
| 466 | 3300025928 | Ga0207700_10147162 | Ga0207700_101471622 | 264 |
| 467 | 3300025929 | Ga0207664_10025181 | Ga0207664_100251814 | 264 |
| 468 | 3300025929 | Ga0207664_10069459 | Ga0207664_100694593 | 264 |
| 469 | 3300025929 | Ga0207664_10069929 | Ga0207664_100699293 | 264 |
| 470 | 3300025931 | Ga0207644_10004087 | Ga0207644_100040877 | 264 |
| 471 | 3300025931 | Ga0207644_10007589 | Ga0207644_100075898 | 264 |
| 472 | 3300025933 | Ga0207706_10009732 | Ga0207706_100097325 | 264 |
| 473 | 3300025933 | Ga0207706_10071563 | Ga0207706_100715632 | 264 |
| 474 | 3300025934 | Ga0207686_10038270 | Ga0207686_100382702 | 264 |
| 475 | 3300025934 | Ga0207686_10051864 | Ga0207686_100518642 | 264 |
| 476 | 3300025934 | Ga0207686_10087052 | Ga0207686_100870521 | 264 |
| 477 | 3300025936 | Ga0207670_10024728 | Ga0207670_100247284 | 264 |
| 478 | 3300025936 | Ga0207670_10455386 | Ga0207670_104553861 | 264 |
| 479 | 3300025938 | Ga0207704_10044627 | Ga0207704_100446274 | 264 |
| 480 | 3300025938 | Ga0207704_10167045 | Ga0207704_101670452 | 264 |
| 481 | 3300025938 | Ga0207704_10324622 | Ga0207704_103246222 | 264 |
| 482 | 3300025939 | Ga0207665_10008397 | Ga0207665_100083977 | 264 |
| 483 | 3300025939 | Ga0207665_10084392 | Ga0207665_100843924 | 264 |
| 484 | 3300025939 | Ga0207665_10099668 | Ga0207665_100996682 | 264 |
| 485 | 3300025939 | Ga0207665_10116867 | Ga0207665_101168671 | 264 |
| 486 | 3300025939 | Ga0207665_10258911 | Ga0207665_102589112 | 264 |
| 487 | 3300025940 | Ga0207691_10004900 | Ga0207691_100049005 | 264 |
| 488 | 3300025940 | Ga0207691_10378582 | Ga0207691_103785821 | 264 |
| 489 | 3300025942 | Ga0207689_10057574 | Ga0207689_100575742 | 264 |
| 490 | 3300025942 | Ga0207689_10230424 | Ga0207689_102304241 | 264 |
| 491 | 3300025942 | Ga0207689_10252882 | Ga0207689_102528822 | 264 |
| 492 | 3300025944 | Ga0207661_10038326 | Ga0207661_100383262 | 264 |
| 493 | 3300025949 | Ga0207667_10050320 | Ga0207667_100503203 | 264 |
| 494 | 3300025949 | Ga0207667_10149652 | Ga0207667_101496521 | 264 |
| 495 | 3300025960 | Ga0207651_10067000 | Ga0207651_100670002 | 264 |
| 496 | 3300025961 | Ga0207712_10065685 | Ga0207712_100656852 | 264 |
| 497 | 3300025961 | Ga0207712_10262516 | Ga0207712_102625162 | 264 |
| 498 | 3300025961 | Ga0207712_10278504 | Ga0207712_102785041 | 264 |
| 499 | 3300025972 | Ga0207668_10003923 | Ga0207668_100039238 | 264 |
| 500 | 3300025986 | Ga0207658_10649969 | Ga0207658_106499691 | 264 |
| 501 | 3300025986 | Ga0207658_10722571 | Ga0207658_107225711 | 264 |
| 502 | 3300026023 | Ga0207677_10043892 | Ga0207677_100438921 | 264 |
| 503 | 3300026035 | Ga0207703_10129636 | Ga0207703_101296363 | 264 |
| 504 | 3300026041 | Ga0207639_10295327 | Ga0207639_102953272 | 264 |
| 505 | 3300026067 | Ga0207678_10021192 | Ga0207678_100211926 | 264 |
| 506 | 3300026067 | Ga0207678_10021441 | Ga0207678_100214416 | 264 |
| 507 | 3300026067 | Ga0207678_10083115 | Ga0207678_100831152 | 264 |
| 508 | 3300026075 | Ga0207708_10060407 | Ga0207708_100604074 | 264 |
| 509 | 3300026075 | Ga0207708_10167170 | Ga0207708_101671701 | 264 |
| 510 | 3300026088 | Ga0207641_10018297 | Ga0207641_100182972 | 264 |
| 511 | 3300026089 | Ga0207648_10388456 | Ga0207648_103884562 | 264 |
| 512 | 3300026095 | Ga0207676_10182782 | Ga0207676_101827822 | 264 |
| 513 | 3300026116 | Ga0207674_10188718 | Ga0207674_101887182 | 264 |
| 514 | 3300026118 | Ga0207675_100331768 | Ga0207675_1003317682 | 264 |
| 515 | 3300026121 | Ga0207683_10000902 | Ga0207683_1000090210 | 264 |
| 516 | 3300026121 | Ga0207683_10050440 | Ga0207683_100504402 | 264 |
| 517 | 3300026121 | Ga0207683_10092348 | Ga0207683_100923482 | 264 |
| 518 | 3300027360 | Ga0209969_1004755 | Ga0209969_10047552 | 264 |
| 519 | 3300027395 | Ga0209996_1008531 | Ga0209996_10085312 | 264 |
| 520 | 3300027695 | Ga0209966_1018921 | Ga0209966_10189212 | 264 |
| 521 | 3300027907 | Ga0207428_10064223 | Ga0207428_100642234 | 264 |
| 522 | 3300027907 | Ga0207428_10406540 | Ga0207428_104065402 | 264 |
| 523 | 3300028379 | Ga0268266_10022103 | Ga0268266_100221031 | 264 |
| 524 | 3300028379 | Ga0268266_10252841 | Ga0268266_102528412 | 264 |
| 525 | 3300028380 | Ga0268265_10261546 | Ga0268265_102615462 | 264 |
| 526 | 3300028556 | Ga0265337_1003784 | Ga0265337_10037846 | 264 |
| 527 | 3300028563 | Ga0265319_1015151 | Ga0265319_10151513 | 264 |
| 528 | 3300028573 | Ga0265334_10000143 | Ga0265334_1000014335 | 264 |
| 529 | 3300028573 | Ga0265334_10007008 | Ga0265334_100070082 | 264 |
| 530 | 3300028573 | Ga0265334_10009472 | Ga0265334_100094725 | 264 |
| 531 | 3300028577 | Ga0265318_10003937 | Ga0265318_100039374 | 264 |
| 532 | 3300028577 | Ga0265318_10017959 | Ga0265318_100179592 | 264 |
| 533 | 3300028800 | Ga0265338_10000043 | Ga0265338_10000043164 | 264 |
| 534 | 3300028800 | Ga0265338_10012357 | Ga0265338_100123578 | 264 |
| 535 | 3300028800 | Ga0265338_10022519 | Ga0265338_100225198 | 264 |
| 536 | 3300028800 | Ga0265338_10076391 | Ga0265338_100763913 | 264 |
| 537 | 3300029957 | Ga0265324_10041806 | Ga0265324_100418062 | 264 |
| 538 | 3300031235 | Ga0265330_10005644 | Ga0265330_100056443 | 264 |
| 539 | 3300031235 | Ga0265330_10083821 | Ga0265330_100838212 | 264 |
| 540 | 3300031238 | Ga0265332_10004974 | Ga0265332_100049745 | 264 |
| 541 | 3300031238 | Ga0265332_10030001 | Ga0265332_100300012 | 264 |
| 542 | 3300031239 | Ga0265328_10008731 | Ga0265328_100087314 | 264 |
| 543 | 3300031239 | Ga0265328_10009813 | Ga0265328_100098132 | 264 |
| 544 | 3300031240 | Ga0265320_10004052 | Ga0265320_100040529 | 264 |
| 545 | 3300031241 | Ga0265325_10000002 | Ga0265325_10000002222 | 264 |
| 546 | 3300031241 | Ga0265325_10000036 | Ga0265325_1000003673 | 264 |
| 547 | 3300031241 | Ga0265325_10000464 | Ga0265325_1000046413 | 264 |
| 548 | 3300031241 | Ga0265325_10012515 | Ga0265325_100125154 | 264 |
| 549 | 3300031242 | Ga0265329_10006598 | Ga0265329_100065982 | 264 |
| 550 | 3300031247 | Ga0265340_10000952 | Ga0265340_1000095210 | 264 |
| 551 | 3300031247 | Ga0265340_10007138 | Ga0265340_100071384 | 264 |
| 552 | 3300031247 | Ga0265340_10017926 | Ga0265340_100179264 | 264 |
| 553 | 3300031247 | Ga0265340_10032994 | Ga0265340_100329941 | 264 |
| 554 | 3300031249 | Ga0265339_10000625 | Ga0265339_100006254 | 264 |
| 555 | 3300031249 | Ga0265339_10001612 | Ga0265339_100016122 | 264 |
| 556 | 3300031249 | Ga0265339_10009163 | Ga0265339_100091637 | 264 |
| 557 | 3300031250 | Ga0265331_10001902 | Ga0265331_1000190211 | 264 |
| 558 | 3300031250 | Ga0265331_10030827 | Ga0265331_100308272 | 264 |
| 559 | 3300031250 | Ga0265331_10091730 | Ga0265331_100917302 | 264 |
| 560 | 3300031344 | Ga0265316_10006610 | Ga0265316_100066105 | 264 |
| 561 | 3300031344 | Ga0265316_10008327 | Ga0265316_100083273 | 264 |
| 562 | 3300031344 | Ga0265316_10205196 | Ga0265316_102051963 | 264 |
| 563 | 3300031456 | Ga0307513_10046517 | Ga0307513_100465177 | 264 |
| 564 | 3300031595 | Ga0265313_10000513 | Ga0265313_1000051322 | 264 |
| 565 | 3300031595 | Ga0265313_10001147 | Ga0265313_1000114714 | 264 |
| 566 | 3300031595 | Ga0265313_10001243 | Ga0265313_100012434 | 264 |
| 567 | 3300031595 | Ga0265313_10001570 | Ga0265313_100015707 | 264 |
| 568 | 3300031595 | Ga0265313_10011866 | Ga0265313_100118663 | 264 |
| 569 | 3300031595 | Ga0265313_10015324 | Ga0265313_100153242 | 264 |
| 570 | 3300031595 | Ga0265313_10077748 | Ga0265313_100777482 | 264 |
| 571 | 3300031595 | Ga0265313_10129214 | Ga0265313_101292142 | 264 |
| 572 | 3300031691 | Ga0316579_10022141 | Ga0316579_100221413 | 264 |
| 573 | 3300031711 | Ga0265314_10005001 | Ga0265314_100050018 | 264 |
| 574 | 3300031712 | Ga0265342_10000715 | Ga0265342_1000071536 | 264 |
| 575 | 3300031712 | Ga0265342_10007638 | Ga0265342_100076384 | 264 |
| 576 | 3300031712 | Ga0265342_10010075 | Ga0265342_100100753 | 264 |
| 577 | 3300031712 | Ga0265342_10090585 | Ga0265342_100905851 | 264 |
| 578 | 3300031852 | Ga0307410_10178059 | Ga0307410_101780592 | 264 |
| 579 | 3300031901 | Ga0307406_10083660 | Ga0307406_100836602 | 264 |
| 580 | 3300031995 | Ga0307409_100481546 | Ga0307409_1004815462 | 264 |
| 581 | 3300034957 | Ga0373938_0000453 | Ga0373938_0000453_3641_4435 | 264 |
| 582 | 3300035083 | Ga0373926_0095560 | Ga0373926_0095560_27_839 | 264 |
| 583 | 3300035084 | Ga0373928_0054743 | Ga0373928_0054743_133_927 | 264 |
| 584 | 3300035088 | Ga0373940_0009414 | Ga0373940_0009414_46_840 | 264 |
| 585 | 3300035089 | Ga0373944_0066480 | Ga0373944_0066480_176_970 | 264 |
| 586 | 3300035090 | Ga0373949_0023914 | Ga0373949_0023914_215_1009 | 264 |
| 587 | 3300035111 | Ga0373923_0031497 | Ga0373923_0031497_269_1063 | 264 |
| 588 | 3300035113 | Ga0373936_0048609 | Ga0373936_0048609_96_890 | 264 |
| 589 | 3300035113 | Ga0373936_0122426 | Ga0373936_0122426_236_1030 | 264 |
| 590 | 3300035114 | Ga0373939_0019310 | Ga0373939_0019310_577_1371 | 264 |
| 591 | 3300035114 | Ga0373939_0053327 | Ga0373939_0053327_370_1164 | 264 |
| 592 | 3300035115 | Ga0373941_0049605 | Ga0373941_0049605_304_1098 | 264 |
| 593 | 3300035116 | Ga0373945_0003237 | Ga0373945_0003237_3131_3925 | 264 |
| 594 | 3300035116 | Ga0373945_0029563 | Ga0373945_0029563_597_1391 | 264 |
| 595 | 3300035116 | Ga0373945_0041680 | Ga0373945_0041680_179_973 | 264 |
| 596 | 3300035117 | Ga0373953_0003538 | Ga0373953_0003538_1958_2764 | 264 |
| 597 | 3300035117 | Ga0373953_0004967 | Ga0373953_0004967_3212_4006 | 264 |
| 598 | 3300035117 | Ga0373953_0034560 | Ga0373953_0034560_1080_1874 | 264 |
| 599 | 3300035117 | Ga0373953_0103293 | Ga0373953_0103293_271_1065 | 264 |
| 600 | 3300035118 | Ga0373954_0000020 | Ga0373954_0000020_19109_19921 | 264 |
| 601 | 3300035118 | Ga0373954_0005850 | Ga0373954_0005850_3934_4728 | 264 |
| 602 | 3300035118 | Ga0373954_0010400 | Ga0373954_0010400_253_1047 | 264 |
| 603 | 3300035118 | Ga0373954_0049628 | Ga0373954_0049628_871_1677 | 264 |
| 604 | 3300035119 | Ga0373956_0009309 | Ga0373956_0009309_1082_1876 | 264 |
| 605 | 3300035119 | Ga0373956_0018550 | Ga0373956_0018550_336_1130 | 264 |
| 606 | 3300035119 | Ga0373956_0030175 | Ga0373956_0030175_224_1030 | 264 |
| 607 | 3300035119 | Ga0373956_0079868 | Ga0373956_0079868_384_1178 | 264 |
| 608 | 3300035119 | Ga0373956_0106861 | Ga0373956_0106861_84_878 | 264 |
| 609 | 3300035120 | Ga0373957_0014040 | Ga0373957_0014040_714_1508 | 264 |
| 610 | 3300035120 | Ga0373957_0020115 | Ga0373957_0020115_615_1409 | 264 |
| 611 | 3300035120 | Ga0373957_0076370 | Ga0373957_0076370_341_1135 | 264 |
| 612 | 3300035170 | Ga0373943_0001299 | Ga0373943_0001299_5726_6520 | 264 |
| 613 | 3300035170 | Ga0373943_0083922 | Ga0373943_0083922_582_1376 | 264 |
| 614 | 3300035171 | Ga0373946_0001129 | Ga0373946_0001129_3090_3884 | 264 |
| 615 | 3300035172 | Ga0373955_0001159 | Ga0373955_0001159_2975_3769 | 264 |
| 616 | 3300035172 | Ga0373955_0002257 | Ga0373955_0002257_1833_2627 | 264 |
| 617 | 3300035172 | Ga0373955_0016631 | Ga0373955_0016631_1864_2658 | 264 |
| 618 | 3300035172 | Ga0373955_0016708 | Ga0373955_0016708_1780_2586 | 264 |
| 619 | 3300035242 | Ga0373962_0002352 | Ga0373962_0002352_3382_4176 | 264 |
| 620 | 3300035242 | Ga0373962_0042640 | Ga0373962_0042640_312_1106 | 264 |
| 621 | 3300035398 | Ga0316574_0118410 | Ga0316574_0118410_553_1347 | 264 |
| 622 | 3300035410 | Ga0373924_0000412 | Ga0373924_0000412_10160_10954 | 264 |
| 623 | 3300035410 | Ga0373924_0149782 | Ga0373924_0149782_144_938 | 264 |
| 624 | 3300035410 | Ga0373924_0185718 | Ga0373924_0185718_23_817 | 264 |
| 625 | 3300035691 | Ga0373931_0017584 | Ga0373931_0017584_1367_2161 | 264 |
| 626 | 3300035691 | Ga0373931_0112714 | Ga0373931_0112714_624_1418 | 264 |
| 627 | 3300035692 | Ga0373935_0000100 | Ga0373935_0000100_1397_2191 | 264 |
| 628 | 3300035692 | Ga0373935_0003876 | Ga0373935_0003876_7212_8006 | 264 |
| 629 | 3300035692 | Ga0373935_0012884 | Ga0373935_0012884_3576_4388 | 264 |
| 630 | 3300035692 | Ga0373935_0018083 | Ga0373935_0018083_3031_3825 | 264 |
| 631 | 3300035695 | Ga0373927_0027983 | Ga0373927_0027983_1073_1867 | 264 |
| 632 | 3300035695 | Ga0373927_0028096 | Ga0373927_0028096_2651_3445 | 264 |
| 633 | 3300035695 | Ga0373927_0037835 | Ga0373927_0037835_1532_2344 | 264 |
| 634 | 3300035695 | Ga0373927_0168007 | Ga0373927_0168007_160_954 | 264 |
| 635 | 3300035695 | Ga0373927_0170787 | Ga0373927_0170787_572_1366 | 264 |
| 636 | 3300035724 | Ga0373933_0004387 | Ga0373933_0004387_3930_4742 | 264 |
| 637 | 3300035724 | Ga0373933_0004411 | Ga0373933_0004411_4606_5400 | 264 |
| 638 | 3300035724 | Ga0373933_0005938 | Ga0373933_0005938_4481_5275 | 264 |
| 639 | 3300035724 | Ga0373933_0020540 | Ga0373933_0020540_1168_1962 | 264 |
| 640 | 3300035724 | Ga0373933_0021741 | Ga0373933_0021741_1940_2746 | 264 |
| 641 | 3300035724 | Ga0373933_0116327 | Ga0373933_0116327_392_1186 | 264 |
| 642 | 3300035724 | Ga0373933_0437972 | Ga0373933_0437972_10_804 | 264 |
| 643 | 3300035725 | Ga0373947_0002174 | Ga0373947_0002174_9647_10441 | 264 |
| 644 | 3300035725 | Ga0373947_0026727 | Ga0373947_0026727_2157_2951 | 264 |
| 645 | 3300035725 | Ga0373947_0059346 | Ga0373947_0059346_1489_2283 | 264 |
| 646 | 3300035725 | Ga0373947_0062153 | Ga0373947_0062153_640_1434 | 264 |
| 647 | 3300036401 | Ga0373937_0000028 | Ga0373937_0000028_113577_114371 | 264 |
| 648 | 3300036401 | Ga0373937_0000179 | Ga0373937_0000179_26971_27783 | 264 |
| 649 | 3300036401 | Ga0373937_0002145 | Ga0373937_0002145_2292_3086 | 264 |
| 650 | 3300036401 | Ga0373937_0006979 | Ga0373937_0006979_4867_5661 | 264 |
| 651 | 3300036401 | Ga0373937_0023517 | Ga0373937_0023517_1926_2732 | 264 |
| 652 | 3300036401 | Ga0373937_0030415 | Ga0373937_0030415_3876_4670 | 264 |
| 653 | 3300036401 | Ga0373937_0104503 | Ga0373937_0104503_648_1442 | 264 |
| 654 | 3300036401 | Ga0373937_0115720 | Ga0373937_0115720_1587_2381 | 264 |
| 655 | 3300036401 | Ga0373937_0290809 | Ga0373937_0290809_725_1519 | 264 |
| 656 | 3300036647 | Ga0316582_0003714 | Ga0316582_0003714_6140_6934 | 264 |
| 657 | 3300037068 | Ga0373925_0000034 | Ga0373925_0000034_82502_83296 | 264 |
| 658 | 3300037068 | Ga0373925_0012776 | Ga0373925_0012776_5139_5933 | 264 |
| 659 | 3300037068 | Ga0373925_0045366 | Ga0373925_0045366_437_1231 | 264 |
| 660 | 3300037068 | Ga0373925_0094430 | Ga0373925_0094430_1379_2191 | 264 |
| 661 | 3300037068 | Ga0373925_0337837 | Ga0373925_0337837_284_1078 | 264 |
| 662 | 3300037312 | Ga0395899_0110496 | Ga0395899_0110496_391_1185 | 264 |
| 663 | 3300037418 | Ga0395900_0076901 | Ga0395900_0076901_1282_2076 | 264 |
| 664 | 3300037418 | Ga0395900_0123668 | Ga0395900_0123668_391_1185 | 264 |
| 665 | 3300037466 | Ga0395898_0125850 | Ga0395898_0125850_504_1298 | 264 |
| 666 | 3300037471 | Ga0395905_0358913 | Ga0395905_0358913_495_1289 | 264 |
| 667 | 3300038443 | Ga0395901_0012651 | Ga0395901_0012651_4314_5108 | 264 |
| 668 | 3300038443 | Ga0395901_0213403 | Ga0395901_0213403_857_1651 | 264 |
| 669 | 3300039093 | Ga0400489_69310 | Ga0400489_69310_246_1040 | 264 |
| 670 | 3300039110 | Ga0400487_24057 | Ga0400487_24057_3998_4792 | 264 |
| 671 | 3300039110 | Ga0400487_45503 | Ga0400487_45503_2229_3023 | 264 |
| 672 | 3300039437 | Ga0436365_1244993 | Ga0436365_1244993_5163_5957 | 264 |
| 673 | 3300039438 | Ga0436360_0848133 | Ga0436360_0848133_82_876 | 264 |
| 674 | 3300039447 | Ga0436361_0313975 | Ga0436361_0313975_66_860 | 264 |
| 675 | 3300039447 | Ga0436361_0553129 | Ga0436361_0553129_2741_3535 | 264 |
| 676 | 3300039450 | Ga0436363_0447376 | Ga0436363_0447376_1186_1980 | 264 |
| 677 | 3300039453 | Ga0436362_0078503 | Ga0436362_0078503_124_918 | 264 |
| 678 | 3300039453 | Ga0436362_0273120 | Ga0436362_0273120_901_1695 | 264 |
| 679 | 3300039453 | Ga0436362_0663757 | Ga0436362_0663757_305_1099 | 264 |
| 680 | 3300041408 | Ga0439453_0000183 | Ga0439453_0000183_721_1515 | 264 |
| 681 | 3300041512 | Ga0451853_0783681 | Ga0451853_0783681_108_902 | 264 |
| 682 | 3300041997 | Ga0439431_0024899 | Ga0439431_0024899_38_832 | 264 |
| 683 | 3300042001 | Ga0439441_014256 | Ga0439441_014256_121_915 | 264 |
| 684 | 3300042003 | Ga0439443_000502 | Ga0439443_000502_731_1540 | 264 |
| 685 | 3300042156 | Ga0439446_0094539 | Ga0439446_0094539_28_822 | 264 |
| 686 | 3300042436 | Ga0439435_0000213 | Ga0439435_0000213_4438_5247 | 264 |
| 687 | 3300042439 | Ga0439464_0046068 | Ga0439464_0046068_268_1062 | 264 |
| 688 | 3300042461 | Ga0439460_0000061 | Ga0439460_0000061_13540_14349 | 264 |
| 689 | 3300044693 | Ga0466961_0326459 | Ga0466961_0326459_55_849 | 264 |
| 690 | 3300044694 | Ga0466963_0239373 | Ga0466963_0239373_314_1108 | 264 |
| 691 | 3300044719 | Ga0466971_0194603 | Ga0466971_0194603_121_915 | 264 |
| 692 | 3300044842 | Ga0466957_0025478 | Ga0466957_0025478_425_1219 | 264 |
| 693 | 3300044842 | Ga0466957_0050775 | Ga0466957_0050775_1534_2328 | 264 |
| 694 | 3300045049 | Ga0466959_0029082 | Ga0466959_0029082_3142_3936 | 264 |
| 695 | 3300045049 | Ga0466959_0044534 | Ga0466959_0044534_704_1498 | 264 |
| 696 | 3300045051 | Ga0451576_0088468 | Ga0451576_0088468_1960_2754 | 264 |
| 697 | 3300045051 | Ga0451576_0106334 | Ga0451576_0106334_1404_2216 | 264 |
| 698 | 3300045836 | Ga0466958_0136957 | Ga0466958_0136957_240_1034 | 264 |
| 699 | 3300046454 | Ga0495592_0000031 | Ga0495592_0000031_14787_15581 | 264 |
| 700 | 3300046454 | Ga0495592_0007672 | Ga0495592_0007672_1607_2410 | 264 |
| 701 | 3300046454 | Ga0495592_0041995 | Ga0495592_0041995_721_1515 | 264 |
| 702 | 3300046454 | Ga0495592_0052265 | Ga0495592_0052265_2155_2949 | 264 |
| 703 | 3300046454 | Ga0495592_0056631 | Ga0495592_0056631_1921_2715 | 264 |
| 704 | 3300046455 | Ga0495603_0016117 | Ga0495603_0016117_3328_4122 | 264 |
| 705 | 3300046459 | Ga0495629_0001240 | Ga0495629_0001240_14213_15007 | 264 |
| 706 | 3300046459 | Ga0495629_0019959 | Ga0495629_0019959_2026_2820 | 264 |
| 707 | 3300046459 | Ga0495629_0253437 | Ga0495629_0253437_382_1176 | 264 |
| 708 | 3300046461 | Ga0495641_0021394 | Ga0495641_0021394_1260_2054 | 264 |
| 709 | 3300046462 | Ga0495651_0001979 | Ga0495651_0001979_7666_8460 | 264 |
| 710 | 3300046462 | Ga0495651_0004229 | Ga0495651_0004229_1736_2530 | 264 |
| 711 | 3300046462 | Ga0495651_0006317 | Ga0495651_0006317_3980_4774 | 264 |
| 712 | 3300046462 | Ga0495651_0114725 | Ga0495651_0114725_942_1736 | 264 |
| 713 | 3300046462 | Ga0495651_0132270 | Ga0495651_0132270_758_1552 | 264 |
| 714 | 3300046462 | Ga0495651_0186838 | Ga0495651_0186838_50_844 | 264 |
| 715 | 3300046463 | Ga0495653_0000012 | Ga0495653_0000012_23411_24205 | 264 |
| 716 | 3300046463 | Ga0495653_0010825 | Ga0495653_0010825_1901_2695 | 264 |
| 717 | 3300046463 | Ga0495653_0309723 | Ga0495653_0309723_81_875 | 264 |
| 718 | 3300046473 | Ga0495582_0003108 | Ga0495582_0003108_3655_4449 | 264 |
| 719 | 3300046474 | Ga0495605_0026401 | Ga0495605_0026401_746_1540 | 264 |
| 720 | 3300046475 | Ga0495639_0013265 | Ga0495639_0013265_2723_3517 | 264 |
| 721 | 3300046475 | Ga0495639_0064018 | Ga0495639_0064018_185_979 | 264 |
| 722 | 3300046476 | Ga0495662_0006996 | Ga0495662_0006996_4154_4948 | 264 |
| 723 | 3300046476 | Ga0495662_0008758 | Ga0495662_0008758_3805_4611 | 264 |
| 724 | 3300046476 | Ga0495662_0009212 | Ga0495662_0009212_823_1626 | 264 |
| 725 | 3300046476 | Ga0495662_0015753 | Ga0495662_0015753_955_1749 | 264 |
| 726 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_358112_358906 | 264 |
| 727 | 3300046477 | Ga0495664_0028098 | Ga0495664_0028098_846_1640 | 264 |
| 728 | 3300046491 | Ga0495584_0010598 | Ga0495584_0010598_3399_4193 | 264 |
| 729 | 3300046491 | Ga0495584_0173548 | Ga0495584_0173548_261_1055 | 264 |
| 730 | 3300046499 | Ga0495594_0010943 | Ga0495594_0010943_1129_1923 | 264 |
| 731 | 3300046499 | Ga0495594_0230064 | Ga0495594_0230064_53_904 | 264 |
| 732 | 3300046511 | Ga0495608_0000005 | Ga0495608_0000005_184630_185424 | 264 |
| 733 | 3300046511 | Ga0495608_0001028 | Ga0495608_0001028_12190_12993 | 264 |
| 734 | 3300046511 | Ga0495608_0001415 | Ga0495608_0001415_10221_11015 | 264 |
| 735 | 3300046511 | Ga0495608_0173488 | Ga0495608_0173488_366_1160 | 264 |
| 736 | 3300046514 | Ga0495618_0000024 | Ga0495618_0000024_34387_35181 | 264 |
| 737 | 3300046514 | Ga0495618_0017306 | Ga0495618_0017306_3163_3957 | 264 |
| 738 | 3300046514 | Ga0495618_0092460 | Ga0495618_0092460_958_1761 | 264 |
| 739 | 3300046514 | Ga0495618_0110584 | Ga0495618_0110584_462_1256 | 264 |
| 740 | 3300046514 | Ga0495618_0147484 | Ga0495618_0147484_217_1011 | 264 |
| 741 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_358101_358895 | 264 |
| 742 | 3300046516 | Ga0495628_0004556 | Ga0495628_0004556_4850_5644 | 264 |
| 743 | 3300046516 | Ga0495628_0023939 | Ga0495628_0023939_3256_4050 | 264 |
| 744 | 3300046516 | Ga0495628_0044540 | Ga0495628_0044540_739_1542 | 264 |
| 745 | 3300046517 | Ga0495630_0000433 | Ga0495630_0000433_782_1576 | 264 |
| 746 | 3300046517 | Ga0495630_0011916 | Ga0495630_0011916_4215_5018 | 264 |
| 747 | 3300046517 | Ga0495630_0012901 | Ga0495630_0012901_2962_3789 | 264 |
| 748 | 3300046519 | Ga0495632_0107467 | Ga0495632_0107467_115_909 | 264 |
| 749 | 3300046526 | Ga0495666_0013635 | Ga0495666_0013635_412_1206 | 264 |
| 750 | 3300046526 | Ga0495666_0029050 | Ga0495666_0029050_88_891 | 264 |
| 751 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_572635_573429 | 264 |
| 752 | 3300046529 | Ga0495652_0042527 | Ga0495652_0042527_383_1177 | 264 |
| 753 | 3300046529 | Ga0495652_0056457 | Ga0495652_0056457_199_1002 | 264 |
| 754 | 3300046529 | Ga0495652_0126864 | Ga0495652_0126864_456_1250 | 264 |
| 755 | 3300046529 | Ga0495652_0190876 | Ga0495652_0190876_168_962 | 264 |
| 756 | 3300046529 | Ga0495652_0248607 | Ga0495652_0248607_413_1207 | 264 |
| 757 | 3300046529 | Ga0495652_0298610 | Ga0495652_0298610_99_893 | 264 |
| 758 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_666639_667433 | 264 |
| 759 | 3300046533 | Ga0495640_0024283 | Ga0495640_0024283_2756_3559 | 264 |
| 760 | 3300046533 | Ga0495640_0034312 | Ga0495640_0034312_1009_1803 | 264 |
| 761 | 3300046533 | Ga0495640_0042302 | Ga0495640_0042302_873_1679 | 264 |
| 762 | 3300046533 | Ga0495640_0090859 | Ga0495640_0090859_626_1420 | 264 |
| 763 | 3300046533 | Ga0495640_0099776 | Ga0495640_0099776_469_1263 | 264 |
| 764 | 3300046535 | Ga0495586_0001347 | Ga0495586_0001347_12219_13022 | 264 |
| 765 | 3300046536 | Ga0495587_0000016 | Ga0495587_0000016_97537_98331 | 264 |
| 766 | 3300046536 | Ga0495587_0004603 | Ga0495587_0004603_5196_5990 | 264 |
| 767 | 3300046536 | Ga0495587_0072055 | Ga0495587_0072055_349_1143 | 264 |
| 768 | 3300046536 | Ga0495587_0081447 | Ga0495587_0081447_415_1209 | 264 |
| 769 | 3300046537 | Ga0495598_0001762 | Ga0495598_0001762_3180_3974 | 264 |
| 770 | 3300046537 | Ga0495598_0001867 | Ga0495598_0001867_2420_3214 | 264 |
| 771 | 3300046539 | Ga0495621_0005502 | Ga0495621_0005502_825_1625 | 264 |
| 772 | 3300046539 | Ga0495621_0050622 | Ga0495621_0050622_536_1336 | 264 |
| 773 | 3300046539 | Ga0495621_0137281 | Ga0495621_0137281_126_938 | 264 |
| 774 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_358114_358908 | 264 |
| 775 | 3300046543 | Ga0495645_0028875 | Ga0495645_0028875_2924_3718 | 264 |
| 776 | 3300046543 | Ga0495645_0052308 | Ga0495645_0052308_1923_2717 | 264 |
| 777 | 3300046559 | Ga0495667_0000007 | Ga0495667_0000007_150849_151643 | 264 |
| 778 | 3300046559 | Ga0495667_0000709 | Ga0495667_0000709_11251_12054 | 264 |
| 779 | 3300046559 | Ga0495667_0001645 | Ga0495667_0001645_3685_4479 | 264 |
| 780 | 3300046559 | Ga0495667_0011650 | Ga0495667_0011650_2005_2799 | 264 |
| 781 | 3300046559 | Ga0495667_0020703 | Ga0495667_0020703_3109_3903 | 264 |
| 782 | 3300046559 | Ga0495667_0040356 | Ga0495667_0040356_1356_2150 | 264 |
| 783 | 3300046559 | Ga0495667_0072754 | Ga0495667_0072754_1212_2006 | 264 |
| 784 | 3300046559 | Ga0495667_0092108 | Ga0495667_0092108_716_1528 | 264 |
| 785 | 3300046615 | Ga0495656_0083713 | Ga0495656_0083713_296_1090 | 264 |
| 786 | 3300046642 | Ga0495634_0000637 | Ga0495634_0000637_33129_33923 | 264 |
| 787 | 3300046642 | Ga0495634_0002751 | Ga0495634_0002751_8152_8955 | 264 |
| 788 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_128029_128823 | 264 |
| 789 | 3300046663 | Ga0495635_0024338 | Ga0495635_0024338_457_1251 | 264 |
| 790 | 3300046663 | Ga0495635_0032827 | Ga0495635_0032827_1698_2492 | 264 |
| 791 | 3300046663 | Ga0495635_0058993 | Ga0495635_0058993_1101_1904 | 264 |
| 792 | 3300046663 | Ga0495635_0080766 | Ga0495635_0080766_776_1570 | 264 |
| 793 | 3300046675 | Ga0495657_0000628 | Ga0495657_0000628_14272_15066 | 264 |
| 794 | 3300046675 | Ga0495657_0020211 | Ga0495657_0020211_3537_4331 | 264 |
| 795 | 3300046675 | Ga0495657_0062494 | Ga0495657_0062494_1564_2358 | 264 |
| 796 | 3300046675 | Ga0495657_0095234 | Ga0495657_0095234_106_918 | 264 |
| 797 | 3300046675 | Ga0495657_0098029 | Ga0495657_0098029_304_1110 | 264 |
| 798 | 3300046678 | Ga0495599_0000005 | Ga0495599_0000005_186336_187130 | 264 |
| 799 | 3300046678 | Ga0495599_0013019 | Ga0495599_0013019_3384_4178 | 264 |
| 800 | 3300046678 | Ga0495599_0042650 | Ga0495599_0042650_174_968 | 264 |
| 801 | 3300046678 | Ga0495599_0089351 | Ga0495599_0089351_1002_1805 | 264 |
| 802 | 3300046679 | Ga0495623_0000016 | Ga0495623_0000016_10286_11080 | 264 |
| 803 | 3300046679 | Ga0495623_0000629 | Ga0495623_0000629_4488_5282 | 264 |
| 804 | 3300046679 | Ga0495623_0080766 | Ga0495623_0080766_854_1648 | 264 |
| 805 | 3300046680 | Ga0495646_0000002 | Ga0495646_0000002_112981_113775 | 264 |
| 806 | 3300046680 | Ga0495646_0012772 | Ga0495646_0012772_721_1515 | 264 |
| 807 | 3300046683 | Ga0495658_0000745 | Ga0495658_0000745_7348_8142 | 264 |
| 808 | 3300046683 | Ga0495658_0004885 | Ga0495658_0004885_4986_5789 | 264 |
| 809 | 3300046683 | Ga0495658_0141604 | Ga0495658_0141604_302_1096 | 264 |
| 810 | 3300046683 | Ga0495658_0184226 | Ga0495658_0184226_377_1171 | 264 |
| 811 | 3300046690 | Ga0495624_0199103 | Ga0495624_0199103_410_1204 | 264 |
| 812 | 3300046691 | Ga0495670_0141521 | Ga0495670_0141521_347_1141 | 264 |
| 813 | 3300046809 | Ga0495600_0000279 | Ga0495600_0000279_6771_7565 | 264 |
| 814 | 3300046809 | Ga0495600_0004235 | Ga0495600_0004235_4089_4883 | 264 |
| 815 | 3300046809 | Ga0495600_0005190 | Ga0495600_0005190_4272_5075 | 264 |
| 816 | 3300046809 | Ga0495600_0023211 | Ga0495600_0023211_2723_3517 | 264 |
| 817 | 3300046809 | Ga0495600_0029019 | Ga0495600_0029019_43_837 | 264 |
| 818 | 3300047317 | Ga0495604_0000020 | Ga0495604_0000020_139227_140021 | 264 |
| 819 | 3300047317 | Ga0495604_0008684 | Ga0495604_0008684_4496_5290 | 264 |
| 820 | 3300047317 | Ga0495604_0013367 | Ga0495604_0013367_3526_4329 | 264 |
| 821 | 3300047317 | Ga0495604_0116986 | Ga0495604_0116986_363_1157 | 264 |
| 822 | 3300047317 | Ga0495604_0182428 | Ga0495604_0182428_79_873 | 264 |
| 823 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_358102_358896 | 264 |
| 824 | 3300047319 | Ga0495674_0020681 | Ga0495674_0020681_4868_5662 | 264 |
| 825 | 3300047319 | Ga0495674_0034881 | Ga0495674_0034881_564_1358 | 264 |
| 826 | 3300047320 | Ga0495672_0000374 | Ga0495672_0000374_19468_20319 | 264 |
| 827 | 3300047321 | Ga0495676_0068957 | Ga0495676_0068957_1192_1986 | 264 |
| 828 | 3300047321 | Ga0495676_0099911 | Ga0495676_0099911_502_1296 | 264 |
| 829 | 3300047321 | Ga0495676_0273221 | Ga0495676_0273221_52_846 | 264 |
| 830 | 3300047322 | Ga0495680_0001158 | Ga0495680_0001158_14228_15022 | 264 |
| 831 | 3300047322 | Ga0495680_0005762 | Ga0495680_0005762_4316_5110 | 264 |
| 832 | 3300047322 | Ga0495680_0019375 | Ga0495680_0019375_155_949 | 264 |
| 833 | 3300047322 | Ga0495680_0020742 | Ga0495680_0020742_4409_5203 | 264 |
| 834 | 3300047322 | Ga0495680_0041210 | Ga0495680_0041210_2017_2811 | 264 |
| 835 | 3300047322 | Ga0495680_0068677 | Ga0495680_0068677_213_1007 | 264 |
| 836 | 3300047444 | Ga0495675_0000284 | Ga0495675_0000284_28099_28893 | 264 |
| 837 | 3300047444 | Ga0495675_0002358 | Ga0495675_0002358_5963_6757 | 264 |
| 838 | 3300047444 | Ga0495675_0131952 | Ga0495675_0131952_146_940 | 264 |
| 839 | 3300047444 | Ga0495675_0177805 | Ga0495675_0177805_488_1291 | 264 |
| 840 | 3300047471 | Ga0495684_0000017 | Ga0495684_0000017_110475_111269 | 264 |
| 841 | 3300047471 | Ga0495684_0034978 | Ga0495684_0034978_2900_3694 | 264 |
| 842 | 3300047472 | Ga0495686_0048541 | Ga0495686_0048541_973_1791 | 264 |
| 843 | 3300047673 | Ga0495593_0001934 | Ga0495593_0001934_559_1353 | 264 |
| 844 | 3300047673 | Ga0495593_0055496 | Ga0495593_0055496_852_1646 | 264 |
| 845 | 3300048088 | Ga0495602_0000040 | Ga0495602_0000040_12412_13206 | 264 |
| 846 | 3300048088 | Ga0495602_0003684 | Ga0495602_0003684_848_1642 | 264 |
| 847 | 3300048088 | Ga0495602_0028395 | Ga0495602_0028395_1911_2705 | 264 |
| 848 | 3300048088 | Ga0495602_0122392 | Ga0495602_0122392_1075_1869 | 264 |
| 849 | 3300048090 | Ga0495615_0053442 | Ga0495615_0053442_186_980 | 264 |
| 850 | 3300048903 | Ga0496100_0010939 | Ga0496100_0010939_2974_3768 | 264 |
| 851 | 3300048903 | Ga0496100_0012203 | Ga0496100_0012203_3785_4579 | 264 |
| 852 | 3300048903 | Ga0496100_0057851 | Ga0496100_0057851_907_1701 | 264 |
| 853 | 3300048904 | Ga0496101_0006634 | Ga0496101_0006634_1679_2473 | 264 |
| 854 | 3300048905 | Ga0496102_0046509 | Ga0496102_0046509_2384_3178 | 264 |
| 855 | 3300048905 | Ga0496102_0195065 | Ga0496102_0195065_307_1101 | 264 |
| 856 | 3300048906 | Ga0496103_0067000 | Ga0496103_0067000_802_1596 | 264 |
| 857 | 3300048906 | Ga0496103_0070323 | Ga0496103_0070323_848_1642 | 264 |
| 858 | 3300048907 | Ga0496104_0000055 | Ga0496104_0000055_59649_60443 | 264 |
| 859 | 3300048907 | Ga0496104_0005521 | Ga0496104_0005521_9998_10792 | 264 |
| 860 | 3300048907 | Ga0496104_0011174 | Ga0496104_0011174_1810_2604 | 264 |
| 861 | 3300048907 | Ga0496104_0083240 | Ga0496104_0083240_16_810 | 264 |
| 862 | 3300048907 | Ga0496104_0122731 | Ga0496104_0122731_125_919 | 264 |
| 863 | 3300048907 | Ga0496104_0135365 | Ga0496104_0135365_901_1695 | 264 |
| 864 | 3300048907 | Ga0496104_0192776 | Ga0496104_0192776_987_1781 | 264 |
| 865 | 3300048907 | Ga0496104_0409884 | Ga0496104_0409884_19_813 | 264 |
| 866 | 3300048908 | Ga0496105_0001352 | Ga0496105_0001352_14456_15250 | 264 |
| 867 | 3300048908 | Ga0496105_0006498 | Ga0496105_0006498_4667_5461 | 264 |
| 868 | 3300048908 | Ga0496105_0013053 | Ga0496105_0013053_5331_6125 | 264 |
| 869 | 3300048908 | Ga0496105_0043251 | Ga0496105_0043251_206_1000 | 264 |
| 870 | 3300048908 | Ga0496105_0182787 | Ga0496105_0182787_455_1249 | 264 |
| 871 | 3300048909 | Ga0496106_0044490 | Ga0496106_0044490_1910_2704 | 264 |
| 872 | 3300048909 | Ga0496106_0059439 | Ga0496106_0059439_856_1650 | 264 |
| 873 | 3300048909 | Ga0496106_0330578 | Ga0496106_0330578_190_984 | 264 |
| 874 | 3300048910 | Ga0496107_0005300 | Ga0496107_0005300_2943_3737 | 264 |
| 875 | 3300048910 | Ga0496107_0058525 | Ga0496107_0058525_256_1050 | 264 |
| 876 | 3300048910 | Ga0496107_0109787 | Ga0496107_0109787_150_944 | 264 |
| 877 | 3300048911 | Ga0496108_0037806 | Ga0496108_0037806_1703_2497 | 264 |
| 878 | 3300048912 | Ga0496109_0039967 | Ga0496109_0039967_83_877 | 264 |
| 879 | 3300048912 | Ga0496109_0051612 | Ga0496109_0051612_1096_1890 | 264 |
| 880 | 3300048912 | Ga0496109_0167017 | Ga0496109_0167017_802_1596 | 264 |
| 881 | 3300048913 | Ga0496110_0043384 | Ga0496110_0043384_1255_2049 | 264 |
| 882 | 3300048913 | Ga0496110_0231798 | Ga0496110_0231798_630_1424 | 264 |
| 883 | 3300048913 | Ga0496110_0246779 | Ga0496110_0246779_456_1250 | 264 |
| 884 | 3300048913 | Ga0496110_0348310 | Ga0496110_0348310_50_844 | 264 |
| 885 | 3300048914 | Ga0496111_0029169 | Ga0496111_0029169_139_933 | 264 |
| 886 | 3300048914 | Ga0496111_0033488 | Ga0496111_0033488_405_1199 | 264 |
| 887 | 3300048914 | Ga0496111_0182544 | Ga0496111_0182544_502_1296 | 264 |
| 888 | 3300048914 | Ga0496111_0260399 | Ga0496111_0260399_482_1276 | 264 |
| 889 | 3300048915 | Ga0496112_0263871 | Ga0496112_0263871_41_835 | 264 |
| 890 | 3300048917 | Ga0496114_0000007 | Ga0496114_0000007_236115_236918 | 264 |
| 891 | 3300048917 | Ga0496114_0011561 | Ga0496114_0011561_5900_6694 | 264 |
| 892 | 3300048917 | Ga0496114_0045542 | Ga0496114_0045542_1705_2499 | 264 |
| 893 | 3300048917 | Ga0496114_0373459 | Ga0496114_0373459_189_983 | 264 |
| 894 | 3300048917 | Ga0496114_0409186 | Ga0496114_0409186_118_912 | 264 |
| 895 | 3300048918 | Ga0496115_0014395 | Ga0496115_0014395_770_1564 | 264 |
| 896 | 3300048918 | Ga0496115_0022410 | Ga0496115_0022410_1689_2483 | 264 |
| 897 | 3300048918 | Ga0496115_0062175 | Ga0496115_0062175_546_1340 | 264 |
| 898 | 3300048918 | Ga0496115_0170415 | Ga0496115_0170415_995_1789 | 264 |
| 899 | 3300048918 | Ga0496115_0302958 | Ga0496115_0302958_62_856 | 264 |
| 900 | 3300048922 | Ga0496119_0000314 | Ga0496119_0000314_27314_28108 | 264 |
| 901 | 3300048924 | Ga0496121_0000445 | Ga0496121_0000445_44630_45547 | 264 |
| 902 | 3300048925 | Ga0496122_0000190 | Ga0496122_0000190_53583_54377 | 264 |
| 903 | 3300048925 | Ga0496122_0001527 | Ga0496122_0001527_27725_28537 | 264 |
| 904 | 3300048926 | Ga0496123_0001016 | Ga0496123_0001016_37088_37882 | 264 |
| 905 | 3300048926 | Ga0496123_0001252 | Ga0496123_0001252_21544_22356 | 264 |
| 906 | 3300048928 | Ga0496125_0000273 | Ga0496125_0000273_61329_62123 | 264 |
| 907 | 3300048928 | Ga0496125_0231617 | Ga0496125_0231617_239_1063 | 264 |
| 908 | 3300048929 | Ga0496126_0364327 | Ga0496126_0364327_123_917 | 264 |
| 909 | 3300049551 | Ga0501335_006568 | Ga0501335_006568_183_1034 | 264 |
| 910 | 3300049568 | Ga0501031_0008676 | Ga0501031_0008676_4211_5005 | 264 |
| 911 | 3300049568 | Ga0501031_0012430 | Ga0501031_0012430_3913_4707 | 264 |
| 912 | 3300049568 | Ga0501031_0033868 | Ga0501031_0033868_1936_2742 | 264 |
| 913 | 3300049569 | Ga0501032_0002877 | Ga0501032_0002877_854_1648 | 264 |
| 914 | 3300049569 | Ga0501032_0007634 | Ga0501032_0007634_5509_6303 | 264 |
| 915 | 3300049569 | Ga0501032_0178977 | Ga0501032_0178977_313_1107 | 264 |
| 916 | 3300049570 | Ga0501033_0057319 | Ga0501033_0057319_945_1739 | 264 |
| 917 | 3300049570 | Ga0501033_0191280 | Ga0501033_0191280_252_1046 | 264 |
| 918 | 3300049571 | Ga0501034_0000442 | Ga0501034_0000442_12372_13166 | 264 |
| 919 | 3300049571 | Ga0501034_0019479 | Ga0501034_0019479_4064_4858 | 264 |
| 920 | 3300049571 | Ga0501034_0058526 | Ga0501034_0058526_2480_3274 | 264 |
| 921 | 3300049571 | Ga0501034_0067565 | Ga0501034_0067565_817_1611 | 264 |
| 922 | 3300049571 | Ga0501034_0086158 | Ga0501034_0086158_1332_2126 | 264 |
| 923 | 3300049571 | Ga0501034_0236274 | Ga0501034_0236274_612_1406 | 264 |
| 924 | 3300049571 | Ga0501034_0591878 | Ga0501034_0591878_74_868 | 264 |
| 925 | 3300049572 | Ga0501036_0000984 | Ga0501036_0000984_19241_20047 | 264 |
| 926 | 3300049572 | Ga0501036_0001853 | Ga0501036_0001853_4934_5728 | 264 |
| 927 | 3300049572 | Ga0501036_0002374 | Ga0501036_0002374_1325_2119 | 264 |
| 928 | 3300049572 | Ga0501036_0039661 | Ga0501036_0039661_1939_2748 | 264 |
| 929 | 3300049572 | Ga0501036_0147876 | Ga0501036_0147876_75_869 | 264 |
| 930 | 3300049572 | Ga0501036_0196679 | Ga0501036_0196679_379_1173 | 264 |
| 931 | 3300049573 | Ga0501037_0002212 | Ga0501037_0002212_12322_13128 | 264 |
| 932 | 3300049573 | Ga0501037_0002785 | Ga0501037_0002785_8649_9443 | 264 |
| 933 | 3300049573 | Ga0501037_0008691 | Ga0501037_0008691_1141_1935 | 264 |
| 934 | 3300049574 | Ga0501038_0002844 | Ga0501038_0002844_10085_10891 | 264 |
| 935 | 3300049574 | Ga0501038_0044931 | Ga0501038_0044931_2797_3591 | 264 |
| 936 | 3300049574 | Ga0501038_0046946 | Ga0501038_0046946_2132_2926 | 264 |
| 937 | 3300049574 | Ga0501038_0074453 | Ga0501038_0074453_1180_1989 | 264 |
| 938 | 3300049574 | Ga0501038_0076376 | Ga0501038_0076376_1040_1834 | 264 |
| 939 | 3300049575 | Ga0501039_0000661 | Ga0501039_0000661_22909_23715 | 264 |
| 940 | 3300049575 | Ga0501039_0008637 | Ga0501039_0008637_4019_4813 | 264 |
| 941 | 3300049575 | Ga0501039_0010027 | Ga0501039_0010027_2103_2897 | 264 |
| 942 | 3300049575 | Ga0501039_0083587 | Ga0501039_0083587_139_948 | 264 |
| 943 | 3300049575 | Ga0501039_0315050 | Ga0501039_0315050_270_1064 | 264 |
| 944 | 3300049575 | Ga0501039_0367618 | Ga0501039_0367618_53_847 | 264 |
| 945 | 3300049576 | Ga0501040_0000759 | Ga0501040_0000759_7510_8316 | 264 |
| 946 | 3300049576 | Ga0501040_0009670 | Ga0501040_0009670_3779_4588 | 264 |
| 947 | 3300049576 | Ga0501040_0028681 | Ga0501040_0028681_974_1783 | 264 |
| 948 | 3300049576 | Ga0501040_0078736 | Ga0501040_0078736_1035_1844 | 264 |
| 949 | 3300049576 | Ga0501040_0445253 | Ga0501040_0445253_10_804 | 264 |
| 950 | 3300049577 | Ga0501041_0000109 | Ga0501041_0000109_12726_13532 | 264 |
| 951 | 3300049577 | Ga0501041_0005052 | Ga0501041_0005052_4800_5609 | 264 |
| 952 | 3300049577 | Ga0501041_0138550 | Ga0501041_0138550_576_1370 | 264 |
| 953 | 3300049578 | Ga0501042_0001562 | Ga0501042_0001562_2902_3708 | 264 |
| 954 | 3300049578 | Ga0501042_0008667 | Ga0501042_0008667_1058_1852 | 264 |
| 955 | 3300049578 | Ga0501042_0102642 | Ga0501042_0102642_1011_1820 | 264 |
| 956 | 3300049578 | Ga0501042_0175466 | Ga0501042_0175466_485_1294 | 264 |
| 957 | 3300049579 | Ga0501043_0000539 | Ga0501043_0000539_27788_28582 | 264 |
| 958 | 3300049579 | Ga0501043_0003859 | Ga0501043_0003859_1787_2581 | 264 |
| 959 | 3300049579 | Ga0501043_0044627 | Ga0501043_0044627_1630_2436 | 264 |
| 960 | 3300049579 | Ga0501043_0129961 | Ga0501043_0129961_480_1274 | 264 |
| 961 | 3300049580 | Ga0501046_0001303 | Ga0501046_0001303_11504_12310 | 264 |
| 962 | 3300049580 | Ga0501046_0002082 | Ga0501046_0002082_14260_15054 | 264 |
| 963 | 3300049580 | Ga0501046_0014507 | Ga0501046_0014507_65_874 | 264 |
| 964 | 3300049580 | Ga0501046_0055809 | Ga0501046_0055809_1165_1959 | 264 |
| 965 | 3300049581 | Ga0501047_0004626 | Ga0501047_0004626_1787_2581 | 264 |
| 966 | 3300049581 | Ga0501047_0006570 | Ga0501047_0006570_977_1771 | 264 |
| 967 | 3300049581 | Ga0501047_0077876 | Ga0501047_0077876_317_1111 | 264 |
| 968 | 3300049581 | Ga0501047_0092118 | Ga0501047_0092118_276_1070 | 264 |
| 969 | 3300049581 | Ga0501047_0432279 | Ga0501047_0432279_303_1097 | 264 |
| 970 | 3300049582 | Ga0501048_0000190 | Ga0501048_0000190_27332_28138 | 264 |
| 971 | 3300049582 | Ga0501048_0003398 | Ga0501048_0003398_4623_5417 | 264 |
| 972 | 3300049582 | Ga0501048_0006966 | Ga0501048_0006966_7400_8209 | 264 |
| 973 | 3300049582 | Ga0501048_0223802 | Ga0501048_0223802_435_1229 | 264 |
| 974 | 3300049583 | Ga0501067_0001787 | Ga0501067_0001787_1298_2092 | 264 |
| 975 | 3300049583 | Ga0501067_0022641 | Ga0501067_0022641_135_929 | 264 |
| 976 | 3300049583 | Ga0501067_0032759 | Ga0501067_0032759_691_1485 | 264 |
| 977 | 3300049583 | Ga0501067_0074035 | Ga0501067_0074035_113_952 | 264 |
| 978 | 3300049584 | Ga0501068_0005962 | Ga0501068_0005962_2672_3478 | 264 |
| 979 | 3300049584 | Ga0501068_0009173 | Ga0501068_0009173_1549_2343 | 264 |
| 980 | 3300049585 | Ga0501069_0000649 | Ga0501069_0000649_9869_10663 | 264 |
| 981 | 3300049586 | Ga0501070_0168390 | Ga0501070_0168390_577_1371 | 264 |
| 982 | 3300049586 | Ga0501070_0312434 | Ga0501070_0312434_149_943 | 264 |
| 983 | 3300049586 | Ga0501070_0348883 | Ga0501070_0348883_366_1160 | 264 |
| 984 | 3300049587 | Ga0501071_0007762 | Ga0501071_0007762_5241_6035 | 264 |
| 985 | 3300049587 | Ga0501071_0032363 | Ga0501071_0032363_1025_1831 | 264 |
| 986 | 3300049587 | Ga0501071_0070158 | Ga0501071_0070158_1131_1940 | 264 |
| 987 | 3300049588 | Ga0501072_0000763 | Ga0501072_0000763_10341_11150 | 264 |
| 988 | 3300049588 | Ga0501072_0019901 | Ga0501072_0019901_3311_4117 | 264 |
| 989 | 3300049588 | Ga0501072_0022921 | Ga0501072_0022921_1170_1979 | 264 |
| 990 | 3300049588 | Ga0501072_0052388 | Ga0501072_0052388_436_1245 | 264 |
| 991 | 3300049588 | Ga0501072_0101793 | Ga0501072_0101793_574_1380 | 264 |
| 992 | 3300049588 | Ga0501072_0378673 | Ga0501072_0378673_85_879 | 264 |
| 993 | 3300049588 | Ga0501072_0622962 | Ga0501072_0622962_10_804 | 264 |
| 994 | 3300049589 | Ga0501073_0004760 | Ga0501073_0004760_1348_2142 | 264 |
| 995 | 3300049589 | Ga0501073_0031779 | Ga0501073_0031779_552_1346 | 264 |
| 996 | 3300049589 | Ga0501073_0312535 | Ga0501073_0312535_56_850 | 264 |
| 997 | 3300049590 | Ga0501074_0006570 | Ga0501074_0006570_5509_6303 | 264 |
| 998 | 3300049590 | Ga0501074_0012006 | Ga0501074_0012006_2916_3722 | 264 |
| 999 | 3300049590 | Ga0501074_0049980 | Ga0501074_0049980_579_1373 | 264 |
| 1000 | 3300049590 | Ga0501074_0256381 | Ga0501074_0256381_11_820 | 264 |
| 1001 | 3300049591 | Ga0501075_0000840 | Ga0501075_0000840_8111_8917 | 264 |
| 1002 | 3300049591 | Ga0501075_0000926 | Ga0501075_0000926_8464_9273 | 264 |
| 1003 | 3300049591 | Ga0501075_0055651 | Ga0501075_0055651_285_1079 | 264 |
| 1004 | 3300049592 | Ga0501076_0038992 | Ga0501076_0038992_300_1109 | 264 |
| 1005 | 3300049592 | Ga0501076_0106733 | Ga0501076_0106733_28_822 | 264 |
| 1006 | 3300049593 | Ga0501077_0000262 | Ga0501077_0000262_17737_18543 | 264 |
| 1007 | 3300049593 | Ga0501077_0096453 | Ga0501077_0096453_187_996 | 264 |
| 1008 | 3300049593 | Ga0501077_0118055 | Ga0501077_0118055_150_944 | 264 |
| 1009 | 3300049741 | Ga0501079_0000684 | Ga0501079_0000684_12612_13418 | 264 |
| 1010 | 3300049741 | Ga0501079_0013866 | Ga0501079_0013866_4798_5592 | 264 |
| 1011 | 3300049741 | Ga0501079_0022746 | Ga0501079_0022746_1543_2352 | 264 |
| 1012 | 3300049741 | Ga0501079_0269594 | Ga0501079_0269594_268_1062 | 264 |
| 1013 | 3300049742 | Ga0501080_0003003 | Ga0501080_0003003_4624_5418 | 264 |
| 1014 | 3300049742 | Ga0501080_0049027 | Ga0501080_0049027_1898_2692 | 264 |
| 1015 | 3300049742 | Ga0501080_0160287 | Ga0501080_0160287_781_1575 | 264 |
| 1016 | 3300049742 | Ga0501080_0193161 | Ga0501080_0193161_1005_1799 | 264 |
| 1017 | 3300049742 | Ga0501080_0388380 | Ga0501080_0388380_222_1028 | 264 |
| 1018 | 3300049743 | Ga0501081_0000356 | Ga0501081_0000356_12777_13583 | 264 |
| 1019 | 3300049743 | Ga0501081_0008011 | Ga0501081_0008011_1058_1867 | 264 |
| 1020 | 3300049743 | Ga0501081_0281770 | Ga0501081_0281770_369_1178 | 264 |
| 1021 | 3300049744 | Ga0501083_0002240 | Ga0501083_0002240_338_1132 | 264 |
| 1022 | 3300049744 | Ga0501083_0004092 | Ga0501083_0004092_164_958 | 264 |
| 1023 | 3300049744 | Ga0501083_0007258 | Ga0501083_0007258_4118_4912 | 264 |
| 1024 | 3300049744 | Ga0501083_0017016 | Ga0501083_0017016_183_977 | 264 |
| 1025 | 3300049744 | Ga0501083_0139129 | Ga0501083_0139129_545_1354 | 264 |
| 1026 | 3300049822 | Ga0501035_0005532 | Ga0501035_0005532_10637_11431 | 264 |
| 1027 | 3300049822 | Ga0501035_0007363 | Ga0501035_0007363_9353_10147 | 264 |
| 1028 | 3300049822 | Ga0501035_0072868 | Ga0501035_0072868_2069_2863 | 264 |
| 1029 | 3300049822 | Ga0501035_0089404 | Ga0501035_0089404_96_1016 | 264 |
| 1030 | 3300049822 | Ga0501035_0207227 | Ga0501035_0207227_731_1525 | 264 |
| 1031 | 3300049822 | Ga0501035_0299608 | Ga0501035_0299608_354_1163 | 264 |
| 1032 | 3300049823 | Ga0501044_0000708 | Ga0501044_0000708_35740_36534 | 264 |
| 1033 | 3300049823 | Ga0501044_0013935 | Ga0501044_0013935_2383_3177 | 264 |
| 1034 | 3300049823 | Ga0501044_0017975 | Ga0501044_0017975_937_1731 | 264 |
| 1035 | 3300049823 | Ga0501044_0021310 | Ga0501044_0021310_2550_3344 | 264 |
| 1036 | 3300049823 | Ga0501044_0079433 | Ga0501044_0079433_776_1570 | 264 |
| 1037 | 3300049823 | Ga0501044_0110623 | Ga0501044_0110623_678_1472 | 264 |
| 1038 | 3300049823 | Ga0501044_0170371 | Ga0501044_0170371_922_1716 | 264 |
| 1039 | 3300049823 | Ga0501044_0382197 | Ga0501044_0382197_239_1033 | 264 |
| 1040 | 3300049824 | Ga0501045_0000221 | Ga0501045_0000221_20698_21492 | 264 |
| 1041 | 3300049824 | Ga0501045_0000749 | Ga0501045_0000749_7415_8221 | 264 |
| 1042 | 3300049824 | Ga0501045_0008385 | Ga0501045_0008385_4368_5162 | 264 |
| 1043 | 3300049824 | Ga0501045_0054276 | Ga0501045_0054276_375_1190 | 264 |
| 1044 | 3300049824 | Ga0501045_0480801 | Ga0501045_0480801_31_825 | 264 |
| 1045 | 3300050489 | nmdc:mga03683_110340_c1 | nmdc:mga03683_110340_c1_94_888 | 264 |
| 1046 | 3300050489 | nmdc:mga03683_169851_c1 | nmdc:mga03683_169851_c1_61_855 | 264 |
| 1047 | 3300050489 | nmdc:mga03683_38247_c1 | nmdc:mga03683_38247_c1_988_1782 | 264 |
| 1048 | 3300050490 | nmdc:mga03n38_5525_c1 | nmdc:mga03n38_5525_c1_2612_3406 | 264 |
| 1049 | 3300050490 | nmdc:mga03n38_74596_c1 | nmdc:mga03n38_74596_c1_568_1362 | 264 |
| 1050 | 3300050491 | nmdc:mga00v17_20753_c1 | nmdc:mga00v17_20753_c1_1171_1965 | 264 |
| 1051 | 3300050492 | nmdc:mga0yw44_11143_c1 | nmdc:mga0yw44_11143_c1_1203_1997 | 264 |
| 1052 | 3300050494 | nmdc:mga06z11_102986_c1 | nmdc:mga06z11_102986_c1_48_842 | 264 |
| 1053 | 3300050494 | nmdc:mga06z11_155414_c1 | nmdc:mga06z11_155414_c1_40_834 | 264 |
| 1054 | 3300050495 | nmdc:mga04h51_6961_c1 | nmdc:mga04h51_6961_c1_1663_2547 | 264 |
| 1055 | 3300050507 | nmdc:mga05p37_30139_c1 | nmdc:mga05p37_30139_c1_2714_3508 | 264 |
| 1056 | 3300050507 | nmdc:mga05p37_56283_c1 | nmdc:mga05p37_56283_c1_1424_2218 | 264 |
| 1057 | 3300050507 | nmdc:mga05p37_67_c1 | nmdc:mga05p37_67_c1_68088_68900 | 264 |
| 1058 | 3300050507 | nmdc:mga05p37_79966_c1 | nmdc:mga05p37_79966_c1_2627_3421 | 264 |
| 1059 | 3300050508 | nmdc:mga09592_137419_c1 | nmdc:mga09592_137419_c1_1127_1921 | 264 |
| 1060 | 3300050508 | nmdc:mga09592_173345_c1 | nmdc:mga09592_173345_c1_475_1269 | 264 |
| 1061 | 3300050508 | nmdc:mga09592_289322_c1 | nmdc:mga09592_289322_c1_22_816 | 264 |
| 1062 | 3300050508 | nmdc:mga09592_45_c1 | nmdc:mga09592_45_c1_54162_54974 | 264 |
| 1063 | 3300050509 | nmdc:mga0qj67_107060_c1 | nmdc:mga0qj67_107060_c1_222_1016 | 264 |
| 1064 | 3300050509 | nmdc:mga0qj67_175746_c1 | nmdc:mga0qj67_175746_c1_129_923 | 264 |
| 1065 | 3300050509 | nmdc:mga0qj67_267_c1 | nmdc:mga0qj67_267_c1_15219_16013 | 264 |
| 1066 | 3300050509 | nmdc:mga0qj67_35658_c1 | nmdc:mga0qj67_35658_c1_2294_3103 | 264 |
| 1067 | 3300050509 | nmdc:mga0qj67_46113_c1 | nmdc:mga0qj67_46113_c1_806_1600 | 264 |
| 1068 | 3300050509 | nmdc:mga0qj67_96444_c1 | nmdc:mga0qj67_96444_c1_874_1686 | 264 |
| 1069 | 3300050510 | nmdc:mga06r32_544367_c1 | nmdc:mga06r32_544367_c1_165_959 | 264 |
| 1070 | 3300050510 | nmdc:mga06r32_62934_c1 | nmdc:mga06r32_62934_c1_1755_2549 | 264 |
| 1071 | 3300050511 | nmdc:mga08y16_126338_c1 | nmdc:mga08y16_126338_c1_1399_2211 | 264 |
| 1072 | 3300050511 | nmdc:mga08y16_196092_c1 | nmdc:mga08y16_196092_c1_1273_2067 | 264 |
| 1073 | 3300050511 | nmdc:mga08y16_219568_c1 | nmdc:mga08y16_219568_c1_1031_1825 | 264 |
| 1074 | 3300050511 | nmdc:mga08y16_51087_c1 | nmdc:mga08y16_51087_c1_321_1127 | 264 |
| 1075 | 3300050512 | nmdc:mga0n895_63492_c1 | nmdc:mga0n895_63492_c1_800_1594 | 264 |
| 1076 | 3300050512 | nmdc:mga0n895_695456_c1 | nmdc:mga0n895_695456_c1_48_842 | 264 |
| 1077 | 3300050513 | nmdc:mga0rr50_30813_c1 | nmdc:mga0rr50_30813_c1_1698_2492 | 264 |
| 1078 | 3300050513 | nmdc:mga0rr50_51956_c1 | nmdc:mga0rr50_51956_c1_1344_2138 | 264 |
| 1079 | 3300050513 | nmdc:mga0rr50_662451_c1 | nmdc:mga0rr50_662451_c1_34_828 | 264 |
| 1080 | 3300050514 | nmdc:mga08x19_3363_c1 | nmdc:mga08x19_3363_c1_2572_3366 | 264 |
| 1081 | 3300050515 | nmdc:mga0a205_338726_c1 | nmdc:mga0a205_338726_c1_342_1136 | 264 |
| 1082 | 3300050515 | nmdc:mga0a205_372926_c1 | nmdc:mga0a205_372926_c1_278_1072 | 264 |
| 1083 | 3300050515 | nmdc:mga0a205_413053_c1 | nmdc:mga0a205_413053_c1_97_900 | 264 |
| 1084 | 3300050515 | nmdc:mga0a205_435087_c1 | nmdc:mga0a205_435087_c1_254_1048 | 264 |
| 1085 | 3300050515 | nmdc:mga0a205_52693_c1 | nmdc:mga0a205_52693_c1_1887_2681 | 264 |
| 1086 | 3300050516 | nmdc:mga0sz30_133465_c1 | nmdc:mga0sz30_133465_c1_77_871 | 264 |
| 1087 | 3300053077 | Ga0495601_0000018 | Ga0495601_0000018_124104_124898 | 264 |
| 1088 | 3300053077 | Ga0495601_0000352 | Ga0495601_0000352_11574_12368 | 264 |
| 1089 | 3300053077 | Ga0495601_0000357 | Ga0495601_0000357_529_1323 | 264 |
| 1090 | 3300053077 | Ga0495601_0008676 | Ga0495601_0008676_4066_4860 | 264 |
| 1091 | 3300053077 | Ga0495601_0010571 | Ga0495601_0010571_1657_2451 | 264 |
| 1092 | 3300053077 | Ga0495601_0048033 | Ga0495601_0048033_1068_1862 | 264 |
| 1093 | 3300053077 | Ga0495601_0311990 | Ga0495601_0311990_101_907 | 264 |
| 1094 | 3300053078 | Ga0495612_0000011 | Ga0495612_0000011_110781_111575 | 264 |
| 1095 | 3300053078 | Ga0495612_0003841 | Ga0495612_0003841_2704_3498 | 264 |
| 1096 | 3300053078 | Ga0495612_0014220 | Ga0495612_0014220_672_1466 | 264 |
| 1097 | 3300053078 | Ga0495612_0033348 | Ga0495612_0033348_1255_2049 | 264 |
| 1098 | 3300053084 | Ga0495595_0000016 | Ga0495595_0000016_49297_50091 | 264 |
| 1099 | 3300053084 | Ga0495595_0000405 | Ga0495595_0000405_3998_4792 | 264 |
| 1100 | 3300053084 | Ga0495595_0001531 | Ga0495595_0001531_4867_5661 | 264 |
| 1101 | 3300053084 | Ga0495595_0002126 | Ga0495595_0002126_952_1746 | 264 |
| 1102 | 3300053084 | Ga0495595_0010289 | Ga0495595_0010289_1319_2113 | 264 |
| 1103 | 3300053085 | Ga0495619_0000014 | Ga0495619_0000014_173358_174152 | 264 |
| 1104 | 3300053085 | Ga0495619_0000085 | Ga0495619_0000085_29292_30086 | 264 |
| 1105 | 3300053085 | Ga0495619_0000536 | Ga0495619_0000536_892_1686 | 264 |
| 1106 | 3300053085 | Ga0495619_0002650 | Ga0495619_0002650_7911_8705 | 264 |
| 1107 | 3300053085 | Ga0495619_0008387 | Ga0495619_0008387_3829_4623 | 264 |
| 1108 | 3300053085 | Ga0495619_0011351 | Ga0495619_0011351_3516_4310 | 264 |
| 1109 | 3300053085 | Ga0495619_0013199 | Ga0495619_0013199_3745_4539 | 264 |
| 1110 | 3300053085 | Ga0495619_0023812 | Ga0495619_0023812_951_1745 | 264 |
| 1111 | 3300053092 | Ga0500583_0142668 | Ga0500583_0142668_209_1003 | 264 |
| 1112 | 3300053093 | Ga0500651_0002083 | Ga0500651_0002083_8683_9477 | 264 |
| 1113 | 3300053096 | Ga0500641_0033918 | Ga0500641_0033918_722_1516 | 264 |
| 1114 | 3300053104 | Ga0500556_0000099 | Ga0500556_0000099_24316_25110 | 264 |
| 1115 | 3300053117 | Ga0500593_012112 | Ga0500593_012112_536_1330 | 264 |
| 1116 | 3300053130 | Ga0500642_0037358 | Ga0500642_0037358_869_1663 | 264 |
| 1117 | 3300053727 | Ga0500611_023857 | Ga0500611_023857_303_1097 | 264 |
| 1118 | 3300054114 | Ga0501084_0000355 | Ga0501084_0000355_12363_13169 | 264 |
| 1119 | 3300054114 | Ga0501084_0000758 | Ga0501084_0000758_17869_18663 | 264 |
| 1120 | 3300054114 | Ga0501084_0013622 | Ga0501084_0013622_3092_3886 | 264 |
| 1121 | 3300054114 | Ga0501084_0034669 | Ga0501084_0034669_1849_2658 | 264 |
| 1122 | 3300054114 | Ga0501084_0041915 | Ga0501084_0041915_2894_3688 | 264 |
| 1123 | 3300054114 | Ga0501084_0127934 | Ga0501084_0127934_1017_1826 | 264 |
| 1124 | 3300060353 | Ga0501082_0000032 | Ga0501082_0000032_72566_73360 | 264 |
| 1125 | 3300060353 | Ga0501082_0003835 | Ga0501082_0003835_1366_2205 | 264 |
| 1126 | 3300060353 | Ga0501082_0004982 | Ga0501082_0004982_4243_5049 | 264 |
| 1127 | 3300060353 | Ga0501082_0056277 | Ga0501082_0056277_1387_2181 | 264 |
| 1128 | 3300060353 | Ga0501082_0126679 | Ga0501082_0126679_663_1472 | 264 |
| 1129 | 3300060353 | Ga0501082_0208152 | Ga0501082_0208152_304_1098 | 264 |
| 1130 | 3300060353 | Ga0501082_0284777 | Ga0501082_0284777_140_934 | 264 |
| 1131 | 3300060353 | Ga0501082_0299606 | Ga0501082_0299606_31_825 | 264 |
| 1132 | 3300061719 | Ga0466962_0148311 | Ga0466962_0148311_332_1126 | 264 |
| 1133 | 3300061734 | Ga0530510_0000542 | Ga0530510_0000542_6587_7396 | 264 |
| 1134 | 3300061734 | Ga0530510_0001016 | Ga0530510_0001016_6466_7272 | 264 |
| 1135 | 3300061734 | Ga0530510_0092420 | Ga0530510_0092420_579_1373 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fto-assembly1.cif.gz_X-2 | y94f mutant of thymidylate synthase bound to thymidine-5'-phosphate and 10-propargyl-5,8-dideazafolid acid | 0.9881 | 3 | 263 |
| 3b5b-assembly1.cif.gz_B | crystal structure of the thymidylate synthase k48q | 0.988 | 1 | 263 |
| 1aiq-assembly1.cif.gz_A | crystal structure of thymidylate synthase r126e mutant | 0.988 | 3 | 263 |
| 3bgx-assembly1.cif.gz_A | e. coli thymidylate synthase c146s mutant complexed with dtmp and mtf | 0.988 | 3 | 263 |
| 1fwm-assembly1.cif.gz_B | crystal structure of the thymidylate synthase r166q mutant | 0.9879 | 3 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9713 | 2 | 263 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.964 | 2 | 250 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.964 | 2 | 263 | 3.30.572.10 |
| af_P06785_1_304_3.30.572.10 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9636 | 3 | 263 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.959 | 2 | 258 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352HMS8-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.998 | 150 | 263 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A6V8DH23-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9976 | 150 | 263 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A2U2SIH8-F1-model_v4 | Thymidylate synthase (TS) (TSase) (EC 2.1.1.45) | 0.9947 | 1 | 263 |
GO:0004799
GO:0005829 GO:0006231 GO:0006235 GO:0032259 |
| AF-A0A0M3GI98-F1-model_v4 | deleted | 0.9943 | 1 | 263 |
|
| AF-A0A7S3TBS6-F1-model_v4 | thymidylate synthase (EC 2.1.1.45) | 0.9942 | 159 | 263 |
GO:0004799
GO:0005739 GO:0005829 GO:0006231 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar