F490633
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1136 | 347 | 2272 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10349299|Ga0207695_103492991 |
| Length | 184 |
| Sequence | MPVDLRETRLPGIGTKFTFRLDDGGRLAVILHNDGVRELYFFRHSDDDEPKAVIRLDDDEARQLGAVIGGAYERPKIVEDLEMALGELLIEWEPVPETSPWIGKTLAESGFRAKTGITVIAILREPEPVTGAQPDDVIQHGDTLVTVGKAGQYGACEGHRPGDHAADCGAVVESAGGRLVHDVC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 117 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 118 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 119 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 212 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 228 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 233 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 236 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 237 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 238 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 239 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 5.37 |
| Rhizosphere | 94.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207695_10349299 | 3300025913 | Bacteria | 1366 |
| 2 | JGI24746J21847_1023075 | 3300001977 | Bacteria | 866 |
| 3 | JGI24747J21853_1002478 | 3300001978 | Unclassified | 1511 |
| 4 | JGI24747J21853_1002619 | 3300001978 | Bacteria | 1486 |
| 5 | JGI24739J22299_10056390 | 3300001989 | Bacteria | 1253 |
| 6 | JGI24737J22298_10126685 | 3300001990 | Bacteria | 754 |
| 7 | JGI24738J21930_10014188 | 3300002075 | Unclassified | 1712 |
| 8 | JGI24744J21845_10010675 | 3300002077 | Bacteria | 1880 |
| 9 | JGI25406J46586_10059686 | 3300003203 | Bacteria | 1237 |
| 10 | JGI25407J50210_10002984 | 3300003373 | Bacteria | 4041 |
| 11 | JGI25407J50210_10007520 | 3300003373 | Bacteria | 2730 |
| 12 | JGI25407J50210_10024604 | 3300003373 | Bacteria | 1561 |
| 13 | JGI25407J50210_10041967 | 3300003373 | Bacteria | 1170 |
| 14 | Ga0070658_10282327 | 3300005327 | Unclassified | 1413 |
| 15 | Ga0070658_10620589 | 3300005327 | Bacteria | 938 |
| 16 | Ga0070676_10016464 | 3300005328 | Archaea | 4089 |
| 17 | Ga0070683_100003925 | 3300005329 | Bacteria | 12158 |
| 18 | Ga0070683_100009447 | 3300005329 | Bacteria | 8340 |
| 19 | Ga0070683_100108205 | 3300005329 | Bacteria | 2621 |
| 20 | Ga0070683_100141718 | 3300005329 | Unclassified | 2277 |
| 21 | Ga0070670_100553389 | 3300005331 | Bacteria | 1026 |
| 22 | Ga0070677_10162324 | 3300005333 | Bacteria | 1049 |
| 23 | Ga0068869_100257223 | 3300005334 | Bacteria | 1397 |
| 24 | Ga0068869_100425317 | 3300005334 | Bacteria | 1096 |
| 25 | Ga0070666_10263690 | 3300005335 | Bacteria | 1222 |
| 26 | Ga0070680_100301197 | 3300005336 | Bacteria | 1360 |
| 27 | Ga0070680_100897501 | 3300005336 | Bacteria | 765 |
| 28 | Ga0070680_100928696 | 3300005336 | Unclassified | 751 |
| 29 | Ga0070682_100004426 | 3300005337 | Bacteria | 7798 |
| 30 | Ga0070682_100005044 | 3300005337 | Bacteria | 7335 |
| 31 | Ga0070682_100420282 | 3300005337 | Bacteria | 1016 |
| 32 | Ga0068868_100037260 | 3300005338 | Unclassified | 3769 |
| 33 | Ga0068868_100423169 | 3300005338 | Unclassified | 1153 |
| 34 | Ga0070660_100036138 | 3300005339 | Unclassified | 3741 |
| 35 | Ga0070660_100218791 | 3300005339 | Bacteria | 1548 |
| 36 | Ga0070660_100329719 | 3300005339 | Bacteria | 1255 |
| 37 | Ga0070660_100369238 | 3300005339 | Bacteria | 1183 |
| 38 | Ga0070689_100007583 | 3300005340 | Bacteria | 7600 |
| 39 | Ga0070689_100066466 | 3300005340 | Bacteria | 2809 |
| 40 | Ga0070689_100200205 | 3300005340 | Bacteria | 1630 |
| 41 | Ga0070689_100294205 | 3300005340 | Bacteria | 1350 |
| 42 | Ga0070691_10369955 | 3300005341 | Bacteria | 801 |
| 43 | Ga0070687_100112212 | 3300005343 | Bacteria | 1545 |
| 44 | Ga0070687_100211575 | 3300005343 | Bacteria | 1181 |
| 45 | Ga0070661_100072981 | 3300005344 | Bacteria | 2526 |
| 46 | Ga0070661_100839525 | 3300005344 | Bacteria | 755 |
| 47 | Ga0070692_10020164 | 3300005345 | Bacteria | 3229 |
| 48 | Ga0070692_10026208 | 3300005345 | Bacteria | 2879 |
| 49 | Ga0070692_10027734 | 3300005345 | Bacteria | 2810 |
| 50 | Ga0070692_10152707 | 3300005345 | Unclassified | 1316 |
| 51 | Ga0070692_10246109 | 3300005345 | Bacteria | 1068 |
| 52 | Ga0070692_10939053 | 3300005345 | Bacteria | 601 |
| 53 | Ga0070668_100159315 | 3300005347 | Archaea | 1830 |
| 54 | Ga0070668_100207387 | 3300005347 | Bacteria | 1611 |
| 55 | Ga0070668_100541116 | 3300005347 | Bacteria | 1012 |
| 56 | Ga0070668_101209453 | 3300005347 | Unclassified | 685 |
| 57 | Ga0070669_100114906 | 3300005353 | Bacteria | 2047 |
| 58 | Ga0070675_100019038 | 3300005354 | Bacteria | 5469 |
| 59 | Ga0070675_100040341 | 3300005354 | Archaea | 3810 |
| 60 | Ga0070675_100152539 | 3300005354 | Bacteria | 1982 |
| 61 | Ga0070675_101338934 | 3300005354 | Bacteria | 660 |
| 62 | Ga0070671_100016569 | 3300005355 | Bacteria | 5957 |
| 63 | Ga0070671_100533134 | 3300005355 | Bacteria | 1011 |
| 64 | Ga0070674_100003185 | 3300005356 | Bacteria | 9145 |
| 65 | Ga0070674_100003686 | 3300005356 | Bacteria | 8636 |
| 66 | Ga0070674_100005915 | 3300005356 | Bacteria | 7114 |
| 67 | Ga0070674_100023351 | 3300005356 | Bacteria | 4002 |
| 68 | Ga0070674_100025544 | 3300005356 | Bacteria | 3847 |
| 69 | Ga0070674_100266281 | 3300005356 | Bacteria | 1352 |
| 70 | Ga0070673_100002906 | 3300005364 | Archaea | 10554 |
| 71 | Ga0070673_100062384 | 3300005364 | Unclassified | 2961 |
| 72 | Ga0070673_100174202 | 3300005364 | Bacteria | 1838 |
| 73 | Ga0070688_100002023 | 3300005365 | Bacteria | 10226 |
| 74 | Ga0070688_100003324 | 3300005365 | Bacteria | 8244 |
| 75 | Ga0070688_100526215 | 3300005365 | Bacteria | 895 |
| 76 | Ga0070659_100005741 | 3300005366 | Bacteria | 8935 |
| 77 | Ga0070659_100054870 | 3300005366 | Bacteria | 3140 |
| 78 | Ga0070659_100421790 | 3300005366 | Bacteria | 1128 |
| 79 | Ga0070659_100479468 | 3300005366 | Unclassified | 1058 |
| 80 | Ga0070667_100992807 | 3300005367 | Bacteria | 783 |
| 81 | Ga0070703_10018421 | 3300005406 | Unclassified | 2018 |
| 82 | Ga0070709_11081122 | 3300005434 | Bacteria | 641 |
| 83 | Ga0070714_100812219 | 3300005435 | Unclassified | 906 |
| 84 | Ga0070710_10004290 | 3300005437 | Bacteria | 6763 |
| 85 | Ga0070701_10018494 | 3300005438 | Archaea | 3276 |
| 86 | Ga0070701_10057995 | 3300005438 | Bacteria | 2031 |
| 87 | Ga0070701_10067481 | 3300005438 | Bacteria | 1903 |
| 88 | Ga0070701_10197692 | 3300005438 | Bacteria | 1186 |
| 89 | Ga0070701_10773223 | 3300005438 | Bacteria | 653 |
| 90 | Ga0070705_100026575 | 3300005440 | Bacteria | 3151 |
| 91 | Ga0070705_100083531 | 3300005440 | Archaea | 1968 |
| 92 | Ga0070705_100145312 | 3300005440 | Unclassified | 1566 |
| 93 | Ga0070705_101047474 | 3300005440 | Bacteria | 665 |
| 94 | Ga0070700_100065742 | 3300005441 | Bacteria | 2300 |
| 95 | Ga0070700_100091470 | 3300005441 | Bacteria | 1986 |
| 96 | Ga0070700_100213282 | 3300005441 | Unclassified | 1364 |
| 97 | Ga0070700_100214718 | 3300005441 | Bacteria | 1359 |
| 98 | Ga0070700_100220524 | 3300005441 | Unclassified | 1343 |
| 99 | Ga0070700_100356766 | 3300005441 | Bacteria | 1086 |
| 100 | Ga0070700_100404593 | 3300005441 | Bacteria | 1027 |
| 101 | Ga0070694_100168350 | 3300005444 | Unclassified | 1612 |
| 102 | Ga0070708_100033983 | 3300005445 | Bacteria | 4433 |
| 103 | Ga0070708_100050577 | 3300005445 | Archaea | 3681 |
| 104 | Ga0070708_100724582 | 3300005445 | Bacteria | 935 |
| 105 | Ga0070678_100085755 | 3300005456 | Archaea | 2400 |
| 106 | Ga0070678_100192821 | 3300005456 | Bacteria | 1676 |
| 107 | Ga0070678_100363225 | 3300005456 | Unclassified | 1248 |
| 108 | Ga0070678_100565631 | 3300005456 | Bacteria | 1011 |
| 109 | Ga0070678_100896334 | 3300005456 | Bacteria | 810 |
| 110 | Ga0070662_100012523 | 3300005457 | Bacteria | 5625 |
| 111 | Ga0070662_100198485 | 3300005457 | Unclassified | 1591 |
| 112 | Ga0070662_100212519 | 3300005457 | Unclassified | 1540 |
| 113 | Ga0070681_10557749 | 3300005458 | Bacteria | 1059 |
| 114 | Ga0070681_11011889 | 3300005458 | Bacteria | 751 |
| 115 | Ga0068867_100009057 | 3300005459 | Bacteria | 7023 |
| 116 | Ga0068867_100023897 | 3300005459 | Bacteria | 4377 |
| 117 | Ga0068867_100037848 | 3300005459 | Unclassified | 3508 |
| 118 | Ga0068867_100081054 | 3300005459 | Bacteria | 2446 |
| 119 | Ga0068867_100235644 | 3300005459 | Unclassified | 1482 |
| 120 | Ga0070685_10030640 | 3300005466 | Bacteria | 3000 |
| 121 | Ga0070685_10043751 | 3300005466 | Archaea | 2561 |
| 122 | Ga0070685_10307345 | 3300005466 | Bacteria | 1070 |
| 123 | Ga0070685_10399322 | 3300005466 | Bacteria | 952 |
| 124 | Ga0070706_100022133 | 3300005467 | Bacteria | 5853 |
| 125 | Ga0070706_100244191 | 3300005467 | Bacteria | 1676 |
| 126 | Ga0070706_100286048 | 3300005467 | Bacteria | 1539 |
| 127 | Ga0070706_100681634 | 3300005467 | Unclassified | 954 |
| 128 | Ga0070707_100008845 | 3300005468 | Bacteria | 9340 |
| 129 | Ga0070698_100035630 | 3300005471 | Bacteria | 5144 |
| 130 | Ga0070698_100098128 | 3300005471 | Bacteria | 2904 |
| 131 | Ga0070699_100004014 | 3300005518 | Bacteria | 13007 |
| 132 | Ga0070699_100023745 | 3300005518 | Bacteria | 5282 |
| 133 | Ga0070699_101087399 | 3300005518 | Bacteria | 733 |
| 134 | Ga0070679_100066648 | 3300005530 | Bacteria | 3589 |
| 135 | Ga0070679_100232563 | 3300005530 | Unclassified | 1802 |
| 136 | Ga0070679_101693971 | 3300005530 | Bacteria | 580 |
| 137 | Ga0070684_100022742 | 3300005535 | Bacteria | 5233 |
| 138 | Ga0070684_100060915 | 3300005535 | Archaea | 3302 |
| 139 | Ga0070684_100454881 | 3300005535 | Bacteria | 1183 |
| 140 | Ga0070684_100497926 | 3300005535 | Unclassified | 1128 |
| 141 | Ga0070684_100909235 | 3300005535 | Bacteria | 825 |
| 142 | Ga0068853_100014245 | 3300005539 | Bacteria | 6508 |
| 143 | Ga0068853_100059158 | 3300005539 | Bacteria | 3310 |
| 144 | Ga0070672_100003708 | 3300005543 | Bacteria | 9940 |
| 145 | Ga0070672_100005767 | 3300005543 | Bacteria | 8256 |
| 146 | Ga0070672_100353089 | 3300005543 | Bacteria | 1254 |
| 147 | Ga0070672_101058692 | 3300005543 | Unclassified | 720 |
| 148 | Ga0070686_100014120 | 3300005544 | Bacteria | 4593 |
| 149 | Ga0070686_100020025 | 3300005544 | Archaea | 3955 |
| 150 | Ga0070686_100074470 | 3300005544 | Bacteria | 2231 |
| 151 | Ga0070686_100096324 | 3300005544 | Bacteria | 1990 |
| 152 | Ga0070686_100470228 | 3300005544 | Archaea | 970 |
| 153 | Ga0070695_100040070 | 3300005545 | Archaea | 2964 |
| 154 | Ga0070695_100790592 | 3300005545 | Bacteria | 759 |
| 155 | Ga0070695_101045979 | 3300005545 | Unclassified | 666 |
| 156 | Ga0070696_100007874 | 3300005546 | Bacteria | 7115 |
| 157 | Ga0070696_100012124 | 3300005546 | Bacteria | 5776 |
| 158 | Ga0070696_100050820 | 3300005546 | Bacteria | 2882 |
| 159 | Ga0070696_100443549 | 3300005546 | Bacteria | 1023 |
| 160 | Ga0070696_100506750 | 3300005546 | Bacteria | 961 |
| 161 | Ga0070693_100010968 | 3300005547 | Bacteria | 4554 |
| 162 | Ga0070693_100032271 | 3300005547 | Bacteria | 2878 |
| 163 | Ga0070665_101228430 | 3300005548 | Bacteria | 760 |
| 164 | Ga0070665_101259555 | 3300005548 | Bacteria | 750 |
| 165 | Ga0070704_100004138 | 3300005549 | Archaea | 8373 |
| 166 | Ga0070704_100005421 | 3300005549 | Bacteria | 7427 |
| 167 | Ga0070704_100041253 | 3300005549 | Bacteria | 3184 |
| 168 | Ga0070704_100186542 | 3300005549 | Bacteria | 1663 |
| 169 | Ga0070704_100791388 | 3300005549 | Bacteria | 847 |
| 170 | Ga0068855_100023324 | 3300005563 | Bacteria | 7410 |
| 171 | Ga0068855_100273760 | 3300005563 | Bacteria | 1877 |
| 172 | Ga0068855_101100678 | 3300005563 | Bacteria | 830 |
| 173 | Ga0070664_100047814 | 3300005564 | Archaea | 3615 |
| 174 | Ga0070664_100070442 | 3300005564 | Bacteria | 2994 |
| 175 | Ga0070664_100403434 | 3300005564 | Archaea | 1250 |
| 176 | Ga0070664_100664708 | 3300005564 | Unclassified | 969 |
| 177 | Ga0070664_100775322 | 3300005564 | Bacteria | 896 |
| 178 | Ga0068857_100000728 | 3300005577 | Bacteria | 24548 |
| 179 | Ga0068857_100291929 | 3300005577 | Bacteria | 1502 |
| 180 | Ga0068854_100002077 | 3300005578 | Bacteria | 12274 |
| 181 | Ga0068854_100370761 | 3300005578 | Bacteria | 1177 |
| 182 | Ga0068854_100535857 | 3300005578 | Unclassified | 991 |
| 183 | Ga0068856_100016532 | 3300005614 | Bacteria | 7141 |
| 184 | Ga0068856_100296562 | 3300005614 | Unclassified | 1634 |
| 185 | Ga0070702_100052421 | 3300005615 | Unclassified | 2339 |
| 186 | Ga0070702_100061145 | 3300005615 | Bacteria | 2192 |
| 187 | Ga0070702_100073889 | 3300005615 | Bacteria | 2021 |
| 188 | Ga0070702_100090115 | 3300005615 | Bacteria | 1858 |
| 189 | Ga0070702_100132237 | 3300005615 | Unclassified | 1577 |
| 190 | Ga0068852_100003129 | 3300005616 | Bacteria | 11528 |
| 191 | Ga0068852_100023602 | 3300005616 | Bacteria | 4953 |
| 192 | Ga0068852_101092066 | 3300005616 | Bacteria | 818 |
| 193 | Ga0068852_101767907 | 3300005616 | Bacteria | 641 |
| 194 | Ga0068859_100007178 | 3300005617 | Bacteria | 11310 |
| 195 | Ga0068859_100178990 | 3300005617 | Unclassified | 2203 |
| 196 | Ga0068859_100320544 | 3300005617 | Bacteria | 1644 |
| 197 | Ga0068859_101481044 | 3300005617 | Bacteria | 749 |
| 198 | Ga0068864_100288905 | 3300005618 | Bacteria | 1533 |
| 199 | Ga0068864_100400930 | 3300005618 | Bacteria | 1303 |
| 200 | Ga0068864_101438311 | 3300005618 | Bacteria | 692 |
| 201 | Ga0068864_101832309 | 3300005618 | Unclassified | 612 |
| 202 | Ga0068866_10271045 | 3300005718 | Bacteria | 1047 |
| 203 | Ga0068866_10635309 | 3300005718 | Unclassified | 725 |
| 204 | Ga0068866_10643364 | 3300005718 | Bacteria | 721 |
| 205 | Ga0068861_100301544 | 3300005719 | Bacteria | 1388 |
| 206 | Ga0068861_100329306 | 3300005719 | Bacteria | 1333 |
| 207 | Ga0068861_100388191 | 3300005719 | Bacteria | 1235 |
| 208 | Ga0068861_100440296 | 3300005719 | Bacteria | 1165 |
| 209 | Ga0068851_10016536 | 3300005834 | Archaea | 3531 |
| 210 | Ga0068851_10542457 | 3300005834 | Bacteria | 702 |
| 211 | Ga0068870_10028562 | 3300005840 | Bacteria | 2802 |
| 212 | Ga0068870_10031844 | 3300005840 | Unclassified | 2675 |
| 213 | Ga0068870_10613789 | 3300005840 | Bacteria | 740 |
| 214 | Ga0068863_100108758 | 3300005841 | Archaea | 2639 |
| 215 | Ga0068858_100010201 | 3300005842 | Bacteria | 8915 |
| 216 | Ga0068858_100156124 | 3300005842 | Bacteria | 2147 |
| 217 | Ga0068858_100305872 | 3300005842 | Unclassified | 1517 |
| 218 | Ga0068858_100428880 | 3300005842 | Unclassified | 1272 |
| 219 | Ga0068860_100034858 | 3300005843 | Archaea | 4828 |
| 220 | Ga0068860_100622404 | 3300005843 | Bacteria | 1086 |
| 221 | Ga0068860_100813720 | 3300005843 | Bacteria | 948 |
| 222 | Ga0068860_100832838 | 3300005843 | Unclassified | 937 |
| 223 | Ga0068862_100181970 | 3300005844 | Unclassified | 1887 |
| 224 | Ga0068862_100219956 | 3300005844 | Bacteria | 1719 |
| 225 | Ga0081455_10003417 | 3300005937 | Bacteria | 18253 |
| 226 | Ga0081455_10005594 | 3300005937 | Bacteria | 13737 |
| 227 | Ga0081455_10056065 | 3300005937 | Unclassified | 3348 |
| 228 | Ga0081455_10200195 | 3300005937 | Bacteria | 1496 |
| 229 | Ga0081455_10648089 | 3300005937 | Unclassified | 681 |
| 230 | Ga0081538_10000080 | 3300005981 | Bacteria | 92392 |
| 231 | Ga0081538_10000144 | 3300005981 | Bacteria | 73787 |
| 232 | Ga0081538_10000231 | 3300005981 | Bacteria | 62826 |
| 233 | Ga0081538_10000667 | 3300005981 | Bacteria | 37780 |
| 234 | Ga0081538_10002291 | 3300005981 | Bacteria | 18909 |
| 235 | Ga0081538_10005049 | 3300005981 | Bacteria | 11996 |
| 236 | Ga0081538_10012554 | 3300005981 | Bacteria | 6784 |
| 237 | Ga0081538_10043132 | 3300005981 | Bacteria | 2837 |
| 238 | Ga0081538_10050060 | 3300005981 | Bacteria | 2528 |
| 239 | Ga0081538_10080682 | 3300005981 | Unclassified | 1734 |
| 240 | Ga0081539_10000452 | 3300005985 | Bacteria | 87416 |
| 241 | Ga0081539_10011583 | 3300005985 | Bacteria | 6951 |
| 242 | Ga0075365_10009783 | 3300006038 | Bacteria | 5540 |
| 243 | Ga0075432_10005071 | 3300006058 | Bacteria | 4485 |
| 244 | Ga0075432_10015202 | 3300006058 | Bacteria | 2625 |
| 245 | Ga0075432_10053012 | 3300006058 | Unclassified | 1434 |
| 246 | Ga0075432_10084539 | 3300006058 | Bacteria | 1155 |
| 247 | Ga0070715_10014164 | 3300006163 | Bacteria | 2946 |
| 248 | Ga0070716_100179839 | 3300006173 | Unclassified | 1387 |
| 249 | Ga0070716_100313760 | 3300006173 | Bacteria | 1096 |
| 250 | Ga0070712_100001977 | 3300006175 | Bacteria | 12563 |
| 251 | Ga0070712_100052849 | 3300006175 | Unclassified | 2835 |
| 252 | Ga0075362_10079235 | 3300006177 | Bacteria | 1512 |
| 253 | Ga0097621_100145977 | 3300006237 | Bacteria | 2025 |
| 254 | Ga0097621_100309270 | 3300006237 | Bacteria | 1398 |
| 255 | Ga0097621_100580338 | 3300006237 | Bacteria | 1023 |
| 256 | Ga0068871_100018627 | 3300006358 | Bacteria | 5283 |
| 257 | Ga0068871_100158924 | 3300006358 | Unclassified | 1932 |
| 258 | Ga0068871_100488358 | 3300006358 | Bacteria | 1109 |
| 259 | Ga0068871_100523613 | 3300006358 | Bacteria | 1071 |
| 260 | Ga0068871_100997292 | 3300006358 | Unclassified | 780 |
| 261 | Ga0068871_101103623 | 3300006358 | Bacteria | 742 |
| 262 | Ga0075428_100013149 | 3300006844 | Bacteria | 9205 |
| 263 | Ga0075428_100085963 | 3300006844 | Bacteria | 3430 |
| 264 | Ga0075428_100238223 | 3300006844 | Unclassified | 1963 |
| 265 | Ga0075430_100016098 | 3300006846 | Bacteria | 6366 |
| 266 | Ga0075430_100055457 | 3300006846 | Bacteria | 3332 |
| 267 | Ga0075430_100083814 | 3300006846 | Bacteria | 2670 |
| 268 | Ga0075430_100116008 | 3300006846 | Bacteria | 2231 |
| 269 | Ga0075431_100005512 | 3300006847 | Bacteria | 12499 |
| 270 | Ga0075431_100117193 | 3300006847 | Bacteria | 2748 |
| 271 | Ga0075431_100167100 | 3300006847 | Unclassified | 2261 |
| 272 | Ga0075431_100428561 | 3300006847 | Bacteria | 1321 |
| 273 | Ga0075433_10565747 | 3300006852 | Bacteria | 999 |
| 274 | Ga0075434_100040445 | 3300006871 | Bacteria | 4616 |
| 275 | Ga0075434_100379247 | 3300006871 | Bacteria | 1435 |
| 276 | Ga0075429_100017339 | 3300006880 | Bacteria | 6226 |
| 277 | Ga0075429_100107051 | 3300006880 | Bacteria | 2443 |
| 278 | Ga0075429_101029327 | 3300006880 | Unclassified | 720 |
| 279 | Ga0075429_101448875 | 3300006880 | Unclassified | 598 |
| 280 | Ga0068865_100082075 | 3300006881 | Bacteria | 2317 |
| 281 | Ga0068865_100086223 | 3300006881 | Bacteria | 2266 |
| 282 | Ga0068865_100222591 | 3300006881 | Unclassified | 1476 |
| 283 | Ga0068865_100240685 | 3300006881 | Unclassified | 1424 |
| 284 | Ga0068865_100449984 | 3300006881 | Unclassified | 1064 |
| 285 | Ga0068865_100473444 | 3300006881 | Bacteria | 1040 |
| 286 | Ga0068865_100604970 | 3300006881 | Unclassified | 927 |
| 287 | Ga0075436_100028486 | 3300006914 | Bacteria | 3842 |
| 288 | Ga0097620_100007178 | 3300006931 | Bacteria | 11310 |
| 289 | Ga0097620_100178999 | 3300006931 | Unclassified | 2203 |
| 290 | Ga0097620_100320545 | 3300006931 | Bacteria | 1644 |
| 291 | Ga0097620_101481283 | 3300006931 | Bacteria | 749 |
| 292 | Ga0075435_100094831 | 3300007076 | Bacteria | 2467 |
| 293 | Ga0105244_10039248 | 3300009036 | Bacteria | 2465 |
| 294 | Ga0105240_10596601 | 3300009093 | Unclassified | 1216 |
| 295 | Ga0105240_11348218 | 3300009093 | Unclassified | 751 |
| 296 | Ga0111539_10003600 | 3300009094 | Bacteria | 20430 |
| 297 | Ga0111539_10027451 | 3300009094 | Bacteria | 6954 |
| 298 | Ga0111539_10038708 | 3300009094 | Bacteria | 5755 |
| 299 | Ga0111539_10077139 | 3300009094 | Bacteria | 3922 |
| 300 | Ga0111539_10252521 | 3300009094 | Bacteria | 2053 |
| 301 | Ga0111539_10262375 | 3300009094 | Bacteria | 2011 |
| 302 | Ga0111539_11293120 | 3300009094 | Bacteria | 846 |
| 303 | Ga0111539_11753510 | 3300009094 | Bacteria | 720 |
| 304 | Ga0111539_12263717 | 3300009094 | Unclassified | 630 |
| 305 | Ga0105245_10003898 | 3300009098 | Bacteria | 13261 |
| 306 | Ga0105245_10018405 | 3300009098 | Bacteria | 6107 |
| 307 | Ga0105245_10142426 | 3300009098 | Unclassified | 2259 |
| 308 | Ga0105245_10155368 | 3300009098 | Bacteria | 2166 |
| 309 | Ga0105245_10184423 | 3300009098 | Unclassified | 1996 |
| 310 | Ga0105245_10335082 | 3300009098 | Bacteria | 1494 |
| 311 | Ga0105247_10264307 | 3300009101 | Unclassified | 1181 |
| 312 | Ga0114129_10034544 | 3300009147 | Bacteria | 7142 |
| 313 | Ga0114129_10224897 | 3300009147 | Bacteria | 2530 |
| 314 | Ga0114129_10225871 | 3300009147 | Bacteria | 2523 |
| 315 | Ga0114129_10472712 | 3300009147 | Unclassified | 1641 |
| 316 | Ga0114129_10698651 | 3300009147 | Unclassified | 1304 |
| 317 | Ga0114129_11869758 | 3300009147 | Bacteria | 729 |
| 318 | Ga0114129_12327259 | 3300009147 | Bacteria | 643 |
| 319 | Ga0105243_10015986 | 3300009148 | Bacteria | 5675 |
| 320 | Ga0105243_10109339 | 3300009148 | Unclassified | 2309 |
| 321 | Ga0105243_10155968 | 3300009148 | Bacteria | 1963 |
| 322 | Ga0105243_10193181 | 3300009148 | Unclassified | 1779 |
| 323 | Ga0105243_10624510 | 3300009148 | Bacteria | 1041 |
| 324 | Ga0105241_10039256 | 3300009174 | Unclassified | 3570 |
| 325 | Ga0105241_10388316 | 3300009174 | Unclassified | 1221 |
| 326 | Ga0105242_10017423 | 3300009176 | Bacteria | 5599 |
| 327 | Ga0105242_10021167 | 3300009176 | Bacteria | 5104 |
| 328 | Ga0105242_10096129 | 3300009176 | Bacteria | 2502 |
| 329 | Ga0105242_10161307 | 3300009176 | Bacteria | 1963 |
| 330 | Ga0105242_10556071 | 3300009176 | Unclassified | 1101 |
| 331 | Ga0105242_11086372 | 3300009176 | Unclassified | 813 |
| 332 | Ga0105248_10039405 | 3300009177 | Bacteria | 5291 |
| 333 | Ga0105248_10064598 | 3300009177 | Bacteria | 4109 |
| 334 | Ga0105248_10073671 | 3300009177 | Bacteria | 3837 |
| 335 | Ga0105248_10191974 | 3300009177 | Archaea | 2301 |
| 336 | Ga0105248_10557329 | 3300009177 | Bacteria | 1293 |
| 337 | Ga0105248_10758936 | 3300009177 | Unclassified | 1095 |
| 338 | Ga0105237_10048944 | 3300009545 | Bacteria | 4249 |
| 339 | Ga0105238_10015083 | 3300009551 | Bacteria | 7825 |
| 340 | Ga0105238_10042589 | 3300009551 | Bacteria | 4597 |
| 341 | Ga0105238_10956076 | 3300009551 | Bacteria | 877 |
| 342 | Ga0105238_11319815 | 3300009551 | Unclassified | 748 |
| 343 | Ga0105249_10005190 | 3300009553 | Bacteria | 11241 |
| 344 | Ga0105249_10028478 | 3300009553 | Bacteria | 5042 |
| 345 | Ga0105249_10338381 | 3300009553 | Bacteria | 1521 |
| 346 | Ga0105249_10683346 | 3300009553 | Bacteria | 1086 |
| 347 | Ga0105249_11290673 | 3300009553 | Bacteria | 801 |
| 348 | Ga0105239_10003612 | 3300010375 | Bacteria | 18903 |
| 349 | Ga0105239_10011361 | 3300010375 | Bacteria | 9935 |
| 350 | Ga0105239_10014264 | 3300010375 | Bacteria | 8821 |
| 351 | Ga0105239_10097832 | 3300010375 | Archaea | 3243 |
| 352 | Ga0105239_10142611 | 3300010375 | Bacteria | 2670 |
| 353 | Ga0105239_10350401 | 3300010375 | Unclassified | 1667 |
| 354 | Ga0105246_10016979 | 3300011119 | Bacteria | 4621 |
| 355 | Ga0105246_10037305 | 3300011119 | Unclassified | 3262 |
| 356 | Ga0105246_10108436 | 3300011119 | Bacteria | 2035 |
| 357 | Ga0105246_10160863 | 3300011119 | Bacteria | 1710 |
| 358 | Ga0157324_1010787 | 3300012506 | Bacteria | 780 |
| 359 | Ga0157342_1006264 | 3300012507 | Bacteria | 1120 |
| 360 | Ga0157315_1009579 | 3300012508 | Bacteria | 836 |
| 361 | Ga0157338_1002008 | 3300012515 | Bacteria | 1548 |
| 362 | Ga0157373_10060991 | 3300013100 | Archaea | 2672 |
| 363 | Ga0157371_10006307 | 3300013102 | Bacteria | 9822 |
| 364 | Ga0157371_10035578 | 3300013102 | Bacteria | 3568 |
| 365 | Ga0157371_10371427 | 3300013102 | Unclassified | 1043 |
| 366 | Ga0157371_10573702 | 3300013102 | Unclassified | 838 |
| 367 | Ga0157369_10784852 | 3300013105 | Bacteria | 979 |
| 368 | Ga0157369_11842336 | 3300013105 | Unclassified | 614 |
| 369 | Ga0157374_10053364 | 3300013296 | Unclassified | 3768 |
| 370 | Ga0157374_10204761 | 3300013296 | Archaea | 1933 |
| 371 | Ga0157378_10010906 | 3300013297 | Bacteria | 7949 |
| 372 | Ga0157378_10315065 | 3300013297 | Bacteria | 1518 |
| 373 | Ga0157378_10316676 | 3300013297 | Unclassified | 1514 |
| 374 | Ga0157378_10788119 | 3300013297 | Unclassified | 975 |
| 375 | Ga0157378_11550472 | 3300013297 | Bacteria | 708 |
| 376 | Ga0163162_10011370 | 3300013306 | Bacteria | 8678 |
| 377 | Ga0163162_10027414 | 3300013306 | Archaea | 5633 |
| 378 | Ga0163162_10079016 | 3300013306 | Bacteria | 3356 |
| 379 | Ga0163162_10154494 | 3300013306 | Bacteria | 2414 |
| 380 | Ga0163162_10199801 | 3300013306 | Bacteria | 2128 |
| 381 | Ga0163162_10279805 | 3300013306 | Unclassified | 1800 |
| 382 | Ga0163162_10325080 | 3300013306 | Bacteria | 1670 |
| 383 | Ga0163162_11070544 | 3300013306 | Bacteria | 913 |
| 384 | Ga0157372_10012819 | 3300013307 | Bacteria | 8934 |
| 385 | Ga0157372_10085638 | 3300013307 | Bacteria | 3575 |
| 386 | Ga0157372_10522207 | 3300013307 | Bacteria | 1384 |
| 387 | Ga0157375_10002897 | 3300013308 | Bacteria | 14865 |
| 388 | Ga0157375_10004110 | 3300013308 | Bacteria | 12624 |
| 389 | Ga0157375_10093364 | 3300013308 | Archaea | 3075 |
| 390 | Ga0157375_10129225 | 3300013308 | Bacteria | 2644 |
| 391 | Ga0157375_10132609 | 3300013308 | Unclassified | 2612 |
| 392 | Ga0163163_10094337 | 3300014325 | Unclassified | 3010 |
| 393 | Ga0163163_10225073 | 3300014325 | Archaea | 1925 |
| 394 | Ga0163163_10314021 | 3300014325 | Bacteria | 1620 |
| 395 | Ga0163163_10356525 | 3300014325 | Bacteria | 1519 |
| 396 | Ga0157380_10007447 | 3300014326 | Bacteria | 7773 |
| 397 | Ga0157380_10132317 | 3300014326 | Bacteria | 2130 |
| 398 | Ga0157380_10522640 | 3300014326 | Bacteria | 1158 |
| 399 | Ga0182008_10180462 | 3300014497 | Bacteria | 1068 |
| 400 | Ga0157377_10001024 | 3300014745 | Bacteria | 11804 |
| 401 | Ga0157377_10039358 | 3300014745 | Unclassified | 2614 |
| 402 | Ga0157377_11232458 | 3300014745 | Bacteria | 581 |
| 403 | Ga0157379_10108056 | 3300014968 | Bacteria | 2497 |
| 404 | Ga0157379_10231771 | 3300014968 | Unclassified | 1674 |
| 405 | Ga0157379_10360086 | 3300014968 | Unclassified | 1333 |
| 406 | Ga0157379_10445731 | 3300014968 | Archaea | 1194 |
| 407 | Ga0157379_10910539 | 3300014968 | Bacteria | 835 |
| 408 | Ga0157376_10088506 | 3300014969 | Bacteria | 2675 |
| 409 | Ga0157376_10456463 | 3300014969 | Bacteria | 1248 |
| 410 | Ga0157376_10688022 | 3300014969 | Unclassified | 1026 |
| 411 | Ga0157376_11905885 | 3300014969 | Bacteria | 631 |
| 412 | Ga0163161_10238465 | 3300017792 | Bacteria | 1414 |
| 413 | Ga0163161_10725799 | 3300017792 | Bacteria | 829 |
| 414 | Ga0163161_11220336 | 3300017792 | Bacteria | 651 |
| 415 | Ga0163161_11317139 | 3300017792 | Bacteria | 628 |
| 416 | Ga0206353_11584542 | 3300020082 | Unclassified | 898 |
| 417 | Ga0207697_10262662 | 3300025315 | Bacteria | 764 |
| 418 | Ga0207656_10082139 | 3300025321 | Unclassified | 1450 |
| 419 | Ga0207656_10137573 | 3300025321 | Bacteria | 1149 |
| 420 | Ga0207653_10008949 | 3300025885 | Bacteria | 3124 |
| 421 | Ga0207692_10368521 | 3300025898 | Bacteria | 889 |
| 422 | Ga0207642_10014429 | 3300025899 | Bacteria | 2916 |
| 423 | Ga0207642_10415577 | 3300025899 | Unclassified | 808 |
| 424 | Ga0207710_10016852 | 3300025900 | Archaea | 3094 |
| 425 | Ga0207688_10002607 | 3300025901 | Bacteria | 9755 |
| 426 | Ga0207688_10003393 | 3300025901 | Bacteria | 8686 |
| 427 | Ga0207688_10031118 | 3300025901 | Bacteria | 2945 |
| 428 | Ga0207688_10033749 | 3300025901 | Bacteria | 2831 |
| 429 | Ga0207688_10081369 | 3300025901 | Bacteria | 1850 |
| 430 | Ga0207688_10248498 | 3300025901 | Bacteria | 1077 |
| 431 | Ga0207680_10532465 | 3300025903 | Bacteria | 838 |
| 432 | Ga0207645_10022120 | 3300025907 | Bacteria | 4140 |
| 433 | Ga0207645_10084423 | 3300025907 | Bacteria | 2038 |
| 434 | Ga0207643_10002023 | 3300025908 | Bacteria | 11196 |
| 435 | Ga0207643_10025022 | 3300025908 | Unclassified | 3297 |
| 436 | Ga0207705_10027306 | 3300025909 | Bacteria | 4071 |
| 437 | Ga0207684_10019475 | 3300025910 | Bacteria | 5805 |
| 438 | Ga0207684_10244472 | 3300025910 | Bacteria | 1548 |
| 439 | Ga0207654_10157131 | 3300025911 | Unclassified | 1465 |
| 440 | Ga0207707_10421024 | 3300025912 | Bacteria | 1145 |
| 441 | Ga0207671_10333132 | 3300025914 | Unclassified | 1202 |
| 442 | Ga0207693_10001432 | 3300025915 | Bacteria | 21142 |
| 443 | Ga0207693_10004838 | 3300025915 | Bacteria | 11332 |
| 444 | Ga0207663_10110384 | 3300025916 | Bacteria | 1865 |
| 445 | Ga0207663_10131634 | 3300025916 | Bacteria | 1729 |
| 446 | Ga0207660_10027789 | 3300025917 | Bacteria | 3864 |
| 447 | Ga0207662_10018197 | 3300025918 | Bacteria | 3982 |
| 448 | Ga0207662_10023638 | 3300025918 | Bacteria | 3533 |
| 449 | Ga0207662_10071346 | 3300025918 | Archaea | 2103 |
| 450 | Ga0207662_10410464 | 3300025918 | Bacteria | 920 |
| 451 | Ga0207657_10006330 | 3300025919 | Bacteria | 12297 |
| 452 | Ga0207657_10114716 | 3300025919 | Bacteria | 2221 |
| 453 | Ga0207649_10262572 | 3300025920 | Bacteria | 1248 |
| 454 | Ga0207652_10358461 | 3300025921 | Unclassified | 1316 |
| 455 | Ga0207652_10506732 | 3300025921 | Bacteria | 1086 |
| 456 | Ga0207652_10701242 | 3300025921 | Unclassified | 903 |
| 457 | Ga0207646_10009493 | 3300025922 | Bacteria | 9612 |
| 458 | Ga0207694_10143128 | 3300025924 | Unclassified | 1923 |
| 459 | Ga0207694_10143533 | 3300025924 | Bacteria | 1921 |
| 460 | Ga0207694_10421023 | 3300025924 | Bacteria | 1112 |
| 461 | Ga0207650_10057330 | 3300025925 | Unclassified | 2897 |
| 462 | Ga0207659_10121756 | 3300025926 | Bacteria | 2000 |
| 463 | Ga0207687_10077879 | 3300025927 | Bacteria | 2385 |
| 464 | Ga0207687_10526155 | 3300025927 | Unclassified | 990 |
| 465 | Ga0207644_10236096 | 3300025931 | Bacteria | 1454 |
| 466 | Ga0207690_10288069 | 3300025932 | Unclassified | 1281 |
| 467 | Ga0207690_10306112 | 3300025932 | Bacteria | 1245 |
| 468 | Ga0207706_10010525 | 3300025933 | Bacteria | 8452 |
| 469 | Ga0207706_10014547 | 3300025933 | Bacteria | 7131 |
| 470 | Ga0207706_10099521 | 3300025933 | Bacteria | 2558 |
| 471 | Ga0207706_10217047 | 3300025933 | Bacteria | 1676 |
| 472 | Ga0207706_10320855 | 3300025933 | Bacteria | 1348 |
| 473 | Ga0207686_10051564 | 3300025934 | Bacteria | 2564 |
| 474 | Ga0207686_10673011 | 3300025934 | Bacteria | 820 |
| 475 | Ga0207686_10746259 | 3300025934 | Bacteria | 781 |
| 476 | Ga0207709_10004029 | 3300025935 | Bacteria | 8559 |
| 477 | Ga0207709_10050362 | 3300025935 | Bacteria | 2547 |
| 478 | Ga0207709_10080099 | 3300025935 | Bacteria | 2102 |
| 479 | Ga0207709_10164195 | 3300025935 | Unclassified | 1552 |
| 480 | Ga0207709_10498600 | 3300025935 | Bacteria | 950 |
| 481 | Ga0207709_10511108 | 3300025935 | Bacteria | 939 |
| 482 | Ga0207709_11116998 | 3300025935 | Unclassified | 648 |
| 483 | Ga0207670_10101189 | 3300025936 | Unclassified | 2059 |
| 484 | Ga0207670_10109467 | 3300025936 | Archaea | 1988 |
| 485 | Ga0207670_11082541 | 3300025936 | Bacteria | 676 |
| 486 | Ga0207669_10003654 | 3300025937 | Bacteria | 6678 |
| 487 | Ga0207669_10051065 | 3300025937 | Bacteria | 2475 |
| 488 | Ga0207669_10293530 | 3300025937 | Bacteria | 1232 |
| 489 | Ga0207704_10018636 | 3300025938 | Archaea | 3628 |
| 490 | Ga0207704_10211308 | 3300025938 | Bacteria | 1428 |
| 491 | Ga0207704_10223787 | 3300025938 | Bacteria | 1394 |
| 492 | Ga0207704_10295378 | 3300025938 | Bacteria | 1238 |
| 493 | Ga0207704_10318772 | 3300025938 | Unclassified | 1198 |
| 494 | Ga0207665_10095246 | 3300025939 | Bacteria | 2069 |
| 495 | Ga0207665_10216825 | 3300025939 | Bacteria | 1401 |
| 496 | Ga0207691_10004005 | 3300025940 | Bacteria | 14289 |
| 497 | Ga0207691_10016003 | 3300025940 | Bacteria | 7123 |
| 498 | Ga0207691_10026907 | 3300025940 | Bacteria | 5396 |
| 499 | Ga0207691_11107296 | 3300025940 | Unclassified | 659 |
| 500 | Ga0207711_10097138 | 3300025941 | Bacteria | 2601 |
| 501 | Ga0207711_10204324 | 3300025941 | Unclassified | 1803 |
| 502 | Ga0207711_10669488 | 3300025941 | Unclassified | 968 |
| 503 | Ga0207689_10013172 | 3300025942 | Archaea | 7056 |
| 504 | Ga0207661_10034257 | 3300025944 | Archaea | 3947 |
| 505 | Ga0207661_10130916 | 3300025944 | Bacteria | 2149 |
| 506 | Ga0207661_10561935 | 3300025944 | Bacteria | 1046 |
| 507 | Ga0207661_10621551 | 3300025944 | Bacteria | 992 |
| 508 | Ga0207679_10054403 | 3300025945 | Bacteria | 2946 |
| 509 | Ga0207679_10395265 | 3300025945 | Unclassified | 1215 |
| 510 | Ga0207679_10455566 | 3300025945 | Unclassified | 1135 |
| 511 | Ga0207667_10171616 | 3300025949 | Bacteria | 2229 |
| 512 | Ga0207667_10280046 | 3300025949 | Bacteria | 1704 |
| 513 | Ga0207667_10709950 | 3300025949 | Bacteria | 1007 |
| 514 | Ga0207651_10238857 | 3300025960 | Bacteria | 1479 |
| 515 | Ga0207651_10272768 | 3300025960 | Bacteria | 1394 |
| 516 | Ga0207651_10711543 | 3300025960 | Bacteria | 885 |
| 517 | Ga0207712_10368692 | 3300025961 | Bacteria | 1198 |
| 518 | Ga0207668_10125752 | 3300025972 | Unclassified | 1949 |
| 519 | Ga0207668_10226566 | 3300025972 | Bacteria | 1504 |
| 520 | Ga0207668_10343761 | 3300025972 | Bacteria | 1245 |
| 521 | Ga0207640_10003852 | 3300025981 | Bacteria | 8095 |
| 522 | Ga0207640_10141404 | 3300025981 | Bacteria | 1755 |
| 523 | Ga0207640_10205986 | 3300025981 | Unclassified | 1494 |
| 524 | Ga0207640_10238631 | 3300025981 | Bacteria | 1403 |
| 525 | Ga0207640_10239298 | 3300025981 | Bacteria | 1402 |
| 526 | Ga0207658_10336637 | 3300025986 | Bacteria | 1311 |
| 527 | Ga0207677_10147593 | 3300026023 | Unclassified | 1809 |
| 528 | Ga0207677_10462440 | 3300026023 | Bacteria | 1089 |
| 529 | Ga0207677_11440775 | 3300026023 | Bacteria | 635 |
| 530 | Ga0207703_10387692 | 3300026035 | Unclassified | 1294 |
| 531 | Ga0207703_10672568 | 3300026035 | Bacteria | 983 |
| 532 | Ga0207639_10067647 | 3300026041 | Bacteria | 2780 |
| 533 | Ga0207639_10083750 | 3300026041 | Bacteria | 2532 |
| 534 | Ga0207678_10013710 | 3300026067 | Archaea | 7120 |
| 535 | Ga0207678_10412608 | 3300026067 | Bacteria | 1170 |
| 536 | Ga0207678_10417254 | 3300026067 | Bacteria | 1163 |
| 537 | Ga0207708_10000760 | 3300026075 | Bacteria | 24224 |
| 538 | Ga0207708_10013914 | 3300026075 | Bacteria | 6013 |
| 539 | Ga0207708_10058599 | 3300026075 | Bacteria | 2938 |
| 540 | Ga0207708_10074394 | 3300026075 | Unclassified | 2604 |
| 541 | Ga0207702_10421937 | 3300026078 | Bacteria | 1290 |
| 542 | Ga0207641_10104193 | 3300026088 | Archaea | 2504 |
| 543 | Ga0207648_10008338 | 3300026089 | Bacteria | 10053 |
| 544 | Ga0207648_10042591 | 3300026089 | Bacteria | 3985 |
| 545 | Ga0207648_10052200 | 3300026089 | Bacteria | 3574 |
| 546 | Ga0207648_10080954 | 3300026089 | Bacteria | 2833 |
| 547 | Ga0207648_10203996 | 3300026089 | Bacteria | 1754 |
| 548 | Ga0207676_10065381 | 3300026095 | Bacteria | 2896 |
| 549 | Ga0207676_10204136 | 3300026095 | Archaea | 1748 |
| 550 | Ga0207674_10000156 | 3300026116 | Bacteria | 80650 |
| 551 | Ga0207674_10216014 | 3300026116 | Bacteria | 1866 |
| 552 | Ga0207675_100003335 | 3300026118 | Bacteria | 15717 |
| 553 | Ga0207675_100008735 | 3300026118 | Bacteria | 9516 |
| 554 | Ga0207675_100020442 | 3300026118 | Bacteria | 6171 |
| 555 | Ga0207675_100033750 | 3300026118 | Archaea | 4768 |
| 556 | Ga0207675_100052136 | 3300026118 | Unclassified | 3818 |
| 557 | Ga0207675_100618802 | 3300026118 | Bacteria | 1087 |
| 558 | Ga0207683_10001662 | 3300026121 | Bacteria | 19920 |
| 559 | Ga0207683_10003793 | 3300026121 | Bacteria | 13096 |
| 560 | Ga0207683_10093159 | 3300026121 | Bacteria | 2684 |
| 561 | Ga0207683_10509562 | 3300026121 | Bacteria | 1112 |
| 562 | Ga0207683_10522159 | 3300026121 | Unclassified | 1097 |
| 563 | Ga0207698_10040895 | 3300026142 | Bacteria | 3450 |
| 564 | Ga0207698_10104261 | 3300026142 | Bacteria | 2359 |
| 565 | Ga0207698_10482844 | 3300026142 | Bacteria | 1202 |
| 566 | Ga0207698_10756107 | 3300026142 | Bacteria | 971 |
| 567 | Ga0207698_10874271 | 3300026142 | Bacteria | 905 |
| 568 | Ga0209966_1008982 | 3300027695 | Bacteria | 1780 |
| 569 | Ga0207428_10013230 | 3300027907 | Bacteria | 7219 |
| 570 | Ga0207428_10014091 | 3300027907 | Bacteria | 6962 |
| 571 | Ga0207428_10023040 | 3300027907 | Bacteria | 5243 |
| 572 | Ga0207428_10026971 | 3300027907 | Bacteria | 4786 |
| 573 | Ga0207428_10027259 | 3300027907 | Archaea | 4758 |
| 574 | Ga0207428_10052131 | 3300027907 | Bacteria | 3269 |
| 575 | Ga0207428_10595189 | 3300027907 | Unclassified | 797 |
| 576 | Ga0268266_10821397 | 3300028379 | Bacteria | 898 |
| 577 | Ga0268266_11998525 | 3300028379 | Unclassified | 553 |
| 578 | Ga0268264_10161296 | 3300028381 | Unclassified | 2020 |
| 579 | Ga0268264_10786122 | 3300028381 | Bacteria | 950 |
| 580 | Ga0307408_100032608 | 3300031548 | Bacteria | 3633 |
| 581 | Ga0307408_100190142 | 3300031548 | Bacteria | 1653 |
| 582 | Ga0307405_10001813 | 3300031731 | Bacteria | 9149 |
| 583 | Ga0307405_10885067 | 3300031731 | Bacteria | 754 |
| 584 | Ga0307413_10363382 | 3300031824 | Bacteria | 1121 |
| 585 | Ga0307406_10072476 | 3300031901 | Bacteria | 2261 |
| 586 | Ga0307407_10086925 | 3300031903 | Bacteria | 1906 |
| 587 | Ga0307412_10023772 | 3300031911 | Bacteria | 3776 |
| 588 | Ga0307412_10250836 | 3300031911 | Bacteria | 1374 |
| 589 | Ga0307409_100001195 | 3300031995 | Bacteria | 12446 |
| 590 | Ga0307409_100044988 | 3300031995 | Bacteria | 3329 |
| 591 | Ga0307416_100011220 | 3300032002 | Bacteria | 5957 |
| 592 | Ga0307416_100423590 | 3300032002 | Bacteria | 1376 |
| 593 | Ga0307414_10015559 | 3300032004 | Bacteria | 4593 |
| 594 | Ga0307411_10054868 | 3300032005 | Bacteria | 2619 |
| 595 | Ga0307411_10068084 | 3300032005 | Bacteria | 2398 |
| 596 | Ga0307415_100006940 | 3300032126 | Bacteria | 6152 |
| 597 | Ga0307415_100101838 | 3300032126 | Bacteria | 2108 |
| 598 | Ga0373958_0063858 | 3300034819 | Bacteria | 803 |
| 599 | Ga0373958_0076411 | 3300034819 | Unclassified | 752 |
| 600 | Ga0373959_0004214 | 3300034820 | Archaea | 2310 |
| 601 | Ga0373949_0053078 | 3300035090 | Unclassified | 1026 |
| 602 | Ga0373945_0198676 | 3300035116 | Bacteria | 832 |
| 603 | Ga0373960_0006030 | 3300035121 | Archaea | 2827 |
| 604 | Ga0373946_0271890 | 3300035171 | Bacteria | 832 |
| 605 | Ga0373961_0019234 | 3300035241 | Archaea | 1791 |
| 606 | Ga0373962_0001783 | 3300035242 | Bacteria | 5127 |
| 607 | Ga0373931_0587956 | 3300035691 | Unclassified | 726 |
| 608 | Ga0373935_0259739 | 3300035692 | Bacteria | 1218 |
| 609 | Ga0373947_0246286 | 3300035725 | Bacteria | 1181 |
| 610 | Ga0395899_0004348 | 3300037312 | Bacteria | 11060 |
| 611 | Ga0395899_0005306 | 3300037312 | Bacteria | 10006 |
| 612 | Ga0395899_0006773 | 3300037312 | Bacteria | 8878 |
| 613 | Ga0395899_0034980 | 3300037312 | Unclassified | 3772 |
| 614 | Ga0395899_0071294 | 3300037312 | Bacteria | 2542 |
| 615 | Ga0395899_0306719 | 3300037312 | Bacteria | 1073 |
| 616 | Ga0395900_0002748 | 3300037418 | Bacteria | 19211 |
| 617 | Ga0395900_0010576 | 3300037418 | Bacteria | 9435 |
| 618 | Ga0395900_0011168 | 3300037418 | Bacteria | 9181 |
| 619 | Ga0395900_0012861 | 3300037418 | Bacteria | 8552 |
| 620 | Ga0395900_0021483 | 3300037418 | Bacteria | 6600 |
| 621 | Ga0395900_0024536 | 3300037418 | Bacteria | 6174 |
| 622 | Ga0395900_0056587 | 3300037418 | Bacteria | 4036 |
| 623 | Ga0395900_0057422 | 3300037418 | Bacteria | 4007 |
| 624 | Ga0395900_0140909 | 3300037418 | Unclassified | 2469 |
| 625 | Ga0395900_0352191 | 3300037418 | Bacteria | 1446 |
| 626 | Ga0395900_0397442 | 3300037418 | Unclassified | 1343 |
| 627 | Ga0395900_0719507 | 3300037418 | Bacteria | 931 |
| 628 | Ga0395900_1163257 | 3300037418 | Bacteria | 687 |
| 629 | Ga0395898_0004644 | 3300037466 | Bacteria | 14973 |
| 630 | Ga0395898_0004773 | 3300037466 | Bacteria | 14746 |
| 631 | Ga0395898_0007284 | 3300037466 | Bacteria | 11745 |
| 632 | Ga0395898_0008187 | 3300037466 | Bacteria | 11062 |
| 633 | Ga0395898_0011507 | 3300037466 | Bacteria | 9187 |
| 634 | Ga0395898_0019216 | 3300037466 | Bacteria | 6956 |
| 635 | Ga0395898_0031134 | 3300037466 | Bacteria | 5334 |
| 636 | Ga0395898_0058222 | 3300037466 | Archaea | 3762 |
| 637 | Ga0395898_0111863 | 3300037466 | Unclassified | 2617 |
| 638 | Ga0395898_0364876 | 3300037466 | Bacteria | 1377 |
| 639 | Ga0395898_1055646 | 3300037466 | Bacteria | 747 |
| 640 | Ga0395898_1324417 | 3300037466 | Bacteria | 649 |
| 641 | Ga0395905_0005256 | 3300037471 | Bacteria | 13245 |
| 642 | Ga0395905_0008250 | 3300037471 | Bacteria | 10288 |
| 643 | Ga0395905_0014153 | 3300037471 | Bacteria | 7622 |
| 644 | Ga0395905_0036212 | 3300037471 | Bacteria | 4634 |
| 645 | Ga0395905_0037437 | 3300037471 | Bacteria | 4554 |
| 646 | Ga0395905_0046765 | 3300037471 | Bacteria | 4057 |
| 647 | Ga0395905_0070640 | 3300037471 | Bacteria | 3272 |
| 648 | Ga0395905_0122828 | 3300037471 | Bacteria | 2441 |
| 649 | Ga0395905_0123239 | 3300037471 | Bacteria | 2437 |
| 650 | Ga0395901_0003097 | 3300038443 | Bacteria | 16727 |
| 651 | Ga0395901_0004483 | 3300038443 | Bacteria | 14079 |
| 652 | Ga0395901_0009567 | 3300038443 | Bacteria | 9834 |
| 653 | Ga0395901_0032052 | 3300038443 | Bacteria | 5422 |
| 654 | Ga0395901_0075575 | 3300038443 | Bacteria | 3514 |
| 655 | Ga0395901_0097195 | 3300038443 | Bacteria | 3086 |
| 656 | Ga0395901_0115356 | 3300038443 | Bacteria | 2821 |
| 657 | Ga0395901_0149312 | 3300038443 | Bacteria | 2456 |
| 658 | Ga0395901_0206841 | 3300038443 | Bacteria | 2055 |
| 659 | Ga0395901_0209342 | 3300038443 | Bacteria | 2041 |
| 660 | Ga0395901_0302976 | 3300038443 | Bacteria | 1657 |
| 661 | Ga0395901_0426423 | 3300038443 | Bacteria | 1359 |
| 662 | Ga0395901_0753539 | 3300038443 | Bacteria | 967 |
| 663 | Ga0395901_0963107 | 3300038443 | Unclassified | 831 |
| 664 | Ga0439453_0036904 | 3300041408 | Unclassified | 946 |
| 665 | Ga0451789_0730060 | 3300041443 | Bacteria | 625 |
| 666 | Ga0451807_1018272 | 3300041486 | Unclassified | 2837 |
| 667 | Ga0451853_3042737 | 3300041512 | Bacteria | 538 |
| 668 | Ga0439448_0060563 | 3300042005 | Bacteria | 1251 |
| 669 | Ga0439463_081380 | 3300042016 | Bacteria | 833 |
| 670 | Ga0450920_076351 | 3300042122 | Bacteria | 684 |
| 671 | Ga0450923_007153 | 3300042125 | Bacteria | 1876 |
| 672 | Ga0450906_044864 | 3300042145 | Bacteria | 780 |
| 673 | Ga0450907_007013 | 3300042146 | Bacteria | 1879 |
| 674 | Ga0439435_0125973 | 3300042436 | Unclassified | 806 |
| 675 | Ga0439460_0153595 | 3300042461 | Unclassified | 769 |
| 676 | Ga0439460_0303399 | 3300042461 | Bacteria | 558 |
| 677 | Ga0439440_0085008 | 3300042993 | Bacteria | 842 |
| 678 | Ga0466960_0747517 | 3300044901 | Unclassified | 589 |
| 679 | Ga0451576_0969523 | 3300045051 | Unclassified | 891 |
| 680 | Ga0495603_0062348 | 3300046455 | Bacteria | 2201 |
| 681 | Ga0495603_0101325 | 3300046455 | Bacteria | 1681 |
| 682 | Ga0495590_0056412 | 3300046457 | Bacteria | 1373 |
| 683 | Ga0495591_122247 | 3300046458 | Unclassified | 635 |
| 684 | Ga0495629_0296460 | 3300046459 | Bacteria | 1108 |
| 685 | Ga0495641_0156043 | 3300046461 | Bacteria | 1021 |
| 686 | Ga0495582_0074420 | 3300046473 | Bacteria | 1880 |
| 687 | Ga0495582_0108816 | 3300046473 | Bacteria | 1556 |
| 688 | Ga0495605_0033189 | 3300046474 | Archaea | 2623 |
| 689 | Ga0495605_0039891 | 3300046474 | Bacteria | 2349 |
| 690 | Ga0495605_0130090 | 3300046474 | Bacteria | 1136 |
| 691 | Ga0495584_0011490 | 3300046491 | Unclassified | 4536 |
| 692 | Ga0495584_0037992 | 3300046491 | Bacteria | 2434 |
| 693 | Ga0495584_0044156 | 3300046491 | Unclassified | 2249 |
| 694 | Ga0495584_0090519 | 3300046491 | Bacteria | 1543 |
| 695 | Ga0495584_0166107 | 3300046491 | Bacteria | 1122 |
| 696 | Ga0495585_0258361 | 3300046492 | Bacteria | 867 |
| 697 | Ga0495585_0272819 | 3300046492 | Bacteria | 838 |
| 698 | Ga0495594_0055152 | 3300046499 | Bacteria | 2191 |
| 699 | Ga0495594_0398380 | 3300046499 | Bacteria | 783 |
| 700 | Ga0495596_0061679 | 3300046500 | Bacteria | 1460 |
| 701 | Ga0495596_0259827 | 3300046500 | Bacteria | 674 |
| 702 | Ga0495583_0116542 | 3300046506 | Unclassified | 1128 |
| 703 | Ga0495616_0099167 | 3300046513 | Bacteria | 1368 |
| 704 | Ga0495620_0071238 | 3300046515 | Bacteria | 1422 |
| 705 | Ga0495630_0849438 | 3300046517 | Bacteria | 696 |
| 706 | Ga0495631_0079726 | 3300046518 | Unclassified | 1413 |
| 707 | Ga0495631_0173179 | 3300046518 | Bacteria | 925 |
| 708 | Ga0495637_0082200 | 3300046520 | Bacteria | 1283 |
| 709 | Ga0495637_0105550 | 3300046520 | Bacteria | 1097 |
| 710 | Ga0495644_0037467 | 3300046523 | Unclassified | 1830 |
| 711 | Ga0495644_0112948 | 3300046523 | Bacteria | 1031 |
| 712 | Ga0495644_0142623 | 3300046523 | Bacteria | 915 |
| 713 | Ga0495644_0172084 | 3300046523 | Bacteria | 832 |
| 714 | Ga0495644_0208322 | 3300046523 | Unclassified | 754 |
| 715 | Ga0495663_0024763 | 3300046525 | Unclassified | 1746 |
| 716 | Ga0495663_0047989 | 3300046525 | Bacteria | 1316 |
| 717 | Ga0495663_0091714 | 3300046525 | Bacteria | 991 |
| 718 | Ga0495666_0147167 | 3300046526 | Bacteria | 1096 |
| 719 | Ga0495642_0024044 | 3300046528 | Bacteria | 2409 |
| 720 | Ga0495642_0088798 | 3300046528 | Bacteria | 1307 |
| 721 | Ga0495642_0183574 | 3300046528 | Bacteria | 911 |
| 722 | Ga0495665_0078872 | 3300046531 | Unclassified | 1732 |
| 723 | Ga0495598_0012782 | 3300046537 | Unclassified | 2069 |
| 724 | Ga0495598_0066578 | 3300046537 | Bacteria | 1124 |
| 725 | Ga0495609_0021345 | 3300046538 | Bacteria | 2987 |
| 726 | Ga0495609_0099970 | 3300046538 | Unclassified | 1257 |
| 727 | Ga0495609_0199550 | 3300046538 | Bacteria | 837 |
| 728 | Ga0495597_0163021 | 3300046542 | Unclassified | 909 |
| 729 | Ga0495656_0224272 | 3300046615 | Bacteria | 941 |
| 730 | Ga0495668_0254543 | 3300046616 | Bacteria | 961 |
| 731 | Ga0495668_0562066 | 3300046616 | Unclassified | 630 |
| 732 | Ga0495611_0168755 | 3300046648 | Bacteria | 1023 |
| 733 | Ga0495659_0055103 | 3300046664 | Unclassified | 1456 |
| 734 | Ga0495659_0244159 | 3300046664 | Bacteria | 747 |
| 735 | Ga0495661_0087667 | 3300046665 | Unclassified | 1779 |
| 736 | Ga0495588_0084886 | 3300046674 | Bacteria | 1655 |
| 737 | Ga0495588_0245878 | 3300046674 | Bacteria | 943 |
| 738 | Ga0495658_0401797 | 3300046683 | Bacteria | 873 |
| 739 | Ga0495669_0030729 | 3300046684 | Archaea | 2358 |
| 740 | Ga0495670_0064904 | 3300046691 | Bacteria | 1840 |
| 741 | Ga0495670_0234395 | 3300046691 | Bacteria | 976 |
| 742 | Ga0495671_0315922 | 3300046692 | Bacteria | 750 |
| 743 | Ga0495589_0010931 | 3300046794 | Bacteria | 4715 |
| 744 | Ga0495589_0276155 | 3300046794 | Bacteria | 782 |
| 745 | Ga0495660_0200212 | 3300046810 | Bacteria | 954 |
| 746 | Ga0495581_0206295 | 3300047315 | Bacteria | 1149 |
| 747 | Ga0495683_0112116 | 3300047323 | Unclassified | 1301 |
| 748 | Ga0495677_0047532 | 3300047445 | Archaea | 1575 |
| 749 | Ga0495677_0124311 | 3300047445 | Bacteria | 985 |
| 750 | Ga0495677_0216816 | 3300047445 | Bacteria | 745 |
| 751 | Ga0495677_0221247 | 3300047445 | Unclassified | 737 |
| 752 | Ga0495673_0189038 | 3300047469 | Unclassified | 776 |
| 753 | Ga0495686_0351765 | 3300047472 | Unclassified | 801 |
| 754 | Ga0495614_0177350 | 3300048089 | Bacteria | 958 |
| 755 | Ga0495615_0073019 | 3300048090 | Bacteria | 928 |
| 756 | Ga0496100_0024806 | 3300048903 | Bacteria | 3662 |
| 757 | Ga0496100_0101405 | 3300048903 | Bacteria | 1984 |
| 758 | Ga0496100_0590448 | 3300048903 | Bacteria | 862 |
| 759 | Ga0496100_0860185 | 3300048903 | Unclassified | 711 |
| 760 | Ga0496100_1076956 | 3300048903 | Bacteria | 633 |
| 761 | Ga0496101_0012970 | 3300048904 | Archaea | 5575 |
| 762 | Ga0496101_0014530 | 3300048904 | Bacteria | 5293 |
| 763 | Ga0496101_0116990 | 3300048904 | Archaea | 2012 |
| 764 | Ga0496101_0246936 | 3300048904 | Unclassified | 1390 |
| 765 | Ga0496101_0320121 | 3300048904 | Bacteria | 1217 |
| 766 | Ga0496102_0000990 | 3300048905 | Bacteria | 26698 |
| 767 | Ga0496102_0176508 | 3300048905 | Unclassified | 2012 |
| 768 | Ga0496102_1016172 | 3300048905 | Bacteria | 750 |
| 769 | Ga0496104_0019090 | 3300048907 | Bacteria | 6266 |
| 770 | Ga0496105_0056456 | 3300048908 | Bacteria | 3241 |
| 771 | Ga0496105_0072857 | 3300048908 | Archaea | 2838 |
| 772 | Ga0496105_0207845 | 3300048908 | Unclassified | 1596 |
| 773 | Ga0496105_0252947 | 3300048908 | Archaea | 1427 |
| 774 | Ga0496105_0313823 | 3300048908 | Bacteria | 1258 |
| 775 | Ga0496106_0004185 | 3300048909 | Bacteria | 10754 |
| 776 | Ga0496106_0062122 | 3300048909 | Bacteria | 2835 |
| 777 | Ga0496106_0098282 | 3300048909 | Archaea | 2267 |
| 778 | Ga0496106_0255798 | 3300048909 | Bacteria | 1401 |
| 779 | Ga0496106_0349934 | 3300048909 | Unclassified | 1187 |
| 780 | Ga0496106_0524335 | 3300048909 | Unclassified | 951 |
| 781 | Ga0496107_0001146 | 3300048910 | Bacteria | 16039 |
| 782 | Ga0496107_0014126 | 3300048910 | Bacteria | 5589 |
| 783 | Ga0496108_0016109 | 3300048911 | Archaea | 6093 |
| 784 | Ga0496108_0061442 | 3300048911 | Archaea | 3162 |
| 785 | Ga0496108_0308495 | 3300048911 | Bacteria | 1379 |
| 786 | Ga0496108_0487990 | 3300048911 | Unclassified | 1076 |
| 787 | Ga0496108_0809422 | 3300048911 | Unclassified | 808 |
| 788 | Ga0496109_0017931 | 3300048912 | Archaea | 6214 |
| 789 | Ga0496109_0162682 | 3300048912 | Bacteria | 2091 |
| 790 | Ga0496109_0209675 | 3300048912 | Bacteria | 1832 |
| 791 | Ga0496109_0293379 | 3300048912 | Bacteria | 1533 |
| 792 | Ga0496109_1219248 | 3300048912 | Bacteria | 689 |
| 793 | Ga0496110_0015030 | 3300048913 | Archaea | 6437 |
| 794 | Ga0496110_0026671 | 3300048913 | Bacteria | 4947 |
| 795 | Ga0496110_0256456 | 3300048913 | Bacteria | 1592 |
| 796 | Ga0496110_0384630 | 3300048913 | Bacteria | 1279 |
| 797 | Ga0496110_0468843 | 3300048913 | Bacteria | 1147 |
| 798 | Ga0496111_0013953 | 3300048914 | Archaea | 5478 |
| 799 | Ga0496111_0031526 | 3300048914 | Archaea | 3776 |
| 800 | Ga0496112_0064751 | 3300048915 | Bacteria | 3608 |
| 801 | Ga0496112_0386277 | 3300048915 | Bacteria | 1340 |
| 802 | Ga0496112_0689187 | 3300048915 | Bacteria | 950 |
| 803 | Ga0496113_0020920 | 3300048916 | Bacteria | 4609 |
| 804 | Ga0496113_0256341 | 3300048916 | Bacteria | 1397 |
| 805 | Ga0496113_0811133 | 3300048916 | Bacteria | 743 |
| 806 | Ga0496114_0018920 | 3300048917 | Bacteria | 5578 |
| 807 | Ga0496114_0048367 | 3300048917 | Archaea | 3538 |
| 808 | Ga0496114_0088183 | 3300048917 | Bacteria | 2632 |
| 809 | Ga0496114_0091784 | 3300048917 | Archaea | 2579 |
| 810 | Ga0496114_0160069 | 3300048917 | Bacteria | 1957 |
| 811 | Ga0496114_0169946 | 3300048917 | Bacteria | 1899 |
| 812 | Ga0496114_0349625 | 3300048917 | Unclassified | 1307 |
| 813 | Ga0496115_0050322 | 3300048918 | Bacteria | 3337 |
| 814 | Ga0496115_0332517 | 3300048918 | Bacteria | 1241 |
| 815 | Ga0501292_025652 | 3300049515 | Bacteria | 972 |
| 816 | Ga0501031_0002040 | 3300049568 | Bacteria | 12709 |
| 817 | Ga0501031_0011335 | 3300049568 | Bacteria | 5806 |
| 818 | Ga0501031_0018235 | 3300049568 | Bacteria | 4567 |
| 819 | Ga0501031_0058959 | 3300049568 | Bacteria | 2502 |
| 820 | Ga0501031_0097481 | 3300049568 | Bacteria | 1919 |
| 821 | Ga0501031_0176349 | 3300049568 | Bacteria | 1396 |
| 822 | Ga0501032_0010152 | 3300049569 | Bacteria | 6795 |
| 823 | Ga0501032_0019630 | 3300049569 | Bacteria | 4724 |
| 824 | Ga0501032_0056794 | 3300049569 | Bacteria | 2630 |
| 825 | Ga0501032_0184625 | 3300049569 | Bacteria | 1364 |
| 826 | Ga0501033_0005477 | 3300049570 | Bacteria | 10051 |
| 827 | Ga0501033_0008600 | 3300049570 | Bacteria | 7901 |
| 828 | Ga0501033_0008837 | 3300049570 | Bacteria | 7780 |
| 829 | Ga0501033_0083439 | 3300049570 | Bacteria | 2342 |
| 830 | Ga0501033_0283115 | 3300049570 | Bacteria | 1170 |
| 831 | Ga0501033_0483880 | 3300049570 | Bacteria | 857 |
| 832 | Ga0501033_1024739 | 3300049570 | Unclassified | 551 |
| 833 | Ga0501034_0021497 | 3300049571 | Bacteria | 6576 |
| 834 | Ga0501034_0153028 | 3300049571 | Bacteria | 2282 |
| 835 | Ga0501034_0447954 | 3300049571 | Bacteria | 1209 |
| 836 | Ga0501036_0000886 | 3300049572 | Bacteria | 22368 |
| 837 | Ga0501036_0001073 | 3300049572 | Bacteria | 20711 |
| 838 | Ga0501036_0046903 | 3300049572 | Bacteria | 3659 |
| 839 | Ga0501036_0061223 | 3300049572 | Bacteria | 3188 |
| 840 | Ga0501036_0078334 | 3300049572 | Bacteria | 2795 |
| 841 | Ga0501036_0111687 | 3300049572 | Unclassified | 2309 |
| 842 | Ga0501036_0114311 | 3300049572 | Bacteria | 2281 |
| 843 | Ga0501036_0188534 | 3300049572 | Bacteria | 1735 |
| 844 | Ga0501036_0189820 | 3300049572 | Unclassified | 1729 |
| 845 | Ga0501036_0485742 | 3300049572 | Bacteria | 1028 |
| 846 | Ga0501037_0003930 | 3300049573 | Bacteria | 10783 |
| 847 | Ga0501037_0006125 | 3300049573 | Bacteria | 8787 |
| 848 | Ga0501037_0006716 | 3300049573 | Bacteria | 8417 |
| 849 | Ga0501037_0048628 | 3300049573 | Bacteria | 3106 |
| 850 | Ga0501037_0121648 | 3300049573 | Bacteria | 1876 |
| 851 | Ga0501037_0394038 | 3300049573 | Unclassified | 950 |
| 852 | Ga0501037_0582074 | 3300049573 | Bacteria | 753 |
| 853 | Ga0501038_0005987 | 3300049574 | Bacteria | 11250 |
| 854 | Ga0501038_0011094 | 3300049574 | Bacteria | 8228 |
| 855 | Ga0501038_0015520 | 3300049574 | Bacteria | 6923 |
| 856 | Ga0501038_0029623 | 3300049574 | Bacteria | 4848 |
| 857 | Ga0501038_0068333 | 3300049574 | Unclassified | 3020 |
| 858 | Ga0501038_0123022 | 3300049574 | Bacteria | 2137 |
| 859 | Ga0501039_0017469 | 3300049575 | Bacteria | 5503 |
| 860 | Ga0501039_0040318 | 3300049575 | Unclassified | 3605 |
| 861 | Ga0501039_0044220 | 3300049575 | Bacteria | 3439 |
| 862 | Ga0501039_0057722 | 3300049575 | Bacteria | 3005 |
| 863 | Ga0501039_0064269 | 3300049575 | Bacteria | 2844 |
| 864 | Ga0501039_0107410 | 3300049575 | Bacteria | 2180 |
| 865 | Ga0501039_0238303 | 3300049575 | Bacteria | 1430 |
| 866 | Ga0501039_0344271 | 3300049575 | Bacteria | 1171 |
| 867 | Ga0501039_0419582 | 3300049575 | Unclassified | 1051 |
| 868 | Ga0501039_0834969 | 3300049575 | Bacteria | 718 |
| 869 | Ga0501039_0877247 | 3300049575 | Bacteria | 699 |
| 870 | Ga0501040_0004527 | 3300049576 | Bacteria | 9020 |
| 871 | Ga0501040_0006935 | 3300049576 | Bacteria | 7335 |
| 872 | Ga0501040_0010841 | 3300049576 | Bacteria | 5957 |
| 873 | Ga0501040_0012989 | 3300049576 | Bacteria | 5475 |
| 874 | Ga0501040_0037918 | 3300049576 | Bacteria | 3276 |
| 875 | Ga0501040_0044156 | 3300049576 | Bacteria | 3038 |
| 876 | Ga0501040_0049347 | 3300049576 | Bacteria | 2877 |
| 877 | Ga0501040_0365298 | 3300049576 | Bacteria | 1034 |
| 878 | Ga0501040_0898678 | 3300049576 | Unclassified | 642 |
| 879 | Ga0501041_0004504 | 3300049577 | Bacteria | 8078 |
| 880 | Ga0501041_0009919 | 3300049577 | Bacteria | 5609 |
| 881 | Ga0501041_0015604 | 3300049577 | Bacteria | 4511 |
| 882 | Ga0501041_0016089 | 3300049577 | Bacteria | 4442 |
| 883 | Ga0501041_0021904 | 3300049577 | Archaea | 3828 |
| 884 | Ga0501041_0037667 | 3300049577 | Bacteria | 2931 |
| 885 | Ga0501041_0041807 | 3300049577 | Bacteria | 2784 |
| 886 | Ga0501041_0090211 | 3300049577 | Bacteria | 1892 |
| 887 | Ga0501041_0211477 | 3300049577 | Bacteria | 1216 |
| 888 | Ga0501041_0216526 | 3300049577 | Bacteria | 1201 |
| 889 | Ga0501041_0369758 | 3300049577 | Unclassified | 907 |
| 890 | Ga0501041_0433023 | 3300049577 | Bacteria | 834 |
| 891 | Ga0501042_0001919 | 3300049578 | Bacteria | 12505 |
| 892 | Ga0501042_0004719 | 3300049578 | Bacteria | 8699 |
| 893 | Ga0501042_0009305 | 3300049578 | Bacteria | 6541 |
| 894 | Ga0501042_0014736 | 3300049578 | Bacteria | 5338 |
| 895 | Ga0501042_0101174 | 3300049578 | Bacteria | 2072 |
| 896 | Ga0501042_0170209 | 3300049578 | Bacteria | 1572 |
| 897 | Ga0501042_0208136 | 3300049578 | Bacteria | 1410 |
| 898 | Ga0501042_0346324 | 3300049578 | Unclassified | 1074 |
| 899 | Ga0501042_0378019 | 3300049578 | Bacteria | 1025 |
| 900 | Ga0501043_0012210 | 3300049579 | Bacteria | 6714 |
| 901 | Ga0501043_0017880 | 3300049579 | Bacteria | 5559 |
| 902 | Ga0501043_0018898 | 3300049579 | Bacteria | 5408 |
| 903 | Ga0501043_0019923 | 3300049579 | Bacteria | 5267 |
| 904 | Ga0501043_0128872 | 3300049579 | Unclassified | 1983 |
| 905 | Ga0501043_0130566 | 3300049579 | Unclassified | 1969 |
| 906 | Ga0501046_0005087 | 3300049580 | Bacteria | 11792 |
| 907 | Ga0501046_0008327 | 3300049580 | Bacteria | 9047 |
| 908 | Ga0501046_0009146 | 3300049580 | Bacteria | 8580 |
| 909 | Ga0501046_0046523 | 3300049580 | Bacteria | 3443 |
| 910 | Ga0501046_0096178 | 3300049580 | Unclassified | 2275 |
| 911 | Ga0501046_0362616 | 3300049580 | Bacteria | 1051 |
| 912 | Ga0501046_0652039 | 3300049580 | Bacteria | 744 |
| 913 | Ga0501046_0762406 | 3300049580 | Bacteria | 679 |
| 914 | Ga0501047_0021938 | 3300049581 | Bacteria | 6132 |
| 915 | Ga0501048_0012692 | 3300049582 | Bacteria | 6264 |
| 916 | Ga0501048_0012846 | 3300049582 | Bacteria | 6221 |
| 917 | Ga0501048_0014745 | 3300049582 | Bacteria | 5782 |
| 918 | Ga0501048_0020631 | 3300049582 | Bacteria | 4829 |
| 919 | Ga0501048_0024160 | 3300049582 | Bacteria | 4437 |
| 920 | Ga0501048_0030498 | 3300049582 | Bacteria | 3902 |
| 921 | Ga0501048_0036094 | 3300049582 | Bacteria | 3554 |
| 922 | Ga0501048_0441559 | 3300049582 | Bacteria | 931 |
| 923 | Ga0501048_0866906 | 3300049582 | Unclassified | 649 |
| 924 | Ga0501067_0030915 | 3300049583 | Bacteria | 2971 |
| 925 | Ga0501067_0031743 | 3300049583 | Bacteria | 2931 |
| 926 | Ga0501067_0540610 | 3300049583 | Bacteria | 652 |
| 927 | Ga0501068_0004660 | 3300049584 | Bacteria | 7463 |
| 928 | Ga0501068_0048689 | 3300049584 | Bacteria | 2559 |
| 929 | Ga0501068_0049958 | 3300049584 | Archaea | 2527 |
| 930 | Ga0501068_0055663 | 3300049584 | Unclassified | 2396 |
| 931 | Ga0501068_0123225 | 3300049584 | Bacteria | 1617 |
| 932 | Ga0501068_0158228 | 3300049584 | Unclassified | 1427 |
| 933 | Ga0501069_0001693 | 3300049585 | Bacteria | 10972 |
| 934 | Ga0501069_0006904 | 3300049585 | Bacteria | 5933 |
| 935 | Ga0501069_0009502 | 3300049585 | Bacteria | 5133 |
| 936 | Ga0501069_0024077 | 3300049585 | Bacteria | 3321 |
| 937 | Ga0501069_0063974 | 3300049585 | Bacteria | 2055 |
| 938 | Ga0501070_0004629 | 3300049586 | Bacteria | 11798 |
| 939 | Ga0501070_0004913 | 3300049586 | Bacteria | 11416 |
| 940 | Ga0501070_0086101 | 3300049586 | Unclassified | 2601 |
| 941 | Ga0501070_0100829 | 3300049586 | Bacteria | 2388 |
| 942 | Ga0501070_0157560 | 3300049586 | Bacteria | 1873 |
| 943 | Ga0501070_0399870 | 3300049586 | Bacteria | 1111 |
| 944 | Ga0501071_0000999 | 3300049587 | Bacteria | 15523 |
| 945 | Ga0501071_0005011 | 3300049587 | Bacteria | 8461 |
| 946 | Ga0501071_0005104 | 3300049587 | Bacteria | 8403 |
| 947 | Ga0501071_0006333 | 3300049587 | Bacteria | 7675 |
| 948 | Ga0501071_0011941 | 3300049587 | Bacteria | 5869 |
| 949 | Ga0501071_0012312 | 3300049587 | Bacteria | 5797 |
| 950 | Ga0501071_0053929 | 3300049587 | Archaea | 2900 |
| 951 | Ga0501071_0072340 | 3300049587 | Bacteria | 2514 |
| 952 | Ga0501071_0076570 | 3300049587 | Bacteria | 2443 |
| 953 | Ga0501071_0107680 | 3300049587 | Bacteria | 2058 |
| 954 | Ga0501071_0145002 | 3300049587 | Bacteria | 1770 |
| 955 | Ga0501071_0219263 | 3300049587 | Unclassified | 1431 |
| 956 | Ga0501071_0502232 | 3300049587 | Bacteria | 930 |
| 957 | Ga0501071_0811865 | 3300049587 | Bacteria | 721 |
| 958 | Ga0501072_0004838 | 3300049588 | Bacteria | 10253 |
| 959 | Ga0501072_0008260 | 3300049588 | Bacteria | 7908 |
| 960 | Ga0501072_0009743 | 3300049588 | Bacteria | 7306 |
| 961 | Ga0501072_0015780 | 3300049588 | Bacteria | 5791 |
| 962 | Ga0501072_0049222 | 3300049588 | Archaea | 3317 |
| 963 | Ga0501072_0053229 | 3300049588 | Bacteria | 3187 |
| 964 | Ga0501072_0061041 | 3300049588 | Unclassified | 2972 |
| 965 | Ga0501072_0123755 | 3300049588 | Bacteria | 2060 |
| 966 | Ga0501072_0129323 | 3300049588 | Bacteria | 2012 |
| 967 | Ga0501072_0132980 | 3300049588 | Bacteria | 1983 |
| 968 | Ga0501072_0855754 | 3300049588 | Unclassified | 711 |
| 969 | Ga0501073_0011249 | 3300049589 | Bacteria | 6546 |
| 970 | Ga0501073_0039547 | 3300049589 | Bacteria | 3340 |
| 971 | Ga0501073_0078997 | 3300049589 | Bacteria | 2290 |
| 972 | Ga0501073_0092780 | 3300049589 | Bacteria | 2098 |
| 973 | Ga0501073_0542958 | 3300049589 | Bacteria | 803 |
| 974 | Ga0501074_0013907 | 3300049590 | Bacteria | 5848 |
| 975 | Ga0501074_0021338 | 3300049590 | Bacteria | 4703 |
| 976 | Ga0501074_0024865 | 3300049590 | Bacteria | 4351 |
| 977 | Ga0501074_0031203 | 3300049590 | Bacteria | 3860 |
| 978 | Ga0501074_0058304 | 3300049590 | Bacteria | 2781 |
| 979 | Ga0501074_0089802 | 3300049590 | Bacteria | 2200 |
| 980 | Ga0501074_0236494 | 3300049590 | Bacteria | 1300 |
| 981 | Ga0501074_0659723 | 3300049590 | Bacteria | 739 |
| 982 | Ga0501074_0769906 | 3300049590 | Bacteria | 678 |
| 983 | Ga0501075_0003257 | 3300049591 | Bacteria | 10867 |
| 984 | Ga0501075_0007314 | 3300049591 | Bacteria | 7657 |
| 985 | Ga0501075_0011550 | 3300049591 | Bacteria | 6251 |
| 986 | Ga0501075_0014974 | 3300049591 | Bacteria | 5563 |
| 987 | Ga0501075_0047476 | 3300049591 | Bacteria | 3226 |
| 988 | Ga0501075_0093057 | 3300049591 | Bacteria | 2289 |
| 989 | Ga0501075_0161851 | 3300049591 | Unclassified | 1707 |
| 990 | Ga0501075_0317319 | 3300049591 | Bacteria | 1188 |
| 991 | Ga0501075_0712432 | 3300049591 | Unclassified | 764 |
| 992 | Ga0501075_1142663 | 3300049591 | Bacteria | 591 |
| 993 | Ga0501075_1148930 | 3300049591 | Bacteria | 589 |
| 994 | Ga0501076_0002512 | 3300049592 | Bacteria | 12627 |
| 995 | Ga0501076_0009539 | 3300049592 | Bacteria | 7164 |
| 996 | Ga0501076_0028300 | 3300049592 | Unclassified | 4350 |
| 997 | Ga0501076_0028561 | 3300049592 | Bacteria | 4332 |
| 998 | Ga0501076_0082214 | 3300049592 | Bacteria | 2585 |
| 999 | Ga0501076_0101717 | 3300049592 | Unclassified | 2316 |
| 1000 | Ga0501076_0127759 | 3300049592 | Bacteria | 2060 |
| 1001 | Ga0501076_0209315 | 3300049592 | Bacteria | 1593 |
| 1002 | Ga0501076_0291945 | 3300049592 | Bacteria | 1336 |
| 1003 | Ga0501076_0366513 | 3300049592 | Bacteria | 1184 |
| 1004 | Ga0501076_0471043 | 3300049592 | Bacteria | 1034 |
| 1005 | Ga0501077_0004980 | 3300049593 | Bacteria | 8053 |
| 1006 | Ga0501077_0005213 | 3300049593 | Bacteria | 7896 |
| 1007 | Ga0501077_0007480 | 3300049593 | Bacteria | 6740 |
| 1008 | Ga0501077_0008613 | 3300049593 | Bacteria | 6323 |
| 1009 | Ga0501077_0009922 | 3300049593 | Bacteria | 5927 |
| 1010 | Ga0501077_0058420 | 3300049593 | Bacteria | 2448 |
| 1011 | Ga0501077_0162461 | 3300049593 | Bacteria | 1418 |
| 1012 | Ga0501077_0172717 | 3300049593 | Unclassified | 1373 |
| 1013 | Ga0501077_0192551 | 3300049593 | Bacteria | 1295 |
| 1014 | Ga0501077_0193904 | 3300049593 | Bacteria | 1291 |
| 1015 | Ga0501077_0409066 | 3300049593 | Bacteria | 867 |
| 1016 | Ga0501077_0451356 | 3300049593 | Bacteria | 823 |
| 1017 | Ga0501077_0806451 | 3300049593 | Unclassified | 604 |
| 1018 | Ga0501209_057763 | 3300049656 | Bacteria | 1075 |
| 1019 | Ga0501079_0005554 | 3300049741 | Bacteria | 9404 |
| 1020 | Ga0501079_0007606 | 3300049741 | Bacteria | 8206 |
| 1021 | Ga0501079_0021858 | 3300049741 | Bacteria | 4898 |
| 1022 | Ga0501079_0046146 | 3300049741 | Archaea | 3361 |
| 1023 | Ga0501079_0060060 | 3300049741 | Bacteria | 2933 |
| 1024 | Ga0501079_0066142 | 3300049741 | Unclassified | 2789 |
| 1025 | Ga0501079_0091708 | 3300049741 | Bacteria | 2354 |
| 1026 | Ga0501079_0344434 | 3300049741 | Bacteria | 1167 |
| 1027 | Ga0501079_0625381 | 3300049741 | Bacteria | 847 |
| 1028 | Ga0501079_0745556 | 3300049741 | Bacteria | 771 |
| 1029 | Ga0501080_0011231 | 3300049742 | Bacteria | 8197 |
| 1030 | Ga0501080_0015179 | 3300049742 | Bacteria | 7097 |
| 1031 | Ga0501080_0025490 | 3300049742 | Bacteria | 5488 |
| 1032 | Ga0501080_0027797 | 3300049742 | Bacteria | 5259 |
| 1033 | Ga0501080_0065341 | 3300049742 | Bacteria | 3384 |
| 1034 | Ga0501080_0089971 | 3300049742 | Bacteria | 2852 |
| 1035 | Ga0501081_0002584 | 3300049743 | Bacteria | 11441 |
| 1036 | Ga0501081_0005329 | 3300049743 | Bacteria | 8294 |
| 1037 | Ga0501081_0035759 | 3300049743 | Bacteria | 3382 |
| 1038 | Ga0501081_0077964 | 3300049743 | Bacteria | 2316 |
| 1039 | Ga0501081_0078815 | 3300049743 | Unclassified | 2303 |
| 1040 | Ga0501081_0088991 | 3300049743 | Bacteria | 2169 |
| 1041 | Ga0501081_0112896 | 3300049743 | Bacteria | 1929 |
| 1042 | Ga0501081_0170109 | 3300049743 | Bacteria | 1573 |
| 1043 | Ga0501081_0305887 | 3300049743 | Bacteria | 1166 |
| 1044 | Ga0501081_0316420 | 3300049743 | Bacteria | 1146 |
| 1045 | Ga0501081_1005301 | 3300049743 | Bacteria | 630 |
| 1046 | Ga0501083_0007601 | 3300049744 | Bacteria | 7675 |
| 1047 | Ga0501083_0021557 | 3300049744 | Bacteria | 4475 |
| 1048 | Ga0501083_0030996 | 3300049744 | Bacteria | 3670 |
| 1049 | Ga0501083_0040735 | 3300049744 | Bacteria | 3153 |
| 1050 | Ga0501083_0087538 | 3300049744 | Bacteria | 2059 |
| 1051 | Ga0501083_0578299 | 3300049744 | Unclassified | 731 |
| 1052 | Ga0501035_0001297 | 3300049822 | Bacteria | 25816 |
| 1053 | Ga0501035_0008968 | 3300049822 | Bacteria | 9303 |
| 1054 | Ga0501035_0009607 | 3300049822 | Bacteria | 8996 |
| 1055 | Ga0501035_0021581 | 3300049822 | Bacteria | 5921 |
| 1056 | Ga0501035_0222709 | 3300049822 | Bacteria | 1610 |
| 1057 | Ga0501035_0237994 | 3300049822 | Bacteria | 1549 |
| 1058 | Ga0501035_0365008 | 3300049822 | Unclassified | 1206 |
| 1059 | Ga0501035_0447148 | 3300049822 | Bacteria | 1069 |
| 1060 | Ga0501035_0460381 | 3300049822 | Unclassified | 1051 |
| 1061 | Ga0501044_0012904 | 3300049823 | Bacteria | 9044 |
| 1062 | Ga0501044_0025083 | 3300049823 | Bacteria | 6323 |
| 1063 | Ga0501044_0166259 | 3300049823 | Bacteria | 2180 |
| 1064 | Ga0501044_0268176 | 3300049823 | Bacteria | 1644 |
| 1065 | Ga0501045_0000294 | 3300049824 | Bacteria | 29182 |
| 1066 | Ga0501045_0003491 | 3300049824 | Bacteria | 10756 |
| 1067 | Ga0501045_0009860 | 3300049824 | Bacteria | 6681 |
| 1068 | Ga0501045_0018316 | 3300049824 | Bacteria | 4980 |
| 1069 | Ga0501045_0018917 | 3300049824 | Bacteria | 4904 |
| 1070 | Ga0501045_0031439 | 3300049824 | Bacteria | 3845 |
| 1071 | Ga0501045_0041762 | 3300049824 | Bacteria | 3337 |
| 1072 | Ga0501045_0068704 | 3300049824 | Bacteria | 2603 |
| 1073 | Ga0501045_0079948 | 3300049824 | Unclassified | 2410 |
| 1074 | Ga0501045_0083114 | 3300049824 | Bacteria | 2362 |
| 1075 | Ga0501045_0091344 | 3300049824 | Bacteria | 2250 |
| 1076 | nmdc:mga05p37_1196845_c1 | 3300050507 | Bacteria | 785 |
| 1077 | nmdc:mga05p37_127268_c1 | 3300050507 | Bacteria | 1349 |
| 1078 | nmdc:mga05p37_383670_c1 | 3300050507 | Unclassified | 1646 |
| 1079 | nmdc:mga05p37_532_c2 | 3300050507 | Bacteria | 11832 |
| 1080 | nmdc:mga09592_2291_c1 | 3300050508 | Bacteria | 15434 |
| 1081 | nmdc:mga09592_297383_c1 | 3300050508 | Unclassified | 1400 |
| 1082 | nmdc:mga0qj67_133148_c1 | 3300050509 | Bacteria | 2014 |
| 1083 | nmdc:mga0qj67_144194_c1 | 3300050509 | Bacteria | 1931 |
| 1084 | nmdc:mga06r32_12732_c1 | 3300050510 | Bacteria | 7604 |
| 1085 | nmdc:mga06r32_393625_c1 | 3300050510 | Bacteria | 1368 |
| 1086 | nmdc:mga06r32_71140_c1 | 3300050510 | Bacteria | 3366 |
| 1087 | nmdc:mga06r32_80912_c1 | 3300050510 | Bacteria | 3162 |
| 1088 | nmdc:mga08y16_129628_c1 | 3300050511 | Unclassified | 2624 |
| 1089 | nmdc:mga08y16_45251_c1 | 3300050511 | Archaea | 4612 |
| 1090 | nmdc:mga08y16_50001_c1 | 3300050511 | Bacteria | 4374 |
| 1091 | nmdc:mga08y16_6843_c1 | 3300050511 | Bacteria | 11955 |
| 1092 | nmdc:mga08y16_823370_c1 | 3300050511 | Bacteria | 920 |
| 1093 | nmdc:mga08y16_911186_c1 | 3300050511 | Bacteria | 865 |
| 1094 | nmdc:mga0n895_181588_c1 | 3300050512 | Bacteria | 2136 |
| 1095 | nmdc:mga0n895_584031_c1 | 3300050512 | Bacteria | 1121 |
| 1096 | nmdc:mga0rr50_37744_c1 | 3300050513 | Bacteria | 3491 |
| 1097 | nmdc:mga0a205_182997_c1 | 3300050515 | Bacteria | 1989 |
| 1098 | nmdc:mga0a205_253073_c1 | 3300050515 | Bacteria | 1640 |
| 1099 | nmdc:mga0a205_886168_c1 | 3300050515 | Bacteria | 739 |
| 1100 | nmdc:mga0a205_95480_c1 | 3300050515 | Bacteria | 2872 |
| 1101 | Ga0495655_0105643 | 3300053083 | Bacteria | 840 |
| 1102 | Ga0495655_0107543 | 3300053083 | Unclassified | 834 |
| 1103 | Ga0495655_0249331 | 3300053083 | Bacteria | 596 |
| 1104 | Ga0501084_0004955 | 3300054114 | Bacteria | 10884 |
| 1105 | Ga0501084_0006048 | 3300054114 | Bacteria | 9952 |
| 1106 | Ga0501084_0040057 | 3300054114 | Bacteria | 3918 |
| 1107 | Ga0501084_0051541 | 3300054114 | Bacteria | 3444 |
| 1108 | Ga0501084_0059960 | 3300054114 | Bacteria | 3186 |
| 1109 | Ga0501084_0062141 | 3300054114 | Bacteria | 3126 |
| 1110 | Ga0501084_0095033 | 3300054114 | Bacteria | 2503 |
| 1111 | Ga0501084_0146941 | 3300054114 | Bacteria | 1986 |
| 1112 | Ga0501084_0182141 | 3300054114 | Bacteria | 1773 |
| 1113 | Ga0501084_0200974 | 3300054114 | Bacteria | 1681 |
| 1114 | Ga0501084_0594151 | 3300054114 | Bacteria | 935 |
| 1115 | Ga0501082_0000584 | 3300060353 | Bacteria | 32310 |
| 1116 | Ga0501082_0004443 | 3300060353 | Bacteria | 12245 |
| 1117 | Ga0501082_0025954 | 3300060353 | Bacteria | 5050 |
| 1118 | Ga0501082_0038520 | 3300060353 | Archaea | 4125 |
| 1119 | Ga0501082_0040890 | 3300060353 | Bacteria | 3997 |
| 1120 | Ga0501082_0107883 | 3300060353 | Bacteria | 2409 |
| 1121 | Ga0501082_0193799 | 3300060353 | Bacteria | 1767 |
| 1122 | Ga0501082_0506737 | 3300060353 | Bacteria | 1055 |
| 1123 | Ga0501082_0914193 | 3300060353 | Bacteria | 767 |
| 1124 | Ga0530510_0002385 | 3300061734 | Bacteria | 12927 |
| 1125 | Ga0530510_0002770 | 3300061734 | Bacteria | 12051 |
| 1126 | Ga0530510_0008577 | 3300061734 | Bacteria | 7138 |
| 1127 | Ga0530510_0034759 | 3300061734 | Bacteria | 3631 |
| 1128 | Ga0530510_0041119 | 3300061734 | Bacteria | 3337 |
| 1129 | Ga0530510_0041547 | 3300061734 | Bacteria | 3320 |
| 1130 | Ga0530510_0068164 | 3300061734 | Bacteria | 2581 |
| 1131 | Ga0530510_0207111 | 3300061734 | Bacteria | 1457 |
| 1132 | Ga0530510_0364766 | 3300061734 | Bacteria | 1086 |
| 1133 | Ga0530510_0550775 | 3300061734 | Bacteria | 876 |
| 1134 | Ga0530510_0561225 | 3300061734 | Bacteria | 867 |
| 1135 | Ga0530510_0781479 | 3300061734 | Unclassified | 728 |
| 1136 | Ga0530510_0786542 | 3300061734 | Bacteria | 726 |
| 1137 | Ga0207695_10349299 | |||
| 1138 | JGI24746J21847_1023075 | |||
| 1139 | JGI24747J21853_1002478 | |||
| 1140 | JGI24747J21853_1002619 | |||
| 1141 | JGI24739J22299_10056390 | |||
| 1142 | JGI24737J22298_10126685 | |||
| 1143 | JGI24738J21930_10014188 | |||
| 1144 | JGI24744J21845_10010675 | |||
| 1145 | JGI25406J46586_10059686 | |||
| 1146 | JGI25407J50210_10002984 | |||
| 1147 | JGI25407J50210_10007520 | |||
| 1148 | JGI25407J50210_10024604 | |||
| 1149 | JGI25407J50210_10041967 | |||
| 1150 | Ga0070658_10282327 | |||
| 1151 | Ga0070658_10620589 | |||
| 1152 | Ga0070676_10016464 | |||
| 1153 | Ga0070683_100003925 | |||
| 1154 | Ga0070683_100009447 | |||
| 1155 | Ga0070683_100108205 | |||
| 1156 | Ga0070683_100141718 | |||
| 1157 | Ga0070670_100553389 | |||
| 1158 | Ga0070677_10162324 | |||
| 1159 | Ga0068869_100257223 | |||
| 1160 | Ga0068869_100425317 | |||
| 1161 | Ga0070666_10263690 | |||
| 1162 | Ga0070680_100301197 | |||
| 1163 | Ga0070680_100897501 | |||
| 1164 | Ga0070680_100928696 | |||
| 1165 | Ga0070682_100004426 | |||
| 1166 | Ga0070682_100005044 | |||
| 1167 | Ga0070682_100420282 | |||
| 1168 | Ga0068868_100037260 | |||
| 1169 | Ga0068868_100423169 | |||
| 1170 | Ga0070660_100036138 | |||
| 1171 | Ga0070660_100218791 | |||
| 1172 | Ga0070660_100329719 | |||
| 1173 | Ga0070660_100369238 | |||
| 1174 | Ga0070689_100007583 | |||
| 1175 | Ga0070689_100066466 | |||
| 1176 | Ga0070689_100200205 | |||
| 1177 | Ga0070689_100294205 | |||
| 1178 | Ga0070691_10369955 | |||
| 1179 | Ga0070687_100112212 | |||
| 1180 | Ga0070687_100211575 | |||
| 1181 | Ga0070661_100072981 | |||
| 1182 | Ga0070661_100839525 | |||
| 1183 | Ga0070692_10020164 | |||
| 1184 | Ga0070692_10026208 | |||
| 1185 | Ga0070692_10027734 | |||
| 1186 | Ga0070692_10152707 | |||
| 1187 | Ga0070692_10246109 | |||
| 1188 | Ga0070692_10939053 | |||
| 1189 | Ga0070668_100159315 | |||
| 1190 | Ga0070668_100207387 | |||
| 1191 | Ga0070668_100541116 | |||
| 1192 | Ga0070668_101209453 | |||
| 1193 | Ga0070669_100114906 | |||
| 1194 | Ga0070675_100019038 | |||
| 1195 | Ga0070675_100040341 | |||
| 1196 | Ga0070675_100152539 | |||
| 1197 | Ga0070675_101338934 | |||
| 1198 | Ga0070671_100016569 | |||
| 1199 | Ga0070671_100533134 | |||
| 1200 | Ga0070674_100003185 | |||
| 1201 | Ga0070674_100003686 | |||
| 1202 | Ga0070674_100005915 | |||
| 1203 | Ga0070674_100023351 | |||
| 1204 | Ga0070674_100025544 | |||
| 1205 | Ga0070674_100266281 | |||
| 1206 | Ga0070673_100002906 | |||
| 1207 | Ga0070673_100062384 | |||
| 1208 | Ga0070673_100174202 | |||
| 1209 | Ga0070688_100002023 | |||
| 1210 | Ga0070688_100003324 | |||
| 1211 | Ga0070688_100526215 | |||
| 1212 | Ga0070659_100005741 | |||
| 1213 | Ga0070659_100054870 | |||
| 1214 | Ga0070659_100421790 | |||
| 1215 | Ga0070659_100479468 | |||
| 1216 | Ga0070667_100992807 | |||
| 1217 | Ga0070703_10018421 | |||
| 1218 | Ga0070709_11081122 | |||
| 1219 | Ga0070714_100812219 | |||
| 1220 | Ga0070710_10004290 | |||
| 1221 | Ga0070701_10018494 | |||
| 1222 | Ga0070701_10057995 | |||
| 1223 | Ga0070701_10067481 | |||
| 1224 | Ga0070701_10197692 | |||
| 1225 | Ga0070701_10773223 | |||
| 1226 | Ga0070705_100026575 | |||
| 1227 | Ga0070705_100083531 | |||
| 1228 | Ga0070705_100145312 | |||
| 1229 | Ga0070705_101047474 | |||
| 1230 | Ga0070700_100065742 | |||
| 1231 | Ga0070700_100091470 | |||
| 1232 | Ga0070700_100213282 | |||
| 1233 | Ga0070700_100214718 | |||
| 1234 | Ga0070700_100220524 | |||
| 1235 | Ga0070700_100356766 | |||
| 1236 | Ga0070700_100404593 | |||
| 1237 | Ga0070694_100168350 | |||
| 1238 | Ga0070708_100033983 | |||
| 1239 | Ga0070708_100050577 | |||
| 1240 | Ga0070708_100724582 | |||
| 1241 | Ga0070678_100085755 | |||
| 1242 | Ga0070678_100192821 | |||
| 1243 | Ga0070678_100363225 | |||
| 1244 | Ga0070678_100565631 | |||
| 1245 | Ga0070678_100896334 | |||
| 1246 | Ga0070662_100012523 | |||
| 1247 | Ga0070662_100198485 | |||
| 1248 | Ga0070662_100212519 | |||
| 1249 | Ga0070681_10557749 | |||
| 1250 | Ga0070681_11011889 | |||
| 1251 | Ga0068867_100009057 | |||
| 1252 | Ga0068867_100023897 | |||
| 1253 | Ga0068867_100037848 | |||
| 1254 | Ga0068867_100081054 | |||
| 1255 | Ga0068867_100235644 | |||
| 1256 | Ga0070685_10030640 | |||
| 1257 | Ga0070685_10043751 | |||
| 1258 | Ga0070685_10307345 | |||
| 1259 | Ga0070685_10399322 | |||
| 1260 | Ga0070706_100022133 | |||
| 1261 | Ga0070706_100244191 | |||
| 1262 | Ga0070706_100286048 | |||
| 1263 | Ga0070706_100681634 | |||
| 1264 | Ga0070707_100008845 | |||
| 1265 | Ga0070698_100035630 | |||
| 1266 | Ga0070698_100098128 | |||
| 1267 | Ga0070699_100004014 | |||
| 1268 | Ga0070699_100023745 | |||
| 1269 | Ga0070699_101087399 | |||
| 1270 | Ga0070679_100066648 | |||
| 1271 | Ga0070679_100232563 | |||
| 1272 | Ga0070679_101693971 | |||
| 1273 | Ga0070684_100022742 | |||
| 1274 | Ga0070684_100060915 | |||
| 1275 | Ga0070684_100454881 | |||
| 1276 | Ga0070684_100497926 | |||
| 1277 | Ga0070684_100909235 | |||
| 1278 | Ga0068853_100014245 | |||
| 1279 | Ga0068853_100059158 | |||
| 1280 | Ga0070672_100003708 | |||
| 1281 | Ga0070672_100005767 | |||
| 1282 | Ga0070672_100353089 | |||
| 1283 | Ga0070672_101058692 | |||
| 1284 | Ga0070686_100014120 | |||
| 1285 | Ga0070686_100020025 | |||
| 1286 | Ga0070686_100074470 | |||
| 1287 | Ga0070686_100096324 | |||
| 1288 | Ga0070686_100470228 | |||
| 1289 | Ga0070695_100040070 | |||
| 1290 | Ga0070695_100790592 | |||
| 1291 | Ga0070695_101045979 | |||
| 1292 | Ga0070696_100007874 | |||
| 1293 | Ga0070696_100012124 | |||
| 1294 | Ga0070696_100050820 | |||
| 1295 | Ga0070696_100443549 | |||
| 1296 | Ga0070696_100506750 | |||
| 1297 | Ga0070693_100010968 | |||
| 1298 | Ga0070693_100032271 | |||
| 1299 | Ga0070665_101228430 | |||
| 1300 | Ga0070665_101259555 | |||
| 1301 | Ga0070704_100004138 | |||
| 1302 | Ga0070704_100005421 | |||
| 1303 | Ga0070704_100041253 | |||
| 1304 | Ga0070704_100186542 | |||
| 1305 | Ga0070704_100791388 | |||
| 1306 | Ga0068855_100023324 | |||
| 1307 | Ga0068855_100273760 | |||
| 1308 | Ga0068855_101100678 | |||
| 1309 | Ga0070664_100047814 | |||
| 1310 | Ga0070664_100070442 | |||
| 1311 | Ga0070664_100403434 | |||
| 1312 | Ga0070664_100664708 | |||
| 1313 | Ga0070664_100775322 | |||
| 1314 | Ga0068857_100000728 | |||
| 1315 | Ga0068857_100291929 | |||
| 1316 | Ga0068854_100002077 | |||
| 1317 | Ga0068854_100370761 | |||
| 1318 | Ga0068854_100535857 | |||
| 1319 | Ga0068856_100016532 | |||
| 1320 | Ga0068856_100296562 | |||
| 1321 | Ga0070702_100052421 | |||
| 1322 | Ga0070702_100061145 | |||
| 1323 | Ga0070702_100073889 | |||
| 1324 | Ga0070702_100090115 | |||
| 1325 | Ga0070702_100132237 | |||
| 1326 | Ga0068852_100003129 | |||
| 1327 | Ga0068852_100023602 | |||
| 1328 | Ga0068852_101092066 | |||
| 1329 | Ga0068852_101767907 | |||
| 1330 | Ga0068859_100007178 | |||
| 1331 | Ga0068859_100178990 | |||
| 1332 | Ga0068859_100320544 | |||
| 1333 | Ga0068859_101481044 | |||
| 1334 | Ga0068864_100288905 | |||
| 1335 | Ga0068864_100400930 | |||
| 1336 | Ga0068864_101438311 | |||
| 1337 | Ga0068864_101832309 | |||
| 1338 | Ga0068866_10271045 | |||
| 1339 | Ga0068866_10635309 | |||
| 1340 | Ga0068866_10643364 | |||
| 1341 | Ga0068861_100301544 | |||
| 1342 | Ga0068861_100329306 | |||
| 1343 | Ga0068861_100388191 | |||
| 1344 | Ga0068861_100440296 | |||
| 1345 | Ga0068851_10016536 | |||
| 1346 | Ga0068851_10542457 | |||
| 1347 | Ga0068870_10028562 | |||
| 1348 | Ga0068870_10031844 | |||
| 1349 | Ga0068870_10613789 | |||
| 1350 | Ga0068863_100108758 | |||
| 1351 | Ga0068858_100010201 | |||
| 1352 | Ga0068858_100156124 | |||
| 1353 | Ga0068858_100305872 | |||
| 1354 | Ga0068858_100428880 | |||
| 1355 | Ga0068860_100034858 | |||
| 1356 | Ga0068860_100622404 | |||
| 1357 | Ga0068860_100813720 | |||
| 1358 | Ga0068860_100832838 | |||
| 1359 | Ga0068862_100181970 | |||
| 1360 | Ga0068862_100219956 | |||
| 1361 | Ga0081455_10003417 | |||
| 1362 | Ga0081455_10005594 | |||
| 1363 | Ga0081455_10056065 | |||
| 1364 | Ga0081455_10200195 | |||
| 1365 | Ga0081455_10648089 | |||
| 1366 | Ga0081538_10000080 | |||
| 1367 | Ga0081538_10000144 | |||
| 1368 | Ga0081538_10000231 | |||
| 1369 | Ga0081538_10000667 | |||
| 1370 | Ga0081538_10002291 | |||
| 1371 | Ga0081538_10005049 | |||
| 1372 | Ga0081538_10012554 | |||
| 1373 | Ga0081538_10043132 | |||
| 1374 | Ga0081538_10050060 | |||
| 1375 | Ga0081538_10080682 | |||
| 1376 | Ga0081539_10000452 | |||
| 1377 | Ga0081539_10011583 | |||
| 1378 | Ga0075365_10009783 | |||
| 1379 | Ga0075432_10005071 | |||
| 1380 | Ga0075432_10015202 | |||
| 1381 | Ga0075432_10053012 | |||
| 1382 | Ga0075432_10084539 | |||
| 1383 | Ga0070715_10014164 | |||
| 1384 | Ga0070716_100179839 | |||
| 1385 | Ga0070716_100313760 | |||
| 1386 | Ga0070712_100001977 | |||
| 1387 | Ga0070712_100052849 | |||
| 1388 | Ga0075362_10079235 | |||
| 1389 | Ga0097621_100145977 | |||
| 1390 | Ga0097621_100309270 | |||
| 1391 | Ga0097621_100580338 | |||
| 1392 | Ga0068871_100018627 | |||
| 1393 | Ga0068871_100158924 | |||
| 1394 | Ga0068871_100488358 | |||
| 1395 | Ga0068871_100523613 | |||
| 1396 | Ga0068871_100997292 | |||
| 1397 | Ga0068871_101103623 | |||
| 1398 | Ga0075428_100013149 | |||
| 1399 | Ga0075428_100085963 | |||
| 1400 | Ga0075428_100238223 | |||
| 1401 | Ga0075430_100016098 | |||
| 1402 | Ga0075430_100055457 | |||
| 1403 | Ga0075430_100083814 | |||
| 1404 | Ga0075430_100116008 | |||
| 1405 | Ga0075431_100005512 | |||
| 1406 | Ga0075431_100117193 | |||
| 1407 | Ga0075431_100167100 | |||
| 1408 | Ga0075431_100428561 | |||
| 1409 | Ga0075433_10565747 | |||
| 1410 | Ga0075434_100040445 | |||
| 1411 | Ga0075434_100379247 | |||
| 1412 | Ga0075429_100017339 | |||
| 1413 | Ga0075429_100107051 | |||
| 1414 | Ga0075429_101029327 | |||
| 1415 | Ga0075429_101448875 | |||
| 1416 | Ga0068865_100082075 | |||
| 1417 | Ga0068865_100086223 | |||
| 1418 | Ga0068865_100222591 | |||
| 1419 | Ga0068865_100240685 | |||
| 1420 | Ga0068865_100449984 | |||
| 1421 | Ga0068865_100473444 | |||
| 1422 | Ga0068865_100604970 | |||
| 1423 | Ga0075436_100028486 | |||
| 1424 | Ga0097620_100007178 | |||
| 1425 | Ga0097620_100178999 | |||
| 1426 | Ga0097620_100320545 | |||
| 1427 | Ga0097620_101481283 | |||
| 1428 | Ga0075435_100094831 | |||
| 1429 | Ga0105244_10039248 | |||
| 1430 | Ga0105240_10596601 | |||
| 1431 | Ga0105240_11348218 | |||
| 1432 | Ga0111539_10003600 | |||
| 1433 | Ga0111539_10027451 | |||
| 1434 | Ga0111539_10038708 | |||
| 1435 | Ga0111539_10077139 | |||
| 1436 | Ga0111539_10252521 | |||
| 1437 | Ga0111539_10262375 | |||
| 1438 | Ga0111539_11293120 | |||
| 1439 | Ga0111539_11753510 | |||
| 1440 | Ga0111539_12263717 | |||
| 1441 | Ga0105245_10003898 | |||
| 1442 | Ga0105245_10018405 | |||
| 1443 | Ga0105245_10142426 | |||
| 1444 | Ga0105245_10155368 | |||
| 1445 | Ga0105245_10184423 | |||
| 1446 | Ga0105245_10335082 | |||
| 1447 | Ga0105247_10264307 | |||
| 1448 | Ga0114129_10034544 | |||
| 1449 | Ga0114129_10224897 | |||
| 1450 | Ga0114129_10225871 | |||
| 1451 | Ga0114129_10472712 | |||
| 1452 | Ga0114129_10698651 | |||
| 1453 | Ga0114129_11869758 | |||
| 1454 | Ga0114129_12327259 | |||
| 1455 | Ga0105243_10015986 | |||
| 1456 | Ga0105243_10109339 | |||
| 1457 | Ga0105243_10155968 | |||
| 1458 | Ga0105243_10193181 | |||
| 1459 | Ga0105243_10624510 | |||
| 1460 | Ga0105241_10039256 | |||
| 1461 | Ga0105241_10388316 | |||
| 1462 | Ga0105242_10017423 | |||
| 1463 | Ga0105242_10021167 | |||
| 1464 | Ga0105242_10096129 | |||
| 1465 | Ga0105242_10161307 | |||
| 1466 | Ga0105242_10556071 | |||
| 1467 | Ga0105242_11086372 | |||
| 1468 | Ga0105248_10039405 | |||
| 1469 | Ga0105248_10064598 | |||
| 1470 | Ga0105248_10073671 | |||
| 1471 | Ga0105248_10191974 | |||
| 1472 | Ga0105248_10557329 | |||
| 1473 | Ga0105248_10758936 | |||
| 1474 | Ga0105237_10048944 | |||
| 1475 | Ga0105238_10015083 | |||
| 1476 | Ga0105238_10042589 | |||
| 1477 | Ga0105238_10956076 | |||
| 1478 | Ga0105238_11319815 | |||
| 1479 | Ga0105249_10005190 | |||
| 1480 | Ga0105249_10028478 | |||
| 1481 | Ga0105249_10338381 | |||
| 1482 | Ga0105249_10683346 | |||
| 1483 | Ga0105249_11290673 | |||
| 1484 | Ga0105239_10003612 | |||
| 1485 | Ga0105239_10011361 | |||
| 1486 | Ga0105239_10014264 | |||
| 1487 | Ga0105239_10097832 | |||
| 1488 | Ga0105239_10142611 | |||
| 1489 | Ga0105239_10350401 | |||
| 1490 | Ga0105246_10016979 | |||
| 1491 | Ga0105246_10037305 | |||
| 1492 | Ga0105246_10108436 | |||
| 1493 | Ga0105246_10160863 | |||
| 1494 | Ga0157324_1010787 | |||
| 1495 | Ga0157342_1006264 | |||
| 1496 | Ga0157315_1009579 | |||
| 1497 | Ga0157338_1002008 | |||
| 1498 | Ga0157373_10060991 | |||
| 1499 | Ga0157371_10006307 | |||
| 1500 | Ga0157371_10035578 | |||
| 1501 | Ga0157371_10371427 | |||
| 1502 | Ga0157371_10573702 | |||
| 1503 | Ga0157369_10784852 | |||
| 1504 | Ga0157369_11842336 | |||
| 1505 | Ga0157374_10053364 | |||
| 1506 | Ga0157374_10204761 | |||
| 1507 | Ga0157378_10010906 | |||
| 1508 | Ga0157378_10315065 | |||
| 1509 | Ga0157378_10316676 | |||
| 1510 | Ga0157378_10788119 | |||
| 1511 | Ga0157378_11550472 | |||
| 1512 | Ga0163162_10011370 | |||
| 1513 | Ga0163162_10027414 | |||
| 1514 | Ga0163162_10079016 | |||
| 1515 | Ga0163162_10154494 | |||
| 1516 | Ga0163162_10199801 | |||
| 1517 | Ga0163162_10279805 | |||
| 1518 | Ga0163162_10325080 | |||
| 1519 | Ga0163162_11070544 | |||
| 1520 | Ga0157372_10012819 | |||
| 1521 | Ga0157372_10085638 | |||
| 1522 | Ga0157372_10522207 | |||
| 1523 | Ga0157375_10002897 | |||
| 1524 | Ga0157375_10004110 | |||
| 1525 | Ga0157375_10093364 | |||
| 1526 | Ga0157375_10129225 | |||
| 1527 | Ga0157375_10132609 | |||
| 1528 | Ga0163163_10094337 | |||
| 1529 | Ga0163163_10225073 | |||
| 1530 | Ga0163163_10314021 | |||
| 1531 | Ga0163163_10356525 | |||
| 1532 | Ga0157380_10007447 | |||
| 1533 | Ga0157380_10132317 | |||
| 1534 | Ga0157380_10522640 | |||
| 1535 | Ga0182008_10180462 | |||
| 1536 | Ga0157377_10001024 | |||
| 1537 | Ga0157377_10039358 | |||
| 1538 | Ga0157377_11232458 | |||
| 1539 | Ga0157379_10108056 | |||
| 1540 | Ga0157379_10231771 | |||
| 1541 | Ga0157379_10360086 | |||
| 1542 | Ga0157379_10445731 | |||
| 1543 | Ga0157379_10910539 | |||
| 1544 | Ga0157376_10088506 | |||
| 1545 | Ga0157376_10456463 | |||
| 1546 | Ga0157376_10688022 | |||
| 1547 | Ga0157376_11905885 | |||
| 1548 | Ga0163161_10238465 | |||
| 1549 | Ga0163161_10725799 | |||
| 1550 | Ga0163161_11220336 | |||
| 1551 | Ga0163161_11317139 | |||
| 1552 | Ga0206353_11584542 | |||
| 1553 | Ga0207697_10262662 | |||
| 1554 | Ga0207656_10082139 | |||
| 1555 | Ga0207656_10137573 | |||
| 1556 | Ga0207653_10008949 | |||
| 1557 | Ga0207692_10368521 | |||
| 1558 | Ga0207642_10014429 | |||
| 1559 | Ga0207642_10415577 | |||
| 1560 | Ga0207710_10016852 | |||
| 1561 | Ga0207688_10002607 | |||
| 1562 | Ga0207688_10003393 | |||
| 1563 | Ga0207688_10031118 | |||
| 1564 | Ga0207688_10033749 | |||
| 1565 | Ga0207688_10081369 | |||
| 1566 | Ga0207688_10248498 | |||
| 1567 | Ga0207680_10532465 | |||
| 1568 | Ga0207645_10022120 | |||
| 1569 | Ga0207645_10084423 | |||
| 1570 | Ga0207643_10002023 | |||
| 1571 | Ga0207643_10025022 | |||
| 1572 | Ga0207705_10027306 | |||
| 1573 | Ga0207684_10019475 | |||
| 1574 | Ga0207684_10244472 | |||
| 1575 | Ga0207654_10157131 | |||
| 1576 | Ga0207707_10421024 | |||
| 1577 | Ga0207671_10333132 | |||
| 1578 | Ga0207693_10001432 | |||
| 1579 | Ga0207693_10004838 | |||
| 1580 | Ga0207663_10110384 | |||
| 1581 | Ga0207663_10131634 | |||
| 1582 | Ga0207660_10027789 | |||
| 1583 | Ga0207662_10018197 | |||
| 1584 | Ga0207662_10023638 | |||
| 1585 | Ga0207662_10071346 | |||
| 1586 | Ga0207662_10410464 | |||
| 1587 | Ga0207657_10006330 | |||
| 1588 | Ga0207657_10114716 | |||
| 1589 | Ga0207649_10262572 | |||
| 1590 | Ga0207652_10358461 | |||
| 1591 | Ga0207652_10506732 | |||
| 1592 | Ga0207652_10701242 | |||
| 1593 | Ga0207646_10009493 | |||
| 1594 | Ga0207694_10143128 | |||
| 1595 | Ga0207694_10143533 | |||
| 1596 | Ga0207694_10421023 | |||
| 1597 | Ga0207650_10057330 | |||
| 1598 | Ga0207659_10121756 | |||
| 1599 | Ga0207687_10077879 | |||
| 1600 | Ga0207687_10526155 | |||
| 1601 | Ga0207644_10236096 | |||
| 1602 | Ga0207690_10288069 | |||
| 1603 | Ga0207690_10306112 | |||
| 1604 | Ga0207706_10010525 | |||
| 1605 | Ga0207706_10014547 | |||
| 1606 | Ga0207706_10099521 | |||
| 1607 | Ga0207706_10217047 | |||
| 1608 | Ga0207706_10320855 | |||
| 1609 | Ga0207686_10051564 | |||
| 1610 | Ga0207686_10673011 | |||
| 1611 | Ga0207686_10746259 | |||
| 1612 | Ga0207709_10004029 | |||
| 1613 | Ga0207709_10050362 | |||
| 1614 | Ga0207709_10080099 | |||
| 1615 | Ga0207709_10164195 | |||
| 1616 | Ga0207709_10498600 | |||
| 1617 | Ga0207709_10511108 | |||
| 1618 | Ga0207709_11116998 | |||
| 1619 | Ga0207670_10101189 | |||
| 1620 | Ga0207670_10109467 | |||
| 1621 | Ga0207670_11082541 | |||
| 1622 | Ga0207669_10003654 | |||
| 1623 | Ga0207669_10051065 | |||
| 1624 | Ga0207669_10293530 | |||
| 1625 | Ga0207704_10018636 | |||
| 1626 | Ga0207704_10211308 | |||
| 1627 | Ga0207704_10223787 | |||
| 1628 | Ga0207704_10295378 | |||
| 1629 | Ga0207704_10318772 | |||
| 1630 | Ga0207665_10095246 | |||
| 1631 | Ga0207665_10216825 | |||
| 1632 | Ga0207691_10004005 | |||
| 1633 | Ga0207691_10016003 | |||
| 1634 | Ga0207691_10026907 | |||
| 1635 | Ga0207691_11107296 | |||
| 1636 | Ga0207711_10097138 | |||
| 1637 | Ga0207711_10204324 | |||
| 1638 | Ga0207711_10669488 | |||
| 1639 | Ga0207689_10013172 | |||
| 1640 | Ga0207661_10034257 | |||
| 1641 | Ga0207661_10130916 | |||
| 1642 | Ga0207661_10561935 | |||
| 1643 | Ga0207661_10621551 | |||
| 1644 | Ga0207679_10054403 | |||
| 1645 | Ga0207679_10395265 | |||
| 1646 | Ga0207679_10455566 | |||
| 1647 | Ga0207667_10171616 | |||
| 1648 | Ga0207667_10280046 | |||
| 1649 | Ga0207667_10709950 | |||
| 1650 | Ga0207651_10238857 | |||
| 1651 | Ga0207651_10272768 | |||
| 1652 | Ga0207651_10711543 | |||
| 1653 | Ga0207712_10368692 | |||
| 1654 | Ga0207668_10125752 | |||
| 1655 | Ga0207668_10226566 | |||
| 1656 | Ga0207668_10343761 | |||
| 1657 | Ga0207640_10003852 | |||
| 1658 | Ga0207640_10141404 | |||
| 1659 | Ga0207640_10205986 | |||
| 1660 | Ga0207640_10238631 | |||
| 1661 | Ga0207640_10239298 | |||
| 1662 | Ga0207658_10336637 | |||
| 1663 | Ga0207677_10147593 | |||
| 1664 | Ga0207677_10462440 | |||
| 1665 | Ga0207677_11440775 | |||
| 1666 | Ga0207703_10387692 | |||
| 1667 | Ga0207703_10672568 | |||
| 1668 | Ga0207639_10067647 | |||
| 1669 | Ga0207639_10083750 | |||
| 1670 | Ga0207678_10013710 | |||
| 1671 | Ga0207678_10412608 | |||
| 1672 | Ga0207678_10417254 | |||
| 1673 | Ga0207708_10000760 | |||
| 1674 | Ga0207708_10013914 | |||
| 1675 | Ga0207708_10058599 | |||
| 1676 | Ga0207708_10074394 | |||
| 1677 | Ga0207702_10421937 | |||
| 1678 | Ga0207641_10104193 | |||
| 1679 | Ga0207648_10008338 | |||
| 1680 | Ga0207648_10042591 | |||
| 1681 | Ga0207648_10052200 | |||
| 1682 | Ga0207648_10080954 | |||
| 1683 | Ga0207648_10203996 | |||
| 1684 | Ga0207676_10065381 | |||
| 1685 | Ga0207676_10204136 | |||
| 1686 | Ga0207674_10000156 | |||
| 1687 | Ga0207674_10216014 | |||
| 1688 | Ga0207675_100003335 | |||
| 1689 | Ga0207675_100008735 | |||
| 1690 | Ga0207675_100020442 | |||
| 1691 | Ga0207675_100033750 | |||
| 1692 | Ga0207675_100052136 | |||
| 1693 | Ga0207675_100618802 | |||
| 1694 | Ga0207683_10001662 | |||
| 1695 | Ga0207683_10003793 | |||
| 1696 | Ga0207683_10093159 | |||
| 1697 | Ga0207683_10509562 | |||
| 1698 | Ga0207683_10522159 | |||
| 1699 | Ga0207698_10040895 | |||
| 1700 | Ga0207698_10104261 | |||
| 1701 | Ga0207698_10482844 | |||
| 1702 | Ga0207698_10756107 | |||
| 1703 | Ga0207698_10874271 | |||
| 1704 | Ga0209966_1008982 | |||
| 1705 | Ga0207428_10013230 | |||
| 1706 | Ga0207428_10014091 | |||
| 1707 | Ga0207428_10023040 | |||
| 1708 | Ga0207428_10026971 | |||
| 1709 | Ga0207428_10027259 | |||
| 1710 | Ga0207428_10052131 | |||
| 1711 | Ga0207428_10595189 | |||
| 1712 | Ga0268266_10821397 | |||
| 1713 | Ga0268266_11998525 | |||
| 1714 | Ga0268264_10161296 | |||
| 1715 | Ga0268264_10786122 | |||
| 1716 | Ga0307408_100032608 | |||
| 1717 | Ga0307408_100190142 | |||
| 1718 | Ga0307405_10001813 | |||
| 1719 | Ga0307405_10885067 | |||
| 1720 | Ga0307413_10363382 | |||
| 1721 | Ga0307406_10072476 | |||
| 1722 | Ga0307407_10086925 | |||
| 1723 | Ga0307412_10023772 | |||
| 1724 | Ga0307412_10250836 | |||
| 1725 | Ga0307409_100001195 | |||
| 1726 | Ga0307409_100044988 | |||
| 1727 | Ga0307416_100011220 | |||
| 1728 | Ga0307416_100423590 | |||
| 1729 | Ga0307414_10015559 | |||
| 1730 | Ga0307411_10054868 | |||
| 1731 | Ga0307411_10068084 | |||
| 1732 | Ga0307415_100006940 | |||
| 1733 | Ga0307415_100101838 | |||
| 1734 | Ga0373958_0063858 | |||
| 1735 | Ga0373958_0076411 | |||
| 1736 | Ga0373959_0004214 | |||
| 1737 | Ga0373949_0053078 | |||
| 1738 | Ga0373945_0198676 | |||
| 1739 | Ga0373960_0006030 | |||
| 1740 | Ga0373946_0271890 | |||
| 1741 | Ga0373961_0019234 | |||
| 1742 | Ga0373962_0001783 | |||
| 1743 | Ga0373931_0587956 | |||
| 1744 | Ga0373935_0259739 | |||
| 1745 | Ga0373947_0246286 | |||
| 1746 | Ga0395899_0004348 | |||
| 1747 | Ga0395899_0005306 | |||
| 1748 | Ga0395899_0006773 | |||
| 1749 | Ga0395899_0034980 | |||
| 1750 | Ga0395899_0071294 | |||
| 1751 | Ga0395899_0306719 | |||
| 1752 | Ga0395900_0002748 | |||
| 1753 | Ga0395900_0010576 | |||
| 1754 | Ga0395900_0011168 | |||
| 1755 | Ga0395900_0012861 | |||
| 1756 | Ga0395900_0021483 | |||
| 1757 | Ga0395900_0024536 | |||
| 1758 | Ga0395900_0056587 | |||
| 1759 | Ga0395900_0057422 | |||
| 1760 | Ga0395900_0140909 | |||
| 1761 | Ga0395900_0352191 | |||
| 1762 | Ga0395900_0397442 | |||
| 1763 | Ga0395900_0719507 | |||
| 1764 | Ga0395900_1163257 | |||
| 1765 | Ga0395898_0004644 | |||
| 1766 | Ga0395898_0004773 | |||
| 1767 | Ga0395898_0007284 | |||
| 1768 | Ga0395898_0008187 | |||
| 1769 | Ga0395898_0011507 | |||
| 1770 | Ga0395898_0019216 | |||
| 1771 | Ga0395898_0031134 | |||
| 1772 | Ga0395898_0058222 | |||
| 1773 | Ga0395898_0111863 | |||
| 1774 | Ga0395898_0364876 | |||
| 1775 | Ga0395898_1055646 | |||
| 1776 | Ga0395898_1324417 | |||
| 1777 | Ga0395905_0005256 | |||
| 1778 | Ga0395905_0008250 | |||
| 1779 | Ga0395905_0014153 | |||
| 1780 | Ga0395905_0036212 | |||
| 1781 | Ga0395905_0037437 | |||
| 1782 | Ga0395905_0046765 | |||
| 1783 | Ga0395905_0070640 | |||
| 1784 | Ga0395905_0122828 | |||
| 1785 | Ga0395905_0123239 | |||
| 1786 | Ga0395901_0003097 | |||
| 1787 | Ga0395901_0004483 | |||
| 1788 | Ga0395901_0009567 | |||
| 1789 | Ga0395901_0032052 | |||
| 1790 | Ga0395901_0075575 | |||
| 1791 | Ga0395901_0097195 | |||
| 1792 | Ga0395901_0115356 | |||
| 1793 | Ga0395901_0149312 | |||
| 1794 | Ga0395901_0206841 | |||
| 1795 | Ga0395901_0209342 | |||
| 1796 | Ga0395901_0302976 | |||
| 1797 | Ga0395901_0426423 | |||
| 1798 | Ga0395901_0753539 | |||
| 1799 | Ga0395901_0963107 | |||
| 1800 | Ga0439453_0036904 | |||
| 1801 | Ga0451789_0730060 | |||
| 1802 | Ga0451807_1018272 | |||
| 1803 | Ga0451853_3042737 | |||
| 1804 | Ga0439448_0060563 | |||
| 1805 | Ga0439463_081380 | |||
| 1806 | Ga0450920_076351 | |||
| 1807 | Ga0450923_007153 | |||
| 1808 | Ga0450906_044864 | |||
| 1809 | Ga0450907_007013 | |||
| 1810 | Ga0439435_0125973 | |||
| 1811 | Ga0439460_0153595 | |||
| 1812 | Ga0439460_0303399 | |||
| 1813 | Ga0439440_0085008 | |||
| 1814 | Ga0466960_0747517 | |||
| 1815 | Ga0451576_0969523 | |||
| 1816 | Ga0495603_0062348 | |||
| 1817 | Ga0495603_0101325 | |||
| 1818 | Ga0495590_0056412 | |||
| 1819 | Ga0495591_122247 | |||
| 1820 | Ga0495629_0296460 | |||
| 1821 | Ga0495641_0156043 | |||
| 1822 | Ga0495582_0074420 | |||
| 1823 | Ga0495582_0108816 | |||
| 1824 | Ga0495605_0033189 | |||
| 1825 | Ga0495605_0039891 | |||
| 1826 | Ga0495605_0130090 | |||
| 1827 | Ga0495584_0011490 | |||
| 1828 | Ga0495584_0037992 | |||
| 1829 | Ga0495584_0044156 | |||
| 1830 | Ga0495584_0090519 | |||
| 1831 | Ga0495584_0166107 | |||
| 1832 | Ga0495585_0258361 | |||
| 1833 | Ga0495585_0272819 | |||
| 1834 | Ga0495594_0055152 | |||
| 1835 | Ga0495594_0398380 | |||
| 1836 | Ga0495596_0061679 | |||
| 1837 | Ga0495596_0259827 | |||
| 1838 | Ga0495583_0116542 | |||
| 1839 | Ga0495616_0099167 | |||
| 1840 | Ga0495620_0071238 | |||
| 1841 | Ga0495630_0849438 | |||
| 1842 | Ga0495631_0079726 | |||
| 1843 | Ga0495631_0173179 | |||
| 1844 | Ga0495637_0082200 | |||
| 1845 | Ga0495637_0105550 | |||
| 1846 | Ga0495644_0037467 | |||
| 1847 | Ga0495644_0112948 | |||
| 1848 | Ga0495644_0142623 | |||
| 1849 | Ga0495644_0172084 | |||
| 1850 | Ga0495644_0208322 | |||
| 1851 | Ga0495663_0024763 | |||
| 1852 | Ga0495663_0047989 | |||
| 1853 | Ga0495663_0091714 | |||
| 1854 | Ga0495666_0147167 | |||
| 1855 | Ga0495642_0024044 | |||
| 1856 | Ga0495642_0088798 | |||
| 1857 | Ga0495642_0183574 | |||
| 1858 | Ga0495665_0078872 | |||
| 1859 | Ga0495598_0012782 | |||
| 1860 | Ga0495598_0066578 | |||
| 1861 | Ga0495609_0021345 | |||
| 1862 | Ga0495609_0099970 | |||
| 1863 | Ga0495609_0199550 | |||
| 1864 | Ga0495597_0163021 | |||
| 1865 | Ga0495656_0224272 | |||
| 1866 | Ga0495668_0254543 | |||
| 1867 | Ga0495668_0562066 | |||
| 1868 | Ga0495611_0168755 | |||
| 1869 | Ga0495659_0055103 | |||
| 1870 | Ga0495659_0244159 | |||
| 1871 | Ga0495661_0087667 | |||
| 1872 | Ga0495588_0084886 | |||
| 1873 | Ga0495588_0245878 | |||
| 1874 | Ga0495658_0401797 | |||
| 1875 | Ga0495669_0030729 | |||
| 1876 | Ga0495670_0064904 | |||
| 1877 | Ga0495670_0234395 | |||
| 1878 | Ga0495671_0315922 | |||
| 1879 | Ga0495589_0010931 | |||
| 1880 | Ga0495589_0276155 | |||
| 1881 | Ga0495660_0200212 | |||
| 1882 | Ga0495581_0206295 | |||
| 1883 | Ga0495683_0112116 | |||
| 1884 | Ga0495677_0047532 | |||
| 1885 | Ga0495677_0124311 | |||
| 1886 | Ga0495677_0216816 | |||
| 1887 | Ga0495677_0221247 | |||
| 1888 | Ga0495673_0189038 | |||
| 1889 | Ga0495686_0351765 | |||
| 1890 | Ga0495614_0177350 | |||
| 1891 | Ga0495615_0073019 | |||
| 1892 | Ga0496100_0024806 | |||
| 1893 | Ga0496100_0101405 | |||
| 1894 | Ga0496100_0590448 | |||
| 1895 | Ga0496100_0860185 | |||
| 1896 | Ga0496100_1076956 | |||
| 1897 | Ga0496101_0012970 | |||
| 1898 | Ga0496101_0014530 | |||
| 1899 | Ga0496101_0116990 | |||
| 1900 | Ga0496101_0246936 | |||
| 1901 | Ga0496101_0320121 | |||
| 1902 | Ga0496102_0000990 | |||
| 1903 | Ga0496102_0176508 | |||
| 1904 | Ga0496102_1016172 | |||
| 1905 | Ga0496104_0019090 | |||
| 1906 | Ga0496105_0056456 | |||
| 1907 | Ga0496105_0072857 | |||
| 1908 | Ga0496105_0207845 | |||
| 1909 | Ga0496105_0252947 | |||
| 1910 | Ga0496105_0313823 | |||
| 1911 | Ga0496106_0004185 | |||
| 1912 | Ga0496106_0062122 | |||
| 1913 | Ga0496106_0098282 | |||
| 1914 | Ga0496106_0255798 | |||
| 1915 | Ga0496106_0349934 | |||
| 1916 | Ga0496106_0524335 | |||
| 1917 | Ga0496107_0001146 | |||
| 1918 | Ga0496107_0014126 | |||
| 1919 | Ga0496108_0016109 | |||
| 1920 | Ga0496108_0061442 | |||
| 1921 | Ga0496108_0308495 | |||
| 1922 | Ga0496108_0487990 | |||
| 1923 | Ga0496108_0809422 | |||
| 1924 | Ga0496109_0017931 | |||
| 1925 | Ga0496109_0162682 | |||
| 1926 | Ga0496109_0209675 | |||
| 1927 | Ga0496109_0293379 | |||
| 1928 | Ga0496109_1219248 | |||
| 1929 | Ga0496110_0015030 | |||
| 1930 | Ga0496110_0026671 | |||
| 1931 | Ga0496110_0256456 | |||
| 1932 | Ga0496110_0384630 | |||
| 1933 | Ga0496110_0468843 | |||
| 1934 | Ga0496111_0013953 | |||
| 1935 | Ga0496111_0031526 | |||
| 1936 | Ga0496112_0064751 | |||
| 1937 | Ga0496112_0386277 | |||
| 1938 | Ga0496112_0689187 | |||
| 1939 | Ga0496113_0020920 | |||
| 1940 | Ga0496113_0256341 | |||
| 1941 | Ga0496113_0811133 | |||
| 1942 | Ga0496114_0018920 | |||
| 1943 | Ga0496114_0048367 | |||
| 1944 | Ga0496114_0088183 | |||
| 1945 | Ga0496114_0091784 | |||
| 1946 | Ga0496114_0160069 | |||
| 1947 | Ga0496114_0169946 | |||
| 1948 | Ga0496114_0349625 | |||
| 1949 | Ga0496115_0050322 | |||
| 1950 | Ga0496115_0332517 | |||
| 1951 | Ga0501292_025652 | |||
| 1952 | Ga0501031_0002040 | |||
| 1953 | Ga0501031_0011335 | |||
| 1954 | Ga0501031_0018235 | |||
| 1955 | Ga0501031_0058959 | |||
| 1956 | Ga0501031_0097481 | |||
| 1957 | Ga0501031_0176349 | |||
| 1958 | Ga0501032_0010152 | |||
| 1959 | Ga0501032_0019630 | |||
| 1960 | Ga0501032_0056794 | |||
| 1961 | Ga0501032_0184625 | |||
| 1962 | Ga0501033_0005477 | |||
| 1963 | Ga0501033_0008600 | |||
| 1964 | Ga0501033_0008837 | |||
| 1965 | Ga0501033_0083439 | |||
| 1966 | Ga0501033_0283115 | |||
| 1967 | Ga0501033_0483880 | |||
| 1968 | Ga0501033_1024739 | |||
| 1969 | Ga0501034_0021497 | |||
| 1970 | Ga0501034_0153028 | |||
| 1971 | Ga0501034_0447954 | |||
| 1972 | Ga0501036_0000886 | |||
| 1973 | Ga0501036_0001073 | |||
| 1974 | Ga0501036_0046903 | |||
| 1975 | Ga0501036_0061223 | |||
| 1976 | Ga0501036_0078334 | |||
| 1977 | Ga0501036_0111687 | |||
| 1978 | Ga0501036_0114311 | |||
| 1979 | Ga0501036_0188534 | |||
| 1980 | Ga0501036_0189820 | |||
| 1981 | Ga0501036_0485742 | |||
| 1982 | Ga0501037_0003930 | |||
| 1983 | Ga0501037_0006125 | |||
| 1984 | Ga0501037_0006716 | |||
| 1985 | Ga0501037_0048628 | |||
| 1986 | Ga0501037_0121648 | |||
| 1987 | Ga0501037_0394038 | |||
| 1988 | Ga0501037_0582074 | |||
| 1989 | Ga0501038_0005987 | |||
| 1990 | Ga0501038_0011094 | |||
| 1991 | Ga0501038_0015520 | |||
| 1992 | Ga0501038_0029623 | |||
| 1993 | Ga0501038_0068333 | |||
| 1994 | Ga0501038_0123022 | |||
| 1995 | Ga0501039_0017469 | |||
| 1996 | Ga0501039_0040318 | |||
| 1997 | Ga0501039_0044220 | |||
| 1998 | Ga0501039_0057722 | |||
| 1999 | Ga0501039_0064269 | |||
| 2000 | Ga0501039_0107410 | |||
| 2001 | Ga0501039_0238303 | |||
| 2002 | Ga0501039_0344271 | |||
| 2003 | Ga0501039_0419582 | |||
| 2004 | Ga0501039_0834969 | |||
| 2005 | Ga0501039_0877247 | |||
| 2006 | Ga0501040_0004527 | |||
| 2007 | Ga0501040_0006935 | |||
| 2008 | Ga0501040_0010841 | |||
| 2009 | Ga0501040_0012989 | |||
| 2010 | Ga0501040_0037918 | |||
| 2011 | Ga0501040_0044156 | |||
| 2012 | Ga0501040_0049347 | |||
| 2013 | Ga0501040_0365298 | |||
| 2014 | Ga0501040_0898678 | |||
| 2015 | Ga0501041_0004504 | |||
| 2016 | Ga0501041_0009919 | |||
| 2017 | Ga0501041_0015604 | |||
| 2018 | Ga0501041_0016089 | |||
| 2019 | Ga0501041_0021904 | |||
| 2020 | Ga0501041_0037667 | |||
| 2021 | Ga0501041_0041807 | |||
| 2022 | Ga0501041_0090211 | |||
| 2023 | Ga0501041_0211477 | |||
| 2024 | Ga0501041_0216526 | |||
| 2025 | Ga0501041_0369758 | |||
| 2026 | Ga0501041_0433023 | |||
| 2027 | Ga0501042_0001919 | |||
| 2028 | Ga0501042_0004719 | |||
| 2029 | Ga0501042_0009305 | |||
| 2030 | Ga0501042_0014736 | |||
| 2031 | Ga0501042_0101174 | |||
| 2032 | Ga0501042_0170209 | |||
| 2033 | Ga0501042_0208136 | |||
| 2034 | Ga0501042_0346324 | |||
| 2035 | Ga0501042_0378019 | |||
| 2036 | Ga0501043_0012210 | |||
| 2037 | Ga0501043_0017880 | |||
| 2038 | Ga0501043_0018898 | |||
| 2039 | Ga0501043_0019923 | |||
| 2040 | Ga0501043_0128872 | |||
| 2041 | Ga0501043_0130566 | |||
| 2042 | Ga0501046_0005087 | |||
| 2043 | Ga0501046_0008327 | |||
| 2044 | Ga0501046_0009146 | |||
| 2045 | Ga0501046_0046523 | |||
| 2046 | Ga0501046_0096178 | |||
| 2047 | Ga0501046_0362616 | |||
| 2048 | Ga0501046_0652039 | |||
| 2049 | Ga0501046_0762406 | |||
| 2050 | Ga0501047_0021938 | |||
| 2051 | Ga0501048_0012692 | |||
| 2052 | Ga0501048_0012846 | |||
| 2053 | Ga0501048_0014745 | |||
| 2054 | Ga0501048_0020631 | |||
| 2055 | Ga0501048_0024160 | |||
| 2056 | Ga0501048_0030498 | |||
| 2057 | Ga0501048_0036094 | |||
| 2058 | Ga0501048_0441559 | |||
| 2059 | Ga0501048_0866906 | |||
| 2060 | Ga0501067_0030915 | |||
| 2061 | Ga0501067_0031743 | |||
| 2062 | Ga0501067_0540610 | |||
| 2063 | Ga0501068_0004660 | |||
| 2064 | Ga0501068_0048689 | |||
| 2065 | Ga0501068_0049958 | |||
| 2066 | Ga0501068_0055663 | |||
| 2067 | Ga0501068_0123225 | |||
| 2068 | Ga0501068_0158228 | |||
| 2069 | Ga0501069_0001693 | |||
| 2070 | Ga0501069_0006904 | |||
| 2071 | Ga0501069_0009502 | |||
| 2072 | Ga0501069_0024077 | |||
| 2073 | Ga0501069_0063974 | |||
| 2074 | Ga0501070_0004629 | |||
| 2075 | Ga0501070_0004913 | |||
| 2076 | Ga0501070_0086101 | |||
| 2077 | Ga0501070_0100829 | |||
| 2078 | Ga0501070_0157560 | |||
| 2079 | Ga0501070_0399870 | |||
| 2080 | Ga0501071_0000999 | |||
| 2081 | Ga0501071_0005011 | |||
| 2082 | Ga0501071_0005104 | |||
| 2083 | Ga0501071_0006333 | |||
| 2084 | Ga0501071_0011941 | |||
| 2085 | Ga0501071_0012312 | |||
| 2086 | Ga0501071_0053929 | |||
| 2087 | Ga0501071_0072340 | |||
| 2088 | Ga0501071_0076570 | |||
| 2089 | Ga0501071_0107680 | |||
| 2090 | Ga0501071_0145002 | |||
| 2091 | Ga0501071_0219263 | |||
| 2092 | Ga0501071_0502232 | |||
| 2093 | Ga0501071_0811865 | |||
| 2094 | Ga0501072_0004838 | |||
| 2095 | Ga0501072_0008260 | |||
| 2096 | Ga0501072_0009743 | |||
| 2097 | Ga0501072_0015780 | |||
| 2098 | Ga0501072_0049222 | |||
| 2099 | Ga0501072_0053229 | |||
| 2100 | Ga0501072_0061041 | |||
| 2101 | Ga0501072_0123755 | |||
| 2102 | Ga0501072_0129323 | |||
| 2103 | Ga0501072_0132980 | |||
| 2104 | Ga0501072_0855754 | |||
| 2105 | Ga0501073_0011249 | |||
| 2106 | Ga0501073_0039547 | |||
| 2107 | Ga0501073_0078997 | |||
| 2108 | Ga0501073_0092780 | |||
| 2109 | Ga0501073_0542958 | |||
| 2110 | Ga0501074_0013907 | |||
| 2111 | Ga0501074_0021338 | |||
| 2112 | Ga0501074_0024865 | |||
| 2113 | Ga0501074_0031203 | |||
| 2114 | Ga0501074_0058304 | |||
| 2115 | Ga0501074_0089802 | |||
| 2116 | Ga0501074_0236494 | |||
| 2117 | Ga0501074_0659723 | |||
| 2118 | Ga0501074_0769906 | |||
| 2119 | Ga0501075_0003257 | |||
| 2120 | Ga0501075_0007314 | |||
| 2121 | Ga0501075_0011550 | |||
| 2122 | Ga0501075_0014974 | |||
| 2123 | Ga0501075_0047476 | |||
| 2124 | Ga0501075_0093057 | |||
| 2125 | Ga0501075_0161851 | |||
| 2126 | Ga0501075_0317319 | |||
| 2127 | Ga0501075_0712432 | |||
| 2128 | Ga0501075_1142663 | |||
| 2129 | Ga0501075_1148930 | |||
| 2130 | Ga0501076_0002512 | |||
| 2131 | Ga0501076_0009539 | |||
| 2132 | Ga0501076_0028300 | |||
| 2133 | Ga0501076_0028561 | |||
| 2134 | Ga0501076_0082214 | |||
| 2135 | Ga0501076_0101717 | |||
| 2136 | Ga0501076_0127759 | |||
| 2137 | Ga0501076_0209315 | |||
| 2138 | Ga0501076_0291945 | |||
| 2139 | Ga0501076_0366513 | |||
| 2140 | Ga0501076_0471043 | |||
| 2141 | Ga0501077_0004980 | |||
| 2142 | Ga0501077_0005213 | |||
| 2143 | Ga0501077_0007480 | |||
| 2144 | Ga0501077_0008613 | |||
| 2145 | Ga0501077_0009922 | |||
| 2146 | Ga0501077_0058420 | |||
| 2147 | Ga0501077_0162461 | |||
| 2148 | Ga0501077_0172717 | |||
| 2149 | Ga0501077_0192551 | |||
| 2150 | Ga0501077_0193904 | |||
| 2151 | Ga0501077_0409066 | |||
| 2152 | Ga0501077_0451356 | |||
| 2153 | Ga0501077_0806451 | |||
| 2154 | Ga0501209_057763 | |||
| 2155 | Ga0501079_0005554 | |||
| 2156 | Ga0501079_0007606 | |||
| 2157 | Ga0501079_0021858 | |||
| 2158 | Ga0501079_0046146 | |||
| 2159 | Ga0501079_0060060 | |||
| 2160 | Ga0501079_0066142 | |||
| 2161 | Ga0501079_0091708 | |||
| 2162 | Ga0501079_0344434 | |||
| 2163 | Ga0501079_0625381 | |||
| 2164 | Ga0501079_0745556 | |||
| 2165 | Ga0501080_0011231 | |||
| 2166 | Ga0501080_0015179 | |||
| 2167 | Ga0501080_0025490 | |||
| 2168 | Ga0501080_0027797 | |||
| 2169 | Ga0501080_0065341 | |||
| 2170 | Ga0501080_0089971 | |||
| 2171 | Ga0501081_0002584 | |||
| 2172 | Ga0501081_0005329 | |||
| 2173 | Ga0501081_0035759 | |||
| 2174 | Ga0501081_0077964 | |||
| 2175 | Ga0501081_0078815 | |||
| 2176 | Ga0501081_0088991 | |||
| 2177 | Ga0501081_0112896 | |||
| 2178 | Ga0501081_0170109 | |||
| 2179 | Ga0501081_0305887 | |||
| 2180 | Ga0501081_0316420 | |||
| 2181 | Ga0501081_1005301 | |||
| 2182 | Ga0501083_0007601 | |||
| 2183 | Ga0501083_0021557 | |||
| 2184 | Ga0501083_0030996 | |||
| 2185 | Ga0501083_0040735 | |||
| 2186 | Ga0501083_0087538 | |||
| 2187 | Ga0501083_0578299 | |||
| 2188 | Ga0501035_0001297 | |||
| 2189 | Ga0501035_0008968 | |||
| 2190 | Ga0501035_0009607 | |||
| 2191 | Ga0501035_0021581 | |||
| 2192 | Ga0501035_0222709 | |||
| 2193 | Ga0501035_0237994 | |||
| 2194 | Ga0501035_0365008 | |||
| 2195 | Ga0501035_0447148 | |||
| 2196 | Ga0501035_0460381 | |||
| 2197 | Ga0501044_0012904 | |||
| 2198 | Ga0501044_0025083 | |||
| 2199 | Ga0501044_0166259 | |||
| 2200 | Ga0501044_0268176 | |||
| 2201 | Ga0501045_0000294 | |||
| 2202 | Ga0501045_0003491 | |||
| 2203 | Ga0501045_0009860 | |||
| 2204 | Ga0501045_0018316 | |||
| 2205 | Ga0501045_0018917 | |||
| 2206 | Ga0501045_0031439 | |||
| 2207 | Ga0501045_0041762 | |||
| 2208 | Ga0501045_0068704 | |||
| 2209 | Ga0501045_0079948 | |||
| 2210 | Ga0501045_0083114 | |||
| 2211 | Ga0501045_0091344 | |||
| 2212 | nmdc:mga05p37_1196845_c1 | |||
| 2213 | nmdc:mga05p37_127268_c1 | |||
| 2214 | nmdc:mga05p37_383670_c1 | |||
| 2215 | nmdc:mga05p37_532_c2 | |||
| 2216 | nmdc:mga09592_2291_c1 | |||
| 2217 | nmdc:mga09592_297383_c1 | |||
| 2218 | nmdc:mga0qj67_133148_c1 | |||
| 2219 | nmdc:mga0qj67_144194_c1 | |||
| 2220 | nmdc:mga06r32_12732_c1 | |||
| 2221 | nmdc:mga06r32_393625_c1 | |||
| 2222 | nmdc:mga06r32_71140_c1 | |||
| 2223 | nmdc:mga06r32_80912_c1 | |||
| 2224 | nmdc:mga08y16_129628_c1 | |||
| 2225 | nmdc:mga08y16_45251_c1 | |||
| 2226 | nmdc:mga08y16_50001_c1 | |||
| 2227 | nmdc:mga08y16_6843_c1 | |||
| 2228 | nmdc:mga08y16_823370_c1 | |||
| 2229 | nmdc:mga08y16_911186_c1 | |||
| 2230 | nmdc:mga0n895_181588_c1 | |||
| 2231 | nmdc:mga0n895_584031_c1 | |||
| 2232 | nmdc:mga0rr50_37744_c1 | |||
| 2233 | nmdc:mga0a205_182997_c1 | |||
| 2234 | nmdc:mga0a205_253073_c1 | |||
| 2235 | nmdc:mga0a205_886168_c1 | |||
| 2236 | nmdc:mga0a205_95480_c1 | |||
| 2237 | Ga0495655_0105643 | |||
| 2238 | Ga0495655_0107543 | |||
| 2239 | Ga0495655_0249331 | |||
| 2240 | Ga0501084_0004955 | |||
| 2241 | Ga0501084_0006048 | |||
| 2242 | Ga0501084_0040057 | |||
| 2243 | Ga0501084_0051541 | |||
| 2244 | Ga0501084_0059960 | |||
| 2245 | Ga0501084_0062141 | |||
| 2246 | Ga0501084_0095033 | |||
| 2247 | Ga0501084_0146941 | |||
| 2248 | Ga0501084_0182141 | |||
| 2249 | Ga0501084_0200974 | |||
| 2250 | Ga0501084_0594151 | |||
| 2251 | Ga0501082_0000584 | |||
| 2252 | Ga0501082_0004443 | |||
| 2253 | Ga0501082_0025954 | |||
| 2254 | Ga0501082_0038520 | |||
| 2255 | Ga0501082_0040890 | |||
| 2256 | Ga0501082_0107883 | |||
| 2257 | Ga0501082_0193799 | |||
| 2258 | Ga0501082_0506737 | |||
| 2259 | Ga0501082_0914193 | |||
| 2260 | Ga0530510_0002385 | |||
| 2261 | Ga0530510_0002770 | |||
| 2262 | Ga0530510_0008577 | |||
| 2263 | Ga0530510_0034759 | |||
| 2264 | Ga0530510_0041119 | |||
| 2265 | Ga0530510_0041547 | |||
| 2266 | Ga0530510_0068164 | |||
| 2267 | Ga0530510_0207111 | |||
| 2268 | Ga0530510_0364766 | |||
| 2269 | Ga0530510_0550775 | |||
| 2270 | Ga0530510_0561225 | |||
| 2271 | Ga0530510_0781479 | |||
| 2272 | Ga0530510_0786542 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7agw-assembly1.cif.gz_B | structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 6.5 | 0.9373 | 3 | 70 |
| 7aht-assembly1.cif.gz_B | structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 | 0.9352 | 3 | 70 |
| 7aht-assembly1.cif.gz_B | structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 | 0.9203 | 3 | 70 |
| 7b5u-assembly1.cif.gz_B | rck_c domain dimer of s.agalactiae busr in complex with c-di-amp | 0.9186 | 90 | 161 |
| 7aht-assembly1.cif.gz_A | structure of the n-domain of the k+/h+ antiporter subunit khtt at ph 7.5 | 0.9016 | 3 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05882_87_159_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9209 | 91 | 162 | 3.30.70.1450 |
| af_Q57604_260_331_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9077 | 91 | 160 | 3.30.70.1450 |
| 2fy8C03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.9001 | 88 | 160 | 3.30.70.1450 |
| af_O05882_87_159_3.30.70.1450 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.8978 | 91 | 162 | 3.30.70.1450 |
| 2bkpA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain | 0.8957 | 86 | 163 | 3.30.70.1450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F5UHQ9-F1-model_v4 | Potassium transporter KefB | 0.948 | 88 | 156 |
GO:0006813
GO:0008324 GO:0015297 GO:0016020 GO:1902600 |
| AF-A0A7W0HAI6-F1-model_v4 | RCK C-terminal domain-containing protein | 0.9391 | 88 | 160 |
GO:0006813
GO:0008324 |
| AF-A0A3N5IHM1-F1-model_v4 | RCK C-terminal domain-containing protein | 0.9196 | 88 | 164 |
GO:0005886
GO:0006813 GO:0008324 |
| AF-A0A2S9YX99-F1-model_v4 | Voltage-gated potassium channel Kch | 0.9176 | 88 | 160 |
GO:0005886
GO:0006813 GO:0008324 |
| AF-A0A1D2R547-F1-model_v4 | RCK C-terminal domain-containing protein | 0.9026 | 88 | 164 |
GO:0006813
GO:0008324 |