F490610

General Info

Members Datasets Scaffolds Average Seq Length
1135 447 1127 265

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10000377|Ga0070717_1000037715
Length 323
Sequence MDKAMDEVPRNEPYGPLHSRVCHPTLDETLAELSIEYGYLNLLRRILNFGHKVSDRTGTGTMSLFGAQLRHDLSDGFPLLTTKKVFFRGVAEELLWMLEGETNVKPLQAKGIKIWDQWADEKGDLGPVYGKQWRRWEAPVTDTDDYMEQPGGERGETGMDYYYKLKYIDQIANVIARIKSNPNCRRLIVSAWNPADVDQMKLPPCHCFFQFKVYDGKLSCQLYQRSADMFLGVPFNIASYALLTTMIAHVCDLVPGEFIHTFGDAHIYLNHLDAVKEQLSRTPRPLPTLVLNQAKKDIFAFTFEDFEIKNYSPHDAIRAEVSV

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
3 2643221583 Caulobacter sp. Root655 Isolate Unclassified
4 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
5 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
6 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
209 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
210 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
264 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
272 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
279 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
280 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
281 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
282 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
283 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
284 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
285 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
288 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
289 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
290 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
340 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
427 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
428 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
429 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
430 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
431 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
432 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
433 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
434 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
435 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
436 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
437 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
438 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
439 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
442 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
446 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
447 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.09
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 5.2
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_101541 3300001430 Bacteria 939
2 JGI24743J22301_10003350 3300001991 Bacteria 2525
3 JGI24744J21845_10027098 3300002077 Bacteria 1109
4 JGI25151J46595_10011269 3300003187 Bacteria 4117
5 JGI25406J46586_10004150 3300003203 Bacteria 6759
6 JGI25153J46596_10008999 3300003215 Bacteria 4700
7 Ga0055537_1000928 3300003773 Bacteria 13696
8 Ga0055524_1000173 3300003775 Bacteria 73388
9 Ga0055536_1008604 3300003781 Bacteria 4355
10 Ga0055534_1000077 3300003784 Bacteria 76400
11 Ga0055528_1000085 3300003790 Bacteria 73426
12 Ga0055531_10025153 3300003794 Bacteria 2172
13 JGI25405J52794_10009844 3300003911 Bacteria 1811
14 Ga0065712_10233304 3300005290 Bacteria 1005
15 Ga0065707_10227956 3300005295 Bacteria 1199
16 Ga0065707_10273660 3300005295 Bacteria 1065
17 Ga0070658_10464784 3300005327 Bacteria 1091
18 Ga0070676_10044744 3300005328 Bacteria 2577
19 Ga0070676_10103735 3300005328 Bacteria 1761
20 Ga0070683_100116818 3300005329 Bacteria 2519
21 Ga0070683_100835748 3300005329 Bacteria 883
22 Ga0070690_100075312 3300005330 Bacteria 2200
23 Ga0070670_100000020 3300005331 Bacteria 215458
24 Ga0070670_100196606 3300005331 Bacteria 1752
25 Ga0070666_10034750 3300005335 Bacteria 3340
26 Ga0070666_10136634 3300005335 Bacteria 1706
27 Ga0070680_100017664 3300005336 Bacteria 5627
28 Ga0070680_100033335 3300005336 Bacteria 4150
29 Ga0070680_100129049 3300005336 Bacteria 2114
30 Ga0070680_100197636 3300005336 Bacteria 1695
31 Ga0070680_100349733 3300005336 Bacteria 1257
32 Ga0070682_100034717 3300005337 Bacteria 3074
33 Ga0070682_100112629 3300005337 Bacteria 1816
34 Ga0068868_100103869 3300005338 Bacteria 2302
35 Ga0070660_100087391 3300005339 Bacteria 2454
36 Ga0070691_10083801 3300005341 Bacteria 1565
37 Ga0070687_100072886 3300005343 Bacteria 1849
38 Ga0070661_100016573 3300005344 Bacteria 5213
39 Ga0070668_100000108 3300005347 Bacteria 50828
40 Ga0070668_100005164 3300005347 Bacteria 9682
41 Ga0070668_100031879 3300005347 Bacteria 4011
42 Ga0070668_100051963 3300005347 Bacteria 3158
43 Ga0070668_100054717 3300005347 Bacteria 3078
44 Ga0070669_100031028 3300005353 Bacteria 3859
45 Ga0070669_100111133 3300005353 Bacteria 2080
46 Ga0070669_100172808 3300005353 Bacteria 1686
47 Ga0070669_100209041 3300005353 Bacteria 1538
48 Ga0070671_100031462 3300005355 Bacteria 4383
49 Ga0070674_100000199 3300005356 Bacteria 28875
50 Ga0070674_100023567 3300005356 Bacteria 3985
51 Ga0070674_100142244 3300005356 Bacteria 1801
52 Ga0070674_100176460 3300005356 Bacteria 1633
53 Ga0070673_100055154 3300005364 Bacteria 3130
54 Ga0070688_100005892 3300005365 Bacteria 6490
55 Ga0070659_100215214 3300005366 Bacteria 1584
56 Ga0070667_100000163 3300005367 Bacteria 83059
57 Ga0070667_100006909 3300005367 Bacteria 9429
58 Ga0070667_100044689 3300005367 Bacteria 3721
59 Ga0070667_100056374 3300005367 Bacteria 3319
60 Ga0070667_100070477 3300005367 Bacteria 2975
61 Ga0070667_100106981 3300005367 Bacteria 2421
62 Ga0070703_10063983 3300005406 Bacteria 1211
63 Ga0070709_10003792 3300005434 Bacteria 8129
64 Ga0070709_10005111 3300005434 Bacteria 7095
65 Ga0070709_10133038 3300005434 Bacteria 1700
66 Ga0070714_100017499 3300005435 Bacteria 5807
67 Ga0070714_100018468 3300005435 Bacteria 5664
68 Ga0070714_100092841 3300005435 Bacteria 2646
69 Ga0070713_100063437 3300005436 Bacteria 3098
70 Ga0070713_100230005 3300005436 Bacteria 1685
71 Ga0070710_10019445 3300005437 Bacteria 3509
72 Ga0070710_10034297 3300005437 Bacteria 2761
73 Ga0070711_100038107 3300005439 Bacteria 3230
74 Ga0070711_100040957 3300005439 Bacteria 3127
75 Ga0070705_100117902 3300005440 Bacteria 1709
76 Ga0070705_100387523 3300005440 Bacteria 1031
77 Ga0070700_100100255 3300005441 Bacteria 1906
78 Ga0070694_100003602 3300005444 Bacteria 9255
79 Ga0070694_100005990 3300005444 Bacteria 7375
80 Ga0070694_100050445 3300005444 Bacteria 2805
81 Ga0070694_100067704 3300005444 Bacteria 2452
82 Ga0070708_100203175 3300005445 Bacteria 1855
83 Ga0070663_100062360 3300005455 Bacteria 2687
84 Ga0070678_100065070 3300005456 Bacteria 2705
85 Ga0070678_100073852 3300005456 Bacteria 2561
86 Ga0070662_100042085 3300005457 Bacteria 3262
87 Ga0070662_100096919 3300005457 Bacteria 2225
88 Ga0070681_10054464 3300005458 Bacteria 3986
89 Ga0070681_10094196 3300005458 Bacteria 2944
90 Ga0070685_10039446 3300005466 Bacteria 2683
91 Ga0070707_100010077 3300005468 Bacteria 8797
92 Ga0070707_100154715 3300005468 Bacteria 2234
93 Ga0070707_100313387 3300005468 Bacteria 1525
94 Ga0070698_100025218 3300005471 Bacteria 6194
95 Ga0070699_100037375 3300005518 Bacteria 4201
96 Ga0070679_100003679 3300005530 Bacteria 14043
97 Ga0070679_100028116 3300005530 Bacteria 5541
98 Ga0070679_100083534 3300005530 Bacteria 3182
99 Ga0070684_100135254 3300005535 Bacteria 2226
100 Ga0070684_100390989 3300005535 Bacteria 1282
101 Ga0068853_100196757 3300005539 Bacteria 1833
102 Ga0070672_100026429 3300005543 Bacteria 4319
103 Ga0070672_100374689 3300005543 Bacteria 1217
104 Ga0070686_100010959 3300005544 Bacteria 5132
105 Ga0070695_100033072 3300005545 Bacteria 3234
106 Ga0070695_100059949 3300005545 Bacteria 2466
107 Ga0070696_100030433 3300005546 Bacteria 3695
108 Ga0070696_100059096 3300005546 Bacteria 2679
109 Ga0070696_100132587 3300005546 Bacteria 1814
110 Ga0070696_100187704 3300005546 Bacteria 1537
111 Ga0070665_100001115 3300005548 Bacteria 33073
112 Ga0070665_100033530 3300005548 Bacteria 5166
113 Ga0070665_100477460 3300005548 Bacteria 1257
114 Ga0070665_100558640 3300005548 Bacteria 1157
115 Ga0070704_100018115 3300005549 Bacteria 4494
116 Ga0070704_100066620 3300005549 Bacteria 2598
117 Ga0070704_100126390 3300005549 Bacteria 1974
118 Ga0070704_100337942 3300005549 Bacteria 1267
119 Ga0068855_100121272 3300005563 Bacteria 2992
120 Ga0068855_100284816 3300005563 Bacteria 1834
121 Ga0068855_100398885 3300005563 Bacteria 1508
122 Ga0068857_100219650 3300005577 Bacteria 1736
123 Ga0068856_100120790 3300005614 Bacteria 2621
124 Ga0070702_100070029 3300005615 Bacteria 2069
125 Ga0068852_100320780 3300005616 Bacteria 1504
126 Ga0068859_100016961 3300005617 Bacteria 7310
127 Ga0068859_100048343 3300005617 Bacteria 4274
128 Ga0068859_100157584 3300005617 Bacteria 2348
129 Ga0068859_100194668 3300005617 Bacteria 2111
130 Ga0068859_100360565 3300005617 Bacteria 1549
131 Ga0068864_100000071 3300005618 Bacteria 111481
132 Ga0068864_100017888 3300005618 Bacteria 5913
133 Ga0068864_100190574 3300005618 Bacteria 1879
134 Ga0068864_100403288 3300005618 Bacteria 1300
135 Ga0068866_10074376 3300005718 Bacteria 1806
136 Ga0068866_10128258 3300005718 Bacteria 1439
137 Ga0068861_100039322 3300005719 Bacteria 3529
138 Ga0068851_10000120 3300005834 Bacteria 42246
139 Ga0068870_10220435 3300005840 Bacteria 1161
140 Ga0068863_100000451 3300005841 Bacteria 41841
141 Ga0068863_100064702 3300005841 Bacteria 3459
142 Ga0068863_100123515 3300005841 Bacteria 2470
143 Ga0068863_100217489 3300005841 Bacteria 1840
144 Ga0068863_100790968 3300005841 Bacteria 946
145 Ga0068858_100000029 3300005842 Bacteria 144691
146 Ga0068858_100002275 3300005842 Bacteria 19425
147 Ga0068858_100033224 3300005842 Bacteria 4790
148 Ga0068858_100245385 3300005842 Bacteria 1700
149 Ga0068860_100142638 3300005843 Bacteria 2303
150 Ga0068860_100208863 3300005843 Bacteria 1893
151 Ga0068862_100001526 3300005844 Bacteria 21211
152 Ga0068862_100009403 3300005844 Bacteria 8086
153 Ga0068862_100012637 3300005844 Bacteria 6988
154 Ga0068862_100162210 3300005844 Bacteria 1996
155 Ga0081455_10011386 3300005937 Bacteria 8941
156 Ga0081455_10108197 3300005937 Bacteria 2215
157 Ga0081455_10183322 3300005937 Bacteria 1583
158 Ga0081538_10040288 3300005981 Bacteria 2982
159 Ga0081540_1000869 3300005983 Bacteria 27365
160 Ga0081540_1000925 3300005983 Bacteria 26377
161 Ga0081540_1020032 3300005983 Bacteria 4039
162 Ga0081540_1024207 3300005983 Bacteria 3528
163 Ga0081540_1137282 3300005983 Bacteria 988
164 Ga0081539_10007161 3300005985 Bacteria 10285
165 Ga0070717_10000377 3300006028 Bacteria 28454
166 Ga0075365_10018424 3300006038 Bacteria 4293
167 Ga0075365_10028585 3300006038 Bacteria 3557
168 Ga0075363_100034239 3300006048 Bacteria 2650
169 Ga0075363_100045718 3300006048 Bacteria 2322
170 Ga0075364_10024862 3300006051 Bacteria 3808
171 Ga0075364_10341842 3300006051 Bacteria 1020
172 Ga0070715_10026458 3300006163 Bacteria 2309
173 Ga0070715_10057430 3300006163 Bacteria 1695
174 Ga0070716_100002527 3300006173 Bacteria 8473
175 Ga0070716_100094885 3300006173 Bacteria 1815
176 Ga0070712_100082962 3300006175 Bacteria 2326
177 Ga0075362_10017105 3300006177 Bacteria 2982
178 Ga0075369_10001871 3300006186 Bacteria 7355
179 Ga0097621_100033091 3300006237 Bacteria 4114
180 Ga0097621_100078746 3300006237 Bacteria 2738
181 Ga0097621_100222433 3300006237 Bacteria 1645
182 Ga0097621_100295236 3300006237 Bacteria 1430
183 Ga0068871_100035625 3300006358 Bacteria 3956
184 Ga0068871_100163007 3300006358 Bacteria 1907
185 Ga0068871_100485698 3300006358 Bacteria 1112
186 Ga0068871_100526784 3300006358 Bacteria 1068
187 Ga0075428_100077850 3300006844 Bacteria 3619
188 Ga0075428_100088833 3300006844 Bacteria 3371
189 Ga0075430_100000617 3300006846 Bacteria 27125
190 Ga0075430_100003539 3300006846 Bacteria 13076
191 Ga0075430_100025309 3300006846 Bacteria 5049
192 Ga0075431_100003819 3300006847 Bacteria 14638
193 Ga0075431_100021855 3300006847 Bacteria 6541
194 Ga0075431_100047714 3300006847 Bacteria 4416
195 Ga0075431_100296804 3300006847 Bacteria 1633
196 Ga0075431_100618393 3300006847 Bacteria 1066
197 Ga0075431_100663013 3300006847 Bacteria 1023
198 Ga0075433_10125584 3300006852 Bacteria 2278
199 Ga0075433_10181745 3300006852 Bacteria 1872
200 Ga0075434_100006453 3300006871 Bacteria 10750
201 Ga0075434_100055718 3300006871 Bacteria 3928
202 Ga0075434_100689859 3300006871 Bacteria 1039
203 Ga0075429_100000019 3300006880 Bacteria 70971
204 Ga0068865_100018172 3300006881 Bacteria 4534
205 Ga0068865_100074017 3300006881 Bacteria 2424
206 Ga0068865_100142583 3300006881 Bacteria 1808
207 Ga0075436_100026004 3300006914 Bacteria 4030
208 Ga0097620_100016961 3300006931 Bacteria 7310
209 Ga0097620_100048344 3300006931 Bacteria 4274
210 Ga0097620_100157582 3300006931 Bacteria 2348
211 Ga0097620_100194667 3300006931 Bacteria 2111
212 Ga0097620_100360558 3300006931 Bacteria 1549
213 Ga0075435_100034059 3300007076 Bacteria 4032
214 Ga0075435_100035744 3300007076 Bacteria 3943
215 Ga0105240_10007706 3300009093 Bacteria 15578
216 Ga0105240_10067540 3300009093 Bacteria 4431
217 Ga0105240_10579805 3300009093 Bacteria 1237
218 Ga0105240_10599855 3300009093 Bacteria 1213
219 Ga0111539_10035620 3300009094 Bacteria 6024
220 Ga0111539_10220872 3300009094 Bacteria 2207
221 Ga0111539_10443705 3300009094 Bacteria 1511
222 Ga0111539_10516128 3300009094 Bacteria 1392
223 Ga0111539_10710599 3300009094 Bacteria 1170
224 Ga0105245_10016102 3300009098 Bacteria 6515
225 Ga0105245_10081242 3300009098 Bacteria 2963
226 Ga0105247_10073339 3300009101 Bacteria 2144
227 Ga0105247_10132744 3300009101 Bacteria 1624
228 Ga0114129_10040477 3300009147 Bacteria 6569
229 Ga0114129_10092045 3300009147 Bacteria 4201
230 Ga0114129_10245526 3300009147 Bacteria 2405
231 Ga0105243_10642671 3300009148 Bacteria 1027
232 Ga0105243_10674974 3300009148 Bacteria 1004
233 Ga0105241_10083262 3300009174 Bacteria 2509
234 Ga0105241_10202785 3300009174 Bacteria 1658
235 Ga0105242_10007510 3300009176 Bacteria 8387
236 Ga0105242_10222522 3300009176 Bacteria 1687
237 Ga0105242_10416572 3300009176 Bacteria 1258
238 Ga0105242_10872090 3300009176 Bacteria 897
239 Ga0105248_10005446 3300009177 Bacteria 13989
240 Ga0105248_10016560 3300009177 Bacteria 8118
241 Ga0105248_10020734 3300009177 Bacteria 7281
242 Ga0105248_10046795 3300009177 Bacteria 4851
243 Ga0105248_10083691 3300009177 Bacteria 3589
244 Ga0105237_10166457 3300009545 Bacteria 2204
245 Ga0105237_10643771 3300009545 Bacteria 1067
246 Ga0105238_10011476 3300009551 Bacteria 8924
247 Ga0105238_10100191 3300009551 Bacteria 2880
248 Ga0105238_10184774 3300009551 Bacteria 2061
249 Ga0105238_10695149 3300009551 Bacteria 1029
250 Ga0105249_10000792 3300009553 Bacteria 28363
251 Ga0105249_10135218 3300009553 Bacteria 2358
252 Ga0105249_10137200 3300009553 Bacteria 2342
253 Ga0105249_10138854 3300009553 Bacteria 2328
254 Ga0105032_100258 3300009979 Bacteria 5476
255 Ga0105239_10007278 3300010375 Bacteria 12708
256 Ga0105239_10075495 3300010375 Bacteria 3706
257 Ga0105246_10064378 3300011119 Bacteria 2561
258 Ga0105246_10421822 3300011119 Bacteria 1114
259 Ga0157371_10014815 3300013102 Bacteria 5869
260 Ga0157370_10147531 3300013104 Bacteria 2190
261 Ga0157369_10000077 3300013105 Viruses 136165
262 Ga0157374_10149095 3300013296 Bacteria 2273
263 Ga0157378_10095979 3300013297 Bacteria 2701
264 Ga0157378_10172376 3300013297 Bacteria 2030
265 Ga0157378_10334615 3300013297 Bacteria 1475
266 Ga0157378_10455304 3300013297 Bacteria 1271
267 Ga0157378_10912542 3300013297 Bacteria 909
268 Ga0163162_10035839 3300013306 Bacteria 4942
269 Ga0157372_10264568 3300013307 Bacteria 1997
270 Ga0157372_10656342 3300013307 Bacteria 1222
271 Ga0157372_10830136 3300013307 Bacteria 1073
272 Ga0157375_10104866 3300013308 Bacteria 2916
273 Ga0157377_10350609 3300014745 Bacteria 990
274 Ga0157379_10009298 3300014968 Bacteria 8559
275 Ga0157376_10051396 3300014969 Bacteria 3423
276 Ga0163161_10167318 3300017792 Bacteria 1679
277 Ga0213872_10000497 3300021361 Bacteria 31473
278 Ga0213872_10000696 3300021361 Bacteria 25247
279 Ga0213872_10002088 3300021361 Bacteria 12051
280 Ga0213872_10014355 3300021361 Bacteria 3696
281 Ga0213872_10045115 3300021361 Bacteria 2005
282 Ga0213876_10015170 3300021384 Bacteria 4082
283 Ga0213876_10060688 3300021384 Bacteria 1995
284 Ga0209565_1000001 3300025263 Bacteria 2950419
285 Ga0209673_1000001 3300025273 Bacteria 3176258
286 Ga0209675_1000001 3300025291 Bacteria 2950293
287 Ga0209676_1000046 3300025292 Bacteria 409173
288 Ga0209676_1000436 3300025292 Bacteria 72143
289 Ga0209676_1004756 3300025292 Bacteria 7409
290 Ga0209564_1000001 3300025295 Bacteria 3176258
291 Ga0209758_1000139 3300025297 Bacteria 175148
292 Ga0209050_1019572 3300025298 Bacteria 2564
293 Ga0209256_1000006 3300025299 Bacteria 1250310
294 Ga0209257_1000505 3300025304 Bacteria 68565
295 Ga0207656_10000165 3300025321 Bacteria 24447
296 Ga0207653_10051551 3300025885 Bacteria 1371
297 Ga0207682_10000171 3300025893 Bacteria 29817
298 Ga0207692_10026289 3300025898 Bacteria 2729
299 Ga0207692_10125308 3300025898 Bacteria 1444
300 Ga0207688_10079370 3300025901 Bacteria 1872
301 Ga0207688_10128291 3300025901 Bacteria 1485
302 Ga0207680_10189154 3300025903 Bacteria 1396
303 Ga0207685_10015243 3300025905 Bacteria 2431
304 Ga0207699_10000553 3300025906 Bacteria 18426
305 Ga0207699_10020681 3300025906 Bacteria 3532
306 Ga0207699_10052584 3300025906 Bacteria 2412
307 Ga0207699_10143305 3300025906 Bacteria 1572
308 Ga0207705_10011301 3300025909 Bacteria 6468
309 Ga0207705_10452832 3300025909 Bacteria 995
310 Ga0207684_10028554 3300025910 Bacteria 4753
311 Ga0207654_10060252 3300025911 Bacteria 2217
312 Ga0207654_10153188 3300025911 Bacteria 1482
313 Ga0207654_10229968 3300025911 Bacteria 1234
314 Ga0207707_10015959 3300025912 Bacteria 6550
315 Ga0207707_10141471 3300025912 Bacteria 2104
316 Ga0207695_10005429 3300025913 Bacteria 16916
317 Ga0207695_10110311 3300025913 Bacteria 2732
318 Ga0207695_10159371 3300025913 Bacteria 2189
319 Ga0207695_10287790 3300025913 Bacteria 1536
320 Ga0207671_10113007 3300025914 Bacteria 2068
321 Ga0207693_10035526 3300025915 Bacteria 3929
322 Ga0207693_10069351 3300025915 Bacteria 2759
323 Ga0207693_10316041 3300025915 Bacteria 1223
324 Ga0207663_10028986 3300025916 Bacteria 3246
325 Ga0207660_10014525 3300025917 Bacteria 5180
326 Ga0207660_10096567 3300025917 Bacteria 2200
327 Ga0207660_10113101 3300025917 Bacteria 2046
328 Ga0207660_10123551 3300025917 Bacteria 1963
329 Ga0207660_10183505 3300025917 Bacteria 1626
330 Ga0207662_10033608 3300025918 Bacteria 2990
331 Ga0207662_10051144 3300025918 Bacteria 2457
332 Ga0207657_10035581 3300025919 Bacteria 4464
333 Ga0207657_10053807 3300025919 Bacteria 3484
334 Ga0207652_10018220 3300025921 Bacteria 5757
335 Ga0207652_10024455 3300025921 Bacteria 5011
336 Ga0207652_10036093 3300025921 Bacteria 4178
337 Ga0207652_10067062 3300025921 Bacteria 3111
338 Ga0207646_10069984 3300025922 Bacteria 3134
339 Ga0207646_10095220 3300025922 Bacteria 2667
340 Ga0207681_10013529 3300025923 Bacteria 5053
341 Ga0207681_10018147 3300025923 Bacteria 4430
342 Ga0207681_10337569 3300025923 Bacteria 1203
343 Ga0207694_10039122 3300025924 Bacteria 3648
344 Ga0207694_10069298 3300025924 Bacteria 2755
345 Ga0207694_10387872 3300025924 Bacteria 1160
346 Ga0207694_10494041 3300025924 Bacteria 1024
347 Ga0207650_10000175 3300025925 Bacteria 75521
348 Ga0207650_10065717 3300025925 Bacteria 2719
349 Ga0207687_10060600 3300025927 Bacteria 2670
350 Ga0207687_10308475 3300025927 Bacteria 1277
351 Ga0207700_10000974 3300025928 Bacteria 16532
352 Ga0207700_10027171 3300025928 Bacteria 4003
353 Ga0207700_10056100 3300025928 Bacteria 2964
354 Ga0207700_10082062 3300025928 Bacteria 2520
355 Ga0207700_10147162 3300025928 Bacteria 1943
356 Ga0207664_10025181 3300025929 Bacteria 4478
357 Ga0207664_10069459 3300025929 Bacteria 2833
358 Ga0207664_10069929 3300025929 Bacteria 2823
359 Ga0207644_10004087 3300025931 Bacteria 9462
360 Ga0207644_10007589 3300025931 Bacteria 7073
361 Ga0207706_10009732 3300025933 Bacteria 8821
362 Ga0207706_10071563 3300025933 Bacteria 3050
363 Ga0207686_10038270 3300025934 Bacteria 2901
364 Ga0207686_10051864 3300025934 Bacteria 2557
365 Ga0207686_10087052 3300025934 Bacteria 2054
366 Ga0207670_10024728 3300025936 Bacteria 3758
367 Ga0207670_10073924 3300025936 Bacteria 2365
368 Ga0207670_10455386 3300025936 Bacteria 1032
369 Ga0207704_10044627 3300025938 Bacteria 2627
370 Ga0207704_10167045 3300025938 Bacteria 1573
371 Ga0207704_10324622 3300025938 Bacteria 1189
372 Ga0207665_10008397 3300025939 Bacteria 6813
373 Ga0207665_10084392 3300025939 Bacteria 2192
374 Ga0207665_10099668 3300025939 Bacteria 2026
375 Ga0207665_10116867 3300025939 Bacteria 1880
376 Ga0207665_10258911 3300025939 Bacteria 1288
377 Ga0207691_10004900 3300025940 Bacteria 12937
378 Ga0207691_10378582 3300025940 Bacteria 1208
379 Ga0207711_10001642 3300025941 Bacteria 20636
380 Ga0207711_10208102 3300025941 Bacteria 1787
381 Ga0207689_10057574 3300025942 Bacteria 3197
382 Ga0207689_10230424 3300025942 Bacteria 1531
383 Ga0207689_10252882 3300025942 Bacteria 1457
384 Ga0207661_10038326 3300025944 Bacteria 3756
385 Ga0207667_10050320 3300025949 Bacteria 4397
386 Ga0207667_10149652 3300025949 Bacteria 2403
387 Ga0207651_10067000 3300025960 Bacteria 2525
388 Ga0207712_10000376 3300025961 Bacteria 39304
389 Ga0207712_10065685 3300025961 Bacteria 2590
390 Ga0207712_10078711 3300025961 Bacteria 2393
391 Ga0207712_10262516 3300025961 Bacteria 1401
392 Ga0207712_10278504 3300025961 Bacteria 1364
393 Ga0207668_10000001 3300025972 Bacteria 266091
394 Ga0207668_10000123 3300025972 Bacteria 54467
395 Ga0207668_10003923 3300025972 Bacteria 8772
396 Ga0207668_10016411 3300025972 Bacteria 4621
397 Ga0207658_10000118 3300025986 Bacteria 87228
398 Ga0207658_10009958 3300025986 Bacteria 6460
399 Ga0207658_10090613 3300025986 Bacteria 2370
400 Ga0207658_10484306 3300025986 Bacteria 1100
401 Ga0207658_10649969 3300025986 Bacteria 950
402 Ga0207658_10722571 3300025986 Bacteria 901
403 Ga0207677_10043892 3300026023 Bacteria 2975
404 Ga0207703_10002470 3300026035 Bacteria 16035
405 Ga0207703_10129636 3300026035 Bacteria 2176
406 Ga0207639_10295327 3300026041 Bacteria 1430
407 Ga0207678_10021192 3300026067 Bacteria 5697
408 Ga0207678_10021441 3300026067 Bacteria 5664
409 Ga0207678_10083115 3300026067 Bacteria 2739
410 Ga0207708_10060407 3300026075 Bacteria 2893
411 Ga0207708_10167170 3300026075 Bacteria 1739
412 Ga0207641_10001419 3300026088 Bacteria 23630
413 Ga0207641_10018297 3300026088 Bacteria 5743
414 Ga0207641_10053054 3300026088 Bacteria 3435
415 Ga0207648_10388456 3300026089 Bacteria 1263
416 Ga0207676_10001782 3300026095 Bacteria 15788
417 Ga0207676_10182782 3300026095 Bacteria 1837
418 Ga0207676_10307420 3300026095 Bacteria 1450
419 Ga0207674_10188718 3300026116 Bacteria 2011
420 Ga0207675_100037302 3300026118 Bacteria 4534
421 Ga0207675_100331768 3300026118 Bacteria 1487
422 Ga0207683_10000902 3300026121 Bacteria 27333
423 Ga0207683_10050440 3300026121 Bacteria 3645
424 Ga0207683_10092348 3300026121 Bacteria 2697
425 Ga0209969_1004755 3300027360 Bacteria 1899
426 Ga0209996_1008531 3300027395 Bacteria 1343
427 Ga0209966_1018921 3300027695 Bacteria 1323
428 Ga0207428_10064223 3300027907 Bacteria 2899
429 Ga0207428_10406540 3300027907 Bacteria 996
430 Ga0268266_10001669 3300028379 Bacteria 25581
431 Ga0268266_10022103 3300028379 Bacteria 5422
432 Ga0268266_10236137 3300028379 Bacteria 1685
433 Ga0268266_10252841 3300028379 Bacteria 1630
434 Ga0268266_10269888 3300028379 Bacteria 1579
435 Ga0268265_10000901 3300028380 Bacteria 27588
436 Ga0268265_10007451 3300028380 Bacteria 7391
437 Ga0268265_10008301 3300028380 Bacteria 7015
438 Ga0268265_10261546 3300028380 Bacteria 1539
439 Ga0268264_10000481 3300028381 Bacteria 53088
440 Ga0268264_10066058 3300028381 Bacteria 3050
441 Ga0265337_1003784 3300028556 Bacteria 6453
442 Ga0265319_1015151 3300028563 Bacteria 2999
443 Ga0265334_10000143 3300028573 Bacteria 44504
444 Ga0265334_10007008 3300028573 Bacteria 4839
445 Ga0265334_10009472 3300028573 Bacteria 4119
446 Ga0265318_10003937 3300028577 Bacteria 7319
447 Ga0265318_10017959 3300028577 Bacteria 2895
448 Ga0265338_10000043 3300028800 Bacteria 226293
449 Ga0265338_10012357 3300028800 Bacteria 9737
450 Ga0265338_10022519 3300028800 Bacteria 6520
451 Ga0265338_10027204 3300028800 Bacteria 5743
452 Ga0265338_10076391 3300028800 Bacteria 2837
453 Ga0265338_10109174 3300028800 Bacteria 2233
454 Ga0265324_10041806 3300029957 Bacteria 1585
455 Ga0265330_10005644 3300031235 Bacteria 6220
456 Ga0265330_10083821 3300031235 Bacteria 1372
457 Ga0265332_10004974 3300031238 Bacteria 6179
458 Ga0265332_10030001 3300031238 Bacteria 2376
459 Ga0265328_10008731 3300031239 Bacteria 4160
460 Ga0265328_10009813 3300031239 Bacteria 3880
461 Ga0265320_10004052 3300031240 Bacteria 9632
462 Ga0265325_10000002 3300031241 Bacteria 396758
463 Ga0265325_10000036 3300031241 Bacteria 96858
464 Ga0265325_10000464 3300031241 Bacteria 29365
465 Ga0265325_10012515 3300031241 Bacteria 4850
466 Ga0265329_10006598 3300031242 Bacteria 4591
467 Ga0265340_10000952 3300031247 Bacteria 16474
468 Ga0265340_10007138 3300031247 Bacteria 6086
469 Ga0265340_10017926 3300031247 Bacteria 3660
470 Ga0265340_10032994 3300031247 Bacteria 2580
471 Ga0265340_10165645 3300031247 Bacteria 1003
472 Ga0265339_10000625 3300031249 Bacteria 27424
473 Ga0265339_10001612 3300031249 Bacteria 16687
474 Ga0265339_10009163 3300031249 Bacteria 6245
475 Ga0265331_10001902 3300031250 Bacteria 14645
476 Ga0265331_10030827 3300031250 Bacteria 2667
477 Ga0265331_10091730 3300031250 Bacteria 1403
478 Ga0265316_10006610 3300031344 Bacteria 11045
479 Ga0265316_10008327 3300031344 Bacteria 9627
480 Ga0265316_10205196 3300031344 Bacteria 1460
481 Ga0307513_10046517 3300031456 Bacteria 4729
482 Ga0265313_10000513 3300031595 Bacteria 40580
483 Ga0265313_10001147 3300031595 Bacteria 25315
484 Ga0265313_10001243 3300031595 Bacteria 24298
485 Ga0265313_10001570 3300031595 Bacteria 21191
486 Ga0265313_10011866 3300031595 Bacteria 5382
487 Ga0265313_10015324 3300031595 Bacteria 4472
488 Ga0265313_10077748 3300031595 Bacteria 1514
489 Ga0265313_10129214 3300031595 Bacteria 1096
490 Ga0316579_10022141 3300031691 Bacteria 2839
491 Ga0265314_10005001 3300031711 Bacteria 12077
492 Ga0265342_10000715 3300031712 Bacteria 34304
493 Ga0265342_10007638 3300031712 Bacteria 7882
494 Ga0265342_10010075 3300031712 Bacteria 6590
495 Ga0265342_10090585 3300031712 Bacteria 1753
496 Ga0307516_10000020 3300031730 Bacteria 195931
497 Ga0307410_10178059 3300031852 Bacteria 1608
498 Ga0307406_10002705 3300031901 Bacteria 9664
499 Ga0307406_10083660 3300031901 Bacteria 2129
500 Ga0307409_100481546 3300031995 Bacteria 1204
501 Ga0307414_10083810 3300032004 Bacteria 2342
502 Ga0307414_10195618 3300032004 Bacteria 1640
503 Ga0373930_0049990 3300034816 Bacteria 911
504 Ga0373938_0000453 3300034957 Bacteria 6689
505 Ga0373926_0095560 3300035083 Bacteria 1108
506 Ga0373928_0054743 3300035084 Bacteria 951
507 Ga0373940_0009414 3300035088 Bacteria 2272
508 Ga0373940_0059527 3300035088 Bacteria 1090
509 Ga0373944_0066480 3300035089 Bacteria 1166
510 Ga0373949_0023914 3300035090 Bacteria 1418
511 Ga0373923_0031497 3300035111 Bacteria 2138
512 Ga0373936_0048609 3300035113 Bacteria 1712
513 Ga0373936_0122426 3300035113 Bacteria 1112
514 Ga0373939_0019310 3300035114 Bacteria 1837
515 Ga0373939_0053327 3300035114 Bacteria 1263
516 Ga0373941_0049605 3300035115 Bacteria 1329
517 Ga0373945_0003237 3300035116 Bacteria 5112
518 Ga0373945_0029563 3300035116 Bacteria 1926
519 Ga0373945_0041680 3300035116 Bacteria 1661
520 Ga0373953_0003538 3300035117 Bacteria 4879
521 Ga0373953_0004967 3300035117 Bacteria 4283
522 Ga0373953_0034560 3300035117 Bacteria 1982
523 Ga0373953_0103293 3300035117 Bacteria 1201
524 Ga0373954_0000020 3300035118 Bacteria 60211
525 Ga0373954_0005850 3300035118 Bacteria 5341
526 Ga0373954_0010400 3300035118 Bacteria 4106
527 Ga0373954_0049628 3300035118 Bacteria 1968
528 Ga0373956_0009309 3300035119 Bacteria 3993
529 Ga0373956_0018550 3300035119 Bacteria 2947
530 Ga0373956_0030175 3300035119 Bacteria 2368
531 Ga0373956_0079868 3300035119 Bacteria 1500
532 Ga0373956_0106861 3300035119 Bacteria 1301
533 Ga0373957_0014040 3300035120 Bacteria 2731
534 Ga0373957_0020115 3300035120 Bacteria 2356
535 Ga0373957_0076370 3300035120 Bacteria 1317
536 Ga0373960_0012957 3300035121 Bacteria 2082
537 Ga0373943_0001299 3300035170 Bacteria 11220
538 Ga0373943_0083922 3300035170 Bacteria 1638
539 Ga0373946_0001129 3300035171 Bacteria 9232
540 Ga0373955_0001159 3300035172 Bacteria 11195
541 Ga0373955_0002257 3300035172 Bacteria 8373
542 Ga0373955_0016631 3300035172 Bacteria 3624
543 Ga0373955_0016708 3300035172 Bacteria 3616
544 Ga0373962_0002352 3300035242 Bacteria 4513
545 Ga0373962_0042640 3300035242 Bacteria 1284
546 Ga0316574_0118410 3300035398 Bacteria 1699
547 Ga0373924_0000412 3300035410 Bacteria 13128
548 Ga0373924_0149782 3300035410 Bacteria 1020
549 Ga0373924_0185718 3300035410 Bacteria 915
550 Ga0373931_0017584 3300035691 Bacteria 3540
551 Ga0373931_0112714 3300035691 Bacteria 1545
552 Ga0373935_0000100 3300035692 Bacteria 38385
553 Ga0373935_0003876 3300035692 Bacteria 8728
554 Ga0373935_0012884 3300035692 Bacteria 5037
555 Ga0373935_0018083 3300035692 Bacteria 4285
556 Ga0373935_0753671 3300035692 Bacteria 717
557 Ga0373927_0027983 3300035695 Bacteria 3679
558 Ga0373927_0028096 3300035695 Bacteria 3670
559 Ga0373927_0037835 3300035695 Bacteria 3135
560 Ga0373927_0168007 3300035695 Bacteria 1437
561 Ga0373927_0170787 3300035695 Bacteria 1425
562 Ga0373933_0004387 3300035724 Bacteria 7746
563 Ga0373933_0004411 3300035724 Bacteria 7729
564 Ga0373933_0005938 3300035724 Bacteria 6643
565 Ga0373933_0020540 3300035724 Bacteria 3744
566 Ga0373933_0021741 3300035724 Bacteria 3647
567 Ga0373933_0116327 3300035724 Bacteria 1671
568 Ga0373933_0437972 3300035724 Bacteria 854
569 Ga0373947_0002174 3300035725 Bacteria 11912
570 Ga0373947_0026727 3300035725 Bacteria 3375
571 Ga0373947_0059346 3300035725 Bacteria 2319
572 Ga0373947_0062153 3300035725 Bacteria 2271
573 Ga0373937_0000028 3300036401 Bacteria 123801
574 Ga0373937_0000179 3300036401 Bacteria 62280
575 Ga0373937_0002145 3300036401 Bacteria 16512
576 Ga0373937_0006979 3300036401 Bacteria 9748
577 Ga0373937_0023517 3300036401 Bacteria 5549
578 Ga0373937_0030415 3300036401 Bacteria 4891
579 Ga0373937_0104503 3300036401 Bacteria 2631
580 Ga0373937_0115720 3300036401 Bacteria 2497
581 Ga0373937_0290809 3300036401 Bacteria 1544
582 Ga0316582_0003714 3300036647 Bacteria 7555
583 Ga0316584_0235608 3300036712 Bacteria 1341
584 Ga0373925_0000034 3300037068 Bacteria 144257
585 Ga0373925_0012776 3300037068 Bacteria 6083
586 Ga0373925_0045366 3300037068 Bacteria 3265
587 Ga0373925_0094430 3300037068 Bacteria 2290
588 Ga0373925_0337837 3300037068 Bacteria 1221
589 Ga0395899_0000026 3300037312 Bacteria 345291
590 Ga0395899_0000095 3300037312 Bacteria 152790
591 Ga0395899_0110496 3300037312 Bacteria 1977
592 Ga0395900_0000006 3300037418 Bacteria 495364
593 Ga0395900_0076901 3300037418 Bacteria 3430
594 Ga0395900_0123668 3300037418 Bacteria 2653
595 Ga0395898_0006778 3300037466 Bacteria 12192
596 Ga0395898_0125850 3300037466 Bacteria 2455
597 Ga0395905_0003726 3300037471 Bacteria 16150
598 Ga0395905_0358913 3300037471 Bacteria 1350
599 Ga0395901_0000001 3300038443 Bacteria 800383
600 Ga0395901_0012651 3300038443 Bacteria 8562
601 Ga0395901_0213403 3300038443 Bacteria 2019
602 Ga0400489_69310 3300039093 Bacteria 1779
603 Ga0400487_24057 3300039110 Bacteria 9098
604 Ga0400487_45503 3300039110 Bacteria 4078
605 Ga0436365_1244993 3300039437 Bacteria 6072
606 Ga0436365_1695948 3300039437 Bacteria 1364
607 Ga0436360_0848133 3300039438 Bacteria 1046
608 Ga0436361_0221120 3300039447 Bacteria 24197
609 Ga0436361_0313975 3300039447 Bacteria 1005
610 Ga0436361_0553129 3300039447 Bacteria 5298
611 Ga0436361_1049174 3300039447 Bacteria 12703
612 Ga0436363_0447376 3300039450 Bacteria 2768
613 Ga0436362_0078503 3300039453 Bacteria 952
614 Ga0436362_0273120 3300039453 Bacteria 1708
615 Ga0436362_0663757 3300039453 Bacteria 1177
616 Ga0439438_000009 3300041405 Viruses 172104
617 Ga0439447_005540 3300041407 Viruses 4183
618 Ga0439453_0000183 3300041408 Bacteria 5931
619 Ga0451847_0639349 3300041503 Bacteria 743
620 Ga0451853_0783681 3300041512 Bacteria 2137
621 Ga0439431_0024899 3300041997 Bacteria 1459
622 Ga0439441_014256 3300042001 Bacteria 1391
623 Ga0439443_000502 3300042003 Bacteria 3516
624 Ga0439445_0012334 3300042004 Bacteria 2052
625 Ga0439446_0094539 3300042156 Bacteria 939
626 Ga0439435_0000213 3300042436 Bacteria 8167
627 Ga0439464_0046068 3300042439 Bacteria 1253
628 Ga0439460_0000061 3300042461 Bacteria 15979
629 Ga0466961_0326459 3300044693 Bacteria 935
630 Ga0466963_0239373 3300044694 Bacteria 1272
631 Ga0466971_0194603 3300044719 Bacteria 956
632 Ga0466957_0025478 3300044842 Bacteria 3506
633 Ga0466957_0050775 3300044842 Bacteria 2524
634 Ga0466959_0029082 3300045049 Bacteria 4094
635 Ga0466959_0044534 3300045049 Bacteria 3270
636 Ga0451576_0088468 3300045051 Bacteria 3222
637 Ga0451576_0106334 3300045051 Bacteria 2920
638 Ga0466958_0136957 3300045836 Bacteria 1540
639 Ga0495592_0000031 3300046454 Bacteria 128596
640 Ga0495592_0007672 3300046454 Bacteria 8076
641 Ga0495592_0041995 3300046454 Bacteria 3425
642 Ga0495592_0052265 3300046454 Bacteria 3034
643 Ga0495592_0056631 3300046454 Bacteria 2896
644 Ga0495603_0016117 3300046455 Bacteria 4518
645 Ga0495629_0001240 3300046459 Bacteria 20042
646 Ga0495629_0019959 3300046459 Bacteria 4782
647 Ga0495629_0253437 3300046459 Bacteria 1210
648 Ga0495638_0150837 3300046460 Bacteria 1348
649 Ga0495641_0021394 3300046461 Bacteria 3255
650 Ga0495651_0001979 3300046462 Bacteria 15875
651 Ga0495651_0004229 3300046462 Bacteria 10999
652 Ga0495651_0006317 3300046462 Bacteria 9063
653 Ga0495651_0114725 3300046462 Bacteria 1987
654 Ga0495651_0132270 3300046462 Bacteria 1820
655 Ga0495651_0186838 3300046462 Bacteria 1462
656 Ga0495653_0000012 3300046463 Bacteria 266880
657 Ga0495653_0010825 3300046463 Bacteria 7465
658 Ga0495653_0309723 3300046463 Bacteria 1027
659 Ga0495582_0003108 3300046473 Bacteria 9307
660 Ga0495605_0026401 3300046474 Bacteria 3020
661 Ga0495639_0013265 3300046475 Bacteria 3556
662 Ga0495639_0064018 3300046475 Bacteria 1689
663 Ga0495662_0006996 3300046476 Bacteria 5603
664 Ga0495662_0008758 3300046476 Bacteria 4977
665 Ga0495662_0009212 3300046476 Bacteria 4843
666 Ga0495662_0015753 3300046476 Bacteria 3669
667 Ga0495664_0000004 3300046477 Bacteria 489411
668 Ga0495664_0028098 3300046477 Bacteria 3283
669 Ga0495584_0010598 3300046491 Bacteria 4735
670 Ga0495584_0136978 3300046491 Bacteria 1243
671 Ga0495584_0173548 3300046491 Bacteria 1096
672 Ga0495594_0010943 3300046499 Bacteria 4707
673 Ga0495594_0230064 3300046499 Bacteria 1057
674 Ga0495608_0000005 3300046511 Bacteria 350726
675 Ga0495608_0001028 3300046511 Bacteria 19566
676 Ga0495608_0001415 3300046511 Bacteria 17058
677 Ga0495608_0173488 3300046511 Bacteria 1367
678 Ga0495610_0008107 3300046512 Bacteria 6872
679 Ga0495618_0000024 3300046514 Bacteria 122536
680 Ga0495618_0017306 3300046514 Bacteria 4417
681 Ga0495618_0092460 3300046514 Bacteria 1934
682 Ga0495618_0110584 3300046514 Bacteria 1759
683 Ga0495618_0147484 3300046514 Bacteria 1504
684 Ga0495628_0000001 3300046516 Bacteria 917742
685 Ga0495628_0004556 3300046516 Bacteria 12274
686 Ga0495628_0023939 3300046516 Bacteria 5005
687 Ga0495628_0044540 3300046516 Bacteria 3529
688 Ga0495630_0000433 3300046517 Bacteria 31976
689 Ga0495630_0011916 3300046517 Bacteria 6304
690 Ga0495630_0012901 3300046517 Bacteria 6071
691 Ga0495632_0107467 3300046519 Bacteria 1312
692 Ga0495666_0013635 3300046526 Bacteria 4053
693 Ga0495666_0029050 3300046526 Bacteria 2720
694 Ga0495652_0000002 3300046529 Bacteria 946606
695 Ga0495652_0042527 3300046529 Bacteria 3917
696 Ga0495652_0056457 3300046529 Bacteria 3334
697 Ga0495652_0126864 3300046529 Bacteria 2026
698 Ga0495652_0190876 3300046529 Bacteria 1563
699 Ga0495652_0248607 3300046529 Bacteria 1319
700 Ga0495652_0298610 3300046529 Bacteria 1172
701 Ga0495654_0146640 3300046530 Bacteria 1047
702 Ga0495640_0000001 3300046533 Bacteria 853827
703 Ga0495640_0024283 3300046533 Bacteria 4411
704 Ga0495640_0034312 3300046533 Bacteria 3599
705 Ga0495640_0042302 3300046533 Bacteria 3180
706 Ga0495640_0090859 3300046533 Bacteria 2015
707 Ga0495640_0099776 3300046533 Bacteria 1907
708 Ga0495586_0001347 3300046535 Bacteria 13630
709 Ga0495586_0035461 3300046535 Bacteria 2680
710 Ga0495587_0000016 3300046536 Bacteria 185585
711 Ga0495587_0004603 3300046536 Bacteria 9067
712 Ga0495587_0072055 3300046536 Bacteria 2009
713 Ga0495587_0081447 3300046536 Bacteria 1876
714 Ga0495598_0001762 3300046537 Bacteria 4349
715 Ga0495598_0001867 3300046537 Bacteria 4247
716 Ga0495598_0026127 3300046537 Bacteria 1598
717 Ga0495621_0005502 3300046539 Bacteria 3644
718 Ga0495621_0050622 3300046539 Bacteria 1485
719 Ga0495621_0137281 3300046539 Bacteria 955
720 Ga0495645_0000002 3300046543 Bacteria 651644
721 Ga0495645_0028875 3300046543 Bacteria 4031
722 Ga0495645_0052308 3300046543 Bacteria 2971
723 Ga0495667_0000007 3300046559 Bacteria 234736
724 Ga0495667_0000709 3300046559 Bacteria 21330
725 Ga0495667_0001645 3300046559 Bacteria 14801
726 Ga0495667_0011650 3300046559 Bacteria 5953
727 Ga0495667_0020703 3300046559 Bacteria 4439
728 Ga0495667_0040356 3300046559 Bacteria 3099
729 Ga0495667_0072754 3300046559 Bacteria 2240
730 Ga0495667_0092108 3300046559 Bacteria 1963
731 Ga0495656_0083713 3300046615 Bacteria 1445
732 Ga0495634_0000637 3300046642 Bacteria 34135
733 Ga0495634_0002751 3300046642 Bacteria 14465
734 Ga0495635_0000002 3300046663 Bacteria 490490
735 Ga0495635_0024338 3300046663 Bacteria 4220
736 Ga0495635_0032827 3300046663 Bacteria 3601
737 Ga0495635_0058993 3300046663 Bacteria 2639
738 Ga0495635_0080766 3300046663 Bacteria 2225
739 Ga0495635_0534565 3300046663 Bacteria 770
740 Ga0495657_0000628 3300046675 Bacteria 31950
741 Ga0495657_0020211 3300046675 Bacteria 4789
742 Ga0495657_0062494 3300046675 Bacteria 2460
743 Ga0495657_0095234 3300046675 Bacteria 1903
744 Ga0495657_0098029 3300046675 Bacteria 1871
745 Ga0495599_0000005 3300046678 Bacteria 300169
746 Ga0495599_0013019 3300046678 Bacteria 5133
747 Ga0495599_0042650 3300046678 Bacteria 2847
748 Ga0495599_0089351 3300046678 Bacteria 1923
749 Ga0495623_0000016 3300046679 Bacteria 113454
750 Ga0495623_0000629 3300046679 Bacteria 23493
751 Ga0495623_0080766 3300046679 Bacteria 2012
752 Ga0495646_0000002 3300046680 Bacteria 310568
753 Ga0495646_0012772 3300046680 Bacteria 5338
754 Ga0495647_0005629 3300046681 Bacteria 4116
755 Ga0495658_0000745 3300046683 Bacteria 17569
756 Ga0495658_0004885 3300046683 Bacteria 6577
757 Ga0495658_0141604 3300046683 Bacteria 1471
758 Ga0495658_0184226 3300046683 Bacteria 1296
759 Ga0495624_0199103 3300046690 Bacteria 1217
760 Ga0495670_0141521 3300046691 Bacteria 1258
761 Ga0495589_0016051 3300046794 Bacteria 3847
762 Ga0495600_0000279 3300046809 Bacteria 27700
763 Ga0495600_0004235 3300046809 Bacteria 8567
764 Ga0495600_0005190 3300046809 Bacteria 7830
765 Ga0495600_0023211 3300046809 Bacteria 3990
766 Ga0495600_0029019 3300046809 Bacteria 3581
767 Ga0495604_0000020 3300047317 Bacteria 171989
768 Ga0495604_0008684 3300047317 Bacteria 8030
769 Ga0495604_0013367 3300047317 Bacteria 6537
770 Ga0495604_0116986 3300047317 Bacteria 1934
771 Ga0495604_0182428 3300047317 Bacteria 1467
772 Ga0495674_0000002 3300047319 Bacteria 642785
773 Ga0495674_0020681 3300047319 Bacteria 6094
774 Ga0495674_0034881 3300047319 Bacteria 4545
775 Ga0495672_0000374 3300047320 Bacteria 55795
776 Ga0495676_0068957 3300047321 Bacteria 2730
777 Ga0495676_0099911 3300047321 Bacteria 2149
778 Ga0495676_0273221 3300047321 Bacteria 1146
779 Ga0495680_0001158 3300047322 Bacteria 29075
780 Ga0495680_0005762 3300047322 Bacteria 11598
781 Ga0495680_0019375 3300047322 Bacteria 5742
782 Ga0495680_0020742 3300047322 Bacteria 5518
783 Ga0495680_0041210 3300047322 Bacteria 3673
784 Ga0495680_0068677 3300047322 Bacteria 2706
785 Ga0495675_0000284 3300047444 Bacteria 36681
786 Ga0495675_0002358 3300047444 Bacteria 11271
787 Ga0495675_0131952 3300047444 Bacteria 1552
788 Ga0495675_0177805 3300047444 Bacteria 1304
789 Ga0495684_0000017 3300047471 Bacteria 160663
790 Ga0495684_0034978 3300047471 Bacteria 3854
791 Ga0495686_0048541 3300047472 Bacteria 2676
792 Ga0495593_0001934 3300047673 Bacteria 12353
793 Ga0495593_0055496 3300047673 Bacteria 2085
794 Ga0495593_0173669 3300047673 Bacteria 1086
795 Ga0495602_0000040 3300048088 Bacteria 127280
796 Ga0495602_0003684 3300048088 Bacteria 15893
797 Ga0495602_0028395 3300048088 Bacteria 5354
798 Ga0495602_0122392 3300048088 Bacteria 2091
799 Ga0495615_0053442 3300048090 Bacteria 1046
800 Ga0496100_0010939 3300048903 Bacteria 5148
801 Ga0496100_0012203 3300048903 Bacteria 4918
802 Ga0496100_0057851 3300048903 Bacteria 2541
803 Ga0496100_0389050 3300048903 Bacteria 1060
804 Ga0496101_0006634 3300048904 Bacteria 7459
805 Ga0496101_0287152 3300048904 Bacteria 1287
806 Ga0496101_0637759 3300048904 Bacteria 842
807 Ga0496102_0046509 3300048905 Bacteria 3941
808 Ga0496102_0058075 3300048905 Bacteria 3534
809 Ga0496102_0195065 3300048905 Bacteria 1908
810 Ga0496102_0216264 3300048905 Bacteria 1806
811 Ga0496103_0067000 3300048906 Bacteria 2241
812 Ga0496103_0070323 3300048906 Bacteria 2189
813 Ga0496104_0000055 3300048907 Bacteria 124267
814 Ga0496104_0005521 3300048907 Bacteria 11076
815 Ga0496104_0011174 3300048907 Bacteria 8035
816 Ga0496104_0083240 3300048907 Bacteria 3051
817 Ga0496104_0122731 3300048907 Bacteria 2494
818 Ga0496104_0135365 3300048907 Bacteria 2367
819 Ga0496104_0192776 3300048907 Bacteria 1950
820 Ga0496104_0409884 3300048907 Bacteria 1267
821 Ga0496105_0001352 3300048908 Bacteria 17218
822 Ga0496105_0006498 3300048908 Bacteria 8988
823 Ga0496105_0013053 3300048908 Bacteria 6584
824 Ga0496105_0043251 3300048908 Bacteria 3715
825 Ga0496105_0182787 3300048908 Bacteria 1716
826 Ga0496106_0044490 3300048909 Bacteria 3332
827 Ga0496106_0059439 3300048909 Bacteria 2896
828 Ga0496106_0079112 3300048909 Bacteria 2524
829 Ga0496106_0330578 3300048909 Bacteria 1224
830 Ga0496107_0005300 3300048910 Bacteria 8812
831 Ga0496107_0058525 3300048910 Bacteria 2786
832 Ga0496107_0109787 3300048910 Bacteria 2026
833 Ga0496108_0037806 3300048911 Bacteria 4021
834 Ga0496109_0039967 3300048912 Bacteria 4247
835 Ga0496109_0051612 3300048912 Bacteria 3746
836 Ga0496109_0063721 3300048912 Bacteria 3372
837 Ga0496109_0167017 3300048912 Bacteria 2063
838 Ga0496110_0043384 3300048913 Bacteria 3927
839 Ga0496110_0231798 3300048913 Bacteria 1679
840 Ga0496110_0246779 3300048913 Bacteria 1625
841 Ga0496110_0348310 3300048913 Bacteria 1349
842 Ga0496111_0029169 3300048914 Bacteria 3917
843 Ga0496111_0033488 3300048914 Bacteria 3665
844 Ga0496111_0182544 3300048914 Bacteria 1560
845 Ga0496111_0260399 3300048914 Bacteria 1287
846 Ga0496112_0263871 3300048915 Bacteria 1671
847 Ga0496113_0121596 3300048916 Bacteria 2041
848 Ga0496114_0000007 3300048917 Bacteria 463098
849 Ga0496114_0011561 3300048917 Bacteria 7053
850 Ga0496114_0045542 3300048917 Bacteria 3644
851 Ga0496114_0373459 3300048917 Bacteria 1262
852 Ga0496114_0409186 3300048917 Bacteria 1201
853 Ga0496115_0014395 3300048918 Bacteria 5987
854 Ga0496115_0022410 3300048918 Bacteria 4893
855 Ga0496115_0062175 3300048918 Bacteria 3012
856 Ga0496115_0089827 3300048918 Bacteria 2509
857 Ga0496115_0170415 3300048918 Bacteria 1800
858 Ga0496115_0302958 3300048918 Bacteria 1309
859 Ga0496117_0017711 3300048920 Bacteria 5941
860 Ga0496119_0000314 3300048922 Bacteria 67717
861 Ga0496121_0000130 3300048924 Bacteria 168094
862 Ga0496121_0000445 3300048924 Bacteria 81575
863 Ga0496121_0020845 3300048924 Bacteria 6458
864 Ga0496121_0112803 3300048924 Bacteria 2070
865 Ga0496122_0000190 3300048925 Bacteria 140376
866 Ga0496122_0001527 3300048925 Bacteria 36858
867 Ga0496122_0003891 3300048925 Bacteria 19134
868 Ga0496123_0001016 3300048926 Bacteria 42813
869 Ga0496123_0001252 3300048926 Bacteria 36667
870 Ga0496125_0000273 3300048928 Bacteria 104663
871 Ga0496125_0231617 3300048928 Bacteria 1181
872 Ga0496126_0225961 3300048929 Bacteria 1570
873 Ga0496126_0364327 3300048929 Bacteria 1180
874 Ga0501335_006568 3300049551 Bacteria 1062
875 Ga0501031_0008676 3300049568 Bacteria 6609
876 Ga0501031_0012430 3300049568 Bacteria 5553
877 Ga0501031_0033868 3300049568 Bacteria 3334
878 Ga0501032_0002877 3300049569 Bacteria 13391
879 Ga0501032_0007634 3300049569 Bacteria 7886
880 Ga0501032_0178977 3300049569 Bacteria 1389
881 Ga0501033_0057319 3300049570 Bacteria 2879
882 Ga0501033_0191280 3300049570 Bacteria 1464
883 Ga0501034_0000442 3300049571 Bacteria 68550
884 Ga0501034_0019479 3300049571 Bacteria 6940
885 Ga0501034_0058526 3300049571 Bacteria 3873
886 Ga0501034_0067565 3300049571 Bacteria 3586
887 Ga0501034_0086158 3300049571 Bacteria 3142
888 Ga0501034_0236274 3300049571 Bacteria 1775
889 Ga0501034_0530442 3300049571 Bacteria 1088
890 Ga0501034_0591878 3300049571 Bacteria 1015
891 Ga0501036_0000984 3300049572 Bacteria 21517
892 Ga0501036_0001853 3300049572 Bacteria 16386
893 Ga0501036_0002374 3300049572 Bacteria 14720
894 Ga0501036_0039661 3300049572 Bacteria 3985
895 Ga0501036_0147876 3300049572 Bacteria 1982
896 Ga0501036_0196679 3300049572 Bacteria 1696
897 Ga0501037_0002212 3300049573 Bacteria 14046
898 Ga0501037_0002785 3300049573 Bacteria 12664
899 Ga0501037_0008691 3300049573 Bacteria 7443
900 Ga0501038_0002844 3300049574 Bacteria 16106
901 Ga0501038_0044931 3300049574 Bacteria 3836
902 Ga0501038_0046946 3300049574 Bacteria 3742
903 Ga0501038_0074453 3300049574 Bacteria 2873
904 Ga0501038_0076376 3300049574 Bacteria 2829
905 Ga0501039_0000661 3300049575 Bacteria 24914
906 Ga0501039_0008637 3300049575 Bacteria 7762
907 Ga0501039_0010027 3300049575 Bacteria 7224
908 Ga0501039_0019866 3300049575 Bacteria 5149
909 Ga0501039_0083587 3300049575 Bacteria 2486
910 Ga0501039_0315050 3300049575 Bacteria 1230
911 Ga0501039_0367618 3300049575 Bacteria 1130
912 Ga0501040_0000759 3300049576 Bacteria 20016
913 Ga0501040_0009670 3300049576 Bacteria 6295
914 Ga0501040_0028681 3300049576 Bacteria 3753
915 Ga0501040_0078736 3300049576 Bacteria 2281
916 Ga0501040_0319335 3300049576 Bacteria 1111
917 Ga0501040_0445253 3300049576 Bacteria 932
918 Ga0501041_0000109 3300049577 Bacteria 34463
919 Ga0501041_0005052 3300049577 Bacteria 7684
920 Ga0501041_0138550 3300049577 Bacteria 1517
921 Ga0501042_0001562 3300049578 Bacteria 13545
922 Ga0501042_0008667 3300049578 Bacteria 6739
923 Ga0501042_0102642 3300049578 Bacteria 2057
924 Ga0501042_0175466 3300049578 Bacteria 1546
925 Ga0501042_0497761 3300049578 Bacteria 885
926 Ga0501043_0000539 3300049579 Bacteria 34110
927 Ga0501043_0003859 3300049579 Bacteria 12318
928 Ga0501043_0044627 3300049579 Bacteria 3486
929 Ga0501043_0129961 3300049579 Bacteria 1974
930 Ga0501046_0001303 3300049580 Bacteria 24159
931 Ga0501046_0002082 3300049580 Bacteria 18977
932 Ga0501046_0014507 3300049580 Bacteria 6645
933 Ga0501046_0055809 3300049580 Bacteria 3102
934 Ga0501047_0004626 3300049581 Bacteria 12950
935 Ga0501047_0006570 3300049581 Bacteria 10947
936 Ga0501047_0039197 3300049581 Bacteria 4584
937 Ga0501047_0077876 3300049581 Bacteria 3188
938 Ga0501047_0092118 3300049581 Bacteria 2909
939 Ga0501047_0432279 3300049581 Bacteria 1147
940 Ga0501048_0000190 3300049582 Bacteria 39467
941 Ga0501048_0003398 3300049582 Bacteria 12097
942 Ga0501048_0006966 3300049582 Bacteria 8589
943 Ga0501048_0223802 3300049582 Bacteria 1335
944 Ga0501067_0001787 3300049583 Bacteria 11809
945 Ga0501067_0022641 3300049583 Bacteria 3477
946 Ga0501067_0032759 3300049583 Bacteria 2884
947 Ga0501067_0074035 3300049583 Bacteria 1887
948 Ga0501067_0143110 3300049583 Bacteria 1332
949 Ga0501067_0217860 3300049583 Bacteria 1063
950 Ga0501068_0005962 3300049584 Bacteria 6688
951 Ga0501068_0009173 3300049584 Bacteria 5525
952 Ga0501069_0000649 3300049585 Bacteria 16136
953 Ga0501070_0168390 3300049586 Bacteria 1805
954 Ga0501070_0312434 3300049586 Bacteria 1279
955 Ga0501070_0348883 3300049586 Bacteria 1201
956 Ga0501070_0794730 3300049586 Bacteria 743
957 Ga0501071_0007762 3300049587 Bacteria 7076
958 Ga0501071_0032363 3300049587 Bacteria 3713
959 Ga0501071_0070158 3300049587 Bacteria 2552
960 Ga0501072_0000763 3300049588 Bacteria 23454
961 Ga0501072_0019901 3300049588 Bacteria 5194
962 Ga0501072_0022921 3300049588 Bacteria 4847
963 Ga0501072_0052388 3300049588 Bacteria 3213
964 Ga0501072_0101793 3300049588 Bacteria 2283
965 Ga0501072_0378673 3300049588 Bacteria 1123
966 Ga0501072_0622962 3300049588 Bacteria 850
967 Ga0501073_0004760 3300049589 Bacteria 10185
968 Ga0501073_0031779 3300049589 Bacteria 3766
969 Ga0501073_0312535 3300049589 Bacteria 1084
970 Ga0501074_0006570 3300049590 Bacteria 8406
971 Ga0501074_0009706 3300049590 Bacteria 6990
972 Ga0501074_0012006 3300049590 Bacteria 6296
973 Ga0501074_0049980 3300049590 Bacteria 3018
974 Ga0501074_0256381 3300049590 Bacteria 1244
975 Ga0501075_0000840 3300049591 Bacteria 19361
976 Ga0501075_0000926 3300049591 Bacteria 18608
977 Ga0501075_0055651 3300049591 Bacteria 2977
978 Ga0501076_0038992 3300049592 Bacteria 3729
979 Ga0501076_0106733 3300049592 Bacteria 2261
980 Ga0501076_0451054 3300049592 Bacteria 1059
981 Ga0501077_0000262 3300049593 Bacteria 30957
982 Ga0501077_0096453 3300049593 Bacteria 1874
983 Ga0501077_0118055 3300049593 Bacteria 1681
984 Ga0501079_0000684 3300049741 Bacteria 22742
985 Ga0501079_0013866 3300049741 Bacteria 6147
986 Ga0501079_0022746 3300049741 Bacteria 4810
987 Ga0501079_0106273 3300049741 Bacteria 2178
988 Ga0501079_0269594 3300049741 Bacteria 1331
989 Ga0501080_0003003 3300049742 Bacteria 14872
990 Ga0501080_0049027 3300049742 Bacteria 3930
991 Ga0501080_0160287 3300049742 Bacteria 2078
992 Ga0501080_0193161 3300049742 Bacteria 1870
993 Ga0501080_0388380 3300049742 Bacteria 1257
994 Ga0501081_0000356 3300049743 Bacteria 24749
995 Ga0501081_0008011 3300049743 Bacteria 6856
996 Ga0501081_0044767 3300049743 Bacteria 3039
997 Ga0501081_0281770 3300049743 Bacteria 1217
998 Ga0501083_0002240 3300049744 Bacteria 13217
999 Ga0501083_0004092 3300049744 Bacteria 10261
1000 Ga0501083_0007258 3300049744 Bacteria 7869
1001 Ga0501083_0017016 3300049744 Bacteria 5076
1002 Ga0501083_0139129 3300049744 Bacteria 1590
1003 Ga0501035_0005532 3300049822 Bacteria 11940
1004 Ga0501035_0007363 3300049822 Bacteria 10284
1005 Ga0501035_0072868 3300049822 Bacteria 3039
1006 Ga0501035_0089404 3300049822 Bacteria 2713
1007 Ga0501035_0207227 3300049822 Bacteria 1679
1008 Ga0501035_0299608 3300049822 Bacteria 1355
1009 Ga0501044_0000708 3300049823 Bacteria 40261
1010 Ga0501044_0013935 3300049823 Bacteria 8685
1011 Ga0501044_0017975 3300049823 Bacteria 7580
1012 Ga0501044_0021310 3300049823 Bacteria 6917
1013 Ga0501044_0079433 3300049823 Bacteria 3324
1014 Ga0501044_0110623 3300049823 Bacteria 2756
1015 Ga0501044_0170371 3300049823 Bacteria 2149
1016 Ga0501044_0382197 3300049823 Bacteria 1323
1017 Ga0501044_0446815 3300049823 Bacteria 1200
1018 Ga0501045_0000221 3300049824 Bacteria 32865
1019 Ga0501045_0000749 3300049824 Bacteria 20755
1020 Ga0501045_0008385 3300049824 Bacteria 7200
1021 Ga0501045_0054276 3300049824 Bacteria 2929
1022 Ga0501045_0480801 3300049824 Bacteria 923
1023 nmdc:mga03683_110340_c1 3300050489 Bacteria 1216
1024 nmdc:mga03683_169851_c1 3300050489 Bacteria 990
1025 nmdc:mga03683_38247_c1 3300050489 Bacteria 1959
1026 nmdc:mga03n38_5525_c1 3300050490 Bacteria 4310
1027 nmdc:mga03n38_74596_c1 3300050490 Bacteria 1578
1028 nmdc:mga00v17_139030_c1 3300050491 Bacteria 1556
1029 nmdc:mga00v17_20753_c1 3300050491 Bacteria 3768
1030 nmdc:mga0yw44_11143_c1 3300050492 Bacteria 4625
1031 nmdc:mga06z11_102986_c1 3300050494 Bacteria 1569
1032 nmdc:mga06z11_155414_c1 3300050494 Bacteria 1304
1033 nmdc:mga04h51_6961_c1 3300050495 Bacteria 2962
1034 nmdc:mga05p37_30139_c1 3300050507 Bacteria 6620
1035 nmdc:mga05p37_56283_c1 3300050507 Bacteria 4842
1036 nmdc:mga05p37_67_c1 3300050507 Bacteria 91619
1037 nmdc:mga05p37_79966_c1 3300050507 Bacteria 4026
1038 nmdc:mga09592_137419_c1 3300050508 Bacteria 2105
1039 nmdc:mga09592_173345_c1 3300050508 Bacteria 1866
1040 nmdc:mga09592_289322_c1 3300050508 Bacteria 1421
1041 nmdc:mga09592_45_c1 3300050508 Bacteria 69144
1042 nmdc:mga0qj67_107060_c1 3300050509 Bacteria 2255
1043 nmdc:mga0qj67_175746_c1 3300050509 Bacteria 1739
1044 nmdc:mga0qj67_267_c1 3300050509 Bacteria 35925
1045 nmdc:mga0qj67_35658_c1 3300050509 Bacteria 3890
1046 nmdc:mga0qj67_46113_c1 3300050509 Bacteria 3441
1047 nmdc:mga0qj67_96444_c1 3300050509 Bacteria 2381
1048 nmdc:mga06r32_10930_c1 3300050510 Bacteria 8174
1049 nmdc:mga06r32_544367_c1 3300050510 Bacteria 1135
1050 nmdc:mga06r32_62934_c1 3300050510 Bacteria 3575
1051 nmdc:mga08y16_126338_c1 3300050511 Bacteria 2660
1052 nmdc:mga08y16_196092_c1 3300050511 Bacteria 2093
1053 nmdc:mga08y16_219568_c1 3300050511 Bacteria 1968
1054 nmdc:mga08y16_252069_c1 3300050511 Bacteria 1824
1055 nmdc:mga08y16_51087_c1 3300050511 Bacteria 4325
1056 nmdc:mga0n895_63492_c1 3300050512 Bacteria 3652
1057 nmdc:mga0n895_695456_c1 3300050512 Bacteria 1013
1058 nmdc:mga0rr50_30813_c1 3300050513 Bacteria 3803
1059 nmdc:mga0rr50_51956_c1 3300050513 Bacteria 3043
1060 nmdc:mga0rr50_662451_c1 3300050513 Bacteria 891
1061 nmdc:mga08x19_3363_c1 3300050514 Bacteria 4239
1062 nmdc:mga0a205_338726_c1 3300050515 Bacteria 1373
1063 nmdc:mga0a205_372926_c1 3300050515 Bacteria 1293
1064 nmdc:mga0a205_413053_c1 3300050515 Bacteria 1212
1065 nmdc:mga0a205_435087_c1 3300050515 Bacteria 1173
1066 nmdc:mga0a205_52693_c1 3300050515 Bacteria 3927
1067 nmdc:mga0sz30_133465_c1 3300050516 Bacteria 1095
1068 Ga0495601_0000018 3300053077 Bacteria 171665
1069 Ga0495601_0000352 3300053077 Bacteria 24145
1070 Ga0495601_0000357 3300053077 Bacteria 23996
1071 Ga0495601_0008676 3300053077 Bacteria 5997
1072 Ga0495601_0010571 3300053077 Bacteria 5496
1073 Ga0495601_0048033 3300053077 Bacteria 2688
1074 Ga0495601_0049828 3300053077 Bacteria 2641
1075 Ga0495601_0311990 3300053077 Bacteria 1024
1076 Ga0495612_0000011 3300053078 Bacteria 224729
1077 Ga0495612_0003841 3300053078 Bacteria 6236
1078 Ga0495612_0014220 3300053078 Bacteria 3201
1079 Ga0495612_0026130 3300053078 Bacteria 2347
1080 Ga0495612_0033348 3300053078 Bacteria 2083
1081 Ga0495595_0000016 3300053084 Bacteria 134329
1082 Ga0495595_0000405 3300053084 Bacteria 16418
1083 Ga0495595_0001531 3300053084 Bacteria 9014
1084 Ga0495595_0002126 3300053084 Bacteria 7698
1085 Ga0495595_0010289 3300053084 Bacteria 3885
1086 Ga0495619_0000014 3300053085 Bacteria 261449
1087 Ga0495619_0000085 3300053085 Bacteria 70073
1088 Ga0495619_0000536 3300053085 Bacteria 25079
1089 Ga0495619_0002650 3300053085 Bacteria 11698
1090 Ga0495619_0008387 3300053085 Bacteria 6533
1091 Ga0495619_0011351 3300053085 Bacteria 5609
1092 Ga0495619_0013199 3300053085 Bacteria 5206
1093 Ga0495619_0023812 3300053085 Bacteria 3924
1094 Ga0495619_0157984 3300053085 Bacteria 1565
1095 Ga0500643_004745 3300053087 Bacteria 6032
1096 Ga0500647_0027125 3300053091 Bacteria 2706
1097 Ga0500583_0142668 3300053092 Bacteria 1190
1098 Ga0500651_0002083 3300053093 Bacteria 10388
1099 Ga0500641_0033918 3300053096 Bacteria 2029
1100 Ga0500556_0000099 3300053104 Bacteria 79263
1101 Ga0500593_012112 3300053117 Bacteria 3648
1102 Ga0500594_0014290 3300053118 Bacteria 1899
1103 Ga0500595_072629 3300053119 Bacteria 1019
1104 Ga0500608_135308 3300053122 Bacteria 1099
1105 Ga0500642_0037358 3300053130 Bacteria 2075
1106 Ga0500616_0044871 3300053153 Bacteria 2357
1107 Ga0500616_0185107 3300053153 Bacteria 935
1108 Ga0500627_0062992 3300053158 Bacteria 1634
1109 Ga0500611_023857 3300053727 Bacteria 1195
1110 Ga0501084_0000355 3300054114 Bacteria 34952
1111 Ga0501084_0000758 3300054114 Bacteria 24600
1112 Ga0501084_0013622 3300054114 Bacteria 6730
1113 Ga0501084_0034669 3300054114 Bacteria 4219
1114 Ga0501084_0041915 3300054114 Bacteria 3828
1115 Ga0501084_0127934 3300054114 Bacteria 2138
1116 Ga0501082_0000032 3300060353 Bacteria 99261
1117 Ga0501082_0003835 3300060353 Bacteria 13147
1118 Ga0501082_0004982 3300060353 Bacteria 11595
1119 Ga0501082_0056277 3300060353 Bacteria 3388
1120 Ga0501082_0126679 3300060353 Bacteria 2215
1121 Ga0501082_0208152 3300060353 Bacteria 1702
1122 Ga0501082_0284777 3300060353 Bacteria 1439
1123 Ga0501082_0299606 3300060353 Bacteria 1400
1124 Ga0466962_0148311 3300061719 Bacteria 1138
1125 Ga0530510_0000542 3300061734 Bacteria 24234
1126 Ga0530510_0001016 3300061734 Bacteria 18589
1127 Ga0530510_0092420 3300061734 Bacteria 2208

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_135308 Ga0500608_135308_18_680 213
2 3300005834 Ga0068851_10000120 Ga0068851_1000012029 220
3 3300025321 Ga0207656_10000165 Ga0207656_1000016518 220
4 3300048903 Ga0496100_0389050 Ga0496100_0389050_384_1046 220
5 3300013297 Ga0157378_10912542 Ga0157378_109125422 221
6 3300035692 Ga0373935_0753671 Ga0373935_0753671_38_703 221
7 3300046491 Ga0495584_0136978 Ga0495584_0136978_10_675 221
8 3300046530 Ga0495654_0146640 Ga0495654_0146640_29_694 221
9 3300046537 Ga0495598_0026127 Ga0495598_0026127_28_693 221
10 3300048924 Ga0496121_0020845 Ga0496121_0020845_5773_6438 221
11 3300049576 Ga0501040_0319335 Ga0501040_0319335_22_687 221
12 3300049583 Ga0501067_0143110 Ga0501067_0143110_22_687 221
13 3300050511 nmdc:mga08y16_252069_c1 nmdc:mga08y16_252069_c1_29_694 221
14 3300053118 Ga0500594_0014290 Ga0500594_0014290_12_677 221
15 3300053158 Ga0500627_0062992 Ga0500627_0062992_944_1609 221
16 3300049590 Ga0501074_0009706 Ga0501074_0009706_5151_5840 225
17 3300049586 Ga0501070_0794730 Ga0501070_0794730_37_720 227
18 3300048904 Ga0496101_0637759 Ga0496101_0637759_119_826 230
19 3300035088 Ga0373940_0059527 Ga0373940_0059527_376_1071 231
20 3300036712 Ga0316584_0235608 Ga0316584_0235608_632_1327 231
21 3300041503 Ga0451847_0639349 Ga0451847_0639349_20_715 231
22 3300046535 Ga0495586_0035461 Ga0495586_0035461_1946_2641 231
23 3300046663 Ga0495635_0534565 Ga0495635_0534565_21_716 231
24 3300046681 Ga0495647_0005629 Ga0495647_0005629_21_716 231
25 3300047673 Ga0495593_0173669 Ga0495593_0173669_377_1072 231
26 3300048904 Ga0496101_0287152 Ga0496101_0287152_17_712 231
27 3300048912 Ga0496109_0063721 Ga0496109_0063721_24_719 231
28 3300048924 Ga0496121_0112803 Ga0496121_0112803_673_1368 231
29 3300049571 Ga0501034_0530442 Ga0501034_0530442_327_1022 231
30 3300049583 Ga0501067_0217860 Ga0501067_0217860_343_1038 231
31 3300049592 Ga0501076_0451054 Ga0501076_0451054_338_1033 231
32 3300050491 nmdc:mga00v17_139030_c1 nmdc:mga00v17_139030_c1_41_736 231
33 3300053077 Ga0495601_0049828 Ga0495601_0049828_23_718 231
34 3300053085 Ga0495619_0157984 Ga0495619_0157984_845_1540 231
35 3300053153 Ga0500616_0185107 Ga0500616_0185107_28_723 231
36 iso_pu_bacteria 2643221699 2644547710 241
37 3300046794 Ga0495589_0016051 Ga0495589_0016051_138_980 251
38 3300005295 Ga0065707_10227956 Ga0065707_102279562 252
39 3300005331 Ga0070670_100196606 Ga0070670_1001966062 252
40 3300005347 Ga0070668_100005164 Ga0070668_1000051642 252
41 3300005353 Ga0070669_100172808 Ga0070669_1001728081 252
42 3300005367 Ga0070667_100106981 Ga0070667_1001069812 252
43 3300005444 Ga0070694_100050445 Ga0070694_1000504453 252
44 3300005468 Ga0070707_100154715 Ga0070707_1001547153 252
45 3300005546 Ga0070696_100132587 Ga0070696_1001325873 252
46 3300005617 Ga0068859_100048343 Ga0068859_1000483435 252
47 3300005719 Ga0068861_100039322 Ga0068861_1000393224 252
48 3300005841 Ga0068863_100064702 Ga0068863_1000647025 252
49 3300005841 Ga0068863_100123515 Ga0068863_1001235152 252
50 3300005844 Ga0068862_100012637 Ga0068862_1000126376 252
51 3300006931 Ga0097620_100048344 Ga0097620_1000483445 252
52 3300009553 Ga0105249_10138854 Ga0105249_101388542 252
53 3300025922 Ga0207646_10095220 Ga0207646_100952203 252
54 3300025923 Ga0207681_10013529 Ga0207681_100135299 252
55 3300025936 Ga0207670_10073924 Ga0207670_100739243 252
56 3300025961 Ga0207712_10078711 Ga0207712_100787114 252
57 3300025972 Ga0207668_10016411 Ga0207668_100164112 252
58 3300025986 Ga0207658_10090613 Ga0207658_100906134 252
59 3300026088 Ga0207641_10053054 Ga0207641_100530545 252
60 3300026095 Ga0207676_10307420 Ga0207676_103074202 252
61 3300026118 Ga0207675_100037302 Ga0207675_1000373024 252
62 3300028379 Ga0268266_10269888 Ga0268266_102698882 252
63 3300028380 Ga0268265_10008301 Ga0268265_100083016 252
64 3300028381 Ga0268264_10066058 Ga0268264_100660585 252
65 3300031730 Ga0307516_10000020 Ga0307516_1000002099 252
66 3300005549 Ga0070704_100018115 Ga0070704_1000181155 253
67 3300005617 Ga0068859_100360565 Ga0068859_1003605652 253
68 3300006931 Ga0097620_100360558 Ga0097620_1003605582 253
69 3300042004 Ga0439445_0012334 Ga0439445_0012334_126_974 253
70 3300046512 Ga0495610_0008107 Ga0495610_0008107_3029_3871 253
71 3300049575 Ga0501039_0019866 Ga0501039_0019866_3635_4444 253
72 3300049578 Ga0501042_0497761 Ga0501042_0497761_63_872 253
73 3300049741 Ga0501079_0106273 Ga0501079_0106273_471_1280 253
74 3300049743 Ga0501081_0044767 Ga0501081_0044767_1371_2180 253
75 3300053119 Ga0500595_072629 Ga0500595_072629_199_993 253
76 3300053153 Ga0500616_0044871 Ga0500616_0044871_551_1345 253
77 3300005842 Ga0068858_100000029 Ga0068858_10000002951 254
78 3300009177 Ga0105248_10016560 Ga0105248_100165607 254
79 3300010375 Ga0105239_10007278 Ga0105239_100072787 254
80 3300025941 Ga0207711_10001642 Ga0207711_1000164217 254
81 3300037312 Ga0395899_0000026 Ga0395899_0000026_282426_283298 254
82 3300046460 Ga0495638_0150837 Ga0495638_0150837_377_1219 254
83 3300048905 Ga0496102_0216264 Ga0496102_0216264_240_1097 254
84 3300048909 Ga0496106_0079112 Ga0496106_0079112_1116_1973 254
85 3300048920 Ga0496117_0017711 Ga0496117_0017711_2264_3121 254
86 3300048924 Ga0496121_0000130 Ga0496121_0000130_253_1110 254
87 3300053087 Ga0500643_004745 Ga0500643_004745_2369_3223 254
88 3300053091 Ga0500647_0027125 Ga0500647_0027125_1577_2416 254
89 3300005546 Ga0070696_100187704 Ga0070696_1001877042 256
90 3300006847 Ga0075431_100047714 Ga0075431_1000477143 256
91 3300048929 Ga0496126_0225961 Ga0496126_0225961_736_1530 256
92 3300050510 nmdc:mga06r32_10930_c1 nmdc:mga06r32_10930_c1_5183_5995 256
93 3300006847 Ga0075431_100003819 Ga0075431_10000381910 257
94 3300034816 Ga0373930_0049990 Ga0373930_0049990_11_784 257
95 3300035121 Ga0373960_0012957 Ga0373960_0012957_1295_2068 257
96 3300039437 Ga0436365_1695948 Ga0436365_1695948_223_996 257
97 3300048905 Ga0496102_0058075 Ga0496102_0058075_2741_3514 257
98 3300048916 Ga0496113_0121596 Ga0496113_0121596_13_786 257
99 3300049581 Ga0501047_0039197 Ga0501047_0039197_569_1417 257
100 3300049823 Ga0501044_0446815 Ga0501044_0446815_227_1075 257
101 3300053078 Ga0495612_0026130 Ga0495612_0026130_1561_2334 257
102 3300003781 Ga0055536_1008604 Ga0055536_10086044 258
103 3300003794 Ga0055531_10025153 Ga0055531_100251533 258
104 3300013105 Ga0157369_10000077 Ga0157369_1000007761 258
105 3300025292 Ga0209676_1000046 Ga0209676_1000046124 258
106 3300025298 Ga0209050_1019572 Ga0209050_10195723 258
107 3300025304 Ga0209257_1000505 Ga0209257_100050573 258
108 3300031901 Ga0307406_10002705 Ga0307406_1000270511 258
109 3300041405 Ga0439438_000009 Ga0439438_000009_135183_136073 258
110 3300041407 Ga0439447_005540 Ga0439447_005540_3157_4047 258
111 iso_pu_bacteria 2554235469 2556064267 260
112 iso_pu_bacteria 2891048133 2891052166 260
113 iso_pu_bacteria 3003665799 3003668799 260
114 iso_pu_bacteria 8001845381 8001846101 260
115 3300025986 Ga0207658_10484306 Ga0207658_104843061 261
116 3300009093 Ga0105240_10007706 Ga0105240_100077069 262
117 3300021361 Ga0213872_10000696 Ga0213872_1000069624 262
118 3300025913 Ga0207695_10005429 Ga0207695_1000542911 262
119 3300039447 Ga0436361_0221120 Ga0436361_0221120_19714_20571 262
120 3300005331 Ga0070670_100000020 Ga0070670_100000020150 263
121 3300005347 Ga0070668_100000108 Ga0070668_10000010842 263
122 3300005347 Ga0070668_100031879 Ga0070668_1000318793 263
123 3300005367 Ga0070667_100000163 Ga0070667_10000016347 263
124 3300005367 Ga0070667_100006909 Ga0070667_10000690910 263
125 3300005548 Ga0070665_100001115 Ga0070665_10000111518 263
126 3300005548 Ga0070665_100033530 Ga0070665_1000335302 263
127 3300005617 Ga0068859_100016961 Ga0068859_1000169612 263
128 3300005618 Ga0068864_100000071 Ga0068864_10000007122 263
129 3300005841 Ga0068863_100000451 Ga0068863_10000045130 263
130 3300005842 Ga0068858_100002275 Ga0068858_1000022757 263
131 3300005843 Ga0068860_100142638 Ga0068860_1001426381 263
132 3300005844 Ga0068862_100001526 Ga0068862_10000152619 263
133 3300005844 Ga0068862_100009403 Ga0068862_1000094034 263
134 3300006931 Ga0097620_100016961 Ga0097620_1000169612 263
135 3300007076 Ga0075435_100035744 Ga0075435_1000357444 263
136 3300009101 Ga0105247_10073339 Ga0105247_100733392 263
137 3300009177 Ga0105248_10083691 Ga0105248_100836912 263
138 3300009553 Ga0105249_10000792 Ga0105249_1000079211 263
139 3300013296 Ga0157374_10149095 Ga0157374_101490953 263
140 3300013306 Ga0163162_10035839 Ga0163162_100358395 263
141 3300014968 Ga0157379_10009298 Ga0157379_100092988 263
142 3300021361 Ga0213872_10000497 Ga0213872_1000049720 263
143 3300021361 Ga0213872_10002088 Ga0213872_100020888 263
144 3300021361 Ga0213872_10045115 Ga0213872_100451152 263
145 3300025292 Ga0209676_1004756 Ga0209676_10047562 263
146 3300025925 Ga0207650_10000175 Ga0207650_1000017546 263
147 3300025941 Ga0207711_10208102 Ga0207711_102081022 263
148 3300025961 Ga0207712_10000376 Ga0207712_1000037629 263
149 3300025972 Ga0207668_10000001 Ga0207668_10000001217 263
150 3300025972 Ga0207668_10000123 Ga0207668_1000012332 263
151 3300025986 Ga0207658_10000118 Ga0207658_1000011861 263
152 3300025986 Ga0207658_10009958 Ga0207658_100099584 263
153 3300026035 Ga0207703_10002470 Ga0207703_100024707 263
154 3300026088 Ga0207641_10001419 Ga0207641_1000141910 263
155 3300026095 Ga0207676_10001782 Ga0207676_1000178221 263
156 3300028379 Ga0268266_10001669 Ga0268266_1000166910 263
157 3300028379 Ga0268266_10236137 Ga0268266_102361371 263
158 3300028380 Ga0268265_10000901 Ga0268265_100009019 263
159 3300028380 Ga0268265_10007451 Ga0268265_100074512 263
160 3300028381 Ga0268264_10000481 Ga0268264_1000048113 263
161 3300028800 Ga0265338_10027204 Ga0265338_100272045 263
162 3300028800 Ga0265338_10109174 Ga0265338_101091742 263
163 3300031247 Ga0265340_10165645 Ga0265340_101656451 263
164 3300032004 Ga0307414_10083810 Ga0307414_100838102 263
165 3300032004 Ga0307414_10195618 Ga0307414_101956181 263
166 3300037312 Ga0395899_0000095 Ga0395899_0000095_83469_84317 263
167 3300037418 Ga0395900_0000006 Ga0395900_0000006_308953_309801 263
168 3300037466 Ga0395898_0006778 Ga0395898_0006778_5935_6783 263
169 3300037471 Ga0395905_0003726 Ga0395905_0003726_3071_3919 263
170 3300038443 Ga0395901_0000001 Ga0395901_0000001_352201_353049 263
171 3300039447 Ga0436361_1049174 Ga0436361_1049174_7099_7890 263
172 3300048918 Ga0496115_0089827 Ga0496115_0089827_92_937 263
173 3300048925 Ga0496122_0003891 Ga0496122_0003891_16277_17134 263
174 iso_pu_bacteria 2643221574 2643883767 263
175 iso_pu_bacteria 2643221583 2643926762 263
176 iso_pu_bacteria 2643221699 2644548193 263
177 3300001430 JGI24032J14994_101541 JGI24032J14994_1015411 264
178 3300001991 JGI24743J22301_10003350 JGI24743J22301_100033502 264
179 3300002077 JGI24744J21845_10027098 JGI24744J21845_100270982 264
180 3300003187 JGI25151J46595_10011269 JGI25151J46595_100112691 264
181 3300003203 JGI25406J46586_10004150 JGI25406J46586_100041503 264
182 3300003215 JGI25153J46596_10008999 JGI25153J46596_100089993 264
183 3300003773 Ga0055537_1000928 Ga0055537_100092811 264
184 3300003775 Ga0055524_1000173 Ga0055524_100017332 264
185 3300003784 Ga0055534_1000077 Ga0055534_100007721 264
186 3300003790 Ga0055528_1000085 Ga0055528_100008532 264
187 3300003911 JGI25405J52794_10009844 JGI25405J52794_100098442 264
188 3300005290 Ga0065712_10233304 Ga0065712_102333042 264
189 3300005295 Ga0065707_10273660 Ga0065707_102736601 264
190 3300005327 Ga0070658_10464784 Ga0070658_104647841 264
191 3300005328 Ga0070676_10044744 Ga0070676_100447444 264
192 3300005328 Ga0070676_10103735 Ga0070676_101037353 264
193 3300005329 Ga0070683_100116818 Ga0070683_1001168184 264
194 3300005329 Ga0070683_100835748 Ga0070683_1008357481 264
195 3300005330 Ga0070690_100075312 Ga0070690_1000753121 264
196 3300005335 Ga0070666_10034750 Ga0070666_100347501 264
197 3300005335 Ga0070666_10136634 Ga0070666_101366342 264
198 3300005336 Ga0070680_100017664 Ga0070680_1000176643 264
199 3300005336 Ga0070680_100033335 Ga0070680_1000333355 264
200 3300005336 Ga0070680_100129049 Ga0070680_1001290493 264
201 3300005336 Ga0070680_100197636 Ga0070680_1001976362 264
202 3300005336 Ga0070680_100349733 Ga0070680_1003497331 264
203 3300005337 Ga0070682_100034717 Ga0070682_1000347172 264
204 3300005337 Ga0070682_100112629 Ga0070682_1001126291 264
205 3300005338 Ga0068868_100103869 Ga0068868_1001038691 264
206 3300005339 Ga0070660_100087391 Ga0070660_1000873912 264
207 3300005341 Ga0070691_10083801 Ga0070691_100838012 264
208 3300005343 Ga0070687_100072886 Ga0070687_1000728862 264
209 3300005344 Ga0070661_100016573 Ga0070661_1000165731 264
210 3300005347 Ga0070668_100051963 Ga0070668_1000519634 264
211 3300005347 Ga0070668_100054717 Ga0070668_1000547173 264
212 3300005353 Ga0070669_100031028 Ga0070669_1000310282 264
213 3300005353 Ga0070669_100111133 Ga0070669_1001111332 264
214 3300005353 Ga0070669_100209041 Ga0070669_1002090412 264
215 3300005355 Ga0070671_100031462 Ga0070671_1000314621 264
216 3300005356 Ga0070674_100000199 Ga0070674_10000019917 264
217 3300005356 Ga0070674_100023567 Ga0070674_1000235673 264
218 3300005356 Ga0070674_100142244 Ga0070674_1001422442 264
219 3300005356 Ga0070674_100176460 Ga0070674_1001764602 264
220 3300005364 Ga0070673_100055154 Ga0070673_1000551543 264
221 3300005365 Ga0070688_100005892 Ga0070688_1000058923 264
222 3300005366 Ga0070659_100215214 Ga0070659_1002152141 264
223 3300005367 Ga0070667_100044689 Ga0070667_1000446893 264
224 3300005367 Ga0070667_100056374 Ga0070667_1000563743 264
225 3300005367 Ga0070667_100070477 Ga0070667_1000704774 264
226 3300005406 Ga0070703_10063983 Ga0070703_100639832 264
227 3300005434 Ga0070709_10003792 Ga0070709_100037926 264
228 3300005434 Ga0070709_10005111 Ga0070709_100051113 264
229 3300005434 Ga0070709_10133038 Ga0070709_101330381 264
230 3300005435 Ga0070714_100017499 Ga0070714_1000174996 264
231 3300005435 Ga0070714_100018468 Ga0070714_1000184683 264
232 3300005435 Ga0070714_100092841 Ga0070714_1000928414 264
233 3300005436 Ga0070713_100063437 Ga0070713_1000634373 264
234 3300005436 Ga0070713_100230005 Ga0070713_1002300052 264
235 3300005437 Ga0070710_10019445 Ga0070710_100194451 264
236 3300005437 Ga0070710_10034297 Ga0070710_100342972 264
237 3300005439 Ga0070711_100038107 Ga0070711_1000381074 264
238 3300005439 Ga0070711_100040957 Ga0070711_1000409573 264
239 3300005440 Ga0070705_100117902 Ga0070705_1001179022 264
240 3300005440 Ga0070705_100387523 Ga0070705_1003875231 264
241 3300005441 Ga0070700_100100255 Ga0070700_1001002553 264
242 3300005444 Ga0070694_100003602 Ga0070694_1000036022 264
243 3300005444 Ga0070694_100005990 Ga0070694_1000059906 264
244 3300005444 Ga0070694_100067704 Ga0070694_1000677042 264
245 3300005445 Ga0070708_100203175 Ga0070708_1002031753 264
246 3300005455 Ga0070663_100062360 Ga0070663_1000623603 264
247 3300005456 Ga0070678_100065070 Ga0070678_1000650702 264
248 3300005456 Ga0070678_100073852 Ga0070678_1000738522 264
249 3300005457 Ga0070662_100042085 Ga0070662_1000420853 264
250 3300005457 Ga0070662_100096919 Ga0070662_1000969192 264
251 3300005458 Ga0070681_10054464 Ga0070681_100544641 264
252 3300005458 Ga0070681_10094196 Ga0070681_100941961 264
253 3300005466 Ga0070685_10039446 Ga0070685_100394463 264
254 3300005468 Ga0070707_100010077 Ga0070707_1000100778 264
255 3300005468 Ga0070707_100313387 Ga0070707_1003133872 264
256 3300005471 Ga0070698_100025218 Ga0070698_1000252184 264
257 3300005518 Ga0070699_100037375 Ga0070699_1000373753 264
258 3300005530 Ga0070679_100003679 Ga0070679_1000036797 264
259 3300005530 Ga0070679_100028116 Ga0070679_1000281165 264
260 3300005530 Ga0070679_100083534 Ga0070679_1000835343 264
261 3300005535 Ga0070684_100135254 Ga0070684_1001352542 264
262 3300005535 Ga0070684_100390989 Ga0070684_1003909892 264
263 3300005539 Ga0068853_100196757 Ga0068853_1001967572 264
264 3300005543 Ga0070672_100026429 Ga0070672_1000264293 264
265 3300005543 Ga0070672_100374689 Ga0070672_1003746892 264
266 3300005544 Ga0070686_100010959 Ga0070686_1000109594 264
267 3300005545 Ga0070695_100033072 Ga0070695_1000330722 264
268 3300005545 Ga0070695_100059949 Ga0070695_1000599492 264
269 3300005546 Ga0070696_100030433 Ga0070696_1000304334 264
270 3300005546 Ga0070696_100059096 Ga0070696_1000590963 264
271 3300005548 Ga0070665_100477460 Ga0070665_1004774602 264
272 3300005548 Ga0070665_100558640 Ga0070665_1005586402 264
273 3300005549 Ga0070704_100066620 Ga0070704_1000666203 264
274 3300005549 Ga0070704_100126390 Ga0070704_1001263903 264
275 3300005549 Ga0070704_100337942 Ga0070704_1003379422 264
276 3300005563 Ga0068855_100121272 Ga0068855_1001212722 264
277 3300005563 Ga0068855_100284816 Ga0068855_1002848162 264
278 3300005563 Ga0068855_100398885 Ga0068855_1003988852 264
279 3300005577 Ga0068857_100219650 Ga0068857_1002196502 264
280 3300005614 Ga0068856_100120790 Ga0068856_1001207902 264
281 3300005615 Ga0070702_100070029 Ga0070702_1000700292 264
282 3300005616 Ga0068852_100320780 Ga0068852_1003207802 264
283 3300005617 Ga0068859_100157584 Ga0068859_1001575843 264
284 3300005617 Ga0068859_100194668 Ga0068859_1001946683 264
285 3300005618 Ga0068864_100017888 Ga0068864_1000178884 264
286 3300005618 Ga0068864_100190574 Ga0068864_1001905742 264
287 3300005618 Ga0068864_100403288 Ga0068864_1004032882 264
288 3300005718 Ga0068866_10074376 Ga0068866_100743762 264
289 3300005718 Ga0068866_10128258 Ga0068866_101282582 264
290 3300005840 Ga0068870_10220435 Ga0068870_102204352 264
291 3300005841 Ga0068863_100217489 Ga0068863_1002174892 264
292 3300005841 Ga0068863_100790968 Ga0068863_1007909681 264
293 3300005842 Ga0068858_100033224 Ga0068858_1000332242 264
294 3300005842 Ga0068858_100245385 Ga0068858_1002453851 264
295 3300005843 Ga0068860_100208863 Ga0068860_1002088633 264
296 3300005844 Ga0068862_100162210 Ga0068862_1001622101 264
297 3300005937 Ga0081455_10011386 Ga0081455_100113863 264
298 3300005937 Ga0081455_10108197 Ga0081455_101081972 264
299 3300005937 Ga0081455_10183322 Ga0081455_101833221 264
300 3300005981 Ga0081538_10040288 Ga0081538_100402883 264
301 3300005983 Ga0081540_1000869 Ga0081540_100086921 264
302 3300005983 Ga0081540_1000925 Ga0081540_100092517 264
303 3300005983 Ga0081540_1020032 Ga0081540_10200324 264
304 3300005983 Ga0081540_1024207 Ga0081540_10242074 264
305 3300005983 Ga0081540_1137282 Ga0081540_11372822 264
306 3300005985 Ga0081539_10007161 Ga0081539_100071617 264
307 3300006028 Ga0070717_10000377 Ga0070717_1000037715 264
308 3300006038 Ga0075365_10018424 Ga0075365_100184243 264
309 3300006038 Ga0075365_10028585 Ga0075365_100285852 264
310 3300006048 Ga0075363_100034239 Ga0075363_1000342393 264
311 3300006048 Ga0075363_100045718 Ga0075363_1000457182 264
312 3300006051 Ga0075364_10024862 Ga0075364_100248623 264
313 3300006051 Ga0075364_10341842 Ga0075364_103418421 264
314 3300006163 Ga0070715_10026458 Ga0070715_100264582 264
315 3300006163 Ga0070715_10057430 Ga0070715_100574302 264
316 3300006173 Ga0070716_100002527 Ga0070716_1000025272 264
317 3300006173 Ga0070716_100094885 Ga0070716_1000948852 264
318 3300006175 Ga0070712_100082962 Ga0070712_1000829622 264
319 3300006177 Ga0075362_10017105 Ga0075362_100171054 264
320 3300006186 Ga0075369_10001871 Ga0075369_100018711 264
321 3300006237 Ga0097621_100033091 Ga0097621_1000330913 264
322 3300006237 Ga0097621_100078746 Ga0097621_1000787462 264
323 3300006237 Ga0097621_100222433 Ga0097621_1002224332 264
324 3300006237 Ga0097621_100295236 Ga0097621_1002952362 264
325 3300006358 Ga0068871_100035625 Ga0068871_1000356254 264
326 3300006358 Ga0068871_100163007 Ga0068871_1001630072 264
327 3300006358 Ga0068871_100485698 Ga0068871_1004856982 264
328 3300006358 Ga0068871_100526784 Ga0068871_1005267842 264
329 3300006844 Ga0075428_100077850 Ga0075428_1000778504 264
330 3300006844 Ga0075428_100088833 Ga0075428_1000888333 264
331 3300006846 Ga0075430_100000617 Ga0075430_10000061714 264
332 3300006846 Ga0075430_100003539 Ga0075430_1000035393 264
333 3300006846 Ga0075430_100025309 Ga0075430_1000253094 264
334 3300006847 Ga0075431_100021855 Ga0075431_1000218555 264
335 3300006847 Ga0075431_100296804 Ga0075431_1002968042 264
336 3300006847 Ga0075431_100618393 Ga0075431_1006183932 264
337 3300006847 Ga0075431_100663013 Ga0075431_1006630131 264
338 3300006852 Ga0075433_10125584 Ga0075433_101255842 264
339 3300006852 Ga0075433_10181745 Ga0075433_101817453 264
340 3300006871 Ga0075434_100006453 Ga0075434_1000064534 264
341 3300006871 Ga0075434_100055718 Ga0075434_1000557184 264
342 3300006871 Ga0075434_100689859 Ga0075434_1006898592 264
343 3300006880 Ga0075429_100000019 Ga0075429_10000001958 264
344 3300006881 Ga0068865_100018172 Ga0068865_1000181725 264
345 3300006881 Ga0068865_100074017 Ga0068865_1000740172 264
346 3300006881 Ga0068865_100142583 Ga0068865_1001425833 264
347 3300006914 Ga0075436_100026004 Ga0075436_1000260045 264
348 3300006931 Ga0097620_100157582 Ga0097620_1001575823 264
349 3300006931 Ga0097620_100194667 Ga0097620_1001946673 264
350 3300007076 Ga0075435_100034059 Ga0075435_1000340595 264
351 3300009093 Ga0105240_10067540 Ga0105240_100675404 264
352 3300009093 Ga0105240_10579805 Ga0105240_105798051 264
353 3300009093 Ga0105240_10599855 Ga0105240_105998552 264
354 3300009094 Ga0111539_10035620 Ga0111539_100356203 264
355 3300009094 Ga0111539_10220872 Ga0111539_102208722 264
356 3300009094 Ga0111539_10443705 Ga0111539_104437052 264
357 3300009094 Ga0111539_10516128 Ga0111539_105161281 264
358 3300009094 Ga0111539_10710599 Ga0111539_107105992 264
359 3300009098 Ga0105245_10016102 Ga0105245_100161025 264
360 3300009098 Ga0105245_10081242 Ga0105245_100812422 264
361 3300009101 Ga0105247_10132744 Ga0105247_101327441 264
362 3300009147 Ga0114129_10040477 Ga0114129_100404777 264
363 3300009147 Ga0114129_10092045 Ga0114129_100920456 264
364 3300009147 Ga0114129_10245526 Ga0114129_102455263 264
365 3300009148 Ga0105243_10642671 Ga0105243_106426712 264
366 3300009148 Ga0105243_10674974 Ga0105243_106749741 264
367 3300009174 Ga0105241_10083262 Ga0105241_100832623 264
368 3300009174 Ga0105241_10202785 Ga0105241_102027852 264
369 3300009176 Ga0105242_10007510 Ga0105242_100075108 264
370 3300009176 Ga0105242_10222522 Ga0105242_102225222 264
371 3300009176 Ga0105242_10416572 Ga0105242_104165722 264
372 3300009176 Ga0105242_10872090 Ga0105242_108720901 264
373 3300009177 Ga0105248_10005446 Ga0105248_100054464 264
374 3300009177 Ga0105248_10020734 Ga0105248_100207346 264
375 3300009177 Ga0105248_10046795 Ga0105248_100467952 264
376 3300009545 Ga0105237_10166457 Ga0105237_101664571 264
377 3300009545 Ga0105237_10643771 Ga0105237_106437711 264
378 3300009551 Ga0105238_10011476 Ga0105238_100114765 264
379 3300009551 Ga0105238_10100191 Ga0105238_101001913 264
380 3300009551 Ga0105238_10184774 Ga0105238_101847742 264
381 3300009551 Ga0105238_10695149 Ga0105238_106951491 264
382 3300009553 Ga0105249_10135218 Ga0105249_101352182 264
383 3300009553 Ga0105249_10137200 Ga0105249_101372001 264
384 3300009979 Ga0105032_100258 Ga0105032_1002587 264
385 3300010375 Ga0105239_10075495 Ga0105239_100754952 264
386 3300011119 Ga0105246_10064378 Ga0105246_100643783 264
387 3300011119 Ga0105246_10421822 Ga0105246_104218222 264
388 3300013102 Ga0157371_10014815 Ga0157371_100148158 264
389 3300013104 Ga0157370_10147531 Ga0157370_101475312 264
390 3300013297 Ga0157378_10095979 Ga0157378_100959793 264
391 3300013297 Ga0157378_10172376 Ga0157378_101723762 264
392 3300013297 Ga0157378_10334615 Ga0157378_103346153 264
393 3300013297 Ga0157378_10455304 Ga0157378_104553042 264
394 3300013307 Ga0157372_10264568 Ga0157372_102645683 264
395 3300013307 Ga0157372_10656342 Ga0157372_106563422 264
396 3300013307 Ga0157372_10830136 Ga0157372_108301361 264
397 3300013308 Ga0157375_10104866 Ga0157375_101048662 264
398 3300014745 Ga0157377_10350609 Ga0157377_103506092 264
399 3300014969 Ga0157376_10051396 Ga0157376_100513963 264
400 3300017792 Ga0163161_10167318 Ga0163161_101673181 264
401 3300021361 Ga0213872_10014355 Ga0213872_100143553 264
402 3300021384 Ga0213876_10015170 Ga0213876_100151703 264
403 3300021384 Ga0213876_10060688 Ga0213876_100606882 264
404 3300025263 Ga0209565_1000001 Ga0209565_10000011030 264
405 3300025273 Ga0209673_1000001 Ga0209673_10000011030 264
406 3300025291 Ga0209675_1000001 Ga0209675_10000011504 264
407 3300025292 Ga0209676_1000436 Ga0209676_100043684 264
408 3300025295 Ga0209564_1000001 Ga0209564_10000011666 264
409 3300025297 Ga0209758_1000139 Ga0209758_10001399 264
410 3300025299 Ga0209256_1000006 Ga0209256_1000006102 264
411 3300025885 Ga0207653_10051551 Ga0207653_100515512 264
412 3300025893 Ga0207682_10000171 Ga0207682_1000017126 264
413 3300025898 Ga0207692_10026289 Ga0207692_100262892 264
414 3300025898 Ga0207692_10125308 Ga0207692_101253081 264
415 3300025901 Ga0207688_10079370 Ga0207688_100793703 264
416 3300025901 Ga0207688_10128291 Ga0207688_101282911 264
417 3300025903 Ga0207680_10189154 Ga0207680_101891541 264
418 3300025905 Ga0207685_10015243 Ga0207685_100152433 264
419 3300025906 Ga0207699_10000553 Ga0207699_1000055311 264
420 3300025906 Ga0207699_10020681 Ga0207699_100206813 264
421 3300025906 Ga0207699_10052584 Ga0207699_100525843 264
422 3300025906 Ga0207699_10143305 Ga0207699_101433051 264
423 3300025909 Ga0207705_10011301 Ga0207705_100113017 264
424 3300025909 Ga0207705_10452832 Ga0207705_104528322 264
425 3300025910 Ga0207684_10028554 Ga0207684_100285546 264
426 3300025911 Ga0207654_10060252 Ga0207654_100602521 264
427 3300025911 Ga0207654_10153188 Ga0207654_101531882 264
428 3300025911 Ga0207654_10229968 Ga0207654_102299682 264
429 3300025912 Ga0207707_10015959 Ga0207707_100159598 264
430 3300025912 Ga0207707_10141471 Ga0207707_101414711 264
431 3300025913 Ga0207695_10110311 Ga0207695_101103111 264
432 3300025913 Ga0207695_10159371 Ga0207695_101593711 264
433 3300025913 Ga0207695_10287790 Ga0207695_102877903 264
434 3300025914 Ga0207671_10113007 Ga0207671_101130072 264
435 3300025915 Ga0207693_10035526 Ga0207693_100355264 264
436 3300025915 Ga0207693_10069351 Ga0207693_100693514 264
437 3300025915 Ga0207693_10316041 Ga0207693_103160412 264
438 3300025916 Ga0207663_10028986 Ga0207663_100289863 264
439 3300025917 Ga0207660_10014525 Ga0207660_100145253 264
440 3300025917 Ga0207660_10096567 Ga0207660_100965673 264
441 3300025917 Ga0207660_10113101 Ga0207660_101131012 264
442 3300025917 Ga0207660_10123551 Ga0207660_101235513 264
443 3300025917 Ga0207660_10183505 Ga0207660_101835052 264
444 3300025918 Ga0207662_10033608 Ga0207662_100336083 264
445 3300025918 Ga0207662_10051144 Ga0207662_100511441 264
446 3300025919 Ga0207657_10035581 Ga0207657_100355813 264
447 3300025919 Ga0207657_10053807 Ga0207657_100538071 264
448 3300025921 Ga0207652_10018220 Ga0207652_100182206 264
449 3300025921 Ga0207652_10024455 Ga0207652_100244553 264
450 3300025921 Ga0207652_10036093 Ga0207652_100360934 264
451 3300025921 Ga0207652_10067062 Ga0207652_100670623 264
452 3300025922 Ga0207646_10069984 Ga0207646_100699844 264
453 3300025923 Ga0207681_10018147 Ga0207681_100181473 264
454 3300025923 Ga0207681_10337569 Ga0207681_103375692 264
455 3300025924 Ga0207694_10039122 Ga0207694_100391223 264
456 3300025924 Ga0207694_10069298 Ga0207694_100692983 264
457 3300025924 Ga0207694_10387872 Ga0207694_103878722 264
458 3300025924 Ga0207694_10494041 Ga0207694_104940411 264
459 3300025925 Ga0207650_10065717 Ga0207650_100657173 264
460 3300025927 Ga0207687_10060600 Ga0207687_100606002 264
461 3300025927 Ga0207687_10308475 Ga0207687_103084752 264
462 3300025928 Ga0207700_10000974 Ga0207700_1000097413 264
463 3300025928 Ga0207700_10027171 Ga0207700_100271713 264
464 3300025928 Ga0207700_10056100 Ga0207700_100561002 264
465 3300025928 Ga0207700_10082062 Ga0207700_100820622 264
466 3300025928 Ga0207700_10147162 Ga0207700_101471622 264
467 3300025929 Ga0207664_10025181 Ga0207664_100251814 264
468 3300025929 Ga0207664_10069459 Ga0207664_100694593 264
469 3300025929 Ga0207664_10069929 Ga0207664_100699293 264
470 3300025931 Ga0207644_10004087 Ga0207644_100040877 264
471 3300025931 Ga0207644_10007589 Ga0207644_100075898 264
472 3300025933 Ga0207706_10009732 Ga0207706_100097325 264
473 3300025933 Ga0207706_10071563 Ga0207706_100715632 264
474 3300025934 Ga0207686_10038270 Ga0207686_100382702 264
475 3300025934 Ga0207686_10051864 Ga0207686_100518642 264
476 3300025934 Ga0207686_10087052 Ga0207686_100870521 264
477 3300025936 Ga0207670_10024728 Ga0207670_100247284 264
478 3300025936 Ga0207670_10455386 Ga0207670_104553861 264
479 3300025938 Ga0207704_10044627 Ga0207704_100446274 264
480 3300025938 Ga0207704_10167045 Ga0207704_101670452 264
481 3300025938 Ga0207704_10324622 Ga0207704_103246222 264
482 3300025939 Ga0207665_10008397 Ga0207665_100083977 264
483 3300025939 Ga0207665_10084392 Ga0207665_100843924 264
484 3300025939 Ga0207665_10099668 Ga0207665_100996682 264
485 3300025939 Ga0207665_10116867 Ga0207665_101168671 264
486 3300025939 Ga0207665_10258911 Ga0207665_102589112 264
487 3300025940 Ga0207691_10004900 Ga0207691_100049005 264
488 3300025940 Ga0207691_10378582 Ga0207691_103785821 264
489 3300025942 Ga0207689_10057574 Ga0207689_100575742 264
490 3300025942 Ga0207689_10230424 Ga0207689_102304241 264
491 3300025942 Ga0207689_10252882 Ga0207689_102528822 264
492 3300025944 Ga0207661_10038326 Ga0207661_100383262 264
493 3300025949 Ga0207667_10050320 Ga0207667_100503203 264
494 3300025949 Ga0207667_10149652 Ga0207667_101496521 264
495 3300025960 Ga0207651_10067000 Ga0207651_100670002 264
496 3300025961 Ga0207712_10065685 Ga0207712_100656852 264
497 3300025961 Ga0207712_10262516 Ga0207712_102625162 264
498 3300025961 Ga0207712_10278504 Ga0207712_102785041 264
499 3300025972 Ga0207668_10003923 Ga0207668_100039238 264
500 3300025986 Ga0207658_10649969 Ga0207658_106499691 264
501 3300025986 Ga0207658_10722571 Ga0207658_107225711 264
502 3300026023 Ga0207677_10043892 Ga0207677_100438921 264
503 3300026035 Ga0207703_10129636 Ga0207703_101296363 264
504 3300026041 Ga0207639_10295327 Ga0207639_102953272 264
505 3300026067 Ga0207678_10021192 Ga0207678_100211926 264
506 3300026067 Ga0207678_10021441 Ga0207678_100214416 264
507 3300026067 Ga0207678_10083115 Ga0207678_100831152 264
508 3300026075 Ga0207708_10060407 Ga0207708_100604074 264
509 3300026075 Ga0207708_10167170 Ga0207708_101671701 264
510 3300026088 Ga0207641_10018297 Ga0207641_100182972 264
511 3300026089 Ga0207648_10388456 Ga0207648_103884562 264
512 3300026095 Ga0207676_10182782 Ga0207676_101827822 264
513 3300026116 Ga0207674_10188718 Ga0207674_101887182 264
514 3300026118 Ga0207675_100331768 Ga0207675_1003317682 264
515 3300026121 Ga0207683_10000902 Ga0207683_1000090210 264
516 3300026121 Ga0207683_10050440 Ga0207683_100504402 264
517 3300026121 Ga0207683_10092348 Ga0207683_100923482 264
518 3300027360 Ga0209969_1004755 Ga0209969_10047552 264
519 3300027395 Ga0209996_1008531 Ga0209996_10085312 264
520 3300027695 Ga0209966_1018921 Ga0209966_10189212 264
521 3300027907 Ga0207428_10064223 Ga0207428_100642234 264
522 3300027907 Ga0207428_10406540 Ga0207428_104065402 264
523 3300028379 Ga0268266_10022103 Ga0268266_100221031 264
524 3300028379 Ga0268266_10252841 Ga0268266_102528412 264
525 3300028380 Ga0268265_10261546 Ga0268265_102615462 264
526 3300028556 Ga0265337_1003784 Ga0265337_10037846 264
527 3300028563 Ga0265319_1015151 Ga0265319_10151513 264
528 3300028573 Ga0265334_10000143 Ga0265334_1000014335 264
529 3300028573 Ga0265334_10007008 Ga0265334_100070082 264
530 3300028573 Ga0265334_10009472 Ga0265334_100094725 264
531 3300028577 Ga0265318_10003937 Ga0265318_100039374 264
532 3300028577 Ga0265318_10017959 Ga0265318_100179592 264
533 3300028800 Ga0265338_10000043 Ga0265338_10000043164 264
534 3300028800 Ga0265338_10012357 Ga0265338_100123578 264
535 3300028800 Ga0265338_10022519 Ga0265338_100225198 264
536 3300028800 Ga0265338_10076391 Ga0265338_100763913 264
537 3300029957 Ga0265324_10041806 Ga0265324_100418062 264
538 3300031235 Ga0265330_10005644 Ga0265330_100056443 264
539 3300031235 Ga0265330_10083821 Ga0265330_100838212 264
540 3300031238 Ga0265332_10004974 Ga0265332_100049745 264
541 3300031238 Ga0265332_10030001 Ga0265332_100300012 264
542 3300031239 Ga0265328_10008731 Ga0265328_100087314 264
543 3300031239 Ga0265328_10009813 Ga0265328_100098132 264
544 3300031240 Ga0265320_10004052 Ga0265320_100040529 264
545 3300031241 Ga0265325_10000002 Ga0265325_10000002222 264
546 3300031241 Ga0265325_10000036 Ga0265325_1000003673 264
547 3300031241 Ga0265325_10000464 Ga0265325_1000046413 264
548 3300031241 Ga0265325_10012515 Ga0265325_100125154 264
549 3300031242 Ga0265329_10006598 Ga0265329_100065982 264
550 3300031247 Ga0265340_10000952 Ga0265340_1000095210 264
551 3300031247 Ga0265340_10007138 Ga0265340_100071384 264
552 3300031247 Ga0265340_10017926 Ga0265340_100179264 264
553 3300031247 Ga0265340_10032994 Ga0265340_100329941 264
554 3300031249 Ga0265339_10000625 Ga0265339_100006254 264
555 3300031249 Ga0265339_10001612 Ga0265339_100016122 264
556 3300031249 Ga0265339_10009163 Ga0265339_100091637 264
557 3300031250 Ga0265331_10001902 Ga0265331_1000190211 264
558 3300031250 Ga0265331_10030827 Ga0265331_100308272 264
559 3300031250 Ga0265331_10091730 Ga0265331_100917302 264
560 3300031344 Ga0265316_10006610 Ga0265316_100066105 264
561 3300031344 Ga0265316_10008327 Ga0265316_100083273 264
562 3300031344 Ga0265316_10205196 Ga0265316_102051963 264
563 3300031456 Ga0307513_10046517 Ga0307513_100465177 264
564 3300031595 Ga0265313_10000513 Ga0265313_1000051322 264
565 3300031595 Ga0265313_10001147 Ga0265313_1000114714 264
566 3300031595 Ga0265313_10001243 Ga0265313_100012434 264
567 3300031595 Ga0265313_10001570 Ga0265313_100015707 264
568 3300031595 Ga0265313_10011866 Ga0265313_100118663 264
569 3300031595 Ga0265313_10015324 Ga0265313_100153242 264
570 3300031595 Ga0265313_10077748 Ga0265313_100777482 264
571 3300031595 Ga0265313_10129214 Ga0265313_101292142 264
572 3300031691 Ga0316579_10022141 Ga0316579_100221413 264
573 3300031711 Ga0265314_10005001 Ga0265314_100050018 264
574 3300031712 Ga0265342_10000715 Ga0265342_1000071536 264
575 3300031712 Ga0265342_10007638 Ga0265342_100076384 264
576 3300031712 Ga0265342_10010075 Ga0265342_100100753 264
577 3300031712 Ga0265342_10090585 Ga0265342_100905851 264
578 3300031852 Ga0307410_10178059 Ga0307410_101780592 264
579 3300031901 Ga0307406_10083660 Ga0307406_100836602 264
580 3300031995 Ga0307409_100481546 Ga0307409_1004815462 264
581 3300034957 Ga0373938_0000453 Ga0373938_0000453_3641_4435 264
582 3300035083 Ga0373926_0095560 Ga0373926_0095560_27_839 264
583 3300035084 Ga0373928_0054743 Ga0373928_0054743_133_927 264
584 3300035088 Ga0373940_0009414 Ga0373940_0009414_46_840 264
585 3300035089 Ga0373944_0066480 Ga0373944_0066480_176_970 264
586 3300035090 Ga0373949_0023914 Ga0373949_0023914_215_1009 264
587 3300035111 Ga0373923_0031497 Ga0373923_0031497_269_1063 264
588 3300035113 Ga0373936_0048609 Ga0373936_0048609_96_890 264
589 3300035113 Ga0373936_0122426 Ga0373936_0122426_236_1030 264
590 3300035114 Ga0373939_0019310 Ga0373939_0019310_577_1371 264
591 3300035114 Ga0373939_0053327 Ga0373939_0053327_370_1164 264
592 3300035115 Ga0373941_0049605 Ga0373941_0049605_304_1098 264
593 3300035116 Ga0373945_0003237 Ga0373945_0003237_3131_3925 264
594 3300035116 Ga0373945_0029563 Ga0373945_0029563_597_1391 264
595 3300035116 Ga0373945_0041680 Ga0373945_0041680_179_973 264
596 3300035117 Ga0373953_0003538 Ga0373953_0003538_1958_2764 264
597 3300035117 Ga0373953_0004967 Ga0373953_0004967_3212_4006 264
598 3300035117 Ga0373953_0034560 Ga0373953_0034560_1080_1874 264
599 3300035117 Ga0373953_0103293 Ga0373953_0103293_271_1065 264
600 3300035118 Ga0373954_0000020 Ga0373954_0000020_19109_19921 264
601 3300035118 Ga0373954_0005850 Ga0373954_0005850_3934_4728 264
602 3300035118 Ga0373954_0010400 Ga0373954_0010400_253_1047 264
603 3300035118 Ga0373954_0049628 Ga0373954_0049628_871_1677 264
604 3300035119 Ga0373956_0009309 Ga0373956_0009309_1082_1876 264
605 3300035119 Ga0373956_0018550 Ga0373956_0018550_336_1130 264
606 3300035119 Ga0373956_0030175 Ga0373956_0030175_224_1030 264
607 3300035119 Ga0373956_0079868 Ga0373956_0079868_384_1178 264
608 3300035119 Ga0373956_0106861 Ga0373956_0106861_84_878 264
609 3300035120 Ga0373957_0014040 Ga0373957_0014040_714_1508 264
610 3300035120 Ga0373957_0020115 Ga0373957_0020115_615_1409 264
611 3300035120 Ga0373957_0076370 Ga0373957_0076370_341_1135 264
612 3300035170 Ga0373943_0001299 Ga0373943_0001299_5726_6520 264
613 3300035170 Ga0373943_0083922 Ga0373943_0083922_582_1376 264
614 3300035171 Ga0373946_0001129 Ga0373946_0001129_3090_3884 264
615 3300035172 Ga0373955_0001159 Ga0373955_0001159_2975_3769 264
616 3300035172 Ga0373955_0002257 Ga0373955_0002257_1833_2627 264
617 3300035172 Ga0373955_0016631 Ga0373955_0016631_1864_2658 264
618 3300035172 Ga0373955_0016708 Ga0373955_0016708_1780_2586 264
619 3300035242 Ga0373962_0002352 Ga0373962_0002352_3382_4176 264
620 3300035242 Ga0373962_0042640 Ga0373962_0042640_312_1106 264
621 3300035398 Ga0316574_0118410 Ga0316574_0118410_553_1347 264
622 3300035410 Ga0373924_0000412 Ga0373924_0000412_10160_10954 264
623 3300035410 Ga0373924_0149782 Ga0373924_0149782_144_938 264
624 3300035410 Ga0373924_0185718 Ga0373924_0185718_23_817 264
625 3300035691 Ga0373931_0017584 Ga0373931_0017584_1367_2161 264
626 3300035691 Ga0373931_0112714 Ga0373931_0112714_624_1418 264
627 3300035692 Ga0373935_0000100 Ga0373935_0000100_1397_2191 264
628 3300035692 Ga0373935_0003876 Ga0373935_0003876_7212_8006 264
629 3300035692 Ga0373935_0012884 Ga0373935_0012884_3576_4388 264
630 3300035692 Ga0373935_0018083 Ga0373935_0018083_3031_3825 264
631 3300035695 Ga0373927_0027983 Ga0373927_0027983_1073_1867 264
632 3300035695 Ga0373927_0028096 Ga0373927_0028096_2651_3445 264
633 3300035695 Ga0373927_0037835 Ga0373927_0037835_1532_2344 264
634 3300035695 Ga0373927_0168007 Ga0373927_0168007_160_954 264
635 3300035695 Ga0373927_0170787 Ga0373927_0170787_572_1366 264
636 3300035724 Ga0373933_0004387 Ga0373933_0004387_3930_4742 264
637 3300035724 Ga0373933_0004411 Ga0373933_0004411_4606_5400 264
638 3300035724 Ga0373933_0005938 Ga0373933_0005938_4481_5275 264
639 3300035724 Ga0373933_0020540 Ga0373933_0020540_1168_1962 264
640 3300035724 Ga0373933_0021741 Ga0373933_0021741_1940_2746 264
641 3300035724 Ga0373933_0116327 Ga0373933_0116327_392_1186 264
642 3300035724 Ga0373933_0437972 Ga0373933_0437972_10_804 264
643 3300035725 Ga0373947_0002174 Ga0373947_0002174_9647_10441 264
644 3300035725 Ga0373947_0026727 Ga0373947_0026727_2157_2951 264
645 3300035725 Ga0373947_0059346 Ga0373947_0059346_1489_2283 264
646 3300035725 Ga0373947_0062153 Ga0373947_0062153_640_1434 264
647 3300036401 Ga0373937_0000028 Ga0373937_0000028_113577_114371 264
648 3300036401 Ga0373937_0000179 Ga0373937_0000179_26971_27783 264
649 3300036401 Ga0373937_0002145 Ga0373937_0002145_2292_3086 264
650 3300036401 Ga0373937_0006979 Ga0373937_0006979_4867_5661 264
651 3300036401 Ga0373937_0023517 Ga0373937_0023517_1926_2732 264
652 3300036401 Ga0373937_0030415 Ga0373937_0030415_3876_4670 264
653 3300036401 Ga0373937_0104503 Ga0373937_0104503_648_1442 264
654 3300036401 Ga0373937_0115720 Ga0373937_0115720_1587_2381 264
655 3300036401 Ga0373937_0290809 Ga0373937_0290809_725_1519 264
656 3300036647 Ga0316582_0003714 Ga0316582_0003714_6140_6934 264
657 3300037068 Ga0373925_0000034 Ga0373925_0000034_82502_83296 264
658 3300037068 Ga0373925_0012776 Ga0373925_0012776_5139_5933 264
659 3300037068 Ga0373925_0045366 Ga0373925_0045366_437_1231 264
660 3300037068 Ga0373925_0094430 Ga0373925_0094430_1379_2191 264
661 3300037068 Ga0373925_0337837 Ga0373925_0337837_284_1078 264
662 3300037312 Ga0395899_0110496 Ga0395899_0110496_391_1185 264
663 3300037418 Ga0395900_0076901 Ga0395900_0076901_1282_2076 264
664 3300037418 Ga0395900_0123668 Ga0395900_0123668_391_1185 264
665 3300037466 Ga0395898_0125850 Ga0395898_0125850_504_1298 264
666 3300037471 Ga0395905_0358913 Ga0395905_0358913_495_1289 264
667 3300038443 Ga0395901_0012651 Ga0395901_0012651_4314_5108 264
668 3300038443 Ga0395901_0213403 Ga0395901_0213403_857_1651 264
669 3300039093 Ga0400489_69310 Ga0400489_69310_246_1040 264
670 3300039110 Ga0400487_24057 Ga0400487_24057_3998_4792 264
671 3300039110 Ga0400487_45503 Ga0400487_45503_2229_3023 264
672 3300039437 Ga0436365_1244993 Ga0436365_1244993_5163_5957 264
673 3300039438 Ga0436360_0848133 Ga0436360_0848133_82_876 264
674 3300039447 Ga0436361_0313975 Ga0436361_0313975_66_860 264
675 3300039447 Ga0436361_0553129 Ga0436361_0553129_2741_3535 264
676 3300039450 Ga0436363_0447376 Ga0436363_0447376_1186_1980 264
677 3300039453 Ga0436362_0078503 Ga0436362_0078503_124_918 264
678 3300039453 Ga0436362_0273120 Ga0436362_0273120_901_1695 264
679 3300039453 Ga0436362_0663757 Ga0436362_0663757_305_1099 264
680 3300041408 Ga0439453_0000183 Ga0439453_0000183_721_1515 264
681 3300041512 Ga0451853_0783681 Ga0451853_0783681_108_902 264
682 3300041997 Ga0439431_0024899 Ga0439431_0024899_38_832 264
683 3300042001 Ga0439441_014256 Ga0439441_014256_121_915 264
684 3300042003 Ga0439443_000502 Ga0439443_000502_731_1540 264
685 3300042156 Ga0439446_0094539 Ga0439446_0094539_28_822 264
686 3300042436 Ga0439435_0000213 Ga0439435_0000213_4438_5247 264
687 3300042439 Ga0439464_0046068 Ga0439464_0046068_268_1062 264
688 3300042461 Ga0439460_0000061 Ga0439460_0000061_13540_14349 264
689 3300044693 Ga0466961_0326459 Ga0466961_0326459_55_849 264
690 3300044694 Ga0466963_0239373 Ga0466963_0239373_314_1108 264
691 3300044719 Ga0466971_0194603 Ga0466971_0194603_121_915 264
692 3300044842 Ga0466957_0025478 Ga0466957_0025478_425_1219 264
693 3300044842 Ga0466957_0050775 Ga0466957_0050775_1534_2328 264
694 3300045049 Ga0466959_0029082 Ga0466959_0029082_3142_3936 264
695 3300045049 Ga0466959_0044534 Ga0466959_0044534_704_1498 264
696 3300045051 Ga0451576_0088468 Ga0451576_0088468_1960_2754 264
697 3300045051 Ga0451576_0106334 Ga0451576_0106334_1404_2216 264
698 3300045836 Ga0466958_0136957 Ga0466958_0136957_240_1034 264
699 3300046454 Ga0495592_0000031 Ga0495592_0000031_14787_15581 264
700 3300046454 Ga0495592_0007672 Ga0495592_0007672_1607_2410 264
701 3300046454 Ga0495592_0041995 Ga0495592_0041995_721_1515 264
702 3300046454 Ga0495592_0052265 Ga0495592_0052265_2155_2949 264
703 3300046454 Ga0495592_0056631 Ga0495592_0056631_1921_2715 264
704 3300046455 Ga0495603_0016117 Ga0495603_0016117_3328_4122 264
705 3300046459 Ga0495629_0001240 Ga0495629_0001240_14213_15007 264
706 3300046459 Ga0495629_0019959 Ga0495629_0019959_2026_2820 264
707 3300046459 Ga0495629_0253437 Ga0495629_0253437_382_1176 264
708 3300046461 Ga0495641_0021394 Ga0495641_0021394_1260_2054 264
709 3300046462 Ga0495651_0001979 Ga0495651_0001979_7666_8460 264
710 3300046462 Ga0495651_0004229 Ga0495651_0004229_1736_2530 264
711 3300046462 Ga0495651_0006317 Ga0495651_0006317_3980_4774 264
712 3300046462 Ga0495651_0114725 Ga0495651_0114725_942_1736 264
713 3300046462 Ga0495651_0132270 Ga0495651_0132270_758_1552 264
714 3300046462 Ga0495651_0186838 Ga0495651_0186838_50_844 264
715 3300046463 Ga0495653_0000012 Ga0495653_0000012_23411_24205 264
716 3300046463 Ga0495653_0010825 Ga0495653_0010825_1901_2695 264
717 3300046463 Ga0495653_0309723 Ga0495653_0309723_81_875 264
718 3300046473 Ga0495582_0003108 Ga0495582_0003108_3655_4449 264
719 3300046474 Ga0495605_0026401 Ga0495605_0026401_746_1540 264
720 3300046475 Ga0495639_0013265 Ga0495639_0013265_2723_3517 264
721 3300046475 Ga0495639_0064018 Ga0495639_0064018_185_979 264
722 3300046476 Ga0495662_0006996 Ga0495662_0006996_4154_4948 264
723 3300046476 Ga0495662_0008758 Ga0495662_0008758_3805_4611 264
724 3300046476 Ga0495662_0009212 Ga0495662_0009212_823_1626 264
725 3300046476 Ga0495662_0015753 Ga0495662_0015753_955_1749 264
726 3300046477 Ga0495664_0000004 Ga0495664_0000004_358112_358906 264
727 3300046477 Ga0495664_0028098 Ga0495664_0028098_846_1640 264
728 3300046491 Ga0495584_0010598 Ga0495584_0010598_3399_4193 264
729 3300046491 Ga0495584_0173548 Ga0495584_0173548_261_1055 264
730 3300046499 Ga0495594_0010943 Ga0495594_0010943_1129_1923 264
731 3300046499 Ga0495594_0230064 Ga0495594_0230064_53_904 264
732 3300046511 Ga0495608_0000005 Ga0495608_0000005_184630_185424 264
733 3300046511 Ga0495608_0001028 Ga0495608_0001028_12190_12993 264
734 3300046511 Ga0495608_0001415 Ga0495608_0001415_10221_11015 264
735 3300046511 Ga0495608_0173488 Ga0495608_0173488_366_1160 264
736 3300046514 Ga0495618_0000024 Ga0495618_0000024_34387_35181 264
737 3300046514 Ga0495618_0017306 Ga0495618_0017306_3163_3957 264
738 3300046514 Ga0495618_0092460 Ga0495618_0092460_958_1761 264
739 3300046514 Ga0495618_0110584 Ga0495618_0110584_462_1256 264
740 3300046514 Ga0495618_0147484 Ga0495618_0147484_217_1011 264
741 3300046516 Ga0495628_0000001 Ga0495628_0000001_358101_358895 264
742 3300046516 Ga0495628_0004556 Ga0495628_0004556_4850_5644 264
743 3300046516 Ga0495628_0023939 Ga0495628_0023939_3256_4050 264
744 3300046516 Ga0495628_0044540 Ga0495628_0044540_739_1542 264
745 3300046517 Ga0495630_0000433 Ga0495630_0000433_782_1576 264
746 3300046517 Ga0495630_0011916 Ga0495630_0011916_4215_5018 264
747 3300046517 Ga0495630_0012901 Ga0495630_0012901_2962_3789 264
748 3300046519 Ga0495632_0107467 Ga0495632_0107467_115_909 264
749 3300046526 Ga0495666_0013635 Ga0495666_0013635_412_1206 264
750 3300046526 Ga0495666_0029050 Ga0495666_0029050_88_891 264
751 3300046529 Ga0495652_0000002 Ga0495652_0000002_572635_573429 264
752 3300046529 Ga0495652_0042527 Ga0495652_0042527_383_1177 264
753 3300046529 Ga0495652_0056457 Ga0495652_0056457_199_1002 264
754 3300046529 Ga0495652_0126864 Ga0495652_0126864_456_1250 264
755 3300046529 Ga0495652_0190876 Ga0495652_0190876_168_962 264
756 3300046529 Ga0495652_0248607 Ga0495652_0248607_413_1207 264
757 3300046529 Ga0495652_0298610 Ga0495652_0298610_99_893 264
758 3300046533 Ga0495640_0000001 Ga0495640_0000001_666639_667433 264
759 3300046533 Ga0495640_0024283 Ga0495640_0024283_2756_3559 264
760 3300046533 Ga0495640_0034312 Ga0495640_0034312_1009_1803 264
761 3300046533 Ga0495640_0042302 Ga0495640_0042302_873_1679 264
762 3300046533 Ga0495640_0090859 Ga0495640_0090859_626_1420 264
763 3300046533 Ga0495640_0099776 Ga0495640_0099776_469_1263 264
764 3300046535 Ga0495586_0001347 Ga0495586_0001347_12219_13022 264
765 3300046536 Ga0495587_0000016 Ga0495587_0000016_97537_98331 264
766 3300046536 Ga0495587_0004603 Ga0495587_0004603_5196_5990 264
767 3300046536 Ga0495587_0072055 Ga0495587_0072055_349_1143 264
768 3300046536 Ga0495587_0081447 Ga0495587_0081447_415_1209 264
769 3300046537 Ga0495598_0001762 Ga0495598_0001762_3180_3974 264
770 3300046537 Ga0495598_0001867 Ga0495598_0001867_2420_3214 264
771 3300046539 Ga0495621_0005502 Ga0495621_0005502_825_1625 264
772 3300046539 Ga0495621_0050622 Ga0495621_0050622_536_1336 264
773 3300046539 Ga0495621_0137281 Ga0495621_0137281_126_938 264
774 3300046543 Ga0495645_0000002 Ga0495645_0000002_358114_358908 264
775 3300046543 Ga0495645_0028875 Ga0495645_0028875_2924_3718 264
776 3300046543 Ga0495645_0052308 Ga0495645_0052308_1923_2717 264
777 3300046559 Ga0495667_0000007 Ga0495667_0000007_150849_151643 264
778 3300046559 Ga0495667_0000709 Ga0495667_0000709_11251_12054 264
779 3300046559 Ga0495667_0001645 Ga0495667_0001645_3685_4479 264
780 3300046559 Ga0495667_0011650 Ga0495667_0011650_2005_2799 264
781 3300046559 Ga0495667_0020703 Ga0495667_0020703_3109_3903 264
782 3300046559 Ga0495667_0040356 Ga0495667_0040356_1356_2150 264
783 3300046559 Ga0495667_0072754 Ga0495667_0072754_1212_2006 264
784 3300046559 Ga0495667_0092108 Ga0495667_0092108_716_1528 264
785 3300046615 Ga0495656_0083713 Ga0495656_0083713_296_1090 264
786 3300046642 Ga0495634_0000637 Ga0495634_0000637_33129_33923 264
787 3300046642 Ga0495634_0002751 Ga0495634_0002751_8152_8955 264
788 3300046663 Ga0495635_0000002 Ga0495635_0000002_128029_128823 264
789 3300046663 Ga0495635_0024338 Ga0495635_0024338_457_1251 264
790 3300046663 Ga0495635_0032827 Ga0495635_0032827_1698_2492 264
791 3300046663 Ga0495635_0058993 Ga0495635_0058993_1101_1904 264
792 3300046663 Ga0495635_0080766 Ga0495635_0080766_776_1570 264
793 3300046675 Ga0495657_0000628 Ga0495657_0000628_14272_15066 264
794 3300046675 Ga0495657_0020211 Ga0495657_0020211_3537_4331 264
795 3300046675 Ga0495657_0062494 Ga0495657_0062494_1564_2358 264
796 3300046675 Ga0495657_0095234 Ga0495657_0095234_106_918 264
797 3300046675 Ga0495657_0098029 Ga0495657_0098029_304_1110 264
798 3300046678 Ga0495599_0000005 Ga0495599_0000005_186336_187130 264
799 3300046678 Ga0495599_0013019 Ga0495599_0013019_3384_4178 264
800 3300046678 Ga0495599_0042650 Ga0495599_0042650_174_968 264
801 3300046678 Ga0495599_0089351 Ga0495599_0089351_1002_1805 264
802 3300046679 Ga0495623_0000016 Ga0495623_0000016_10286_11080 264
803 3300046679 Ga0495623_0000629 Ga0495623_0000629_4488_5282 264
804 3300046679 Ga0495623_0080766 Ga0495623_0080766_854_1648 264
805 3300046680 Ga0495646_0000002 Ga0495646_0000002_112981_113775 264
806 3300046680 Ga0495646_0012772 Ga0495646_0012772_721_1515 264
807 3300046683 Ga0495658_0000745 Ga0495658_0000745_7348_8142 264
808 3300046683 Ga0495658_0004885 Ga0495658_0004885_4986_5789 264
809 3300046683 Ga0495658_0141604 Ga0495658_0141604_302_1096 264
810 3300046683 Ga0495658_0184226 Ga0495658_0184226_377_1171 264
811 3300046690 Ga0495624_0199103 Ga0495624_0199103_410_1204 264
812 3300046691 Ga0495670_0141521 Ga0495670_0141521_347_1141 264
813 3300046809 Ga0495600_0000279 Ga0495600_0000279_6771_7565 264
814 3300046809 Ga0495600_0004235 Ga0495600_0004235_4089_4883 264
815 3300046809 Ga0495600_0005190 Ga0495600_0005190_4272_5075 264
816 3300046809 Ga0495600_0023211 Ga0495600_0023211_2723_3517 264
817 3300046809 Ga0495600_0029019 Ga0495600_0029019_43_837 264
818 3300047317 Ga0495604_0000020 Ga0495604_0000020_139227_140021 264
819 3300047317 Ga0495604_0008684 Ga0495604_0008684_4496_5290 264
820 3300047317 Ga0495604_0013367 Ga0495604_0013367_3526_4329 264
821 3300047317 Ga0495604_0116986 Ga0495604_0116986_363_1157 264
822 3300047317 Ga0495604_0182428 Ga0495604_0182428_79_873 264
823 3300047319 Ga0495674_0000002 Ga0495674_0000002_358102_358896 264
824 3300047319 Ga0495674_0020681 Ga0495674_0020681_4868_5662 264
825 3300047319 Ga0495674_0034881 Ga0495674_0034881_564_1358 264
826 3300047320 Ga0495672_0000374 Ga0495672_0000374_19468_20319 264
827 3300047321 Ga0495676_0068957 Ga0495676_0068957_1192_1986 264
828 3300047321 Ga0495676_0099911 Ga0495676_0099911_502_1296 264
829 3300047321 Ga0495676_0273221 Ga0495676_0273221_52_846 264
830 3300047322 Ga0495680_0001158 Ga0495680_0001158_14228_15022 264
831 3300047322 Ga0495680_0005762 Ga0495680_0005762_4316_5110 264
832 3300047322 Ga0495680_0019375 Ga0495680_0019375_155_949 264
833 3300047322 Ga0495680_0020742 Ga0495680_0020742_4409_5203 264
834 3300047322 Ga0495680_0041210 Ga0495680_0041210_2017_2811 264
835 3300047322 Ga0495680_0068677 Ga0495680_0068677_213_1007 264
836 3300047444 Ga0495675_0000284 Ga0495675_0000284_28099_28893 264
837 3300047444 Ga0495675_0002358 Ga0495675_0002358_5963_6757 264
838 3300047444 Ga0495675_0131952 Ga0495675_0131952_146_940 264
839 3300047444 Ga0495675_0177805 Ga0495675_0177805_488_1291 264
840 3300047471 Ga0495684_0000017 Ga0495684_0000017_110475_111269 264
841 3300047471 Ga0495684_0034978 Ga0495684_0034978_2900_3694 264
842 3300047472 Ga0495686_0048541 Ga0495686_0048541_973_1791 264
843 3300047673 Ga0495593_0001934 Ga0495593_0001934_559_1353 264
844 3300047673 Ga0495593_0055496 Ga0495593_0055496_852_1646 264
845 3300048088 Ga0495602_0000040 Ga0495602_0000040_12412_13206 264
846 3300048088 Ga0495602_0003684 Ga0495602_0003684_848_1642 264
847 3300048088 Ga0495602_0028395 Ga0495602_0028395_1911_2705 264
848 3300048088 Ga0495602_0122392 Ga0495602_0122392_1075_1869 264
849 3300048090 Ga0495615_0053442 Ga0495615_0053442_186_980 264
850 3300048903 Ga0496100_0010939 Ga0496100_0010939_2974_3768 264
851 3300048903 Ga0496100_0012203 Ga0496100_0012203_3785_4579 264
852 3300048903 Ga0496100_0057851 Ga0496100_0057851_907_1701 264
853 3300048904 Ga0496101_0006634 Ga0496101_0006634_1679_2473 264
854 3300048905 Ga0496102_0046509 Ga0496102_0046509_2384_3178 264
855 3300048905 Ga0496102_0195065 Ga0496102_0195065_307_1101 264
856 3300048906 Ga0496103_0067000 Ga0496103_0067000_802_1596 264
857 3300048906 Ga0496103_0070323 Ga0496103_0070323_848_1642 264
858 3300048907 Ga0496104_0000055 Ga0496104_0000055_59649_60443 264
859 3300048907 Ga0496104_0005521 Ga0496104_0005521_9998_10792 264
860 3300048907 Ga0496104_0011174 Ga0496104_0011174_1810_2604 264
861 3300048907 Ga0496104_0083240 Ga0496104_0083240_16_810 264
862 3300048907 Ga0496104_0122731 Ga0496104_0122731_125_919 264
863 3300048907 Ga0496104_0135365 Ga0496104_0135365_901_1695 264
864 3300048907 Ga0496104_0192776 Ga0496104_0192776_987_1781 264
865 3300048907 Ga0496104_0409884 Ga0496104_0409884_19_813 264
866 3300048908 Ga0496105_0001352 Ga0496105_0001352_14456_15250 264
867 3300048908 Ga0496105_0006498 Ga0496105_0006498_4667_5461 264
868 3300048908 Ga0496105_0013053 Ga0496105_0013053_5331_6125 264
869 3300048908 Ga0496105_0043251 Ga0496105_0043251_206_1000 264
870 3300048908 Ga0496105_0182787 Ga0496105_0182787_455_1249 264
871 3300048909 Ga0496106_0044490 Ga0496106_0044490_1910_2704 264
872 3300048909 Ga0496106_0059439 Ga0496106_0059439_856_1650 264
873 3300048909 Ga0496106_0330578 Ga0496106_0330578_190_984 264
874 3300048910 Ga0496107_0005300 Ga0496107_0005300_2943_3737 264
875 3300048910 Ga0496107_0058525 Ga0496107_0058525_256_1050 264
876 3300048910 Ga0496107_0109787 Ga0496107_0109787_150_944 264
877 3300048911 Ga0496108_0037806 Ga0496108_0037806_1703_2497 264
878 3300048912 Ga0496109_0039967 Ga0496109_0039967_83_877 264
879 3300048912 Ga0496109_0051612 Ga0496109_0051612_1096_1890 264
880 3300048912 Ga0496109_0167017 Ga0496109_0167017_802_1596 264
881 3300048913 Ga0496110_0043384 Ga0496110_0043384_1255_2049 264
882 3300048913 Ga0496110_0231798 Ga0496110_0231798_630_1424 264
883 3300048913 Ga0496110_0246779 Ga0496110_0246779_456_1250 264
884 3300048913 Ga0496110_0348310 Ga0496110_0348310_50_844 264
885 3300048914 Ga0496111_0029169 Ga0496111_0029169_139_933 264
886 3300048914 Ga0496111_0033488 Ga0496111_0033488_405_1199 264
887 3300048914 Ga0496111_0182544 Ga0496111_0182544_502_1296 264
888 3300048914 Ga0496111_0260399 Ga0496111_0260399_482_1276 264
889 3300048915 Ga0496112_0263871 Ga0496112_0263871_41_835 264
890 3300048917 Ga0496114_0000007 Ga0496114_0000007_236115_236918 264
891 3300048917 Ga0496114_0011561 Ga0496114_0011561_5900_6694 264
892 3300048917 Ga0496114_0045542 Ga0496114_0045542_1705_2499 264
893 3300048917 Ga0496114_0373459 Ga0496114_0373459_189_983 264
894 3300048917 Ga0496114_0409186 Ga0496114_0409186_118_912 264
895 3300048918 Ga0496115_0014395 Ga0496115_0014395_770_1564 264
896 3300048918 Ga0496115_0022410 Ga0496115_0022410_1689_2483 264
897 3300048918 Ga0496115_0062175 Ga0496115_0062175_546_1340 264
898 3300048918 Ga0496115_0170415 Ga0496115_0170415_995_1789 264
899 3300048918 Ga0496115_0302958 Ga0496115_0302958_62_856 264
900 3300048922 Ga0496119_0000314 Ga0496119_0000314_27314_28108 264
901 3300048924 Ga0496121_0000445 Ga0496121_0000445_44630_45547 264
902 3300048925 Ga0496122_0000190 Ga0496122_0000190_53583_54377 264
903 3300048925 Ga0496122_0001527 Ga0496122_0001527_27725_28537 264
904 3300048926 Ga0496123_0001016 Ga0496123_0001016_37088_37882 264
905 3300048926 Ga0496123_0001252 Ga0496123_0001252_21544_22356 264
906 3300048928 Ga0496125_0000273 Ga0496125_0000273_61329_62123 264
907 3300048928 Ga0496125_0231617 Ga0496125_0231617_239_1063 264
908 3300048929 Ga0496126_0364327 Ga0496126_0364327_123_917 264
909 3300049551 Ga0501335_006568 Ga0501335_006568_183_1034 264
910 3300049568 Ga0501031_0008676 Ga0501031_0008676_4211_5005 264
911 3300049568 Ga0501031_0012430 Ga0501031_0012430_3913_4707 264
912 3300049568 Ga0501031_0033868 Ga0501031_0033868_1936_2742 264
913 3300049569 Ga0501032_0002877 Ga0501032_0002877_854_1648 264
914 3300049569 Ga0501032_0007634 Ga0501032_0007634_5509_6303 264
915 3300049569 Ga0501032_0178977 Ga0501032_0178977_313_1107 264
916 3300049570 Ga0501033_0057319 Ga0501033_0057319_945_1739 264
917 3300049570 Ga0501033_0191280 Ga0501033_0191280_252_1046 264
918 3300049571 Ga0501034_0000442 Ga0501034_0000442_12372_13166 264
919 3300049571 Ga0501034_0019479 Ga0501034_0019479_4064_4858 264
920 3300049571 Ga0501034_0058526 Ga0501034_0058526_2480_3274 264
921 3300049571 Ga0501034_0067565 Ga0501034_0067565_817_1611 264
922 3300049571 Ga0501034_0086158 Ga0501034_0086158_1332_2126 264
923 3300049571 Ga0501034_0236274 Ga0501034_0236274_612_1406 264
924 3300049571 Ga0501034_0591878 Ga0501034_0591878_74_868 264
925 3300049572 Ga0501036_0000984 Ga0501036_0000984_19241_20047 264
926 3300049572 Ga0501036_0001853 Ga0501036_0001853_4934_5728 264
927 3300049572 Ga0501036_0002374 Ga0501036_0002374_1325_2119 264
928 3300049572 Ga0501036_0039661 Ga0501036_0039661_1939_2748 264
929 3300049572 Ga0501036_0147876 Ga0501036_0147876_75_869 264
930 3300049572 Ga0501036_0196679 Ga0501036_0196679_379_1173 264
931 3300049573 Ga0501037_0002212 Ga0501037_0002212_12322_13128 264
932 3300049573 Ga0501037_0002785 Ga0501037_0002785_8649_9443 264
933 3300049573 Ga0501037_0008691 Ga0501037_0008691_1141_1935 264
934 3300049574 Ga0501038_0002844 Ga0501038_0002844_10085_10891 264
935 3300049574 Ga0501038_0044931 Ga0501038_0044931_2797_3591 264
936 3300049574 Ga0501038_0046946 Ga0501038_0046946_2132_2926 264
937 3300049574 Ga0501038_0074453 Ga0501038_0074453_1180_1989 264
938 3300049574 Ga0501038_0076376 Ga0501038_0076376_1040_1834 264
939 3300049575 Ga0501039_0000661 Ga0501039_0000661_22909_23715 264
940 3300049575 Ga0501039_0008637 Ga0501039_0008637_4019_4813 264
941 3300049575 Ga0501039_0010027 Ga0501039_0010027_2103_2897 264
942 3300049575 Ga0501039_0083587 Ga0501039_0083587_139_948 264
943 3300049575 Ga0501039_0315050 Ga0501039_0315050_270_1064 264
944 3300049575 Ga0501039_0367618 Ga0501039_0367618_53_847 264
945 3300049576 Ga0501040_0000759 Ga0501040_0000759_7510_8316 264
946 3300049576 Ga0501040_0009670 Ga0501040_0009670_3779_4588 264
947 3300049576 Ga0501040_0028681 Ga0501040_0028681_974_1783 264
948 3300049576 Ga0501040_0078736 Ga0501040_0078736_1035_1844 264
949 3300049576 Ga0501040_0445253 Ga0501040_0445253_10_804 264
950 3300049577 Ga0501041_0000109 Ga0501041_0000109_12726_13532 264
951 3300049577 Ga0501041_0005052 Ga0501041_0005052_4800_5609 264
952 3300049577 Ga0501041_0138550 Ga0501041_0138550_576_1370 264
953 3300049578 Ga0501042_0001562 Ga0501042_0001562_2902_3708 264
954 3300049578 Ga0501042_0008667 Ga0501042_0008667_1058_1852 264
955 3300049578 Ga0501042_0102642 Ga0501042_0102642_1011_1820 264
956 3300049578 Ga0501042_0175466 Ga0501042_0175466_485_1294 264
957 3300049579 Ga0501043_0000539 Ga0501043_0000539_27788_28582 264
958 3300049579 Ga0501043_0003859 Ga0501043_0003859_1787_2581 264
959 3300049579 Ga0501043_0044627 Ga0501043_0044627_1630_2436 264
960 3300049579 Ga0501043_0129961 Ga0501043_0129961_480_1274 264
961 3300049580 Ga0501046_0001303 Ga0501046_0001303_11504_12310 264
962 3300049580 Ga0501046_0002082 Ga0501046_0002082_14260_15054 264
963 3300049580 Ga0501046_0014507 Ga0501046_0014507_65_874 264
964 3300049580 Ga0501046_0055809 Ga0501046_0055809_1165_1959 264
965 3300049581 Ga0501047_0004626 Ga0501047_0004626_1787_2581 264
966 3300049581 Ga0501047_0006570 Ga0501047_0006570_977_1771 264
967 3300049581 Ga0501047_0077876 Ga0501047_0077876_317_1111 264
968 3300049581 Ga0501047_0092118 Ga0501047_0092118_276_1070 264
969 3300049581 Ga0501047_0432279 Ga0501047_0432279_303_1097 264
970 3300049582 Ga0501048_0000190 Ga0501048_0000190_27332_28138 264
971 3300049582 Ga0501048_0003398 Ga0501048_0003398_4623_5417 264
972 3300049582 Ga0501048_0006966 Ga0501048_0006966_7400_8209 264
973 3300049582 Ga0501048_0223802 Ga0501048_0223802_435_1229 264
974 3300049583 Ga0501067_0001787 Ga0501067_0001787_1298_2092 264
975 3300049583 Ga0501067_0022641 Ga0501067_0022641_135_929 264
976 3300049583 Ga0501067_0032759 Ga0501067_0032759_691_1485 264
977 3300049583 Ga0501067_0074035 Ga0501067_0074035_113_952 264
978 3300049584 Ga0501068_0005962 Ga0501068_0005962_2672_3478 264
979 3300049584 Ga0501068_0009173 Ga0501068_0009173_1549_2343 264
980 3300049585 Ga0501069_0000649 Ga0501069_0000649_9869_10663 264
981 3300049586 Ga0501070_0168390 Ga0501070_0168390_577_1371 264
982 3300049586 Ga0501070_0312434 Ga0501070_0312434_149_943 264
983 3300049586 Ga0501070_0348883 Ga0501070_0348883_366_1160 264
984 3300049587 Ga0501071_0007762 Ga0501071_0007762_5241_6035 264
985 3300049587 Ga0501071_0032363 Ga0501071_0032363_1025_1831 264
986 3300049587 Ga0501071_0070158 Ga0501071_0070158_1131_1940 264
987 3300049588 Ga0501072_0000763 Ga0501072_0000763_10341_11150 264
988 3300049588 Ga0501072_0019901 Ga0501072_0019901_3311_4117 264
989 3300049588 Ga0501072_0022921 Ga0501072_0022921_1170_1979 264
990 3300049588 Ga0501072_0052388 Ga0501072_0052388_436_1245 264
991 3300049588 Ga0501072_0101793 Ga0501072_0101793_574_1380 264
992 3300049588 Ga0501072_0378673 Ga0501072_0378673_85_879 264
993 3300049588 Ga0501072_0622962 Ga0501072_0622962_10_804 264
994 3300049589 Ga0501073_0004760 Ga0501073_0004760_1348_2142 264
995 3300049589 Ga0501073_0031779 Ga0501073_0031779_552_1346 264
996 3300049589 Ga0501073_0312535 Ga0501073_0312535_56_850 264
997 3300049590 Ga0501074_0006570 Ga0501074_0006570_5509_6303 264
998 3300049590 Ga0501074_0012006 Ga0501074_0012006_2916_3722 264
999 3300049590 Ga0501074_0049980 Ga0501074_0049980_579_1373 264
1000 3300049590 Ga0501074_0256381 Ga0501074_0256381_11_820 264
1001 3300049591 Ga0501075_0000840 Ga0501075_0000840_8111_8917 264
1002 3300049591 Ga0501075_0000926 Ga0501075_0000926_8464_9273 264
1003 3300049591 Ga0501075_0055651 Ga0501075_0055651_285_1079 264
1004 3300049592 Ga0501076_0038992 Ga0501076_0038992_300_1109 264
1005 3300049592 Ga0501076_0106733 Ga0501076_0106733_28_822 264
1006 3300049593 Ga0501077_0000262 Ga0501077_0000262_17737_18543 264
1007 3300049593 Ga0501077_0096453 Ga0501077_0096453_187_996 264
1008 3300049593 Ga0501077_0118055 Ga0501077_0118055_150_944 264
1009 3300049741 Ga0501079_0000684 Ga0501079_0000684_12612_13418 264
1010 3300049741 Ga0501079_0013866 Ga0501079_0013866_4798_5592 264
1011 3300049741 Ga0501079_0022746 Ga0501079_0022746_1543_2352 264
1012 3300049741 Ga0501079_0269594 Ga0501079_0269594_268_1062 264
1013 3300049742 Ga0501080_0003003 Ga0501080_0003003_4624_5418 264
1014 3300049742 Ga0501080_0049027 Ga0501080_0049027_1898_2692 264
1015 3300049742 Ga0501080_0160287 Ga0501080_0160287_781_1575 264
1016 3300049742 Ga0501080_0193161 Ga0501080_0193161_1005_1799 264
1017 3300049742 Ga0501080_0388380 Ga0501080_0388380_222_1028 264
1018 3300049743 Ga0501081_0000356 Ga0501081_0000356_12777_13583 264
1019 3300049743 Ga0501081_0008011 Ga0501081_0008011_1058_1867 264
1020 3300049743 Ga0501081_0281770 Ga0501081_0281770_369_1178 264
1021 3300049744 Ga0501083_0002240 Ga0501083_0002240_338_1132 264
1022 3300049744 Ga0501083_0004092 Ga0501083_0004092_164_958 264
1023 3300049744 Ga0501083_0007258 Ga0501083_0007258_4118_4912 264
1024 3300049744 Ga0501083_0017016 Ga0501083_0017016_183_977 264
1025 3300049744 Ga0501083_0139129 Ga0501083_0139129_545_1354 264
1026 3300049822 Ga0501035_0005532 Ga0501035_0005532_10637_11431 264
1027 3300049822 Ga0501035_0007363 Ga0501035_0007363_9353_10147 264
1028 3300049822 Ga0501035_0072868 Ga0501035_0072868_2069_2863 264
1029 3300049822 Ga0501035_0089404 Ga0501035_0089404_96_1016 264
1030 3300049822 Ga0501035_0207227 Ga0501035_0207227_731_1525 264
1031 3300049822 Ga0501035_0299608 Ga0501035_0299608_354_1163 264
1032 3300049823 Ga0501044_0000708 Ga0501044_0000708_35740_36534 264
1033 3300049823 Ga0501044_0013935 Ga0501044_0013935_2383_3177 264
1034 3300049823 Ga0501044_0017975 Ga0501044_0017975_937_1731 264
1035 3300049823 Ga0501044_0021310 Ga0501044_0021310_2550_3344 264
1036 3300049823 Ga0501044_0079433 Ga0501044_0079433_776_1570 264
1037 3300049823 Ga0501044_0110623 Ga0501044_0110623_678_1472 264
1038 3300049823 Ga0501044_0170371 Ga0501044_0170371_922_1716 264
1039 3300049823 Ga0501044_0382197 Ga0501044_0382197_239_1033 264
1040 3300049824 Ga0501045_0000221 Ga0501045_0000221_20698_21492 264
1041 3300049824 Ga0501045_0000749 Ga0501045_0000749_7415_8221 264
1042 3300049824 Ga0501045_0008385 Ga0501045_0008385_4368_5162 264
1043 3300049824 Ga0501045_0054276 Ga0501045_0054276_375_1190 264
1044 3300049824 Ga0501045_0480801 Ga0501045_0480801_31_825 264
1045 3300050489 nmdc:mga03683_110340_c1 nmdc:mga03683_110340_c1_94_888 264
1046 3300050489 nmdc:mga03683_169851_c1 nmdc:mga03683_169851_c1_61_855 264
1047 3300050489 nmdc:mga03683_38247_c1 nmdc:mga03683_38247_c1_988_1782 264
1048 3300050490 nmdc:mga03n38_5525_c1 nmdc:mga03n38_5525_c1_2612_3406 264
1049 3300050490 nmdc:mga03n38_74596_c1 nmdc:mga03n38_74596_c1_568_1362 264
1050 3300050491 nmdc:mga00v17_20753_c1 nmdc:mga00v17_20753_c1_1171_1965 264
1051 3300050492 nmdc:mga0yw44_11143_c1 nmdc:mga0yw44_11143_c1_1203_1997 264
1052 3300050494 nmdc:mga06z11_102986_c1 nmdc:mga06z11_102986_c1_48_842 264
1053 3300050494 nmdc:mga06z11_155414_c1 nmdc:mga06z11_155414_c1_40_834 264
1054 3300050495 nmdc:mga04h51_6961_c1 nmdc:mga04h51_6961_c1_1663_2547 264
1055 3300050507 nmdc:mga05p37_30139_c1 nmdc:mga05p37_30139_c1_2714_3508 264
1056 3300050507 nmdc:mga05p37_56283_c1 nmdc:mga05p37_56283_c1_1424_2218 264
1057 3300050507 nmdc:mga05p37_67_c1 nmdc:mga05p37_67_c1_68088_68900 264
1058 3300050507 nmdc:mga05p37_79966_c1 nmdc:mga05p37_79966_c1_2627_3421 264
1059 3300050508 nmdc:mga09592_137419_c1 nmdc:mga09592_137419_c1_1127_1921 264
1060 3300050508 nmdc:mga09592_173345_c1 nmdc:mga09592_173345_c1_475_1269 264
1061 3300050508 nmdc:mga09592_289322_c1 nmdc:mga09592_289322_c1_22_816 264
1062 3300050508 nmdc:mga09592_45_c1 nmdc:mga09592_45_c1_54162_54974 264
1063 3300050509 nmdc:mga0qj67_107060_c1 nmdc:mga0qj67_107060_c1_222_1016 264
1064 3300050509 nmdc:mga0qj67_175746_c1 nmdc:mga0qj67_175746_c1_129_923 264
1065 3300050509 nmdc:mga0qj67_267_c1 nmdc:mga0qj67_267_c1_15219_16013 264
1066 3300050509 nmdc:mga0qj67_35658_c1 nmdc:mga0qj67_35658_c1_2294_3103 264
1067 3300050509 nmdc:mga0qj67_46113_c1 nmdc:mga0qj67_46113_c1_806_1600 264
1068 3300050509 nmdc:mga0qj67_96444_c1 nmdc:mga0qj67_96444_c1_874_1686 264
1069 3300050510 nmdc:mga06r32_544367_c1 nmdc:mga06r32_544367_c1_165_959 264
1070 3300050510 nmdc:mga06r32_62934_c1 nmdc:mga06r32_62934_c1_1755_2549 264
1071 3300050511 nmdc:mga08y16_126338_c1 nmdc:mga08y16_126338_c1_1399_2211 264
1072 3300050511 nmdc:mga08y16_196092_c1 nmdc:mga08y16_196092_c1_1273_2067 264
1073 3300050511 nmdc:mga08y16_219568_c1 nmdc:mga08y16_219568_c1_1031_1825 264
1074 3300050511 nmdc:mga08y16_51087_c1 nmdc:mga08y16_51087_c1_321_1127 264
1075 3300050512 nmdc:mga0n895_63492_c1 nmdc:mga0n895_63492_c1_800_1594 264
1076 3300050512 nmdc:mga0n895_695456_c1 nmdc:mga0n895_695456_c1_48_842 264
1077 3300050513 nmdc:mga0rr50_30813_c1 nmdc:mga0rr50_30813_c1_1698_2492 264
1078 3300050513 nmdc:mga0rr50_51956_c1 nmdc:mga0rr50_51956_c1_1344_2138 264
1079 3300050513 nmdc:mga0rr50_662451_c1 nmdc:mga0rr50_662451_c1_34_828 264
1080 3300050514 nmdc:mga08x19_3363_c1 nmdc:mga08x19_3363_c1_2572_3366 264
1081 3300050515 nmdc:mga0a205_338726_c1 nmdc:mga0a205_338726_c1_342_1136 264
1082 3300050515 nmdc:mga0a205_372926_c1 nmdc:mga0a205_372926_c1_278_1072 264
1083 3300050515 nmdc:mga0a205_413053_c1 nmdc:mga0a205_413053_c1_97_900 264
1084 3300050515 nmdc:mga0a205_435087_c1 nmdc:mga0a205_435087_c1_254_1048 264
1085 3300050515 nmdc:mga0a205_52693_c1 nmdc:mga0a205_52693_c1_1887_2681 264
1086 3300050516 nmdc:mga0sz30_133465_c1 nmdc:mga0sz30_133465_c1_77_871 264
1087 3300053077 Ga0495601_0000018 Ga0495601_0000018_124104_124898 264
1088 3300053077 Ga0495601_0000352 Ga0495601_0000352_11574_12368 264
1089 3300053077 Ga0495601_0000357 Ga0495601_0000357_529_1323 264
1090 3300053077 Ga0495601_0008676 Ga0495601_0008676_4066_4860 264
1091 3300053077 Ga0495601_0010571 Ga0495601_0010571_1657_2451 264
1092 3300053077 Ga0495601_0048033 Ga0495601_0048033_1068_1862 264
1093 3300053077 Ga0495601_0311990 Ga0495601_0311990_101_907 264
1094 3300053078 Ga0495612_0000011 Ga0495612_0000011_110781_111575 264
1095 3300053078 Ga0495612_0003841 Ga0495612_0003841_2704_3498 264
1096 3300053078 Ga0495612_0014220 Ga0495612_0014220_672_1466 264
1097 3300053078 Ga0495612_0033348 Ga0495612_0033348_1255_2049 264
1098 3300053084 Ga0495595_0000016 Ga0495595_0000016_49297_50091 264
1099 3300053084 Ga0495595_0000405 Ga0495595_0000405_3998_4792 264
1100 3300053084 Ga0495595_0001531 Ga0495595_0001531_4867_5661 264
1101 3300053084 Ga0495595_0002126 Ga0495595_0002126_952_1746 264
1102 3300053084 Ga0495595_0010289 Ga0495595_0010289_1319_2113 264
1103 3300053085 Ga0495619_0000014 Ga0495619_0000014_173358_174152 264
1104 3300053085 Ga0495619_0000085 Ga0495619_0000085_29292_30086 264
1105 3300053085 Ga0495619_0000536 Ga0495619_0000536_892_1686 264
1106 3300053085 Ga0495619_0002650 Ga0495619_0002650_7911_8705 264
1107 3300053085 Ga0495619_0008387 Ga0495619_0008387_3829_4623 264
1108 3300053085 Ga0495619_0011351 Ga0495619_0011351_3516_4310 264
1109 3300053085 Ga0495619_0013199 Ga0495619_0013199_3745_4539 264
1110 3300053085 Ga0495619_0023812 Ga0495619_0023812_951_1745 264
1111 3300053092 Ga0500583_0142668 Ga0500583_0142668_209_1003 264
1112 3300053093 Ga0500651_0002083 Ga0500651_0002083_8683_9477 264
1113 3300053096 Ga0500641_0033918 Ga0500641_0033918_722_1516 264
1114 3300053104 Ga0500556_0000099 Ga0500556_0000099_24316_25110 264
1115 3300053117 Ga0500593_012112 Ga0500593_012112_536_1330 264
1116 3300053130 Ga0500642_0037358 Ga0500642_0037358_869_1663 264
1117 3300053727 Ga0500611_023857 Ga0500611_023857_303_1097 264
1118 3300054114 Ga0501084_0000355 Ga0501084_0000355_12363_13169 264
1119 3300054114 Ga0501084_0000758 Ga0501084_0000758_17869_18663 264
1120 3300054114 Ga0501084_0013622 Ga0501084_0013622_3092_3886 264
1121 3300054114 Ga0501084_0034669 Ga0501084_0034669_1849_2658 264
1122 3300054114 Ga0501084_0041915 Ga0501084_0041915_2894_3688 264
1123 3300054114 Ga0501084_0127934 Ga0501084_0127934_1017_1826 264
1124 3300060353 Ga0501082_0000032 Ga0501082_0000032_72566_73360 264
1125 3300060353 Ga0501082_0003835 Ga0501082_0003835_1366_2205 264
1126 3300060353 Ga0501082_0004982 Ga0501082_0004982_4243_5049 264
1127 3300060353 Ga0501082_0056277 Ga0501082_0056277_1387_2181 264
1128 3300060353 Ga0501082_0126679 Ga0501082_0126679_663_1472 264
1129 3300060353 Ga0501082_0208152 Ga0501082_0208152_304_1098 264
1130 3300060353 Ga0501082_0284777 Ga0501082_0284777_140_934 264
1131 3300060353 Ga0501082_0299606 Ga0501082_0299606_31_825 264
1132 3300061719 Ga0466962_0148311 Ga0466962_0148311_332_1126 264
1133 3300061734 Ga0530510_0000542 Ga0530510_0000542_6587_7396 264
1134 3300061734 Ga0530510_0001016 Ga0530510_0001016_6466_7272 264
1135 3300061734 Ga0530510_0092420 Ga0530510_0092420_579_1373 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

37

323

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fto-assembly1.cif.gz_X-2 y94f mutant of thymidylate synthase bound to thymidine-5'-phosphate and 10-propargyl-5,8-dideazafolid acid 0.9881 3 263
3b5b-assembly1.cif.gz_B crystal structure of the thymidylate synthase k48q 0.988 1 263
1aiq-assembly1.cif.gz_A crystal structure of thymidylate synthase r126e mutant 0.988 3 263
3bgx-assembly1.cif.gz_A e. coli thymidylate synthase c146s mutant complexed with dtmp and mtf 0.988 3 263
1fwm-assembly1.cif.gz_B crystal structure of the thymidylate synthase r166q mutant 0.9879 3 263
ID Description Score Start End Superfamily
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9713 2 263 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.964 2 250 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.964 2 263 3.30.572.10
af_P06785_1_304_3.30.572.10 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9636 3 263 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.959 2 258 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A352HMS8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.998 150 263 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A6V8DH23-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9976 150 263 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2U2SIH8-F1-model_v4 Thymidylate synthase (TS) (TSase) (EC 2.1.1.45) 0.9947 1 263 GO:0004799
GO:0005829
GO:0006231
GO:0006235
GO:0032259
AF-A0A0M3GI98-F1-model_v4 deleted 0.9943 1 263
AF-A0A7S3TBS6-F1-model_v4 thymidylate synthase (EC 2.1.1.45) 0.9942 159 263 GO:0004799
GO:0005739
GO:0005829
GO:0006231
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.94 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map