F490633

General Info

Members Datasets Scaffolds Average Seq Length
1136 347 2272 166

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10349299|Ga0207695_103492991
Length 184
Sequence MPVDLRETRLPGIGTKFTFRLDDGGRLAVILHNDGVRELYFFRHSDDDEPKAVIRLDDDEARQLGAVIGGAYERPKIVEDLEMALGELLIEWEPVPETSPWIGKTLAESGFRAKTGITVIAILREPEPVTGAQPDDVIQHGDTLVTVGKAGQYGACEGHRPGDHAADCGAVVESAGGRLVHDVC

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
117 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
118 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
119 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
233 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
236 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
347 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 5.37
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 17.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10349299 3300025913 Bacteria 1366
2 JGI24746J21847_1023075 3300001977 Bacteria 866
3 JGI24747J21853_1002478 3300001978 Unclassified 1511
4 JGI24747J21853_1002619 3300001978 Bacteria 1486
5 JGI24739J22299_10056390 3300001989 Bacteria 1253
6 JGI24737J22298_10126685 3300001990 Bacteria 754
7 JGI24738J21930_10014188 3300002075 Unclassified 1712
8 JGI24744J21845_10010675 3300002077 Bacteria 1880
9 JGI25406J46586_10059686 3300003203 Bacteria 1237
10 JGI25407J50210_10002984 3300003373 Bacteria 4041
11 JGI25407J50210_10007520 3300003373 Bacteria 2730
12 JGI25407J50210_10024604 3300003373 Bacteria 1561
13 JGI25407J50210_10041967 3300003373 Bacteria 1170
14 Ga0070658_10282327 3300005327 Unclassified 1413
15 Ga0070658_10620589 3300005327 Bacteria 938
16 Ga0070676_10016464 3300005328 Archaea 4089
17 Ga0070683_100003925 3300005329 Bacteria 12158
18 Ga0070683_100009447 3300005329 Bacteria 8340
19 Ga0070683_100108205 3300005329 Bacteria 2621
20 Ga0070683_100141718 3300005329 Unclassified 2277
21 Ga0070670_100553389 3300005331 Bacteria 1026
22 Ga0070677_10162324 3300005333 Bacteria 1049
23 Ga0068869_100257223 3300005334 Bacteria 1397
24 Ga0068869_100425317 3300005334 Bacteria 1096
25 Ga0070666_10263690 3300005335 Bacteria 1222
26 Ga0070680_100301197 3300005336 Bacteria 1360
27 Ga0070680_100897501 3300005336 Bacteria 765
28 Ga0070680_100928696 3300005336 Unclassified 751
29 Ga0070682_100004426 3300005337 Bacteria 7798
30 Ga0070682_100005044 3300005337 Bacteria 7335
31 Ga0070682_100420282 3300005337 Bacteria 1016
32 Ga0068868_100037260 3300005338 Unclassified 3769
33 Ga0068868_100423169 3300005338 Unclassified 1153
34 Ga0070660_100036138 3300005339 Unclassified 3741
35 Ga0070660_100218791 3300005339 Bacteria 1548
36 Ga0070660_100329719 3300005339 Bacteria 1255
37 Ga0070660_100369238 3300005339 Bacteria 1183
38 Ga0070689_100007583 3300005340 Bacteria 7600
39 Ga0070689_100066466 3300005340 Bacteria 2809
40 Ga0070689_100200205 3300005340 Bacteria 1630
41 Ga0070689_100294205 3300005340 Bacteria 1350
42 Ga0070691_10369955 3300005341 Bacteria 801
43 Ga0070687_100112212 3300005343 Bacteria 1545
44 Ga0070687_100211575 3300005343 Bacteria 1181
45 Ga0070661_100072981 3300005344 Bacteria 2526
46 Ga0070661_100839525 3300005344 Bacteria 755
47 Ga0070692_10020164 3300005345 Bacteria 3229
48 Ga0070692_10026208 3300005345 Bacteria 2879
49 Ga0070692_10027734 3300005345 Bacteria 2810
50 Ga0070692_10152707 3300005345 Unclassified 1316
51 Ga0070692_10246109 3300005345 Bacteria 1068
52 Ga0070692_10939053 3300005345 Bacteria 601
53 Ga0070668_100159315 3300005347 Archaea 1830
54 Ga0070668_100207387 3300005347 Bacteria 1611
55 Ga0070668_100541116 3300005347 Bacteria 1012
56 Ga0070668_101209453 3300005347 Unclassified 685
57 Ga0070669_100114906 3300005353 Bacteria 2047
58 Ga0070675_100019038 3300005354 Bacteria 5469
59 Ga0070675_100040341 3300005354 Archaea 3810
60 Ga0070675_100152539 3300005354 Bacteria 1982
61 Ga0070675_101338934 3300005354 Bacteria 660
62 Ga0070671_100016569 3300005355 Bacteria 5957
63 Ga0070671_100533134 3300005355 Bacteria 1011
64 Ga0070674_100003185 3300005356 Bacteria 9145
65 Ga0070674_100003686 3300005356 Bacteria 8636
66 Ga0070674_100005915 3300005356 Bacteria 7114
67 Ga0070674_100023351 3300005356 Bacteria 4002
68 Ga0070674_100025544 3300005356 Bacteria 3847
69 Ga0070674_100266281 3300005356 Bacteria 1352
70 Ga0070673_100002906 3300005364 Archaea 10554
71 Ga0070673_100062384 3300005364 Unclassified 2961
72 Ga0070673_100174202 3300005364 Bacteria 1838
73 Ga0070688_100002023 3300005365 Bacteria 10226
74 Ga0070688_100003324 3300005365 Bacteria 8244
75 Ga0070688_100526215 3300005365 Bacteria 895
76 Ga0070659_100005741 3300005366 Bacteria 8935
77 Ga0070659_100054870 3300005366 Bacteria 3140
78 Ga0070659_100421790 3300005366 Bacteria 1128
79 Ga0070659_100479468 3300005366 Unclassified 1058
80 Ga0070667_100992807 3300005367 Bacteria 783
81 Ga0070703_10018421 3300005406 Unclassified 2018
82 Ga0070709_11081122 3300005434 Bacteria 641
83 Ga0070714_100812219 3300005435 Unclassified 906
84 Ga0070710_10004290 3300005437 Bacteria 6763
85 Ga0070701_10018494 3300005438 Archaea 3276
86 Ga0070701_10057995 3300005438 Bacteria 2031
87 Ga0070701_10067481 3300005438 Bacteria 1903
88 Ga0070701_10197692 3300005438 Bacteria 1186
89 Ga0070701_10773223 3300005438 Bacteria 653
90 Ga0070705_100026575 3300005440 Bacteria 3151
91 Ga0070705_100083531 3300005440 Archaea 1968
92 Ga0070705_100145312 3300005440 Unclassified 1566
93 Ga0070705_101047474 3300005440 Bacteria 665
94 Ga0070700_100065742 3300005441 Bacteria 2300
95 Ga0070700_100091470 3300005441 Bacteria 1986
96 Ga0070700_100213282 3300005441 Unclassified 1364
97 Ga0070700_100214718 3300005441 Bacteria 1359
98 Ga0070700_100220524 3300005441 Unclassified 1343
99 Ga0070700_100356766 3300005441 Bacteria 1086
100 Ga0070700_100404593 3300005441 Bacteria 1027
101 Ga0070694_100168350 3300005444 Unclassified 1612
102 Ga0070708_100033983 3300005445 Bacteria 4433
103 Ga0070708_100050577 3300005445 Archaea 3681
104 Ga0070708_100724582 3300005445 Bacteria 935
105 Ga0070678_100085755 3300005456 Archaea 2400
106 Ga0070678_100192821 3300005456 Bacteria 1676
107 Ga0070678_100363225 3300005456 Unclassified 1248
108 Ga0070678_100565631 3300005456 Bacteria 1011
109 Ga0070678_100896334 3300005456 Bacteria 810
110 Ga0070662_100012523 3300005457 Bacteria 5625
111 Ga0070662_100198485 3300005457 Unclassified 1591
112 Ga0070662_100212519 3300005457 Unclassified 1540
113 Ga0070681_10557749 3300005458 Bacteria 1059
114 Ga0070681_11011889 3300005458 Bacteria 751
115 Ga0068867_100009057 3300005459 Bacteria 7023
116 Ga0068867_100023897 3300005459 Bacteria 4377
117 Ga0068867_100037848 3300005459 Unclassified 3508
118 Ga0068867_100081054 3300005459 Bacteria 2446
119 Ga0068867_100235644 3300005459 Unclassified 1482
120 Ga0070685_10030640 3300005466 Bacteria 3000
121 Ga0070685_10043751 3300005466 Archaea 2561
122 Ga0070685_10307345 3300005466 Bacteria 1070
123 Ga0070685_10399322 3300005466 Bacteria 952
124 Ga0070706_100022133 3300005467 Bacteria 5853
125 Ga0070706_100244191 3300005467 Bacteria 1676
126 Ga0070706_100286048 3300005467 Bacteria 1539
127 Ga0070706_100681634 3300005467 Unclassified 954
128 Ga0070707_100008845 3300005468 Bacteria 9340
129 Ga0070698_100035630 3300005471 Bacteria 5144
130 Ga0070698_100098128 3300005471 Bacteria 2904
131 Ga0070699_100004014 3300005518 Bacteria 13007
132 Ga0070699_100023745 3300005518 Bacteria 5282
133 Ga0070699_101087399 3300005518 Bacteria 733
134 Ga0070679_100066648 3300005530 Bacteria 3589
135 Ga0070679_100232563 3300005530 Unclassified 1802
136 Ga0070679_101693971 3300005530 Bacteria 580
137 Ga0070684_100022742 3300005535 Bacteria 5233
138 Ga0070684_100060915 3300005535 Archaea 3302
139 Ga0070684_100454881 3300005535 Bacteria 1183
140 Ga0070684_100497926 3300005535 Unclassified 1128
141 Ga0070684_100909235 3300005535 Bacteria 825
142 Ga0068853_100014245 3300005539 Bacteria 6508
143 Ga0068853_100059158 3300005539 Bacteria 3310
144 Ga0070672_100003708 3300005543 Bacteria 9940
145 Ga0070672_100005767 3300005543 Bacteria 8256
146 Ga0070672_100353089 3300005543 Bacteria 1254
147 Ga0070672_101058692 3300005543 Unclassified 720
148 Ga0070686_100014120 3300005544 Bacteria 4593
149 Ga0070686_100020025 3300005544 Archaea 3955
150 Ga0070686_100074470 3300005544 Bacteria 2231
151 Ga0070686_100096324 3300005544 Bacteria 1990
152 Ga0070686_100470228 3300005544 Archaea 970
153 Ga0070695_100040070 3300005545 Archaea 2964
154 Ga0070695_100790592 3300005545 Bacteria 759
155 Ga0070695_101045979 3300005545 Unclassified 666
156 Ga0070696_100007874 3300005546 Bacteria 7115
157 Ga0070696_100012124 3300005546 Bacteria 5776
158 Ga0070696_100050820 3300005546 Bacteria 2882
159 Ga0070696_100443549 3300005546 Bacteria 1023
160 Ga0070696_100506750 3300005546 Bacteria 961
161 Ga0070693_100010968 3300005547 Bacteria 4554
162 Ga0070693_100032271 3300005547 Bacteria 2878
163 Ga0070665_101228430 3300005548 Bacteria 760
164 Ga0070665_101259555 3300005548 Bacteria 750
165 Ga0070704_100004138 3300005549 Archaea 8373
166 Ga0070704_100005421 3300005549 Bacteria 7427
167 Ga0070704_100041253 3300005549 Bacteria 3184
168 Ga0070704_100186542 3300005549 Bacteria 1663
169 Ga0070704_100791388 3300005549 Bacteria 847
170 Ga0068855_100023324 3300005563 Bacteria 7410
171 Ga0068855_100273760 3300005563 Bacteria 1877
172 Ga0068855_101100678 3300005563 Bacteria 830
173 Ga0070664_100047814 3300005564 Archaea 3615
174 Ga0070664_100070442 3300005564 Bacteria 2994
175 Ga0070664_100403434 3300005564 Archaea 1250
176 Ga0070664_100664708 3300005564 Unclassified 969
177 Ga0070664_100775322 3300005564 Bacteria 896
178 Ga0068857_100000728 3300005577 Bacteria 24548
179 Ga0068857_100291929 3300005577 Bacteria 1502
180 Ga0068854_100002077 3300005578 Bacteria 12274
181 Ga0068854_100370761 3300005578 Bacteria 1177
182 Ga0068854_100535857 3300005578 Unclassified 991
183 Ga0068856_100016532 3300005614 Bacteria 7141
184 Ga0068856_100296562 3300005614 Unclassified 1634
185 Ga0070702_100052421 3300005615 Unclassified 2339
186 Ga0070702_100061145 3300005615 Bacteria 2192
187 Ga0070702_100073889 3300005615 Bacteria 2021
188 Ga0070702_100090115 3300005615 Bacteria 1858
189 Ga0070702_100132237 3300005615 Unclassified 1577
190 Ga0068852_100003129 3300005616 Bacteria 11528
191 Ga0068852_100023602 3300005616 Bacteria 4953
192 Ga0068852_101092066 3300005616 Bacteria 818
193 Ga0068852_101767907 3300005616 Bacteria 641
194 Ga0068859_100007178 3300005617 Bacteria 11310
195 Ga0068859_100178990 3300005617 Unclassified 2203
196 Ga0068859_100320544 3300005617 Bacteria 1644
197 Ga0068859_101481044 3300005617 Bacteria 749
198 Ga0068864_100288905 3300005618 Bacteria 1533
199 Ga0068864_100400930 3300005618 Bacteria 1303
200 Ga0068864_101438311 3300005618 Bacteria 692
201 Ga0068864_101832309 3300005618 Unclassified 612
202 Ga0068866_10271045 3300005718 Bacteria 1047
203 Ga0068866_10635309 3300005718 Unclassified 725
204 Ga0068866_10643364 3300005718 Bacteria 721
205 Ga0068861_100301544 3300005719 Bacteria 1388
206 Ga0068861_100329306 3300005719 Bacteria 1333
207 Ga0068861_100388191 3300005719 Bacteria 1235
208 Ga0068861_100440296 3300005719 Bacteria 1165
209 Ga0068851_10016536 3300005834 Archaea 3531
210 Ga0068851_10542457 3300005834 Bacteria 702
211 Ga0068870_10028562 3300005840 Bacteria 2802
212 Ga0068870_10031844 3300005840 Unclassified 2675
213 Ga0068870_10613789 3300005840 Bacteria 740
214 Ga0068863_100108758 3300005841 Archaea 2639
215 Ga0068858_100010201 3300005842 Bacteria 8915
216 Ga0068858_100156124 3300005842 Bacteria 2147
217 Ga0068858_100305872 3300005842 Unclassified 1517
218 Ga0068858_100428880 3300005842 Unclassified 1272
219 Ga0068860_100034858 3300005843 Archaea 4828
220 Ga0068860_100622404 3300005843 Bacteria 1086
221 Ga0068860_100813720 3300005843 Bacteria 948
222 Ga0068860_100832838 3300005843 Unclassified 937
223 Ga0068862_100181970 3300005844 Unclassified 1887
224 Ga0068862_100219956 3300005844 Bacteria 1719
225 Ga0081455_10003417 3300005937 Bacteria 18253
226 Ga0081455_10005594 3300005937 Bacteria 13737
227 Ga0081455_10056065 3300005937 Unclassified 3348
228 Ga0081455_10200195 3300005937 Bacteria 1496
229 Ga0081455_10648089 3300005937 Unclassified 681
230 Ga0081538_10000080 3300005981 Bacteria 92392
231 Ga0081538_10000144 3300005981 Bacteria 73787
232 Ga0081538_10000231 3300005981 Bacteria 62826
233 Ga0081538_10000667 3300005981 Bacteria 37780
234 Ga0081538_10002291 3300005981 Bacteria 18909
235 Ga0081538_10005049 3300005981 Bacteria 11996
236 Ga0081538_10012554 3300005981 Bacteria 6784
237 Ga0081538_10043132 3300005981 Bacteria 2837
238 Ga0081538_10050060 3300005981 Bacteria 2528
239 Ga0081538_10080682 3300005981 Unclassified 1734
240 Ga0081539_10000452 3300005985 Bacteria 87416
241 Ga0081539_10011583 3300005985 Bacteria 6951
242 Ga0075365_10009783 3300006038 Bacteria 5540
243 Ga0075432_10005071 3300006058 Bacteria 4485
244 Ga0075432_10015202 3300006058 Bacteria 2625
245 Ga0075432_10053012 3300006058 Unclassified 1434
246 Ga0075432_10084539 3300006058 Bacteria 1155
247 Ga0070715_10014164 3300006163 Bacteria 2946
248 Ga0070716_100179839 3300006173 Unclassified 1387
249 Ga0070716_100313760 3300006173 Bacteria 1096
250 Ga0070712_100001977 3300006175 Bacteria 12563
251 Ga0070712_100052849 3300006175 Unclassified 2835
252 Ga0075362_10079235 3300006177 Bacteria 1512
253 Ga0097621_100145977 3300006237 Bacteria 2025
254 Ga0097621_100309270 3300006237 Bacteria 1398
255 Ga0097621_100580338 3300006237 Bacteria 1023
256 Ga0068871_100018627 3300006358 Bacteria 5283
257 Ga0068871_100158924 3300006358 Unclassified 1932
258 Ga0068871_100488358 3300006358 Bacteria 1109
259 Ga0068871_100523613 3300006358 Bacteria 1071
260 Ga0068871_100997292 3300006358 Unclassified 780
261 Ga0068871_101103623 3300006358 Bacteria 742
262 Ga0075428_100013149 3300006844 Bacteria 9205
263 Ga0075428_100085963 3300006844 Bacteria 3430
264 Ga0075428_100238223 3300006844 Unclassified 1963
265 Ga0075430_100016098 3300006846 Bacteria 6366
266 Ga0075430_100055457 3300006846 Bacteria 3332
267 Ga0075430_100083814 3300006846 Bacteria 2670
268 Ga0075430_100116008 3300006846 Bacteria 2231
269 Ga0075431_100005512 3300006847 Bacteria 12499
270 Ga0075431_100117193 3300006847 Bacteria 2748
271 Ga0075431_100167100 3300006847 Unclassified 2261
272 Ga0075431_100428561 3300006847 Bacteria 1321
273 Ga0075433_10565747 3300006852 Bacteria 999
274 Ga0075434_100040445 3300006871 Bacteria 4616
275 Ga0075434_100379247 3300006871 Bacteria 1435
276 Ga0075429_100017339 3300006880 Bacteria 6226
277 Ga0075429_100107051 3300006880 Bacteria 2443
278 Ga0075429_101029327 3300006880 Unclassified 720
279 Ga0075429_101448875 3300006880 Unclassified 598
280 Ga0068865_100082075 3300006881 Bacteria 2317
281 Ga0068865_100086223 3300006881 Bacteria 2266
282 Ga0068865_100222591 3300006881 Unclassified 1476
283 Ga0068865_100240685 3300006881 Unclassified 1424
284 Ga0068865_100449984 3300006881 Unclassified 1064
285 Ga0068865_100473444 3300006881 Bacteria 1040
286 Ga0068865_100604970 3300006881 Unclassified 927
287 Ga0075436_100028486 3300006914 Bacteria 3842
288 Ga0097620_100007178 3300006931 Bacteria 11310
289 Ga0097620_100178999 3300006931 Unclassified 2203
290 Ga0097620_100320545 3300006931 Bacteria 1644
291 Ga0097620_101481283 3300006931 Bacteria 749
292 Ga0075435_100094831 3300007076 Bacteria 2467
293 Ga0105244_10039248 3300009036 Bacteria 2465
294 Ga0105240_10596601 3300009093 Unclassified 1216
295 Ga0105240_11348218 3300009093 Unclassified 751
296 Ga0111539_10003600 3300009094 Bacteria 20430
297 Ga0111539_10027451 3300009094 Bacteria 6954
298 Ga0111539_10038708 3300009094 Bacteria 5755
299 Ga0111539_10077139 3300009094 Bacteria 3922
300 Ga0111539_10252521 3300009094 Bacteria 2053
301 Ga0111539_10262375 3300009094 Bacteria 2011
302 Ga0111539_11293120 3300009094 Bacteria 846
303 Ga0111539_11753510 3300009094 Bacteria 720
304 Ga0111539_12263717 3300009094 Unclassified 630
305 Ga0105245_10003898 3300009098 Bacteria 13261
306 Ga0105245_10018405 3300009098 Bacteria 6107
307 Ga0105245_10142426 3300009098 Unclassified 2259
308 Ga0105245_10155368 3300009098 Bacteria 2166
309 Ga0105245_10184423 3300009098 Unclassified 1996
310 Ga0105245_10335082 3300009098 Bacteria 1494
311 Ga0105247_10264307 3300009101 Unclassified 1181
312 Ga0114129_10034544 3300009147 Bacteria 7142
313 Ga0114129_10224897 3300009147 Bacteria 2530
314 Ga0114129_10225871 3300009147 Bacteria 2523
315 Ga0114129_10472712 3300009147 Unclassified 1641
316 Ga0114129_10698651 3300009147 Unclassified 1304
317 Ga0114129_11869758 3300009147 Bacteria 729
318 Ga0114129_12327259 3300009147 Bacteria 643
319 Ga0105243_10015986 3300009148 Bacteria 5675
320 Ga0105243_10109339 3300009148 Unclassified 2309
321 Ga0105243_10155968 3300009148 Bacteria 1963
322 Ga0105243_10193181 3300009148 Unclassified 1779
323 Ga0105243_10624510 3300009148 Bacteria 1041
324 Ga0105241_10039256 3300009174 Unclassified 3570
325 Ga0105241_10388316 3300009174 Unclassified 1221
326 Ga0105242_10017423 3300009176 Bacteria 5599
327 Ga0105242_10021167 3300009176 Bacteria 5104
328 Ga0105242_10096129 3300009176 Bacteria 2502
329 Ga0105242_10161307 3300009176 Bacteria 1963
330 Ga0105242_10556071 3300009176 Unclassified 1101
331 Ga0105242_11086372 3300009176 Unclassified 813
332 Ga0105248_10039405 3300009177 Bacteria 5291
333 Ga0105248_10064598 3300009177 Bacteria 4109
334 Ga0105248_10073671 3300009177 Bacteria 3837
335 Ga0105248_10191974 3300009177 Archaea 2301
336 Ga0105248_10557329 3300009177 Bacteria 1293
337 Ga0105248_10758936 3300009177 Unclassified 1095
338 Ga0105237_10048944 3300009545 Bacteria 4249
339 Ga0105238_10015083 3300009551 Bacteria 7825
340 Ga0105238_10042589 3300009551 Bacteria 4597
341 Ga0105238_10956076 3300009551 Bacteria 877
342 Ga0105238_11319815 3300009551 Unclassified 748
343 Ga0105249_10005190 3300009553 Bacteria 11241
344 Ga0105249_10028478 3300009553 Bacteria 5042
345 Ga0105249_10338381 3300009553 Bacteria 1521
346 Ga0105249_10683346 3300009553 Bacteria 1086
347 Ga0105249_11290673 3300009553 Bacteria 801
348 Ga0105239_10003612 3300010375 Bacteria 18903
349 Ga0105239_10011361 3300010375 Bacteria 9935
350 Ga0105239_10014264 3300010375 Bacteria 8821
351 Ga0105239_10097832 3300010375 Archaea 3243
352 Ga0105239_10142611 3300010375 Bacteria 2670
353 Ga0105239_10350401 3300010375 Unclassified 1667
354 Ga0105246_10016979 3300011119 Bacteria 4621
355 Ga0105246_10037305 3300011119 Unclassified 3262
356 Ga0105246_10108436 3300011119 Bacteria 2035
357 Ga0105246_10160863 3300011119 Bacteria 1710
358 Ga0157324_1010787 3300012506 Bacteria 780
359 Ga0157342_1006264 3300012507 Bacteria 1120
360 Ga0157315_1009579 3300012508 Bacteria 836
361 Ga0157338_1002008 3300012515 Bacteria 1548
362 Ga0157373_10060991 3300013100 Archaea 2672
363 Ga0157371_10006307 3300013102 Bacteria 9822
364 Ga0157371_10035578 3300013102 Bacteria 3568
365 Ga0157371_10371427 3300013102 Unclassified 1043
366 Ga0157371_10573702 3300013102 Unclassified 838
367 Ga0157369_10784852 3300013105 Bacteria 979
368 Ga0157369_11842336 3300013105 Unclassified 614
369 Ga0157374_10053364 3300013296 Unclassified 3768
370 Ga0157374_10204761 3300013296 Archaea 1933
371 Ga0157378_10010906 3300013297 Bacteria 7949
372 Ga0157378_10315065 3300013297 Bacteria 1518
373 Ga0157378_10316676 3300013297 Unclassified 1514
374 Ga0157378_10788119 3300013297 Unclassified 975
375 Ga0157378_11550472 3300013297 Bacteria 708
376 Ga0163162_10011370 3300013306 Bacteria 8678
377 Ga0163162_10027414 3300013306 Archaea 5633
378 Ga0163162_10079016 3300013306 Bacteria 3356
379 Ga0163162_10154494 3300013306 Bacteria 2414
380 Ga0163162_10199801 3300013306 Bacteria 2128
381 Ga0163162_10279805 3300013306 Unclassified 1800
382 Ga0163162_10325080 3300013306 Bacteria 1670
383 Ga0163162_11070544 3300013306 Bacteria 913
384 Ga0157372_10012819 3300013307 Bacteria 8934
385 Ga0157372_10085638 3300013307 Bacteria 3575
386 Ga0157372_10522207 3300013307 Bacteria 1384
387 Ga0157375_10002897 3300013308 Bacteria 14865
388 Ga0157375_10004110 3300013308 Bacteria 12624
389 Ga0157375_10093364 3300013308 Archaea 3075
390 Ga0157375_10129225 3300013308 Bacteria 2644
391 Ga0157375_10132609 3300013308 Unclassified 2612
392 Ga0163163_10094337 3300014325 Unclassified 3010
393 Ga0163163_10225073 3300014325 Archaea 1925
394 Ga0163163_10314021 3300014325 Bacteria 1620
395 Ga0163163_10356525 3300014325 Bacteria 1519
396 Ga0157380_10007447 3300014326 Bacteria 7773
397 Ga0157380_10132317 3300014326 Bacteria 2130
398 Ga0157380_10522640 3300014326 Bacteria 1158
399 Ga0182008_10180462 3300014497 Bacteria 1068
400 Ga0157377_10001024 3300014745 Bacteria 11804
401 Ga0157377_10039358 3300014745 Unclassified 2614
402 Ga0157377_11232458 3300014745 Bacteria 581
403 Ga0157379_10108056 3300014968 Bacteria 2497
404 Ga0157379_10231771 3300014968 Unclassified 1674
405 Ga0157379_10360086 3300014968 Unclassified 1333
406 Ga0157379_10445731 3300014968 Archaea 1194
407 Ga0157379_10910539 3300014968 Bacteria 835
408 Ga0157376_10088506 3300014969 Bacteria 2675
409 Ga0157376_10456463 3300014969 Bacteria 1248
410 Ga0157376_10688022 3300014969 Unclassified 1026
411 Ga0157376_11905885 3300014969 Bacteria 631
412 Ga0163161_10238465 3300017792 Bacteria 1414
413 Ga0163161_10725799 3300017792 Bacteria 829
414 Ga0163161_11220336 3300017792 Bacteria 651
415 Ga0163161_11317139 3300017792 Bacteria 628
416 Ga0206353_11584542 3300020082 Unclassified 898
417 Ga0207697_10262662 3300025315 Bacteria 764
418 Ga0207656_10082139 3300025321 Unclassified 1450
419 Ga0207656_10137573 3300025321 Bacteria 1149
420 Ga0207653_10008949 3300025885 Bacteria 3124
421 Ga0207692_10368521 3300025898 Bacteria 889
422 Ga0207642_10014429 3300025899 Bacteria 2916
423 Ga0207642_10415577 3300025899 Unclassified 808
424 Ga0207710_10016852 3300025900 Archaea 3094
425 Ga0207688_10002607 3300025901 Bacteria 9755
426 Ga0207688_10003393 3300025901 Bacteria 8686
427 Ga0207688_10031118 3300025901 Bacteria 2945
428 Ga0207688_10033749 3300025901 Bacteria 2831
429 Ga0207688_10081369 3300025901 Bacteria 1850
430 Ga0207688_10248498 3300025901 Bacteria 1077
431 Ga0207680_10532465 3300025903 Bacteria 838
432 Ga0207645_10022120 3300025907 Bacteria 4140
433 Ga0207645_10084423 3300025907 Bacteria 2038
434 Ga0207643_10002023 3300025908 Bacteria 11196
435 Ga0207643_10025022 3300025908 Unclassified 3297
436 Ga0207705_10027306 3300025909 Bacteria 4071
437 Ga0207684_10019475 3300025910 Bacteria 5805
438 Ga0207684_10244472 3300025910 Bacteria 1548
439 Ga0207654_10157131 3300025911 Unclassified 1465
440 Ga0207707_10421024 3300025912 Bacteria 1145
441 Ga0207671_10333132 3300025914 Unclassified 1202
442 Ga0207693_10001432 3300025915 Bacteria 21142
443 Ga0207693_10004838 3300025915 Bacteria 11332
444 Ga0207663_10110384 3300025916 Bacteria 1865
445 Ga0207663_10131634 3300025916 Bacteria 1729
446 Ga0207660_10027789 3300025917 Bacteria 3864
447 Ga0207662_10018197 3300025918 Bacteria 3982
448 Ga0207662_10023638 3300025918 Bacteria 3533
449 Ga0207662_10071346 3300025918 Archaea 2103
450 Ga0207662_10410464 3300025918 Bacteria 920
451 Ga0207657_10006330 3300025919 Bacteria 12297
452 Ga0207657_10114716 3300025919 Bacteria 2221
453 Ga0207649_10262572 3300025920 Bacteria 1248
454 Ga0207652_10358461 3300025921 Unclassified 1316
455 Ga0207652_10506732 3300025921 Bacteria 1086
456 Ga0207652_10701242 3300025921 Unclassified 903
457 Ga0207646_10009493 3300025922 Bacteria 9612
458 Ga0207694_10143128 3300025924 Unclassified 1923
459 Ga0207694_10143533 3300025924 Bacteria 1921
460 Ga0207694_10421023 3300025924 Bacteria 1112
461 Ga0207650_10057330 3300025925 Unclassified 2897
462 Ga0207659_10121756 3300025926 Bacteria 2000
463 Ga0207687_10077879 3300025927 Bacteria 2385
464 Ga0207687_10526155 3300025927 Unclassified 990
465 Ga0207644_10236096 3300025931 Bacteria 1454
466 Ga0207690_10288069 3300025932 Unclassified 1281
467 Ga0207690_10306112 3300025932 Bacteria 1245
468 Ga0207706_10010525 3300025933 Bacteria 8452
469 Ga0207706_10014547 3300025933 Bacteria 7131
470 Ga0207706_10099521 3300025933 Bacteria 2558
471 Ga0207706_10217047 3300025933 Bacteria 1676
472 Ga0207706_10320855 3300025933 Bacteria 1348
473 Ga0207686_10051564 3300025934 Bacteria 2564
474 Ga0207686_10673011 3300025934 Bacteria 820
475 Ga0207686_10746259 3300025934 Bacteria 781
476 Ga0207709_10004029 3300025935 Bacteria 8559
477 Ga0207709_10050362 3300025935 Bacteria 2547
478 Ga0207709_10080099 3300025935 Bacteria 2102
479 Ga0207709_10164195 3300025935 Unclassified 1552
480 Ga0207709_10498600 3300025935 Bacteria 950
481 Ga0207709_10511108 3300025935 Bacteria 939
482 Ga0207709_11116998 3300025935 Unclassified 648
483 Ga0207670_10101189 3300025936 Unclassified 2059
484 Ga0207670_10109467 3300025936 Archaea 1988
485 Ga0207670_11082541 3300025936 Bacteria 676
486 Ga0207669_10003654 3300025937 Bacteria 6678
487 Ga0207669_10051065 3300025937 Bacteria 2475
488 Ga0207669_10293530 3300025937 Bacteria 1232
489 Ga0207704_10018636 3300025938 Archaea 3628
490 Ga0207704_10211308 3300025938 Bacteria 1428
491 Ga0207704_10223787 3300025938 Bacteria 1394
492 Ga0207704_10295378 3300025938 Bacteria 1238
493 Ga0207704_10318772 3300025938 Unclassified 1198
494 Ga0207665_10095246 3300025939 Bacteria 2069
495 Ga0207665_10216825 3300025939 Bacteria 1401
496 Ga0207691_10004005 3300025940 Bacteria 14289
497 Ga0207691_10016003 3300025940 Bacteria 7123
498 Ga0207691_10026907 3300025940 Bacteria 5396
499 Ga0207691_11107296 3300025940 Unclassified 659
500 Ga0207711_10097138 3300025941 Bacteria 2601
501 Ga0207711_10204324 3300025941 Unclassified 1803
502 Ga0207711_10669488 3300025941 Unclassified 968
503 Ga0207689_10013172 3300025942 Archaea 7056
504 Ga0207661_10034257 3300025944 Archaea 3947
505 Ga0207661_10130916 3300025944 Bacteria 2149
506 Ga0207661_10561935 3300025944 Bacteria 1046
507 Ga0207661_10621551 3300025944 Bacteria 992
508 Ga0207679_10054403 3300025945 Bacteria 2946
509 Ga0207679_10395265 3300025945 Unclassified 1215
510 Ga0207679_10455566 3300025945 Unclassified 1135
511 Ga0207667_10171616 3300025949 Bacteria 2229
512 Ga0207667_10280046 3300025949 Bacteria 1704
513 Ga0207667_10709950 3300025949 Bacteria 1007
514 Ga0207651_10238857 3300025960 Bacteria 1479
515 Ga0207651_10272768 3300025960 Bacteria 1394
516 Ga0207651_10711543 3300025960 Bacteria 885
517 Ga0207712_10368692 3300025961 Bacteria 1198
518 Ga0207668_10125752 3300025972 Unclassified 1949
519 Ga0207668_10226566 3300025972 Bacteria 1504
520 Ga0207668_10343761 3300025972 Bacteria 1245
521 Ga0207640_10003852 3300025981 Bacteria 8095
522 Ga0207640_10141404 3300025981 Bacteria 1755
523 Ga0207640_10205986 3300025981 Unclassified 1494
524 Ga0207640_10238631 3300025981 Bacteria 1403
525 Ga0207640_10239298 3300025981 Bacteria 1402
526 Ga0207658_10336637 3300025986 Bacteria 1311
527 Ga0207677_10147593 3300026023 Unclassified 1809
528 Ga0207677_10462440 3300026023 Bacteria 1089
529 Ga0207677_11440775 3300026023 Bacteria 635
530 Ga0207703_10387692 3300026035 Unclassified 1294
531 Ga0207703_10672568 3300026035 Bacteria 983
532 Ga0207639_10067647 3300026041 Bacteria 2780
533 Ga0207639_10083750 3300026041 Bacteria 2532
534 Ga0207678_10013710 3300026067 Archaea 7120
535 Ga0207678_10412608 3300026067 Bacteria 1170
536 Ga0207678_10417254 3300026067 Bacteria 1163
537 Ga0207708_10000760 3300026075 Bacteria 24224
538 Ga0207708_10013914 3300026075 Bacteria 6013
539 Ga0207708_10058599 3300026075 Bacteria 2938
540 Ga0207708_10074394 3300026075 Unclassified 2604
541 Ga0207702_10421937 3300026078 Bacteria 1290
542 Ga0207641_10104193 3300026088 Archaea 2504
543 Ga0207648_10008338 3300026089 Bacteria 10053
544 Ga0207648_10042591 3300026089 Bacteria 3985
545 Ga0207648_10052200 3300026089 Bacteria 3574
546 Ga0207648_10080954 3300026089 Bacteria 2833
547 Ga0207648_10203996 3300026089 Bacteria 1754
548 Ga0207676_10065381 3300026095 Bacteria 2896
549 Ga0207676_10204136 3300026095 Archaea 1748
550 Ga0207674_10000156 3300026116 Bacteria 80650
551 Ga0207674_10216014 3300026116 Bacteria 1866
552 Ga0207675_100003335 3300026118 Bacteria 15717
553 Ga0207675_100008735 3300026118 Bacteria 9516
554 Ga0207675_100020442 3300026118 Bacteria 6171
555 Ga0207675_100033750 3300026118 Archaea 4768
556 Ga0207675_100052136 3300026118 Unclassified 3818
557 Ga0207675_100618802 3300026118 Bacteria 1087
558 Ga0207683_10001662 3300026121 Bacteria 19920
559 Ga0207683_10003793 3300026121 Bacteria 13096
560 Ga0207683_10093159 3300026121 Bacteria 2684
561 Ga0207683_10509562 3300026121 Bacteria 1112
562 Ga0207683_10522159 3300026121 Unclassified 1097
563 Ga0207698_10040895 3300026142 Bacteria 3450
564 Ga0207698_10104261 3300026142 Bacteria 2359
565 Ga0207698_10482844 3300026142 Bacteria 1202
566 Ga0207698_10756107 3300026142 Bacteria 971
567 Ga0207698_10874271 3300026142 Bacteria 905
568 Ga0209966_1008982 3300027695 Bacteria 1780
569 Ga0207428_10013230 3300027907 Bacteria 7219
570 Ga0207428_10014091 3300027907 Bacteria 6962
571 Ga0207428_10023040 3300027907 Bacteria 5243
572 Ga0207428_10026971 3300027907 Bacteria 4786
573 Ga0207428_10027259 3300027907 Archaea 4758
574 Ga0207428_10052131 3300027907 Bacteria 3269
575 Ga0207428_10595189 3300027907 Unclassified 797
576 Ga0268266_10821397 3300028379 Bacteria 898
577 Ga0268266_11998525 3300028379 Unclassified 553
578 Ga0268264_10161296 3300028381 Unclassified 2020
579 Ga0268264_10786122 3300028381 Bacteria 950
580 Ga0307408_100032608 3300031548 Bacteria 3633
581 Ga0307408_100190142 3300031548 Bacteria 1653
582 Ga0307405_10001813 3300031731 Bacteria 9149
583 Ga0307405_10885067 3300031731 Bacteria 754
584 Ga0307413_10363382 3300031824 Bacteria 1121
585 Ga0307406_10072476 3300031901 Bacteria 2261
586 Ga0307407_10086925 3300031903 Bacteria 1906
587 Ga0307412_10023772 3300031911 Bacteria 3776
588 Ga0307412_10250836 3300031911 Bacteria 1374
589 Ga0307409_100001195 3300031995 Bacteria 12446
590 Ga0307409_100044988 3300031995 Bacteria 3329
591 Ga0307416_100011220 3300032002 Bacteria 5957
592 Ga0307416_100423590 3300032002 Bacteria 1376
593 Ga0307414_10015559 3300032004 Bacteria 4593
594 Ga0307411_10054868 3300032005 Bacteria 2619
595 Ga0307411_10068084 3300032005 Bacteria 2398
596 Ga0307415_100006940 3300032126 Bacteria 6152
597 Ga0307415_100101838 3300032126 Bacteria 2108
598 Ga0373958_0063858 3300034819 Bacteria 803
599 Ga0373958_0076411 3300034819 Unclassified 752
600 Ga0373959_0004214 3300034820 Archaea 2310
601 Ga0373949_0053078 3300035090 Unclassified 1026
602 Ga0373945_0198676 3300035116 Bacteria 832
603 Ga0373960_0006030 3300035121 Archaea 2827
604 Ga0373946_0271890 3300035171 Bacteria 832
605 Ga0373961_0019234 3300035241 Archaea 1791
606 Ga0373962_0001783 3300035242 Bacteria 5127
607 Ga0373931_0587956 3300035691 Unclassified 726
608 Ga0373935_0259739 3300035692 Bacteria 1218
609 Ga0373947_0246286 3300035725 Bacteria 1181
610 Ga0395899_0004348 3300037312 Bacteria 11060
611 Ga0395899_0005306 3300037312 Bacteria 10006
612 Ga0395899_0006773 3300037312 Bacteria 8878
613 Ga0395899_0034980 3300037312 Unclassified 3772
614 Ga0395899_0071294 3300037312 Bacteria 2542
615 Ga0395899_0306719 3300037312 Bacteria 1073
616 Ga0395900_0002748 3300037418 Bacteria 19211
617 Ga0395900_0010576 3300037418 Bacteria 9435
618 Ga0395900_0011168 3300037418 Bacteria 9181
619 Ga0395900_0012861 3300037418 Bacteria 8552
620 Ga0395900_0021483 3300037418 Bacteria 6600
621 Ga0395900_0024536 3300037418 Bacteria 6174
622 Ga0395900_0056587 3300037418 Bacteria 4036
623 Ga0395900_0057422 3300037418 Bacteria 4007
624 Ga0395900_0140909 3300037418 Unclassified 2469
625 Ga0395900_0352191 3300037418 Bacteria 1446
626 Ga0395900_0397442 3300037418 Unclassified 1343
627 Ga0395900_0719507 3300037418 Bacteria 931
628 Ga0395900_1163257 3300037418 Bacteria 687
629 Ga0395898_0004644 3300037466 Bacteria 14973
630 Ga0395898_0004773 3300037466 Bacteria 14746
631 Ga0395898_0007284 3300037466 Bacteria 11745
632 Ga0395898_0008187 3300037466 Bacteria 11062
633 Ga0395898_0011507 3300037466 Bacteria 9187
634 Ga0395898_0019216 3300037466 Bacteria 6956
635 Ga0395898_0031134 3300037466 Bacteria 5334
636 Ga0395898_0058222 3300037466 Archaea 3762
637 Ga0395898_0111863 3300037466 Unclassified 2617
638 Ga0395898_0364876 3300037466 Bacteria 1377
639 Ga0395898_1055646 3300037466 Bacteria 747
640 Ga0395898_1324417 3300037466 Bacteria 649
641 Ga0395905_0005256 3300037471 Bacteria 13245
642 Ga0395905_0008250 3300037471 Bacteria 10288
643 Ga0395905_0014153 3300037471 Bacteria 7622
644 Ga0395905_0036212 3300037471 Bacteria 4634
645 Ga0395905_0037437 3300037471 Bacteria 4554
646 Ga0395905_0046765 3300037471 Bacteria 4057
647 Ga0395905_0070640 3300037471 Bacteria 3272
648 Ga0395905_0122828 3300037471 Bacteria 2441
649 Ga0395905_0123239 3300037471 Bacteria 2437
650 Ga0395901_0003097 3300038443 Bacteria 16727
651 Ga0395901_0004483 3300038443 Bacteria 14079
652 Ga0395901_0009567 3300038443 Bacteria 9834
653 Ga0395901_0032052 3300038443 Bacteria 5422
654 Ga0395901_0075575 3300038443 Bacteria 3514
655 Ga0395901_0097195 3300038443 Bacteria 3086
656 Ga0395901_0115356 3300038443 Bacteria 2821
657 Ga0395901_0149312 3300038443 Bacteria 2456
658 Ga0395901_0206841 3300038443 Bacteria 2055
659 Ga0395901_0209342 3300038443 Bacteria 2041
660 Ga0395901_0302976 3300038443 Bacteria 1657
661 Ga0395901_0426423 3300038443 Bacteria 1359
662 Ga0395901_0753539 3300038443 Bacteria 967
663 Ga0395901_0963107 3300038443 Unclassified 831
664 Ga0439453_0036904 3300041408 Unclassified 946
665 Ga0451789_0730060 3300041443 Bacteria 625
666 Ga0451807_1018272 3300041486 Unclassified 2837
667 Ga0451853_3042737 3300041512 Bacteria 538
668 Ga0439448_0060563 3300042005 Bacteria 1251
669 Ga0439463_081380 3300042016 Bacteria 833
670 Ga0450920_076351 3300042122 Bacteria 684
671 Ga0450923_007153 3300042125 Bacteria 1876
672 Ga0450906_044864 3300042145 Bacteria 780
673 Ga0450907_007013 3300042146 Bacteria 1879
674 Ga0439435_0125973 3300042436 Unclassified 806
675 Ga0439460_0153595 3300042461 Unclassified 769
676 Ga0439460_0303399 3300042461 Bacteria 558
677 Ga0439440_0085008 3300042993 Bacteria 842
678 Ga0466960_0747517 3300044901 Unclassified 589
679 Ga0451576_0969523 3300045051 Unclassified 891
680 Ga0495603_0062348 3300046455 Bacteria 2201
681 Ga0495603_0101325 3300046455 Bacteria 1681
682 Ga0495590_0056412 3300046457 Bacteria 1373
683 Ga0495591_122247 3300046458 Unclassified 635
684 Ga0495629_0296460 3300046459 Bacteria 1108
685 Ga0495641_0156043 3300046461 Bacteria 1021
686 Ga0495582_0074420 3300046473 Bacteria 1880
687 Ga0495582_0108816 3300046473 Bacteria 1556
688 Ga0495605_0033189 3300046474 Archaea 2623
689 Ga0495605_0039891 3300046474 Bacteria 2349
690 Ga0495605_0130090 3300046474 Bacteria 1136
691 Ga0495584_0011490 3300046491 Unclassified 4536
692 Ga0495584_0037992 3300046491 Bacteria 2434
693 Ga0495584_0044156 3300046491 Unclassified 2249
694 Ga0495584_0090519 3300046491 Bacteria 1543
695 Ga0495584_0166107 3300046491 Bacteria 1122
696 Ga0495585_0258361 3300046492 Bacteria 867
697 Ga0495585_0272819 3300046492 Bacteria 838
698 Ga0495594_0055152 3300046499 Bacteria 2191
699 Ga0495594_0398380 3300046499 Bacteria 783
700 Ga0495596_0061679 3300046500 Bacteria 1460
701 Ga0495596_0259827 3300046500 Bacteria 674
702 Ga0495583_0116542 3300046506 Unclassified 1128
703 Ga0495616_0099167 3300046513 Bacteria 1368
704 Ga0495620_0071238 3300046515 Bacteria 1422
705 Ga0495630_0849438 3300046517 Bacteria 696
706 Ga0495631_0079726 3300046518 Unclassified 1413
707 Ga0495631_0173179 3300046518 Bacteria 925
708 Ga0495637_0082200 3300046520 Bacteria 1283
709 Ga0495637_0105550 3300046520 Bacteria 1097
710 Ga0495644_0037467 3300046523 Unclassified 1830
711 Ga0495644_0112948 3300046523 Bacteria 1031
712 Ga0495644_0142623 3300046523 Bacteria 915
713 Ga0495644_0172084 3300046523 Bacteria 832
714 Ga0495644_0208322 3300046523 Unclassified 754
715 Ga0495663_0024763 3300046525 Unclassified 1746
716 Ga0495663_0047989 3300046525 Bacteria 1316
717 Ga0495663_0091714 3300046525 Bacteria 991
718 Ga0495666_0147167 3300046526 Bacteria 1096
719 Ga0495642_0024044 3300046528 Bacteria 2409
720 Ga0495642_0088798 3300046528 Bacteria 1307
721 Ga0495642_0183574 3300046528 Bacteria 911
722 Ga0495665_0078872 3300046531 Unclassified 1732
723 Ga0495598_0012782 3300046537 Unclassified 2069
724 Ga0495598_0066578 3300046537 Bacteria 1124
725 Ga0495609_0021345 3300046538 Bacteria 2987
726 Ga0495609_0099970 3300046538 Unclassified 1257
727 Ga0495609_0199550 3300046538 Bacteria 837
728 Ga0495597_0163021 3300046542 Unclassified 909
729 Ga0495656_0224272 3300046615 Bacteria 941
730 Ga0495668_0254543 3300046616 Bacteria 961
731 Ga0495668_0562066 3300046616 Unclassified 630
732 Ga0495611_0168755 3300046648 Bacteria 1023
733 Ga0495659_0055103 3300046664 Unclassified 1456
734 Ga0495659_0244159 3300046664 Bacteria 747
735 Ga0495661_0087667 3300046665 Unclassified 1779
736 Ga0495588_0084886 3300046674 Bacteria 1655
737 Ga0495588_0245878 3300046674 Bacteria 943
738 Ga0495658_0401797 3300046683 Bacteria 873
739 Ga0495669_0030729 3300046684 Archaea 2358
740 Ga0495670_0064904 3300046691 Bacteria 1840
741 Ga0495670_0234395 3300046691 Bacteria 976
742 Ga0495671_0315922 3300046692 Bacteria 750
743 Ga0495589_0010931 3300046794 Bacteria 4715
744 Ga0495589_0276155 3300046794 Bacteria 782
745 Ga0495660_0200212 3300046810 Bacteria 954
746 Ga0495581_0206295 3300047315 Bacteria 1149
747 Ga0495683_0112116 3300047323 Unclassified 1301
748 Ga0495677_0047532 3300047445 Archaea 1575
749 Ga0495677_0124311 3300047445 Bacteria 985
750 Ga0495677_0216816 3300047445 Bacteria 745
751 Ga0495677_0221247 3300047445 Unclassified 737
752 Ga0495673_0189038 3300047469 Unclassified 776
753 Ga0495686_0351765 3300047472 Unclassified 801
754 Ga0495614_0177350 3300048089 Bacteria 958
755 Ga0495615_0073019 3300048090 Bacteria 928
756 Ga0496100_0024806 3300048903 Bacteria 3662
757 Ga0496100_0101405 3300048903 Bacteria 1984
758 Ga0496100_0590448 3300048903 Bacteria 862
759 Ga0496100_0860185 3300048903 Unclassified 711
760 Ga0496100_1076956 3300048903 Bacteria 633
761 Ga0496101_0012970 3300048904 Archaea 5575
762 Ga0496101_0014530 3300048904 Bacteria 5293
763 Ga0496101_0116990 3300048904 Archaea 2012
764 Ga0496101_0246936 3300048904 Unclassified 1390
765 Ga0496101_0320121 3300048904 Bacteria 1217
766 Ga0496102_0000990 3300048905 Bacteria 26698
767 Ga0496102_0176508 3300048905 Unclassified 2012
768 Ga0496102_1016172 3300048905 Bacteria 750
769 Ga0496104_0019090 3300048907 Bacteria 6266
770 Ga0496105_0056456 3300048908 Bacteria 3241
771 Ga0496105_0072857 3300048908 Archaea 2838
772 Ga0496105_0207845 3300048908 Unclassified 1596
773 Ga0496105_0252947 3300048908 Archaea 1427
774 Ga0496105_0313823 3300048908 Bacteria 1258
775 Ga0496106_0004185 3300048909 Bacteria 10754
776 Ga0496106_0062122 3300048909 Bacteria 2835
777 Ga0496106_0098282 3300048909 Archaea 2267
778 Ga0496106_0255798 3300048909 Bacteria 1401
779 Ga0496106_0349934 3300048909 Unclassified 1187
780 Ga0496106_0524335 3300048909 Unclassified 951
781 Ga0496107_0001146 3300048910 Bacteria 16039
782 Ga0496107_0014126 3300048910 Bacteria 5589
783 Ga0496108_0016109 3300048911 Archaea 6093
784 Ga0496108_0061442 3300048911 Archaea 3162
785 Ga0496108_0308495 3300048911 Bacteria 1379
786 Ga0496108_0487990 3300048911 Unclassified 1076
787 Ga0496108_0809422 3300048911 Unclassified 808
788 Ga0496109_0017931 3300048912 Archaea 6214
789 Ga0496109_0162682 3300048912 Bacteria 2091
790 Ga0496109_0209675 3300048912 Bacteria 1832
791 Ga0496109_0293379 3300048912 Bacteria 1533
792 Ga0496109_1219248 3300048912 Bacteria 689
793 Ga0496110_0015030 3300048913 Archaea 6437
794 Ga0496110_0026671 3300048913 Bacteria 4947
795 Ga0496110_0256456 3300048913 Bacteria 1592
796 Ga0496110_0384630 3300048913 Bacteria 1279
797 Ga0496110_0468843 3300048913 Bacteria 1147
798 Ga0496111_0013953 3300048914 Archaea 5478
799 Ga0496111_0031526 3300048914 Archaea 3776
800 Ga0496112_0064751 3300048915 Bacteria 3608
801 Ga0496112_0386277 3300048915 Bacteria 1340
802 Ga0496112_0689187 3300048915 Bacteria 950
803 Ga0496113_0020920 3300048916 Bacteria 4609
804 Ga0496113_0256341 3300048916 Bacteria 1397
805 Ga0496113_0811133 3300048916 Bacteria 743
806 Ga0496114_0018920 3300048917 Bacteria 5578
807 Ga0496114_0048367 3300048917 Archaea 3538
808 Ga0496114_0088183 3300048917 Bacteria 2632
809 Ga0496114_0091784 3300048917 Archaea 2579
810 Ga0496114_0160069 3300048917 Bacteria 1957
811 Ga0496114_0169946 3300048917 Bacteria 1899
812 Ga0496114_0349625 3300048917 Unclassified 1307
813 Ga0496115_0050322 3300048918 Bacteria 3337
814 Ga0496115_0332517 3300048918 Bacteria 1241
815 Ga0501292_025652 3300049515 Bacteria 972
816 Ga0501031_0002040 3300049568 Bacteria 12709
817 Ga0501031_0011335 3300049568 Bacteria 5806
818 Ga0501031_0018235 3300049568 Bacteria 4567
819 Ga0501031_0058959 3300049568 Bacteria 2502
820 Ga0501031_0097481 3300049568 Bacteria 1919
821 Ga0501031_0176349 3300049568 Bacteria 1396
822 Ga0501032_0010152 3300049569 Bacteria 6795
823 Ga0501032_0019630 3300049569 Bacteria 4724
824 Ga0501032_0056794 3300049569 Bacteria 2630
825 Ga0501032_0184625 3300049569 Bacteria 1364
826 Ga0501033_0005477 3300049570 Bacteria 10051
827 Ga0501033_0008600 3300049570 Bacteria 7901
828 Ga0501033_0008837 3300049570 Bacteria 7780
829 Ga0501033_0083439 3300049570 Bacteria 2342
830 Ga0501033_0283115 3300049570 Bacteria 1170
831 Ga0501033_0483880 3300049570 Bacteria 857
832 Ga0501033_1024739 3300049570 Unclassified 551
833 Ga0501034_0021497 3300049571 Bacteria 6576
834 Ga0501034_0153028 3300049571 Bacteria 2282
835 Ga0501034_0447954 3300049571 Bacteria 1209
836 Ga0501036_0000886 3300049572 Bacteria 22368
837 Ga0501036_0001073 3300049572 Bacteria 20711
838 Ga0501036_0046903 3300049572 Bacteria 3659
839 Ga0501036_0061223 3300049572 Bacteria 3188
840 Ga0501036_0078334 3300049572 Bacteria 2795
841 Ga0501036_0111687 3300049572 Unclassified 2309
842 Ga0501036_0114311 3300049572 Bacteria 2281
843 Ga0501036_0188534 3300049572 Bacteria 1735
844 Ga0501036_0189820 3300049572 Unclassified 1729
845 Ga0501036_0485742 3300049572 Bacteria 1028
846 Ga0501037_0003930 3300049573 Bacteria 10783
847 Ga0501037_0006125 3300049573 Bacteria 8787
848 Ga0501037_0006716 3300049573 Bacteria 8417
849 Ga0501037_0048628 3300049573 Bacteria 3106
850 Ga0501037_0121648 3300049573 Bacteria 1876
851 Ga0501037_0394038 3300049573 Unclassified 950
852 Ga0501037_0582074 3300049573 Bacteria 753
853 Ga0501038_0005987 3300049574 Bacteria 11250
854 Ga0501038_0011094 3300049574 Bacteria 8228
855 Ga0501038_0015520 3300049574 Bacteria 6923
856 Ga0501038_0029623 3300049574 Bacteria 4848
857 Ga0501038_0068333 3300049574 Unclassified 3020
858 Ga0501038_0123022 3300049574 Bacteria 2137
859 Ga0501039_0017469 3300049575 Bacteria 5503
860 Ga0501039_0040318 3300049575 Unclassified 3605
861 Ga0501039_0044220 3300049575 Bacteria 3439
862 Ga0501039_0057722 3300049575 Bacteria 3005
863 Ga0501039_0064269 3300049575 Bacteria 2844
864 Ga0501039_0107410 3300049575 Bacteria 2180
865 Ga0501039_0238303 3300049575 Bacteria 1430
866 Ga0501039_0344271 3300049575 Bacteria 1171
867 Ga0501039_0419582 3300049575 Unclassified 1051
868 Ga0501039_0834969 3300049575 Bacteria 718
869 Ga0501039_0877247 3300049575 Bacteria 699
870 Ga0501040_0004527 3300049576 Bacteria 9020
871 Ga0501040_0006935 3300049576 Bacteria 7335
872 Ga0501040_0010841 3300049576 Bacteria 5957
873 Ga0501040_0012989 3300049576 Bacteria 5475
874 Ga0501040_0037918 3300049576 Bacteria 3276
875 Ga0501040_0044156 3300049576 Bacteria 3038
876 Ga0501040_0049347 3300049576 Bacteria 2877
877 Ga0501040_0365298 3300049576 Bacteria 1034
878 Ga0501040_0898678 3300049576 Unclassified 642
879 Ga0501041_0004504 3300049577 Bacteria 8078
880 Ga0501041_0009919 3300049577 Bacteria 5609
881 Ga0501041_0015604 3300049577 Bacteria 4511
882 Ga0501041_0016089 3300049577 Bacteria 4442
883 Ga0501041_0021904 3300049577 Archaea 3828
884 Ga0501041_0037667 3300049577 Bacteria 2931
885 Ga0501041_0041807 3300049577 Bacteria 2784
886 Ga0501041_0090211 3300049577 Bacteria 1892
887 Ga0501041_0211477 3300049577 Bacteria 1216
888 Ga0501041_0216526 3300049577 Bacteria 1201
889 Ga0501041_0369758 3300049577 Unclassified 907
890 Ga0501041_0433023 3300049577 Bacteria 834
891 Ga0501042_0001919 3300049578 Bacteria 12505
892 Ga0501042_0004719 3300049578 Bacteria 8699
893 Ga0501042_0009305 3300049578 Bacteria 6541
894 Ga0501042_0014736 3300049578 Bacteria 5338
895 Ga0501042_0101174 3300049578 Bacteria 2072
896 Ga0501042_0170209 3300049578 Bacteria 1572
897 Ga0501042_0208136 3300049578 Bacteria 1410
898 Ga0501042_0346324 3300049578 Unclassified 1074
899 Ga0501042_0378019 3300049578 Bacteria 1025
900 Ga0501043_0012210 3300049579 Bacteria 6714
901 Ga0501043_0017880 3300049579 Bacteria 5559
902 Ga0501043_0018898 3300049579 Bacteria 5408
903 Ga0501043_0019923 3300049579 Bacteria 5267
904 Ga0501043_0128872 3300049579 Unclassified 1983
905 Ga0501043_0130566 3300049579 Unclassified 1969
906 Ga0501046_0005087 3300049580 Bacteria 11792
907 Ga0501046_0008327 3300049580 Bacteria 9047
908 Ga0501046_0009146 3300049580 Bacteria 8580
909 Ga0501046_0046523 3300049580 Bacteria 3443
910 Ga0501046_0096178 3300049580 Unclassified 2275
911 Ga0501046_0362616 3300049580 Bacteria 1051
912 Ga0501046_0652039 3300049580 Bacteria 744
913 Ga0501046_0762406 3300049580 Bacteria 679
914 Ga0501047_0021938 3300049581 Bacteria 6132
915 Ga0501048_0012692 3300049582 Bacteria 6264
916 Ga0501048_0012846 3300049582 Bacteria 6221
917 Ga0501048_0014745 3300049582 Bacteria 5782
918 Ga0501048_0020631 3300049582 Bacteria 4829
919 Ga0501048_0024160 3300049582 Bacteria 4437
920 Ga0501048_0030498 3300049582 Bacteria 3902
921 Ga0501048_0036094 3300049582 Bacteria 3554
922 Ga0501048_0441559 3300049582 Bacteria 931
923 Ga0501048_0866906 3300049582 Unclassified 649
924 Ga0501067_0030915 3300049583 Bacteria 2971
925 Ga0501067_0031743 3300049583 Bacteria 2931
926 Ga0501067_0540610 3300049583 Bacteria 652
927 Ga0501068_0004660 3300049584 Bacteria 7463
928 Ga0501068_0048689 3300049584 Bacteria 2559
929 Ga0501068_0049958 3300049584 Archaea 2527
930 Ga0501068_0055663 3300049584 Unclassified 2396
931 Ga0501068_0123225 3300049584 Bacteria 1617
932 Ga0501068_0158228 3300049584 Unclassified 1427
933 Ga0501069_0001693 3300049585 Bacteria 10972
934 Ga0501069_0006904 3300049585 Bacteria 5933
935 Ga0501069_0009502 3300049585 Bacteria 5133
936 Ga0501069_0024077 3300049585 Bacteria 3321
937 Ga0501069_0063974 3300049585 Bacteria 2055
938 Ga0501070_0004629 3300049586 Bacteria 11798
939 Ga0501070_0004913 3300049586 Bacteria 11416
940 Ga0501070_0086101 3300049586 Unclassified 2601
941 Ga0501070_0100829 3300049586 Bacteria 2388
942 Ga0501070_0157560 3300049586 Bacteria 1873
943 Ga0501070_0399870 3300049586 Bacteria 1111
944 Ga0501071_0000999 3300049587 Bacteria 15523
945 Ga0501071_0005011 3300049587 Bacteria 8461
946 Ga0501071_0005104 3300049587 Bacteria 8403
947 Ga0501071_0006333 3300049587 Bacteria 7675
948 Ga0501071_0011941 3300049587 Bacteria 5869
949 Ga0501071_0012312 3300049587 Bacteria 5797
950 Ga0501071_0053929 3300049587 Archaea 2900
951 Ga0501071_0072340 3300049587 Bacteria 2514
952 Ga0501071_0076570 3300049587 Bacteria 2443
953 Ga0501071_0107680 3300049587 Bacteria 2058
954 Ga0501071_0145002 3300049587 Bacteria 1770
955 Ga0501071_0219263 3300049587 Unclassified 1431
956 Ga0501071_0502232 3300049587 Bacteria 930
957 Ga0501071_0811865 3300049587 Bacteria 721
958 Ga0501072_0004838 3300049588 Bacteria 10253
959 Ga0501072_0008260 3300049588 Bacteria 7908
960 Ga0501072_0009743 3300049588 Bacteria 7306
961 Ga0501072_0015780 3300049588 Bacteria 5791
962 Ga0501072_0049222 3300049588 Archaea 3317
963 Ga0501072_0053229 3300049588 Bacteria 3187
964 Ga0501072_0061041 3300049588 Unclassified 2972
965 Ga0501072_0123755 3300049588 Bacteria 2060
966 Ga0501072_0129323 3300049588 Bacteria 2012
967 Ga0501072_0132980 3300049588 Bacteria 1983
968 Ga0501072_0855754 3300049588 Unclassified 711
969 Ga0501073_0011249 3300049589 Bacteria 6546
970 Ga0501073_0039547 3300049589 Bacteria 3340
971 Ga0501073_0078997 3300049589 Bacteria 2290
972 Ga0501073_0092780 3300049589 Bacteria 2098
973 Ga0501073_0542958 3300049589 Bacteria 803
974 Ga0501074_0013907 3300049590 Bacteria 5848
975 Ga0501074_0021338 3300049590 Bacteria 4703
976 Ga0501074_0024865 3300049590 Bacteria 4351
977 Ga0501074_0031203 3300049590 Bacteria 3860
978 Ga0501074_0058304 3300049590 Bacteria 2781
979 Ga0501074_0089802 3300049590 Bacteria 2200
980 Ga0501074_0236494 3300049590 Bacteria 1300
981 Ga0501074_0659723 3300049590 Bacteria 739
982 Ga0501074_0769906 3300049590 Bacteria 678
983 Ga0501075_0003257 3300049591 Bacteria 10867
984 Ga0501075_0007314 3300049591 Bacteria 7657
985 Ga0501075_0011550 3300049591 Bacteria 6251
986 Ga0501075_0014974 3300049591 Bacteria 5563
987 Ga0501075_0047476 3300049591 Bacteria 3226
988 Ga0501075_0093057 3300049591 Bacteria 2289
989 Ga0501075_0161851 3300049591 Unclassified 1707
990 Ga0501075_0317319 3300049591 Bacteria 1188
991 Ga0501075_0712432 3300049591 Unclassified 764
992 Ga0501075_1142663 3300049591 Bacteria 591
993 Ga0501075_1148930 3300049591 Bacteria 589
994 Ga0501076_0002512 3300049592 Bacteria 12627
995 Ga0501076_0009539 3300049592 Bacteria 7164
996 Ga0501076_0028300 3300049592 Unclassified 4350
997 Ga0501076_0028561 3300049592 Bacteria 4332
998 Ga0501076_0082214 3300049592 Bacteria 2585
999 Ga0501076_0101717 3300049592 Unclassified 2316
1000 Ga0501076_0127759 3300049592 Bacteria 2060
1001 Ga0501076_0209315 3300049592 Bacteria 1593
1002 Ga0501076_0291945 3300049592 Bacteria 1336
1003 Ga0501076_0366513 3300049592 Bacteria 1184
1004 Ga0501076_0471043 3300049592 Bacteria 1034
1005 Ga0501077_0004980 3300049593 Bacteria 8053
1006 Ga0501077_0005213 3300049593 Bacteria 7896
1007 Ga0501077_0007480 3300049593 Bacteria 6740
1008 Ga0501077_0008613 3300049593 Bacteria 6323
1009 Ga0501077_0009922 3300049593 Bacteria 5927
1010 Ga0501077_0058420 3300049593 Bacteria 2448
1011 Ga0501077_0162461 3300049593 Bacteria 1418
1012 Ga0501077_0172717 3300049593 Unclassified 1373
1013 Ga0501077_0192551 3300049593 Bacteria 1295
1014 Ga0501077_0193904 3300049593 Bacteria 1291
1015 Ga0501077_0409066 3300049593 Bacteria 867
1016 Ga0501077_0451356 3300049593 Bacteria 823
1017 Ga0501077_0806451 3300049593 Unclassified 604
1018 Ga0501209_057763 3300049656 Bacteria 1075
1019 Ga0501079_0005554 3300049741 Bacteria 9404
1020 Ga0501079_0007606 3300049741 Bacteria 8206
1021 Ga0501079_0021858 3300049741 Bacteria 4898
1022 Ga0501079_0046146 3300049741 Archaea 3361
1023 Ga0501079_0060060 3300049741 Bacteria 2933
1024 Ga0501079_0066142 3300049741 Unclassified 2789
1025 Ga0501079_0091708 3300049741 Bacteria 2354
1026 Ga0501079_0344434 3300049741 Bacteria 1167
1027 Ga0501079_0625381 3300049741 Bacteria 847
1028 Ga0501079_0745556 3300049741 Bacteria 771
1029 Ga0501080_0011231 3300049742 Bacteria 8197
1030 Ga0501080_0015179 3300049742 Bacteria 7097
1031 Ga0501080_0025490 3300049742 Bacteria 5488
1032 Ga0501080_0027797 3300049742 Bacteria 5259
1033 Ga0501080_0065341 3300049742 Bacteria 3384
1034 Ga0501080_0089971 3300049742 Bacteria 2852
1035 Ga0501081_0002584 3300049743 Bacteria 11441
1036 Ga0501081_0005329 3300049743 Bacteria 8294
1037 Ga0501081_0035759 3300049743 Bacteria 3382
1038 Ga0501081_0077964 3300049743 Bacteria 2316
1039 Ga0501081_0078815 3300049743 Unclassified 2303
1040 Ga0501081_0088991 3300049743 Bacteria 2169
1041 Ga0501081_0112896 3300049743 Bacteria 1929
1042 Ga0501081_0170109 3300049743 Bacteria 1573
1043 Ga0501081_0305887 3300049743 Bacteria 1166
1044 Ga0501081_0316420 3300049743 Bacteria 1146
1045 Ga0501081_1005301 3300049743 Bacteria 630
1046 Ga0501083_0007601 3300049744 Bacteria 7675
1047 Ga0501083_0021557 3300049744 Bacteria 4475
1048 Ga0501083_0030996 3300049744 Bacteria 3670
1049 Ga0501083_0040735 3300049744 Bacteria 3153
1050 Ga0501083_0087538 3300049744 Bacteria 2059
1051 Ga0501083_0578299 3300049744 Unclassified 731
1052 Ga0501035_0001297 3300049822 Bacteria 25816
1053 Ga0501035_0008968 3300049822 Bacteria 9303
1054 Ga0501035_0009607 3300049822 Bacteria 8996
1055 Ga0501035_0021581 3300049822 Bacteria 5921
1056 Ga0501035_0222709 3300049822 Bacteria 1610
1057 Ga0501035_0237994 3300049822 Bacteria 1549
1058 Ga0501035_0365008 3300049822 Unclassified 1206
1059 Ga0501035_0447148 3300049822 Bacteria 1069
1060 Ga0501035_0460381 3300049822 Unclassified 1051
1061 Ga0501044_0012904 3300049823 Bacteria 9044
1062 Ga0501044_0025083 3300049823 Bacteria 6323
1063 Ga0501044_0166259 3300049823 Bacteria 2180
1064 Ga0501044_0268176 3300049823 Bacteria 1644
1065 Ga0501045_0000294 3300049824 Bacteria 29182
1066 Ga0501045_0003491 3300049824 Bacteria 10756
1067 Ga0501045_0009860 3300049824 Bacteria 6681
1068 Ga0501045_0018316 3300049824 Bacteria 4980
1069 Ga0501045_0018917 3300049824 Bacteria 4904
1070 Ga0501045_0031439 3300049824 Bacteria 3845
1071 Ga0501045_0041762 3300049824 Bacteria 3337
1072 Ga0501045_0068704 3300049824 Bacteria 2603
1073 Ga0501045_0079948 3300049824 Unclassified 2410
1074 Ga0501045_0083114 3300049824 Bacteria 2362
1075 Ga0501045_0091344 3300049824 Bacteria 2250
1076 nmdc:mga05p37_1196845_c1 3300050507 Bacteria 785
1077 nmdc:mga05p37_127268_c1 3300050507 Bacteria 1349
1078 nmdc:mga05p37_383670_c1 3300050507 Unclassified 1646
1079 nmdc:mga05p37_532_c2 3300050507 Bacteria 11832
1080 nmdc:mga09592_2291_c1 3300050508 Bacteria 15434
1081 nmdc:mga09592_297383_c1 3300050508 Unclassified 1400
1082 nmdc:mga0qj67_133148_c1 3300050509 Bacteria 2014
1083 nmdc:mga0qj67_144194_c1 3300050509 Bacteria 1931
1084 nmdc:mga06r32_12732_c1 3300050510 Bacteria 7604
1085 nmdc:mga06r32_393625_c1 3300050510 Bacteria 1368
1086 nmdc:mga06r32_71140_c1 3300050510 Bacteria 3366
1087 nmdc:mga06r32_80912_c1 3300050510 Bacteria 3162
1088 nmdc:mga08y16_129628_c1 3300050511 Unclassified 2624
1089 nmdc:mga08y16_45251_c1 3300050511 Archaea 4612
1090 nmdc:mga08y16_50001_c1 3300050511 Bacteria 4374
1091 nmdc:mga08y16_6843_c1 3300050511 Bacteria 11955
1092 nmdc:mga08y16_823370_c1 3300050511 Bacteria 920
1093 nmdc:mga08y16_911186_c1 3300050511 Bacteria 865
1094 nmdc:mga0n895_181588_c1 3300050512 Bacteria 2136
1095 nmdc:mga0n895_584031_c1 3300050512 Bacteria 1121
1096 nmdc:mga0rr50_37744_c1 3300050513 Bacteria 3491
1097 nmdc:mga0a205_182997_c1 3300050515 Bacteria 1989
1098 nmdc:mga0a205_253073_c1 3300050515 Bacteria 1640
1099 nmdc:mga0a205_886168_c1 3300050515 Bacteria 739
1100 nmdc:mga0a205_95480_c1 3300050515 Bacteria 2872
1101 Ga0495655_0105643 3300053083 Bacteria 840
1102 Ga0495655_0107543 3300053083 Unclassified 834
1103 Ga0495655_0249331 3300053083 Bacteria 596
1104 Ga0501084_0004955 3300054114 Bacteria 10884
1105 Ga0501084_0006048 3300054114 Bacteria 9952
1106 Ga0501084_0040057 3300054114 Bacteria 3918
1107 Ga0501084_0051541 3300054114 Bacteria 3444
1108 Ga0501084_0059960 3300054114 Bacteria 3186
1109 Ga0501084_0062141 3300054114 Bacteria 3126
1110 Ga0501084_0095033 3300054114 Bacteria 2503
1111 Ga0501084_0146941 3300054114 Bacteria 1986
1112 Ga0501084_0182141 3300054114 Bacteria 1773
1113 Ga0501084_0200974 3300054114 Bacteria 1681
1114 Ga0501084_0594151 3300054114 Bacteria 935
1115 Ga0501082_0000584 3300060353 Bacteria 32310
1116 Ga0501082_0004443 3300060353 Bacteria 12245
1117 Ga0501082_0025954 3300060353 Bacteria 5050
1118 Ga0501082_0038520 3300060353 Archaea 4125
1119 Ga0501082_0040890 3300060353 Bacteria 3997
1120 Ga0501082_0107883 3300060353 Bacteria 2409
1121 Ga0501082_0193799 3300060353 Bacteria 1767
1122 Ga0501082_0506737 3300060353 Bacteria 1055
1123 Ga0501082_0914193 3300060353 Bacteria 767
1124 Ga0530510_0002385 3300061734 Bacteria 12927
1125 Ga0530510_0002770 3300061734 Bacteria 12051
1126 Ga0530510_0008577 3300061734 Bacteria 7138
1127 Ga0530510_0034759 3300061734 Bacteria 3631
1128 Ga0530510_0041119 3300061734 Bacteria 3337
1129 Ga0530510_0041547 3300061734 Bacteria 3320
1130 Ga0530510_0068164 3300061734 Bacteria 2581
1131 Ga0530510_0207111 3300061734 Bacteria 1457
1132 Ga0530510_0364766 3300061734 Bacteria 1086
1133 Ga0530510_0550775 3300061734 Bacteria 876
1134 Ga0530510_0561225 3300061734 Bacteria 867
1135 Ga0530510_0781479 3300061734 Unclassified 728
1136 Ga0530510_0786542 3300061734 Bacteria 726
1137 Ga0207695_10349299
1138 JGI24746J21847_1023075
1139 JGI24747J21853_1002478
1140 JGI24747J21853_1002619
1141 JGI24739J22299_10056390
1142 JGI24737J22298_10126685
1143 JGI24738J21930_10014188
1144 JGI24744J21845_10010675
1145 JGI25406J46586_10059686
1146 JGI25407J50210_10002984
1147 JGI25407J50210_10007520
1148 JGI25407J50210_10024604
1149 JGI25407J50210_10041967
1150 Ga0070658_10282327
1151 Ga0070658_10620589
1152 Ga0070676_10016464
1153 Ga0070683_100003925
1154 Ga0070683_100009447
1155 Ga0070683_100108205
1156 Ga0070683_100141718
1157 Ga0070670_100553389
1158 Ga0070677_10162324
1159 Ga0068869_100257223
1160 Ga0068869_100425317
1161 Ga0070666_10263690
1162 Ga0070680_100301197
1163 Ga0070680_100897501
1164 Ga0070680_100928696
1165 Ga0070682_100004426
1166 Ga0070682_100005044
1167 Ga0070682_100420282
1168 Ga0068868_100037260
1169 Ga0068868_100423169
1170 Ga0070660_100036138
1171 Ga0070660_100218791
1172 Ga0070660_100329719
1173 Ga0070660_100369238
1174 Ga0070689_100007583
1175 Ga0070689_100066466
1176 Ga0070689_100200205
1177 Ga0070689_100294205
1178 Ga0070691_10369955
1179 Ga0070687_100112212
1180 Ga0070687_100211575
1181 Ga0070661_100072981
1182 Ga0070661_100839525
1183 Ga0070692_10020164
1184 Ga0070692_10026208
1185 Ga0070692_10027734
1186 Ga0070692_10152707
1187 Ga0070692_10246109
1188 Ga0070692_10939053
1189 Ga0070668_100159315
1190 Ga0070668_100207387
1191 Ga0070668_100541116
1192 Ga0070668_101209453
1193 Ga0070669_100114906
1194 Ga0070675_100019038
1195 Ga0070675_100040341
1196 Ga0070675_100152539
1197 Ga0070675_101338934
1198 Ga0070671_100016569
1199 Ga0070671_100533134
1200 Ga0070674_100003185
1201 Ga0070674_100003686
1202 Ga0070674_100005915
1203 Ga0070674_100023351
1204 Ga0070674_100025544
1205 Ga0070674_100266281
1206 Ga0070673_100002906
1207 Ga0070673_100062384
1208 Ga0070673_100174202
1209 Ga0070688_100002023
1210 Ga0070688_100003324
1211 Ga0070688_100526215
1212 Ga0070659_100005741
1213 Ga0070659_100054870
1214 Ga0070659_100421790
1215 Ga0070659_100479468
1216 Ga0070667_100992807
1217 Ga0070703_10018421
1218 Ga0070709_11081122
1219 Ga0070714_100812219
1220 Ga0070710_10004290
1221 Ga0070701_10018494
1222 Ga0070701_10057995
1223 Ga0070701_10067481
1224 Ga0070701_10197692
1225 Ga0070701_10773223
1226 Ga0070705_100026575
1227 Ga0070705_100083531
1228 Ga0070705_100145312
1229 Ga0070705_101047474
1230 Ga0070700_100065742
1231 Ga0070700_100091470
1232 Ga0070700_100213282
1233 Ga0070700_100214718
1234 Ga0070700_100220524
1235 Ga0070700_100356766
1236 Ga0070700_100404593
1237 Ga0070694_100168350
1238 Ga0070708_100033983
1239 Ga0070708_100050577
1240 Ga0070708_100724582
1241 Ga0070678_100085755
1242 Ga0070678_100192821
1243 Ga0070678_100363225
1244 Ga0070678_100565631
1245 Ga0070678_100896334
1246 Ga0070662_100012523
1247 Ga0070662_100198485
1248 Ga0070662_100212519
1249 Ga0070681_10557749
1250 Ga0070681_11011889
1251 Ga0068867_100009057
1252 Ga0068867_100023897
1253 Ga0068867_100037848
1254 Ga0068867_100081054
1255 Ga0068867_100235644
1256 Ga0070685_10030640
1257 Ga0070685_10043751
1258 Ga0070685_10307345
1259 Ga0070685_10399322
1260 Ga0070706_100022133
1261 Ga0070706_100244191
1262 Ga0070706_100286048
1263 Ga0070706_100681634
1264 Ga0070707_100008845
1265 Ga0070698_100035630
1266 Ga0070698_100098128
1267 Ga0070699_100004014
1268 Ga0070699_100023745
1269 Ga0070699_101087399
1270 Ga0070679_100066648
1271 Ga0070679_100232563
1272 Ga0070679_101693971
1273 Ga0070684_100022742
1274 Ga0070684_100060915
1275 Ga0070684_100454881
1276 Ga0070684_100497926
1277 Ga0070684_100909235
1278 Ga0068853_100014245
1279 Ga0068853_100059158
1280 Ga0070672_100003708
1281 Ga0070672_100005767
1282 Ga0070672_100353089
1283 Ga0070672_101058692
1284 Ga0070686_100014120
1285 Ga0070686_100020025
1286 Ga0070686_100074470
1287 Ga0070686_100096324
1288 Ga0070686_100470228
1289 Ga0070695_100040070
1290 Ga0070695_100790592
1291 Ga0070695_101045979
1292 Ga0070696_100007874
1293 Ga0070696_100012124
1294 Ga0070696_100050820
1295 Ga0070696_100443549
1296 Ga0070696_100506750
1297 Ga0070693_100010968
1298 Ga0070693_100032271
1299 Ga0070665_101228430
1300 Ga0070665_101259555
1301 Ga0070704_100004138
1302 Ga0070704_100005421
1303 Ga0070704_100041253
1304 Ga0070704_100186542
1305 Ga0070704_100791388
1306 Ga0068855_100023324
1307 Ga0068855_100273760
1308 Ga0068855_101100678
1309 Ga0070664_100047814
1310 Ga0070664_100070442
1311 Ga0070664_100403434
1312 Ga0070664_100664708
1313 Ga0070664_100775322
1314 Ga0068857_100000728
1315 Ga0068857_100291929
1316 Ga0068854_100002077
1317 Ga0068854_100370761
1318 Ga0068854_100535857
1319 Ga0068856_100016532
1320 Ga0068856_100296562
1321 Ga0070702_100052421
1322 Ga0070702_100061145
1323 Ga0070702_100073889
1324 Ga0070702_100090115
1325 Ga0070702_100132237
1326 Ga0068852_100003129
1327 Ga0068852_100023602
1328 Ga0068852_101092066
1329 Ga0068852_101767907
1330 Ga0068859_100007178
1331 Ga0068859_100178990
1332 Ga0068859_100320544
1333 Ga0068859_101481044
1334 Ga0068864_100288905
1335 Ga0068864_100400930
1336 Ga0068864_101438311
1337 Ga0068864_101832309
1338 Ga0068866_10271045
1339 Ga0068866_10635309
1340 Ga0068866_10643364
1341 Ga0068861_100301544
1342 Ga0068861_100329306
1343 Ga0068861_100388191
1344 Ga0068861_100440296
1345 Ga0068851_10016536
1346 Ga0068851_10542457
1347 Ga0068870_10028562
1348 Ga0068870_10031844
1349 Ga0068870_10613789
1350 Ga0068863_100108758
1351 Ga0068858_100010201
1352 Ga0068858_100156124
1353 Ga0068858_100305872
1354 Ga0068858_100428880
1355 Ga0068860_100034858
1356 Ga0068860_100622404
1357 Ga0068860_100813720
1358 Ga0068860_100832838
1359 Ga0068862_100181970
1360 Ga0068862_100219956
1361 Ga0081455_10003417
1362 Ga0081455_10005594
1363 Ga0081455_10056065
1364 Ga0081455_10200195
1365 Ga0081455_10648089
1366 Ga0081538_10000080
1367 Ga0081538_10000144
1368 Ga0081538_10000231
1369 Ga0081538_10000667
1370 Ga0081538_10002291
1371 Ga0081538_10005049
1372 Ga0081538_10012554
1373 Ga0081538_10043132
1374 Ga0081538_10050060
1375 Ga0081538_10080682
1376 Ga0081539_10000452
1377 Ga0081539_10011583
1378 Ga0075365_10009783
1379 Ga0075432_10005071
1380 Ga0075432_10015202
1381 Ga0075432_10053012
1382 Ga0075432_10084539
1383 Ga0070715_10014164
1384 Ga0070716_100179839
1385 Ga0070716_100313760
1386 Ga0070712_100001977
1387 Ga0070712_100052849
1388 Ga0075362_10079235
1389 Ga0097621_100145977
1390 Ga0097621_100309270
1391 Ga0097621_100580338
1392 Ga0068871_100018627
1393 Ga0068871_100158924
1394 Ga0068871_100488358
1395 Ga0068871_100523613
1396 Ga0068871_100997292
1397 Ga0068871_101103623
1398 Ga0075428_100013149
1399 Ga0075428_100085963
1400 Ga0075428_100238223
1401 Ga0075430_100016098
1402 Ga0075430_100055457
1403 Ga0075430_100083814
1404 Ga0075430_100116008
1405 Ga0075431_100005512
1406 Ga0075431_100117193
1407 Ga0075431_100167100
1408 Ga0075431_100428561
1409 Ga0075433_10565747
1410 Ga0075434_100040445
1411 Ga0075434_100379247
1412 Ga0075429_100017339
1413 Ga0075429_100107051
1414 Ga0075429_101029327
1415 Ga0075429_101448875
1416 Ga0068865_100082075
1417 Ga0068865_100086223
1418 Ga0068865_100222591
1419 Ga0068865_100240685
1420 Ga0068865_100449984
1421 Ga0068865_100473444
1422 Ga0068865_100604970
1423 Ga0075436_100028486
1424 Ga0097620_100007178
1425 Ga0097620_100178999
1426 Ga0097620_100320545
1427 Ga0097620_101481283
1428 Ga0075435_100094831
1429 Ga0105244_10039248
1430 Ga0105240_10596601
1431 Ga0105240_11348218
1432 Ga0111539_10003600
1433 Ga0111539_10027451
1434 Ga0111539_10038708
1435 Ga0111539_10077139
1436 Ga0111539_10252521
1437 Ga0111539_10262375
1438 Ga0111539_11293120
1439 Ga0111539_11753510
1440 Ga0111539_12263717
1441 Ga0105245_10003898
1442 Ga0105245_10018405
1443 Ga0105245_10142426
1444 Ga0105245_10155368
1445 Ga0105245_10184423
1446 Ga0105245_10335082
1447 Ga0105247_10264307
1448 Ga0114129_10034544
1449 Ga0114129_10224897
1450 Ga0114129_10225871
1451 Ga0114129_10472712
1452 Ga0114129_10698651
1453 Ga0114129_11869758
1454 Ga0114129_12327259
1455 Ga0105243_10015986
1456 Ga0105243_10109339
1457 Ga0105243_10155968
1458 Ga0105243_10193181
1459 Ga0105243_10624510
1460 Ga0105241_10039256
1461 Ga0105241_10388316
1462 Ga0105242_10017423
1463 Ga0105242_10021167
1464 Ga0105242_10096129
1465 Ga0105242_10161307
1466 Ga0105242_10556071
1467 Ga0105242_11086372
1468 Ga0105248_10039405
1469 Ga0105248_10064598
1470 Ga0105248_10073671
1471 Ga0105248_10191974
1472 Ga0105248_10557329
1473 Ga0105248_10758936
1474 Ga0105237_10048944
1475 Ga0105238_10015083
1476 Ga0105238_10042589
1477 Ga0105238_10956076
1478 Ga0105238_11319815
1479 Ga0105249_10005190
1480 Ga0105249_10028478
1481 Ga0105249_10338381
1482 Ga0105249_10683346
1483 Ga0105249_11290673
1484 Ga0105239_10003612
1485 Ga0105239_10011361
1486 Ga0105239_10014264
1487 Ga0105239_10097832
1488 Ga0105239_10142611
1489 Ga0105239_10350401
1490 Ga0105246_10016979
1491 Ga0105246_10037305
1492 Ga0105246_10108436
1493 Ga0105246_10160863
1494 Ga0157324_1010787
1495 Ga0157342_1006264
1496 Ga0157315_1009579
1497 Ga0157338_1002008
1498 Ga0157373_10060991
1499 Ga0157371_10006307
1500 Ga0157371_10035578
1501 Ga0157371_10371427
1502 Ga0157371_10573702
1503 Ga0157369_10784852
1504 Ga0157369_11842336
1505 Ga0157374_10053364
1506 Ga0157374_10204761
1507 Ga0157378_10010906
1508 Ga0157378_10315065
1509 Ga0157378_10316676
1510 Ga0157378_10788119
1511 Ga0157378_11550472
1512 Ga0163162_10011370
1513 Ga0163162_10027414
1514 Ga0163162_10079016
1515 Ga0163162_10154494
1516 Ga0163162_10199801
1517 Ga0163162_10279805
1518 Ga0163162_10325080
1519 Ga0163162_11070544
1520 Ga0157372_10012819
1521 Ga0157372_10085638
1522 Ga0157372_10522207
1523 Ga0157375_10002897
1524 Ga0157375_10004110
1525 Ga0157375_10093364
1526 Ga0157375_10129225
1527 Ga0157375_10132609
1528 Ga0163163_10094337
1529 Ga0163163_10225073
1530 Ga0163163_10314021
1531 Ga0163163_10356525
1532 Ga0157380_10007447
1533 Ga0157380_10132317
1534 Ga0157380_10522640
1535 Ga0182008_10180462
1536 Ga0157377_10001024
1537 Ga0157377_10039358
1538 Ga0157377_11232458
1539 Ga0157379_10108056
1540 Ga0157379_10231771
1541 Ga0157379_10360086
1542 Ga0157379_10445731
1543 Ga0157379_10910539
1544 Ga0157376_10088506
1545 Ga0157376_10456463
1546 Ga0157376_10688022
1547 Ga0157376_11905885
1548 Ga0163161_10238465
1549 Ga0163161_10725799
1550 Ga0163161_11220336
1551 Ga0163161_11317139
1552 Ga0206353_11584542
1553 Ga0207697_10262662
1554 Ga0207656_10082139
1555 Ga0207656_10137573
1556 Ga0207653_10008949
1557 Ga0207692_10368521
1558 Ga0207642_10014429
1559 Ga0207642_10415577
1560 Ga0207710_10016852
1561 Ga0207688_10002607
1562 Ga0207688_10003393
1563 Ga0207688_10031118
1564 Ga0207688_10033749
1565 Ga0207688_10081369
1566 Ga0207688_10248498
1567 Ga0207680_10532465
1568 Ga0207645_10022120
1569 Ga0207645_10084423
1570 Ga0207643_10002023
1571 Ga0207643_10025022
1572 Ga0207705_10027306
1573 Ga0207684_10019475
1574 Ga0207684_10244472
1575 Ga0207654_10157131
1576 Ga0207707_10421024
1577 Ga0207671_10333132
1578 Ga0207693_10001432
1579 Ga0207693_10004838
1580 Ga0207663_10110384
1581 Ga0207663_10131634
1582 Ga0207660_10027789
1583 Ga0207662_10018197
1584 Ga0207662_10023638
1585 Ga0207662_10071346
1586 Ga0207662_10410464
1587 Ga0207657_10006330
1588 Ga0207657_10114716
1589 Ga0207649_10262572
1590 Ga0207652_10358461
1591 Ga0207652_10506732
1592 Ga0207652_10701242
1593 Ga0207646_10009493
1594 Ga0207694_10143128
1595 Ga0207694_10143533
1596 Ga0207694_10421023
1597 Ga0207650_10057330
1598 Ga0207659_10121756
1599 Ga0207687_10077879
1600 Ga0207687_10526155
1601 Ga0207644_10236096
1602 Ga0207690_10288069
1603 Ga0207690_10306112
1604 Ga0207706_10010525
1605 Ga0207706_10014547
1606 Ga0207706_10099521
1607 Ga0207706_10217047
1608 Ga0207706_10320855
1609 Ga0207686_10051564
1610 Ga0207686_10673011
1611 Ga0207686_10746259
1612 Ga0207709_10004029
1613 Ga0207709_10050362
1614 Ga0207709_10080099
1615 Ga0207709_10164195
1616 Ga0207709_10498600
1617 Ga0207709_10511108
1618 Ga0207709_11116998
1619 Ga0207670_10101189
1620 Ga0207670_10109467
1621 Ga0207670_11082541
1622 Ga0207669_10003654
1623 Ga0207669_10051065
1624 Ga0207669_10293530
1625 Ga0207704_10018636
1626 Ga0207704_10211308
1627 Ga0207704_10223787
1628 Ga0207704_10295378
1629 Ga0207704_10318772
1630 Ga0207665_10095246
1631 Ga0207665_10216825
1632 Ga0207691_10004005
1633 Ga0207691_10016003
1634 Ga0207691_10026907
1635 Ga0207691_11107296
1636 Ga0207711_10097138
1637 Ga0207711_10204324
1638 Ga0207711_10669488
1639 Ga0207689_10013172
1640 Ga0207661_10034257
1641 Ga0207661_10130916
1642 Ga0207661_10561935
1643 Ga0207661_10621551
1644 Ga0207679_10054403
1645 Ga0207679_10395265
1646 Ga0207679_10455566
1647 Ga0207667_10171616
1648 Ga0207667_10280046
1649 Ga0207667_10709950
1650 Ga0207651_10238857
1651 Ga0207651_10272768
1652 Ga0207651_10711543
1653 Ga0207712_10368692
1654 Ga0207668_10125752
1655 Ga0207668_10226566
1656 Ga0207668_10343761
1657 Ga0207640_10003852
1658 Ga0207640_10141404
1659 Ga0207640_10205986
1660 Ga0207640_10238631
1661 Ga0207640_10239298
1662 Ga0207658_10336637
1663 Ga0207677_10147593
1664 Ga0207677_10462440
1665 Ga0207677_11440775
1666 Ga0207703_10387692
1667 Ga0207703_10672568
1668 Ga0207639_10067647
1669 Ga0207639_10083750
1670 Ga0207678_10013710
1671 Ga0207678_10412608
1672 Ga0207678_10417254
1673 Ga0207708_10000760
1674 Ga0207708_10013914
1675 Ga0207708_10058599
1676 Ga0207708_10074394
1677 Ga0207702_10421937
1678 Ga0207641_10104193
1679 Ga0207648_10008338
1680 Ga0207648_10042591
1681 Ga0207648_10052200
1682 Ga0207648_10080954
1683 Ga0207648_10203996
1684 Ga0207676_10065381
1685 Ga0207676_10204136
1686 Ga0207674_10000156
1687 Ga0207674_10216014
1688 Ga0207675_100003335
1689 Ga0207675_100008735
1690 Ga0207675_100020442
1691 Ga0207675_100033750
1692 Ga0207675_100052136
1693 Ga0207675_100618802
1694 Ga0207683_10001662
1695 Ga0207683_10003793
1696 Ga0207683_10093159
1697 Ga0207683_10509562
1698 Ga0207683_10522159
1699 Ga0207698_10040895
1700 Ga0207698_10104261
1701 Ga0207698_10482844
1702 Ga0207698_10756107
1703 Ga0207698_10874271
1704 Ga0209966_1008982
1705 Ga0207428_10013230
1706 Ga0207428_10014091
1707 Ga0207428_10023040
1708 Ga0207428_10026971
1709 Ga0207428_10027259
1710 Ga0207428_10052131
1711 Ga0207428_10595189
1712 Ga0268266_10821397
1713 Ga0268266_11998525
1714 Ga0268264_10161296
1715 Ga0268264_10786122
1716 Ga0307408_100032608
1717 Ga0307408_100190142
1718 Ga0307405_10001813
1719 Ga0307405_10885067
1720 Ga0307413_10363382
1721 Ga0307406_10072476
1722 Ga0307407_10086925
1723 Ga0307412_10023772
1724 Ga0307412_10250836
1725 Ga0307409_100001195
1726 Ga0307409_100044988
1727 Ga0307416_100011220
1728 Ga0307416_100423590
1729 Ga0307414_10015559
1730 Ga0307411_10054868
1731 Ga0307411_10068084
1732 Ga0307415_100006940
1733 Ga0307415_100101838
1734 Ga0373958_0063858
1735 Ga0373958_0076411
1736 Ga0373959_0004214
1737 Ga0373949_0053078
1738 Ga0373945_0198676
1739 Ga0373960_0006030
1740 Ga0373946_0271890
1741 Ga0373961_0019234
1742 Ga0373962_0001783
1743 Ga0373931_0587956
1744 Ga0373935_0259739
1745 Ga0373947_0246286
1746 Ga0395899_0004348
1747 Ga0395899_0005306
1748 Ga0395899_0006773
1749 Ga0395899_0034980
1750 Ga0395899_0071294
1751 Ga0395899_0306719
1752 Ga0395900_0002748
1753 Ga0395900_0010576
1754 Ga0395900_0011168
1755 Ga0395900_0012861
1756 Ga0395900_0021483
1757 Ga0395900_0024536
1758 Ga0395900_0056587
1759 Ga0395900_0057422
1760 Ga0395900_0140909
1761 Ga0395900_0352191
1762 Ga0395900_0397442
1763 Ga0395900_0719507
1764 Ga0395900_1163257
1765 Ga0395898_0004644
1766 Ga0395898_0004773
1767 Ga0395898_0007284
1768 Ga0395898_0008187
1769 Ga0395898_0011507
1770 Ga0395898_0019216
1771 Ga0395898_0031134
1772 Ga0395898_0058222
1773 Ga0395898_0111863
1774 Ga0395898_0364876
1775 Ga0395898_1055646
1776 Ga0395898_1324417
1777 Ga0395905_0005256
1778 Ga0395905_0008250
1779 Ga0395905_0014153
1780 Ga0395905_0036212
1781 Ga0395905_0037437
1782 Ga0395905_0046765
1783 Ga0395905_0070640
1784 Ga0395905_0122828
1785 Ga0395905_0123239
1786 Ga0395901_0003097
1787 Ga0395901_0004483
1788 Ga0395901_0009567
1789 Ga0395901_0032052
1790 Ga0395901_0075575
1791 Ga0395901_0097195
1792 Ga0395901_0115356
1793 Ga0395901_0149312
1794 Ga0395901_0206841
1795 Ga0395901_0209342
1796 Ga0395901_0302976
1797 Ga0395901_0426423
1798 Ga0395901_0753539
1799 Ga0395901_0963107
1800 Ga0439453_0036904
1801 Ga0451789_0730060
1802 Ga0451807_1018272
1803 Ga0451853_3042737
1804 Ga0439448_0060563
1805 Ga0439463_081380
1806 Ga0450920_076351
1807 Ga0450923_007153
1808 Ga0450906_044864
1809 Ga0450907_007013
1810 Ga0439435_0125973
1811 Ga0439460_0153595
1812 Ga0439460_0303399
1813 Ga0439440_0085008
1814 Ga0466960_0747517
1815 Ga0451576_0969523
1816 Ga0495603_0062348
1817 Ga0495603_0101325
1818 Ga0495590_0056412
1819 Ga0495591_122247
1820 Ga0495629_0296460
1821 Ga0495641_0156043
1822 Ga0495582_0074420
1823 Ga0495582_0108816
1824 Ga0495605_0033189
1825 Ga0495605_0039891
1826 Ga0495605_0130090
1827 Ga0495584_0011490
1828 Ga0495584_0037992
1829 Ga0495584_0044156
1830 Ga0495584_0090519
1831 Ga0495584_0166107
1832 Ga0495585_0258361
1833 Ga0495585_0272819
1834 Ga0495594_0055152
1835 Ga0495594_0398380
1836 Ga0495596_0061679
1837 Ga0495596_0259827
1838 Ga0495583_0116542
1839 Ga0495616_0099167
1840 Ga0495620_0071238
1841 Ga0495630_0849438
1842 Ga0495631_0079726
1843 Ga0495631_0173179
1844 Ga0495637_0082200
1845 Ga0495637_0105550
1846 Ga0495644_0037467
1847 Ga0495644_0112948
1848 Ga0495644_0142623
1849 Ga0495644_0172084
1850 Ga0495644_0208322
1851 Ga0495663_0024763
1852 Ga0495663_0047989
1853 Ga0495663_0091714
1854 Ga0495666_0147167
1855 Ga0495642_0024044
1856 Ga0495642_0088798
1857 Ga0495642_0183574
1858 Ga0495665_0078872
1859 Ga0495598_0012782
1860 Ga0495598_0066578
1861 Ga0495609_0021345
1862 Ga0495609_0099970
1863 Ga0495609_0199550
1864 Ga0495597_0163021
1865 Ga0495656_0224272
1866 Ga0495668_0254543
1867 Ga0495668_0562066
1868 Ga0495611_0168755
1869 Ga0495659_0055103
1870 Ga0495659_0244159
1871 Ga0495661_0087667
1872 Ga0495588_0084886
1873 Ga0495588_0245878
1874 Ga0495658_0401797
1875 Ga0495669_0030729
1876 Ga0495670_0064904
1877 Ga0495670_0234395
1878 Ga0495671_0315922
1879 Ga0495589_0010931
1880 Ga0495589_0276155
1881 Ga0495660_0200212
1882 Ga0495581_0206295
1883 Ga0495683_0112116
1884 Ga0495677_0047532
1885 Ga0495677_0124311
1886 Ga0495677_0216816
1887 Ga0495677_0221247
1888 Ga0495673_0189038
1889 Ga0495686_0351765
1890 Ga0495614_0177350
1891 Ga0495615_0073019
1892 Ga0496100_0024806
1893 Ga0496100_0101405
1894 Ga0496100_0590448
1895 Ga0496100_0860185
1896 Ga0496100_1076956
1897 Ga0496101_0012970
1898 Ga0496101_0014530
1899 Ga0496101_0116990
1900 Ga0496101_0246936
1901 Ga0496101_0320121
1902 Ga0496102_0000990
1903 Ga0496102_0176508
1904 Ga0496102_1016172
1905 Ga0496104_0019090
1906 Ga0496105_0056456
1907 Ga0496105_0072857
1908 Ga0496105_0207845
1909 Ga0496105_0252947
1910 Ga0496105_0313823
1911 Ga0496106_0004185
1912 Ga0496106_0062122
1913 Ga0496106_0098282
1914 Ga0496106_0255798
1915 Ga0496106_0349934
1916 Ga0496106_0524335
1917 Ga0496107_0001146
1918 Ga0496107_0014126
1919 Ga0496108_0016109
1920 Ga0496108_0061442
1921 Ga0496108_0308495
1922 Ga0496108_0487990
1923 Ga0496108_0809422
1924 Ga0496109_0017931
1925 Ga0496109_0162682
1926 Ga0496109_0209675
1927 Ga0496109_0293379
1928 Ga0496109_1219248
1929 Ga0496110_0015030
1930 Ga0496110_0026671
1931 Ga0496110_0256456
1932 Ga0496110_0384630
1933 Ga0496110_0468843
1934 Ga0496111_0013953
1935 Ga0496111_0031526
1936 Ga0496112_0064751
1937 Ga0496112_0386277
1938 Ga0496112_0689187
1939 Ga0496113_0020920
1940 Ga0496113_0256341
1941 Ga0496113_0811133
1942 Ga0496114_0018920
1943 Ga0496114_0048367
1944 Ga0496114_0088183
1945 Ga0496114_0091784
1946 Ga0496114_0160069
1947 Ga0496114_0169946
1948 Ga0496114_0349625
1949 Ga0496115_0050322
1950 Ga0496115_0332517
1951 Ga0501292_025652
1952 Ga0501031_0002040
1953 Ga0501031_0011335
1954 Ga0501031_0018235
1955 Ga0501031_0058959
1956 Ga0501031_0097481
1957 Ga0501031_0176349
1958 Ga0501032_0010152
1959 Ga0501032_0019630
1960 Ga0501032_0056794
1961 Ga0501032_0184625
1962 Ga0501033_0005477
1963 Ga0501033_0008600
1964 Ga0501033_0008837
1965 Ga0501033_0083439
1966 Ga0501033_0283115
1967 Ga0501033_0483880
1968 Ga0501033_1024739
1969 Ga0501034_0021497
1970 Ga0501034_0153028
1971 Ga0501034_0447954
1972 Ga0501036_0000886
1973 Ga0501036_0001073
1974 Ga0501036_0046903
1975 Ga0501036_0061223
1976 Ga0501036_0078334
1977 Ga0501036_0111687
1978 Ga0501036_0114311
1979 Ga0501036_0188534
1980 Ga0501036_0189820
1981 Ga0501036_0485742
1982 Ga0501037_0003930
1983 Ga0501037_0006125
1984 Ga0501037_0006716
1985 Ga0501037_0048628
1986 Ga0501037_0121648
1987 Ga0501037_0394038
1988 Ga0501037_0582074
1989 Ga0501038_0005987
1990 Ga0501038_0011094
1991 Ga0501038_0015520
1992 Ga0501038_0029623
1993 Ga0501038_0068333
1994 Ga0501038_0123022
1995 Ga0501039_0017469
1996 Ga0501039_0040318
1997 Ga0501039_0044220
1998 Ga0501039_0057722
1999 Ga0501039_0064269
2000 Ga0501039_0107410
2001 Ga0501039_0238303
2002 Ga0501039_0344271
2003 Ga0501039_0419582
2004 Ga0501039_0834969
2005 Ga0501039_0877247
2006 Ga0501040_0004527
2007 Ga0501040_0006935
2008 Ga0501040_0010841
2009 Ga0501040_0012989
2010 Ga0501040_0037918
2011 Ga0501040_0044156
2012 Ga0501040_0049347
2013 Ga0501040_0365298
2014 Ga0501040_0898678
2015 Ga0501041_0004504
2016 Ga0501041_0009919
2017 Ga0501041_0015604
2018 Ga0501041_0016089
2019 Ga0501041_0021904
2020 Ga0501041_0037667
2021 Ga0501041_0041807
2022 Ga0501041_0090211
2023 Ga0501041_0211477
2024 Ga0501041_0216526
2025 Ga0501041_0369758
2026 Ga0501041_0433023
2027 Ga0501042_0001919
2028 Ga0501042_0004719
2029 Ga0501042_0009305
2030 Ga0501042_0014736
2031 Ga0501042_0101174
2032 Ga0501042_0170209
2033 Ga0501042_0208136
2034 Ga0501042_0346324
2035 Ga0501042_0378019
2036 Ga0501043_0012210
2037 Ga0501043_0017880
2038 Ga0501043_0018898
2039 Ga0501043_0019923
2040 Ga0501043_0128872
2041 Ga0501043_0130566
2042 Ga0501046_0005087
2043 Ga0501046_0008327
2044 Ga0501046_0009146
2045 Ga0501046_0046523
2046 Ga0501046_0096178
2047 Ga0501046_0362616
2048 Ga0501046_0652039
2049 Ga0501046_0762406
2050 Ga0501047_0021938
2051 Ga0501048_0012692
2052 Ga0501048_0012846
2053 Ga0501048_0014745
2054 Ga0501048_0020631
2055 Ga0501048_0024160
2056 Ga0501048_0030498
2057 Ga0501048_0036094
2058 Ga0501048_0441559
2059 Ga0501048_0866906
2060 Ga0501067_0030915
2061 Ga0501067_0031743
2062 Ga0501067_0540610
2063 Ga0501068_0004660
2064 Ga0501068_0048689
2065 Ga0501068_0049958
2066 Ga0501068_0055663
2067 Ga0501068_0123225
2068 Ga0501068_0158228
2069 Ga0501069_0001693
2070 Ga0501069_0006904
2071 Ga0501069_0009502
2072 Ga0501069_0024077
2073 Ga0501069_0063974
2074 Ga0501070_0004629
2075 Ga0501070_0004913
2076 Ga0501070_0086101
2077 Ga0501070_0100829
2078 Ga0501070_0157560
2079 Ga0501070_0399870
2080 Ga0501071_0000999
2081 Ga0501071_0005011
2082 Ga0501071_0005104
2083 Ga0501071_0006333
2084 Ga0501071_0011941
2085 Ga0501071_0012312
2086 Ga0501071_0053929
2087 Ga0501071_0072340
2088 Ga0501071_0076570
2089 Ga0501071_0107680
2090 Ga0501071_0145002
2091 Ga0501071_0219263
2092 Ga0501071_0502232
2093 Ga0501071_0811865
2094 Ga0501072_0004838
2095 Ga0501072_0008260
2096 Ga0501072_0009743
2097 Ga0501072_0015780
2098 Ga0501072_0049222
2099 Ga0501072_0053229
2100 Ga0501072_0061041
2101 Ga0501072_0123755
2102 Ga0501072_0129323
2103 Ga0501072_0132980
2104 Ga0501072_0855754
2105 Ga0501073_0011249
2106 Ga0501073_0039547
2107 Ga0501073_0078997
2108 Ga0501073_0092780
2109 Ga0501073_0542958
2110 Ga0501074_0013907
2111 Ga0501074_0021338
2112 Ga0501074_0024865
2113 Ga0501074_0031203
2114 Ga0501074_0058304
2115 Ga0501074_0089802
2116 Ga0501074_0236494
2117 Ga0501074_0659723
2118 Ga0501074_0769906
2119 Ga0501075_0003257
2120 Ga0501075_0007314
2121 Ga0501075_0011550
2122 Ga0501075_0014974
2123 Ga0501075_0047476
2124 Ga0501075_0093057
2125 Ga0501075_0161851
2126 Ga0501075_0317319
2127 Ga0501075_0712432
2128 Ga0501075_1142663
2129 Ga0501075_1148930
2130 Ga0501076_0002512
2131 Ga0501076_0009539
2132 Ga0501076_0028300
2133 Ga0501076_0028561
2134 Ga0501076_0082214
2135 Ga0501076_0101717
2136 Ga0501076_0127759
2137 Ga0501076_0209315
2138 Ga0501076_0291945
2139 Ga0501076_0366513
2140 Ga0501076_0471043
2141 Ga0501077_0004980
2142 Ga0501077_0005213
2143 Ga0501077_0007480
2144 Ga0501077_0008613
2145 Ga0501077_0009922
2146 Ga0501077_0058420
2147 Ga0501077_0162461
2148 Ga0501077_0172717
2149 Ga0501077_0192551
2150 Ga0501077_0193904
2151 Ga0501077_0409066
2152 Ga0501077_0451356
2153 Ga0501077_0806451
2154 Ga0501209_057763
2155 Ga0501079_0005554
2156 Ga0501079_0007606
2157 Ga0501079_0021858
2158 Ga0501079_0046146
2159 Ga0501079_0060060
2160 Ga0501079_0066142
2161 Ga0501079_0091708
2162 Ga0501079_0344434
2163 Ga0501079_0625381
2164 Ga0501079_0745556
2165 Ga0501080_0011231
2166 Ga0501080_0015179
2167 Ga0501080_0025490
2168 Ga0501080_0027797
2169 Ga0501080_0065341
2170 Ga0501080_0089971
2171 Ga0501081_0002584
2172 Ga0501081_0005329
2173 Ga0501081_0035759
2174 Ga0501081_0077964
2175 Ga0501081_0078815
2176 Ga0501081_0088991
2177 Ga0501081_0112896
2178 Ga0501081_0170109
2179 Ga0501081_0305887
2180 Ga0501081_0316420
2181 Ga0501081_1005301
2182 Ga0501083_0007601
2183 Ga0501083_0021557
2184 Ga0501083_0030996
2185 Ga0501083_0040735
2186 Ga0501083_0087538
2187 Ga0501083_0578299
2188 Ga0501035_0001297
2189 Ga0501035_0008968
2190 Ga0501035_0009607
2191 Ga0501035_0021581
2192 Ga0501035_0222709
2193 Ga0501035_0237994
2194 Ga0501035_0365008
2195 Ga0501035_0447148
2196 Ga0501035_0460381
2197 Ga0501044_0012904
2198 Ga0501044_0025083
2199 Ga0501044_0166259
2200 Ga0501044_0268176
2201 Ga0501045_0000294
2202 Ga0501045_0003491
2203 Ga0501045_0009860
2204 Ga0501045_0018316
2205 Ga0501045_0018917
2206 Ga0501045_0031439
2207 Ga0501045_0041762
2208 Ga0501045_0068704
2209 Ga0501045_0079948
2210 Ga0501045_0083114
2211 Ga0501045_0091344
2212 nmdc:mga05p37_1196845_c1
2213 nmdc:mga05p37_127268_c1
2214 nmdc:mga05p37_383670_c1
2215 nmdc:mga05p37_532_c2
2216 nmdc:mga09592_2291_c1
2217 nmdc:mga09592_297383_c1
2218 nmdc:mga0qj67_133148_c1
2219 nmdc:mga0qj67_144194_c1
2220 nmdc:mga06r32_12732_c1
2221 nmdc:mga06r32_393625_c1
2222 nmdc:mga06r32_71140_c1
2223 nmdc:mga06r32_80912_c1
2224 nmdc:mga08y16_129628_c1
2225 nmdc:mga08y16_45251_c1
2226 nmdc:mga08y16_50001_c1
2227 nmdc:mga08y16_6843_c1
2228 nmdc:mga08y16_823370_c1
2229 nmdc:mga08y16_911186_c1
2230 nmdc:mga0n895_181588_c1
2231 nmdc:mga0n895_584031_c1
2232 nmdc:mga0rr50_37744_c1
2233 nmdc:mga0a205_182997_c1
2234 nmdc:mga0a205_253073_c1
2235 nmdc:mga0a205_886168_c1
2236 nmdc:mga0a205_95480_c1
2237 Ga0495655_0105643
2238 Ga0495655_0107543
2239 Ga0495655_0249331
2240 Ga0501084_0004955
2241 Ga0501084_0006048
2242 Ga0501084_0040057
2243 Ga0501084_0051541
2244 Ga0501084_0059960
2245 Ga0501084_0062141
2246 Ga0501084_0095033
2247 Ga0501084_0146941
2248 Ga0501084_0182141
2249 Ga0501084_0200974
2250 Ga0501084_0594151
2251 Ga0501082_0000584
2252 Ga0501082_0004443
2253 Ga0501082_0025954
2254 Ga0501082_0038520
2255 Ga0501082_0040890
2256 Ga0501082_0107883
2257 Ga0501082_0193799
2258 Ga0501082_0506737
2259 Ga0501082_0914193
2260 Ga0530510_0002385
2261 Ga0530510_0002770
2262 Ga0530510_0008577
2263 Ga0530510_0034759
2264 Ga0530510_0041119
2265 Ga0530510_0041547
2266 Ga0530510_0068164
2267 Ga0530510_0207111
2268 Ga0530510_0364766
2269 Ga0530510_0550775
2270 Ga0530510_0561225
2271 Ga0530510_0781479
2272 Ga0530510_0786542

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02080

TrkA_C

TrkA-C domain

90

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7agw-assembly1.cif.gz_B structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 6.5 0.9373 3 70
7aht-assembly1.cif.gz_B structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 0.9352 3 70
7aht-assembly1.cif.gz_B structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 0.9203 3 70
7b5u-assembly1.cif.gz_B rck_c domain dimer of s.agalactiae busr in complex with c-di-amp 0.9186 90 161
7aht-assembly1.cif.gz_A structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 0.9016 3 70
ID Description Score Start End Superfamily
af_O05882_87_159_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9209 91 162 3.30.70.1450
af_Q57604_260_331_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9077 91 160 3.30.70.1450
2fy8C03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9001 88 160 3.30.70.1450
af_O05882_87_159_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8978 91 162 3.30.70.1450
2bkpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8957 86 163 3.30.70.1450
ID Description Score Start End GO Terms
AF-A0A1F5UHQ9-F1-model_v4 Potassium transporter KefB 0.948 88 156 GO:0006813
GO:0008324
GO:0015297
GO:0016020
GO:1902600
AF-A0A7W0HAI6-F1-model_v4 RCK C-terminal domain-containing protein 0.9391 88 160 GO:0006813
GO:0008324
AF-A0A3N5IHM1-F1-model_v4 RCK C-terminal domain-containing protein 0.9196 88 164 GO:0005886
GO:0006813
GO:0008324
AF-A0A2S9YX99-F1-model_v4 Voltage-gated potassium channel Kch 0.9176 88 160 GO:0005886
GO:0006813
GO:0008324
AF-A0A1D2R547-F1-model_v4 RCK C-terminal domain-containing protein 0.9026 88 164 GO:0006813
GO:0008324

Map