F490639

General Info

Members Datasets Scaffolds Average Seq Length
1137 518 992 321

Family's Representative Sequence

Representative Sequence 3300002705|JGI25156J39149_1001544|JGI25156J39149_10015447
Length 354
Sequence MKTRCRGPVKSNALIAAAAVKHAPGGNKEQQMDVLGIDEITYGADDLPTCRQFFLDWGMTLAQESADALVFESQNGCRVVVRSSADPALPPAIEAGPTLREVVWGVSSAEVLPKFAERIKDLPGYLNDGKRVGCTDPNGLAVRFQVSQKREVKVECATMNTWNEKNRINQRSPVYDHASPIEVGHVVFFVKDVRACEKFYCENFGFVPSDRYPERGAFLRCADVGGHHDIFLLQPPEARSGLNHVAFTVRDIHEVFGGGMHMSRKGWDTQLGPGRHPISSAYFWYFKNPAGGLIEYYADEDQLDADWEPRDFEPGPTVFAEWAIDGGIDGNTRRQKNAQGPTGKFLTDRQPTHK

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231021 Pseudomonas sp. GM78 Isolate Nodule
6 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
9 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
10 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
11 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
14 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
15 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
16 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
17 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
20 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
21 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
22 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
23 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
24 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
25 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
26 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
27 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
28 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
29 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
30 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
31 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
32 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
33 2643221645 Massilia sp. Root351 Isolate Unclassified
34 2643221658 Variovorax sp. Root411 Isolate Unclassified
35 2643221664 Massilia sp. Root418 Isolate Unclassified
36 2643221672 Variovorax sp. Root434 Isolate Unclassified
37 2643221683 Variovorax sp. Root473 Isolate Unclassified
38 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
39 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
40 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
41 2721755523 Delftia sp. HK171 Isolate Unclassified
42 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
43 2738541280 Massilia sp. GV090 Isolate Unclassified
44 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
45 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
46 2738541300 Massilia sp. GV016 Isolate Unclassified
47 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
48 2738541307 Variovorax sp. GV008 Isolate Unclassified
49 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
50 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
51 2738543013 Variovorax sp. BT01 Isolate Unclassified
52 2738543018 Massilia sp. GV045 Isolate Unclassified
53 2738543030 Massilia sp. GV097 Isolate Unclassified
54 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
55 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
56 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
57 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
58 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
59 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
60 2818991446 Variovorax sp. 1180 Isolate Unclassified
61 2818991450 Burkholderia sp. 604 Isolate Unclassified
62 2818991452 Burkholderia cepacia 561 Isolate Unclassified
63 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
64 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
65 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
66 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
67 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
68 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
69 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
70 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
71 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
72 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
73 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
74 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
75 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
76 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
77 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
78 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
79 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
80 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
81 2885198086 Variovorax sp. 679 Isolate Unclassified
82 2885211737 Variovorax sp. 553 Isolate Unclassified
83 2885266251 Ralstonia sp. SET104 Isolate Nodule
84 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
85 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
86 2899924645 Variovorax sp. 369 Isolate Unclassified
87 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
88 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
89 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
90 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
91 2904456579 Variovorax sp. 2002 Isolate Unclassified
92 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
93 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
94 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
95 2904564687 Burkholderia sp. 571 Isolate Unclassified
96 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
97 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
98 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
99 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
100 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
101 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
102 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
103 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
104 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
105 2928037797 Variovorax sp. 1126 Isolate Unclassified
106 2928044640 Variovorax sp. 1128 Isolate Unclassified
107 2928051484 Variovorax sp. 1133 Isolate Unclassified
108 2928058823 Ralstonia sp. 1138 Isolate Unclassified
109 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
110 2928070936 Variovorax gossypii 1167 Isolate Unclassified
111 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
112 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
113 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
114 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
115 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
116 2928163908 Burkholderia sp. 567 Isolate Unclassified
117 2928170801 Burkholderia sp. 572 Isolate Unclassified
118 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
119 2928536128 Burkholderia sola 565 Isolate Unclassified
120 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
121 2929520902 Variovorax beijingensis 502 Isolate Unclassified
122 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
123 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
124 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
125 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
126 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
127 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
128 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
129 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
130 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
131 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
132 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
133 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
134 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
135 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
136 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
137 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
138 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
139 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
140 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
141 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
142 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
143 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
144 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
145 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
146 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
147 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
148 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
149 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
150 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
151 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
152 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
153 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
154 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
155 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
156 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
157 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
158 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
159 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
160 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
161 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
162 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
163 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
164 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
165 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
166 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
167 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
168 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
169 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
170 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
171 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
172 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
173 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
174 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
175 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
176 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
177 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
178 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
179 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
180 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
181 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
182 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
183 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
184 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
185 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
186 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
187 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
188 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
189 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
190 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
191 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
192 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
193 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
194 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
195 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
196 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
197 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
198 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
199 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
200 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
201 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
202 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
203 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
204 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
210 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
211 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
212 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
213 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
214 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
219 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
220 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
221 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
222 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
223 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
224 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
227 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
228 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
229 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
237 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
239 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
240 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
241 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
244 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
245 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
246 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
253 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
255 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
284 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
286 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
287 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
290 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
291 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
292 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
295 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
296 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
297 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
300 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
307 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
308 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
309 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
310 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
311 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
312 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
313 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
314 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
315 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
316 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
317 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
318 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
319 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
320 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
321 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
322 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
323 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
324 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
325 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
326 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
327 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
328 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
329 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
334 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
337 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
340 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
341 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
342 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
343 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
344 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
364 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
365 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
366 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
371 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
372 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
373 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
374 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
375 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
382 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
383 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
384 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
385 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
386 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
387 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
388 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
389 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
392 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
393 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
394 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
395 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
396 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
397 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
398 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
399 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
400 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
401 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
402 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
403 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
404 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
405 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
406 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
407 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
408 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
409 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
410 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
411 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
412 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
413 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
414 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
415 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
416 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
417 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
418 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
419 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
420 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
421 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
422 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
423 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
424 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
434 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
435 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
436 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
437 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
438 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
439 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
440 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
441 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
442 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
443 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
444 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
445 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
446 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
447 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
448 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
449 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
450 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
463 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
464 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
465 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
466 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
467 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
468 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
469 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
470 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
471 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
472 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
473 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
474 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
476 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
477 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
478 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
479 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
480 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
481 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
482 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
483 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
484 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
485 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
486 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
487 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
488 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
489 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
490 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
491 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
492 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
496 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
497 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
498 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
499 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
500 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
501 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
502 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
503 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
504 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
505 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
506 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
507 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
508 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
509 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
510 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
511 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
512 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
513 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
514 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
515 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
516 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
517 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
518 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.07
Metatranscriptomes 0.18
Isolates 12.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.2
Nodule 2.11
Rhizoplane 4.05
Rhizosphere 58.66
Stem 0
Stem Tuber 0
Unclassified 13.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000536 3300001915 Bacteria 11603
2 JGI24740J21852_10000036 3300001979 Bacteria 44619
3 JGI24740J21852_10000873 3300001979 Bacteria 13338
4 JGI24740J21852_10000911 3300001979 Bacteria 13113
5 JGI24739J22299_10005556 3300001989 Bacteria 4780
6 JGI24739J22299_10023299 3300001989 Bacteria 2190
7 JGI24739J22299_10041068 3300001989 Bacteria 1541
8 JGI24737J22298_10034905 3300001990 Bacteria 1558
9 JGI24735J21928_10006651 3300002067 Bacteria 3795
10 JGI24735J21928_10010353 3300002067 Bacteria 2977
11 JGI25155J39150_1000737 3300002704 Bacteria 5632
12 JGI25155J39150_1000769 3300002704 Bacteria 5273
13 JGI25156J39149_1000521 3300002705 Bacteria 22290
14 JGI25156J39149_1000586 3300002705 Bacteria 20618
15 JGI25156J39149_1001544 3300002705 Bacteria 9511
16 JGI25156J39149_1003507 3300002705 Bacteria 5111
17 JGI25156J39149_1009393 3300002705 Bacteria 2383
18 JGI25162J39368_1007559 3300002737 Bacteria 1674
19 JGI25154J39366_1000382 3300002738 Bacteria 24334
20 JGI25154J39366_1001257 3300002738 Bacteria 9511
21 JGI25154J39366_1002177 3300002738 Bacteria 5458
22 JGI25157J39369_1000593 3300002741 Bacteria 21398
23 JGI25157J39369_1000711 3300002741 Bacteria 17917
24 JGI25159J45721_1007642 3300002987 Bacteria 3073
25 JGI25151J46595_10000360 3300003187 Bacteria 48149
26 JGI25151J46595_10000362 3300003187 Bacteria 47753
27 JGI25151J46595_10001007 3300003187 Bacteria 21295
28 JGI25151J46595_10003059 3300003187 Bacteria 9460
29 JGI25151J46595_10004421 3300003187 Bacteria 7442
30 JGI25151J46595_10005097 3300003187 Bacteria 6826
31 JGI25151J46595_10008892 3300003187 Bacteria 4795
32 JGI25151J46595_10011276 3300003187 Bacteria 4116
33 JGI25151J46595_10023197 3300003187 Bacteria 2562
34 JGI25151J46595_10027170 3300003187 Bacteria 2299
35 JGI25151J46595_10052046 3300003187 Bacteria 1381
36 JGI25165J46597_1000875 3300003214 Bacteria 21417
37 JGI25153J46596_10028440 3300003215 Bacteria 1938
38 rootH1_10131663 3300003316 Bacteria 1140
39 JGI25160J50197_1005351 3300003354 Bacteria 5359
40 JGI25161J50226_1001166 3300003374 Bacteria 8720
41 JGI25161J50226_1003857 3300003374 Bacteria 3290
42 Ga0055538_1001443 3300003751 Bacteria 4572
43 Ga0055538_1001482 3300003751 Bacteria 4457
44 Ga0055538_1004435 3300003751 Bacteria 1593
45 Ga0055539_1000178 3300003752 Bacteria 54121
46 Ga0055533_1000173 3300003756 Bacteria 58305
47 Ga0055533_1000463 3300003756 Bacteria 15368
48 Ga0055533_1000533 3300003756 Bacteria 13609
49 Ga0055533_1002281 3300003756 Bacteria 4457
50 Ga0055533_1007318 3300003756 Bacteria 1516
51 Ga0055532_1000014 3300003758 Bacteria 344702
52 Ga0055532_1000041 3300003758 Bacteria 195749
53 Ga0055532_1000310 3300003758 Bacteria 29584
54 Ga0055532_1000534 3300003758 Bacteria 16440
55 Ga0055532_1001391 3300003758 Bacteria 6824
56 Ga0055532_1001394 3300003758 Bacteria 6816
57 Ga0055525_1000504 3300003759 Bacteria 19403
58 Ga0055527_1000013 3300003760 Bacteria 347416
59 Ga0055527_1000444 3300003760 Bacteria 16440
60 Ga0055535_1000011 3300003761 Bacteria 347416
61 Ga0055535_1000030 3300003761 Bacteria 195749
62 Ga0055535_1001100 3300003761 Bacteria 16440
63 Ga0055535_1001288 3300003761 Bacteria 13548
64 Ga0055535_1001794 3300003761 Bacteria 9420
65 Ga0055535_1006942 3300003761 Bacteria 2221
66 Ga0055542_1000004 3300003762 Bacteria 553532
67 Ga0055542_1000018 3300003762 Bacteria 347416
68 Ga0055542_1001322 3300003762 Bacteria 12978
69 Ga0055542_1001883 3300003762 Bacteria 8345
70 Ga0055542_1002010 3300003762 Bacteria 7812
71 Ga0055542_1004738 3300003762 Bacteria 3210
72 Ga0055529_1000017 3300003763 Bacteria 347416
73 Ga0055529_1000058 3300003763 Bacteria 195735
74 Ga0055529_1000470 3300003763 Bacteria 38708
75 Ga0055526_1001983 3300003771 Bacteria 14108
76 Ga0055526_1010824 3300003771 Bacteria 4194
77 Ga0055526_1023599 3300003771 Bacteria 2047
78 Ga0055537_1000174 3300003773 Bacteria 47786
79 Ga0055537_1000975 3300003773 Bacteria 13010
80 Ga0055537_1004186 3300003773 Bacteria 4194
81 Ga0055524_1000236 3300003775 Bacteria 58057
82 Ga0055524_1008320 3300003775 Bacteria 4318
83 Ga0055524_1030895 3300003775 Bacteria 1552
84 Ga0055536_1000201 3300003781 Bacteria 48808
85 Ga0055534_1000143 3300003784 Bacteria 53491
86 Ga0055534_1000173 3300003784 Bacteria 47984
87 Ga0055534_1000191 3300003784 Bacteria 45111
88 Ga0055534_1000233 3300003784 Bacteria 40184
89 Ga0055534_1014108 3300003784 Bacteria 1510
90 Ga0055528_1000221 3300003790 Bacteria 48033
91 Ga0055528_1004569 3300003790 Bacteria 6637
92 Ga0055528_1028258 3300003790 Bacteria 1552
93 Ga0055530_10002962 3300003791 Bacteria 10231
94 Ga0055540_1002232 3300003792 Bacteria 10483
95 Ga0055541_1000264 3300003841 Bacteria 18463
96 Ga0055541_1001811 3300003841 Bacteria 4457
97 Ga0055543_1001238 3300004625 Bacteria 10652
98 Ga0055543_1007444 3300004625 Bacteria 2530
99 Ga0065165_1000067 3300005262 Bacteria 170811
100 Ga0065165_1000191 3300005262 Bacteria 106980
101 Ga0065165_1003020 3300005262 Bacteria 12691
102 Ga0065714_10006689 3300005288 Bacteria 3180
103 Ga0065714_10064920 3300005288 Bacteria 15454
104 Ga0065714_10078094 3300005288 Bacteria 2630
105 Ga0065715_10141291 3300005293 Bacteria 1850
106 Ga0070682_100348359 3300005337 Bacteria 1103
107 Ga0070660_100160112 3300005339 Bacteria 1814
108 Ga0070661_100000072 3300005344 Bacteria 82584
109 Ga0070661_100071842 3300005344 Bacteria 2547
110 Ga0070661_100167450 3300005344 Bacteria 1667
111 Ga0070668_100270277 3300005347 Bacteria 1417
112 Ga0070659_100000181 3300005366 Bacteria 48434
113 Ga0070659_100000307 3300005366 Bacteria 38077
114 Ga0070667_100525852 3300005367 Bacteria 1086
115 Ga0070694_100088395 3300005444 Bacteria 2169
116 Ga0070663_100000015 3300005455 Bacteria 131905
117 Ga0070663_100001146 3300005455 Bacteria 14603
118 Ga0070663_100250752 3300005455 Bacteria 1401
119 Ga0068867_100435125 3300005459 Bacteria 1114
120 Ga0068855_100003015 3300005563 Bacteria 20600
121 Ga0068855_100173681 3300005563 Bacteria 2439
122 Ga0070664_100000058 3300005564 Bacteria 67966
123 Ga0068857_100009908 3300005577 Bacteria 8269
124 Ga0068857_100106054 3300005577 Bacteria 2523
125 Ga0068857_100207537 3300005577 Bacteria 1787
126 Ga0068854_100000025 3300005578 Bacteria 123547
127 Ga0068854_100000568 3300005578 Bacteria 22144
128 Ga0068854_100060076 3300005578 Bacteria 2749
129 Ga0068856_100000084 3300005614 Bacteria 87749
130 Ga0068852_100003058 3300005616 Bacteria 11640
131 Ga0068852_100085179 3300005616 Bacteria 2815
132 Ga0068851_10003560 3300005834 Bacteria 6938
133 Ga0068851_10205462 3300005834 Bacteria 1101
134 Ga0068858_100238120 3300005842 Bacteria 1726
135 Ga0068862_100115715 3300005844 Bacteria 2358
136 Ga0075365_10092622 3300006038 Bacteria 2060
137 Ga0075368_10003356 3300006042 Bacteria 5333
138 Ga0075368_10054113 3300006042 Bacteria 1599
139 Ga0075363_100050814 3300006048 Bacteria 2209
140 Ga0075432_10000001 3300006058 Bacteria 64068
141 Ga0075432_10002256 3300006058 Bacteria 6411
142 Ga0075432_10032843 3300006058 Bacteria 1798
143 Ga0075362_10032174 3300006177 Bacteria 2274
144 Ga0075367_10129328 3300006178 Bacteria 1560
145 Ga0075369_10014050 3300006186 Bacteria 3192
146 Ga0075369_10038864 3300006186 Bacteria 2031
147 Ga0075366_10006898 3300006195 Bacteria 6252
148 Ga0075366_10052980 3300006195 Bacteria 2410
149 Ga0075370_10002278 3300006353 Bacteria 8848
150 Ga0075370_10003866 3300006353 Bacteria 7176
151 Ga0075370_10011877 3300006353 Bacteria 4586
152 Ga0075370_10049018 3300006353 Bacteria 2394
153 Ga0075370_10056001 3300006353 Bacteria 2241
154 Ga0075436_100011170 3300006914 Bacteria 6157
155 Ga0075436_100033512 3300006914 Bacteria 3540
156 Ga0079104_1000226 3300006946 Bacteria 77894
157 Ga0099826_10000031 3300006948 Bacteria 124966
158 Ga0105251_10000674 3300009011 Bacteria 31403
159 Ga0105251_10003817 3300009011 Bacteria 10733
160 Ga0105251_10006641 3300009011 Bacteria 7321
161 Ga0105251_10015428 3300009011 Bacteria 4176
162 Ga0105251_10060849 3300009011 Bacteria 1777
163 Ga0105251_10085981 3300009011 Bacteria 1449
164 Ga0105244_10001011 3300009036 Bacteria 23532
165 Ga0105244_10001337 3300009036 Bacteria 20127
166 Ga0105244_10019526 3300009036 Bacteria 3781
167 Ga0105250_10000138 3300009092 Bacteria 63230
168 Ga0105250_10000526 3300009092 Bacteria 26634
169 Ga0105250_10002381 3300009092 Bacteria 9489
170 Ga0105250_10036398 3300009092 Bacteria 1975
171 Ga0105240_10013189 3300009093 Bacteria 11368
172 Ga0105240_10016683 3300009093 Bacteria 9932
173 Ga0105240_10025173 3300009093 Bacteria 7826
174 Ga0105240_10047755 3300009093 Bacteria 5416
175 Ga0105240_10060433 3300009093 Bacteria 4724
176 Ga0105240_10126762 3300009093 Bacteria 3066
177 Ga0105240_10148726 3300009093 Bacteria 2791
178 Ga0105245_10186035 3300009098 Bacteria 1987
179 Ga0105243_10002670 3300009148 Bacteria 14816
180 Ga0105243_10007533 3300009148 Bacteria 8370
181 Ga0105242_10001195 3300009176 Bacteria 20496
182 Ga0105237_10023997 3300009545 Bacteria 6240
183 Ga0105237_10038427 3300009545 Bacteria 4833
184 Ga0105237_10194897 3300009545 Bacteria 2025
185 Ga0105237_10573072 3300009545 Bacteria 1136
186 Ga0105238_10000065 3300009551 Bacteria 121196
187 Ga0105238_10036956 3300009551 Bacteria 4966
188 Ga0105238_10068160 3300009551 Bacteria 3559
189 Ga0105238_10260686 3300009551 Bacteria 1713
190 Ga0105238_10279753 3300009551 Bacteria 1650
191 Ga0105238_10285253 3300009551 Bacteria 1633
192 Ga0105239_10005960 3300010375 Bacteria 14185
193 Ga0157373_10008272 3300013100 Bacteria 7732
194 Ga0157373_10054161 3300013100 Bacteria 2851
195 Ga0157371_10000100 3300013102 Bacteria 131924
196 Ga0157370_10000004 3300013104 Bacteria 366426
197 Ga0157370_10069039 3300013104 Bacteria 3339
198 Ga0157369_10014095 3300013105 Bacteria 9036
199 Ga0157369_10034904 3300013105 Bacteria 5516
200 Ga0157369_10299406 3300013105 Bacteria 1673
201 Ga0157374_10029992 3300013296 Bacteria 4934
202 Ga0163162_10004924 3300013306 Bacteria 12876
203 Ga0163162_10008588 3300013306 Bacteria 9958
204 Ga0163162_10318029 3300013306 Bacteria 1689
205 Ga0157372_10001269 3300013307 Bacteria 27302
206 Ga0157372_10053850 3300013307 Bacteria 4486
207 Ga0157375_10418713 3300013308 Bacteria 1506
208 Ga0182008_10003799 3300014497 Bacteria 8975
209 Ga0182008_10005597 3300014497 Bacteria 7121
210 Ga0182008_10013054 3300014497 Bacteria 4370
211 Ga0182008_10037122 3300014497 Bacteria 2438
212 Ga0182008_10041086 3300014497 Bacteria 2307
213 Ga0182006_1000955 3300015261 Bacteria 19201
214 Ga0182006_1002044 3300015261 Bacteria 11321
215 Ga0182006_1002577 3300015261 Bacteria 9818
216 Ga0182006_1028209 3300015261 Bacteria 2285
217 Ga0182006_1046589 3300015261 Bacteria 1684
218 Ga0182007_10000501 3300015262 Bacteria 23243
219 Ga0182007_10000617 3300015262 Bacteria 20740
220 Ga0182007_10001834 3300015262 Bacteria 11079
221 Ga0182007_10010306 3300015262 Bacteria 3704
222 Ga0182007_10079780 3300015262 Bacteria 1073
223 Ga0182005_1018440 3300015265 Bacteria 1928
224 Ga0182005_1041229 3300015265 Bacteria 1255
225 Ga0183362_10001 3300015683 Bacteria 2046624
226 Ga0163161_10000065 3300017792 Bacteria 108321
227 Ga0163161_10001330 3300017792 Bacteria 18390
228 Ga0163161_10030339 3300017792 Bacteria 3847
229 Ga0163161_10236727 3300017792 Bacteria 1419
230 Ga0206351_10922417 3300020077 Bacteria 2432
231 Ga0154015_1039511 3300020610 Bacteria 12637
232 Ga0213872_10000365 3300021361 Bacteria 38169
233 Ga0213872_10000722 3300021361 Bacteria 24663
234 Ga0213872_10003137 3300021361 Bacteria 9284
235 Ga0213872_10006128 3300021361 Bacteria 6079
236 Ga0213872_10023546 3300021361 Bacteria 2834
237 Ga0209435_100060 3300025206 Bacteria 79407
238 Ga0209435_100681 3300025206 Bacteria 5950
239 Ga0209435_101516 3300025206 Bacteria 2906
240 Ga0209436_113824 3300025208 Bacteria 1305
241 Ga0209784_100029 3300025224 Bacteria 347315
242 Ga0209784_100768 3300025224 Bacteria 7877
243 Ga0209566_100030 3300025225 Bacteria 347329
244 Ga0209566_100662 3300025225 Bacteria 20627
245 Ga0209566_101069 3300025225 Bacteria 10847
246 Ga0209566_102557 3300025225 Bacteria 3275
247 Ga0209674_100049 3300025226 Bacteria 346969
248 Ga0209674_100051 3300025226 Bacteria 338399
249 Ga0209674_100081 3300025226 Bacteria 201146
250 Ga0209674_100089 3300025226 Bacteria 178751
251 Ga0209674_100123 3300025226 Bacteria 131438
252 Ga0209674_101112 3300025226 Bacteria 7911
253 Ga0209674_102107 3300025226 Bacteria 4509
254 Ga0209672_100027 3300025228 Bacteria 344500
255 Ga0209672_100042 3300025228 Bacteria 272005
256 Ga0209672_100131 3300025228 Bacteria 74237
257 Ga0209672_100961 3300025228 Bacteria 12819
258 Ga0209672_101173 3300025228 Bacteria 10695
259 Ga0209147_100008 3300025229 Bacteria 777096
260 Ga0209147_100012 3300025229 Bacteria 681990
261 Ga0209147_100035 3300025229 Bacteria 344500
262 Ga0209147_100046 3300025229 Bacteria 295158
263 Ga0209147_100052 3300025229 Bacteria 272005
264 Ga0209147_100165 3300025229 Bacteria 90385
265 Ga0209563_100186 3300025230 Bacteria 36838
266 Ga0209563_102345 3300025230 Bacteria 4327
267 Ga0209563_107461 3300025230 Bacteria 1794
268 Ga0207427_100722 3300025231 Bacteria 15390
269 Ga0209437_100595 3300025233 Bacteria 22745
270 Ga0209258_100013 3300025242 Bacteria 777096
271 Ga0209258_100022 3300025242 Bacteria 553584
272 Ga0209258_100030 3300025242 Bacteria 470208
273 Ga0209258_100052 3300025242 Bacteria 344500
274 Ga0209258_100073 3300025242 Bacteria 272005
275 Ga0209258_100573 3300025242 Bacteria 31220
276 Ga0207425_1000138 3300025245 Bacteria 65477
277 Ga0209646_1000065 3300025246 Bacteria 245452
278 Ga0209646_1000143 3300025246 Bacteria 105906
279 Ga0209646_1000181 3300025246 Bacteria 79407
280 Ga0209026_1000217 3300025250 Bacteria 79407
281 Ga0209026_1002525 3300025250 Bacteria 6778
282 Ga0209026_1003642 3300025250 Bacteria 4941
283 Ga0209677_100030 3300025253 Bacteria 347314
284 Ga0209148_1000022 3300025254 Bacteria 681990
285 Ga0209148_1000034 3300025254 Bacteria 553584
286 Ga0209148_1000064 3300025254 Bacteria 344500
287 Ga0209148_1000113 3300025254 Bacteria 195646
288 Ga0209148_1000524 3300025254 Bacteria 37800
289 Ga0209148_1002495 3300025254 Bacteria 6234
290 Ga0209759_1000015 3300025256 Bacteria 388724
291 Ga0209759_1000041 3300025256 Bacteria 252893
292 Ga0209759_1000044 3300025256 Bacteria 241431
293 Ga0209759_1000791 3300025256 Bacteria 26015
294 Ga0209759_1001072 3300025256 Bacteria 17915
295 Ga0209759_1001115 3300025256 Bacteria 17309
296 Ga0209759_1003524 3300025256 Bacteria 6198
297 Ga0209759_1003635 3300025256 Bacteria 6068
298 Ga0209129_1000023 3300025258 Bacteria 420646
299 Ga0209129_1004158 3300025258 Bacteria 5845
300 Ga0209129_1007672 3300025258 Bacteria 3150
301 Ga0209233_1000073 3300025261 Bacteria 362383
302 Ga0209565_1000006 3300025263 Bacteria 897294
303 Ga0209565_1000053 3300025263 Bacteria 210249
304 Ga0209565_1000649 3300025263 Bacteria 22398
305 Ga0209455_1000024 3300025272 Bacteria 676133
306 Ga0209455_1000057 3300025272 Bacteria 344500
307 Ga0209455_1000106 3300025272 Bacteria 195801
308 Ga0209455_1000505 3300025272 Bacteria 27995
309 Ga0209673_1000004 3300025273 Bacteria 896155
310 Ga0209673_1000021 3300025273 Bacteria 422978
311 Ga0209673_1001445 3300025273 Bacteria 22547
312 Ga0209673_1001448 3300025273 Bacteria 22538
313 Ga0209673_1010458 3300025273 Bacteria 3913
314 Ga0209130_1000222 3300025284 Bacteria 74607
315 Ga0209130_1000476 3300025284 Bacteria 41280
316 Ga0209130_1001231 3300025284 Bacteria 17981
317 Ga0209130_1006194 3300025284 Bacteria 3935
318 Ga0209675_1000078 3300025291 Bacteria 156111
319 Ga0209675_1000091 3300025291 Bacteria 146390
320 Ga0209675_1000123 3300025291 Bacteria 106157
321 Ga0209675_1002241 3300025291 Bacteria 10106
322 Ga0209675_1002494 3300025291 Bacteria 9420
323 Ga0209675_1010439 3300025291 Bacteria 3169
324 Ga0209675_1011454 3300025291 Bacteria 2941
325 Ga0209676_1000005 3300025292 Bacteria 1076001
326 Ga0209676_1000121 3300025292 Bacteria 198920
327 Ga0209676_1001320 3300025292 Bacteria 25099
328 Ga0209676_1001396 3300025292 Bacteria 23358
329 Ga0209025_1000034 3300025294 Bacteria 413205
330 Ga0209025_1000051 3300025294 Bacteria 330080
331 Ga0209025_1000085 3300025294 Bacteria 263782
332 Ga0209025_1000096 3300025294 Bacteria 239153
333 Ga0209025_1000157 3300025294 Bacteria 168790
334 Ga0209025_1000476 3300025294 Bacteria 77754
335 Ga0209025_1001087 3300025294 Bacteria 39361
336 Ga0209025_1003078 3300025294 Bacteria 16365
337 Ga0209025_1016183 3300025294 Bacteria 4426
338 Ga0209025_1023843 3300025294 Bacteria 3181
339 Ga0209025_1023882 3300025294 Bacteria 3178
340 Ga0209564_1000133 3300025295 Bacteria 189140
341 Ga0209564_1000400 3300025295 Bacteria 77039
342 Ga0209564_1001022 3300025295 Bacteria 34533
343 Ga0209564_1001147 3300025295 Bacteria 31038
344 Ga0209564_1001357 3300025295 Bacteria 25809
345 Ga0209564_1005727 3300025295 Bacteria 6948
346 Ga0209758_1000064 3300025297 Bacteria 311812
347 Ga0209758_1020079 3300025297 Bacteria 3181
348 Ga0209758_1020110 3300025297 Bacteria 3178
349 Ga0209050_1000007 3300025298 Bacteria 1187891
350 Ga0209050_1016709 3300025298 Bacteria 2981
351 Ga0209256_1000038 3300025299 Bacteria 375225
352 Ga0209256_1000115 3300025299 Bacteria 173607
353 Ga0209256_1000219 3300025299 Bacteria 106112
354 Ga0209256_1000400 3300025299 Bacteria 68737
355 Ga0209256_1005371 3300025299 Bacteria 7418
356 Ga0207426_1000001 3300025302 Bacteria 1341301
357 Ga0207426_1000021 3300025302 Bacteria 556343
358 Ga0207426_1000090 3300025302 Bacteria 280662
359 Ga0207426_1001543 3300025302 Bacteria 18717
360 Ga0209051_1000009 3300025303 Bacteria 706778
361 Ga0209051_1000092 3300025303 Bacteria 170056
362 Ga0209051_1000490 3300025303 Bacteria 51070
363 Ga0209051_1000944 3300025303 Bacteria 28691
364 Ga0209051_1008125 3300025303 Bacteria 5608
365 Ga0209051_1012375 3300025303 Bacteria 4132
366 Ga0209051_1012472 3300025303 Bacteria 4108
367 Ga0209051_1049257 3300025303 Bacteria 1421
368 Ga0209257_1000011 3300025304 Bacteria 1112630
369 Ga0209257_1000508 3300025304 Bacteria 68156
370 Ga0209257_1028013 3300025304 Bacteria 1862
371 Ga0207656_10158101 3300025321 Bacteria 1077
372 Ga0207696_1000078 3300025711 Bacteria 207623
373 Ga0207696_1001349 3300025711 Bacteria 13489
374 Ga0207696_1004805 3300025711 Bacteria 5737
375 Ga0207696_1011995 3300025711 Bacteria 3089
376 Ga0207655_1000151 3300025728 Bacteria 127538
377 Ga0207713_1000010 3300025735 Bacteria 528374
378 Ga0207713_1000183 3300025735 Bacteria 88841
379 Ga0207713_1001684 3300025735 Bacteria 17099
380 Ga0207713_1003679 3300025735 Bacteria 10315
381 Ga0207713_1016167 3300025735 Bacteria 3797
382 Ga0207647_10007818 3300025904 Bacteria 7697
383 Ga0207647_10012166 3300025904 Bacteria 6002
384 Ga0207647_10026028 3300025904 Bacteria 3833
385 Ga0207645_10212143 3300025907 Bacteria 1275
386 Ga0207695_10000815 3300025913 Bacteria 57965
387 Ga0207695_10002153 3300025913 Bacteria 29827
388 Ga0207695_10002680 3300025913 Bacteria 25988
389 Ga0207695_10022412 3300025913 Bacteria 7169
390 Ga0207695_10373365 3300025913 Bacteria 1312
391 Ga0207671_10020333 3300025914 Bacteria 5055
392 Ga0207671_10058750 3300025914 Bacteria 2851
393 Ga0207657_10000111 3300025919 Bacteria 79991
394 Ga0207657_10273236 3300025919 Bacteria 1343
395 Ga0207649_10002587 3300025920 Bacteria 10054
396 Ga0207649_10168579 3300025920 Bacteria 1523
397 Ga0207694_10000286 3300025924 Bacteria 47592
398 Ga0207690_10000009 3300025932 Bacteria 366044
399 Ga0207690_10000722 3300025932 Bacteria 21290
400 Ga0207706_10010532 3300025933 Bacteria 8448
401 Ga0207706_10322155 3300025933 Bacteria 1345
402 Ga0207686_10013312 3300025934 Bacteria 4549
403 Ga0207686_10212201 3300025934 Bacteria 1392
404 Ga0207709_10000165 3300025935 Bacteria 90586
405 Ga0207709_10000785 3300025935 Bacteria 24867
406 Ga0207709_10001556 3300025935 Bacteria 15728
407 Ga0207679_10000038 3300025945 Bacteria 131935
408 Ga0207667_10003683 3300025949 Bacteria 18899
409 Ga0207667_10059518 3300025949 Bacteria 4000
410 Ga0207640_10000828 3300025981 Bacteria 17606
411 Ga0207640_10005912 3300025981 Bacteria 6680
412 Ga0207640_10028815 3300025981 Bacteria 3400
413 Ga0207639_10004693 3300026041 Bacteria 9197
414 Ga0207678_10000021 3300026067 Bacteria 131877
415 Ga0207678_10000347 3300026067 Bacteria 41971
416 Ga0207678_10138140 3300026067 Bacteria 2079
417 Ga0207702_10000563 3300026078 Bacteria 41238
418 Ga0207674_10026194 3300026116 Bacteria 6202
419 Ga0207698_10002086 3300026142 Bacteria 11787
420 Ga0207698_10002808 3300026142 Bacteria 10409
421 Ga0209281_1000002 3300027111 Bacteria 1924012
422 Ga0209371_1000881 3300027312 Bacteria 24014
423 Ga0209371_1003481 3300027312 Bacteria 7611
424 Ga0209282_1000011 3300027666 Bacteria 217665
425 Ga0207428_10000155 3300027907 Bacteria 93472
426 Ga0207428_10172630 3300027907 Bacteria 1637
427 Ga0268266_10039347 3300028379 Bacteria 4027
428 Ga0268265_10214087 3300028380 Bacteria 1681
429 Ga0307515_10000028 3300028794 Bacteria 368467
430 Ga0307515_10001264 3300028794 Bacteria 57666
431 Ga0268256_1000741 3300030500 Bacteria 24023
432 Ga0268256_1003164 3300030500 Bacteria 7659
433 Ga0307511_10000043 3300030521 Bacteria 101232
434 Ga0265327_10000465 3300031251 Bacteria 72062
435 Ga0307513_10070491 3300031456 Bacteria 3653
436 Ga0307513_10196183 3300031456 Bacteria 1865
437 Ga0307408_100001688 3300031548 Bacteria 16232
438 Ga0307408_100013471 3300031548 Bacteria 5428
439 Ga0307514_10001952 3300031649 Bacteria 22533
440 Ga0307405_10017284 3300031731 Bacteria 3954
441 Ga0307405_10239301 3300031731 Bacteria 1343
442 Ga0307406_10000194 3300031901 Bacteria 36252
443 Ga0307412_10000010 3300031911 Bacteria 421262
444 Ga0307412_10005778 3300031911 Bacteria 6957
445 Ga0307412_10015702 3300031911 Bacteria 4495
446 Ga0307412_10330692 3300031911 Bacteria 1216
447 Ga0307416_100406257 3300032002 Bacteria 1401
448 Ga0307411_10044619 3300032005 Bacteria 2846
449 Ga0395899_0001705 3300037312 Bacteria 18309
450 Ga0395899_0047125 3300037312 Bacteria 3209
451 Ga0395899_0120476 3300037312 Bacteria 1880
452 Ga0395900_0001713 3300037418 Bacteria 25348
453 Ga0395900_0017362 3300037418 Bacteria 7346
454 Ga0395900_0029973 3300037418 Bacteria 5584
455 Ga0395900_0068092 3300037418 Bacteria 3658
456 Ga0395898_0025789 3300037466 Bacteria 5919
457 Ga0395898_0099992 3300037466 Bacteria 2785
458 Ga0395905_0000004 3300037471 Bacteria 674991
459 Ga0395905_0000144 3300037471 Bacteria 117622
460 Ga0395905_0020038 3300037471 Bacteria 6337
461 Ga0395905_0050165 3300037471 Bacteria 3911
462 Ga0395905_0116042 3300037471 Bacteria 2516
463 Ga0395905_0122125 3300037471 Bacteria 2449
464 Ga0395905_0182200 3300037471 Bacteria 1972
465 Ga0395905_0288913 3300037471 Bacteria 1526
466 Ga0395901_0004147 3300038443 Bacteria 14621
467 Ga0436361_0126106 3300039447 Bacteria 1611
468 Ga0436361_0139980 3300039447 Bacteria 21951
469 Ga0436361_0408019 3300039447 Bacteria 3912
470 Ga0436361_0480402 3300039447 Bacteria 7653
471 Ga0436361_0602324 3300039447 Bacteria 38715
472 Ga0436361_0767394 3300039447 Bacteria 56110
473 Ga0436361_0995447 3300039447 Bacteria 133902
474 Ga0436361_1187046 3300039447 Bacteria 1772
475 Ga0439436_0002482 3300041404 Bacteria 5549
476 Ga0439438_001193 3300041405 Bacteria 11537
477 Ga0439438_001381 3300041405 Bacteria 10707
478 Ga0439438_011801 3300041405 Bacteria 2704
479 Ga0439447_000064 3300041407 Bacteria 37780
480 Ga0439447_001131 3300041407 Bacteria 9710
481 Ga0439466_0000097 3300041411 Bacteria 33898
482 Ga0439466_0000247 3300041411 Bacteria 21354
483 Ga0439466_0002262 3300041411 Bacteria 7550
484 Ga0439466_0051904 3300041411 Bacteria 1342
485 Ga0439442_006629 3300042002 Bacteria 2325
486 Ga0439448_0031397 3300042005 Bacteria 1687
487 Ga0439432_004127 3300042006 Bacteria 5308
488 Ga0439432_006936 3300042006 Bacteria 4030
489 Ga0439451_000625 3300042009 Bacteria 6707
490 Ga0439451_001656 3300042009 Bacteria 4424
491 Ga0439452_002519 3300042010 Bacteria 6738
492 Ga0439452_006105 3300042010 Bacteria 3803
493 Ga0450923_001538 3300042125 Bacteria 3095
494 Ga0450923_005158 3300042125 Bacteria 2094
495 Ga0450900_001585 3300042136 Bacteria 2253
496 Ga0450902_000888 3300042137 Bacteria 3895
497 Ga0450903_005681 3300042138 Bacteria 2084
498 Ga0450905_000029 3300042142 Bacteria 11982
499 Ga0450907_000003 3300042146 Bacteria 138102
500 Ga0439446_0000206 3300042156 Bacteria 10742
501 Ga0439446_0002193 3300042156 Bacteria 4652
502 Ga0450908_003708 3300042184 Bacteria 2963
503 Ga0450909_000288 3300042185 Bacteria 6175
504 Ga0439434_0000017 3300042435 Bacteria 43012
505 Ga0439434_0001685 3300042435 Bacteria 6404
506 Ga0439434_0001880 3300042435 Bacteria 6104
507 Ga0439464_0011618 3300042439 Bacteria 2335
508 Ga0450901_000115 3300042533 Bacteria 8737
509 Ga0439440_0000015 3300042993 Bacteria 19886
510 Ga0466986_0154337 3300044650 Bacteria 1547
511 Ga0466972_0003068 3300044658 Bacteria 8282
512 Ga0466972_0013678 3300044658 Bacteria 4071
513 Ga0466978_0000544 3300044671 Bacteria 11685
514 Ga0466961_0000294 3300044693 Bacteria 33138
515 Ga0466964_0009193 3300044706 Bacteria 3717
516 Ga0466970_0000253 3300044765 Bacteria 26234
517 Ga0466970_0001601 3300044765 Bacteria 10920
518 Ga0466957_0055752 3300044842 Bacteria 2415
519 Ga0466957_0181467 3300044842 Bacteria 1375
520 Ga0466959_0001112 3300045049 Bacteria 16164
521 Ga0466959_0026452 3300045049 Bacteria 4300
522 Ga0466958_0002829 3300045836 Bacteria 8832
523 Ga0466958_0005703 3300045836 Bacteria 6724
524 Ga0466967_0019948 3300045976 Bacteria 5404
525 Ga0495617_000214 3300046452 Bacteria 35487
526 Ga0495617_000472 3300046452 Bacteria 21463
527 Ga0495617_003864 3300046452 Bacteria 5521
528 Ga0495617_006162 3300046452 Bacteria 4219
529 Ga0495627_007772 3300046453 Bacteria 4085
530 Ga0495627_008647 3300046453 Bacteria 3799
531 Ga0495627_031813 3300046453 Bacteria 1663
532 Ga0495592_0024207 3300046454 Bacteria 4616
533 Ga0495592_0082130 3300046454 Bacteria 2329
534 Ga0495592_0137472 3300046454 Bacteria 1703
535 Ga0495603_0024902 3300046455 Bacteria 3619
536 Ga0495590_0008326 3300046457 Bacteria 3961
537 Ga0495591_000266 3300046458 Bacteria 49608
538 Ga0495591_000724 3300046458 Bacteria 23934
539 Ga0495591_012626 3300046458 Bacteria 3134
540 Ga0495629_0000021 3300046459 Bacteria 153700
541 Ga0495629_0000554 3300046459 Bacteria 30535
542 Ga0495629_0010016 3300046459 Bacteria 6918
543 Ga0495629_0012539 3300046459 Bacteria 6138
544 Ga0495629_0150970 3300046459 Bacteria 1614
545 Ga0495638_0000921 3300046460 Bacteria 29967
546 Ga0495638_0002886 3300046460 Bacteria 13734
547 Ga0495638_0038991 3300046460 Bacteria 3018
548 Ga0495638_0055017 3300046460 Bacteria 2472
549 Ga0495638_0059035 3300046460 Bacteria 2376
550 Ga0495638_0191955 3300046460 Bacteria 1158
551 Ga0495641_0033656 3300046461 Bacteria 2430
552 Ga0495651_0008247 3300046462 Bacteria 7984
553 Ga0495653_0003419 3300046463 Bacteria 12764
554 Ga0495653_0005597 3300046463 Bacteria 10246
555 Ga0495653_0056210 3300046463 Bacteria 3000
556 Ga0495653_0064185 3300046463 Bacteria 2767
557 Ga0495650_0000512 3300046471 Bacteria 57758
558 Ga0495650_0002591 3300046471 Bacteria 14223
559 Ga0495650_0019956 3300046471 Bacteria 3281
560 Ga0495580_0000565 3300046472 Bacteria 31266
561 Ga0495580_0000732 3300046472 Bacteria 28141
562 Ga0495580_0001414 3300046472 Bacteria 21085
563 Ga0495580_0004872 3300046472 Bacteria 11224
564 Ga0495580_0005358 3300046472 Bacteria 10627
565 Ga0495580_0112619 3300046472 Bacteria 1889
566 Ga0495582_0003844 3300046473 Bacteria 8452
567 Ga0495582_0007274 3300046473 Bacteria 6138
568 Ga0495582_0014248 3300046473 Bacteria 4374
569 Ga0495605_0009040 3300046474 Bacteria 5608
570 Ga0495605_0010080 3300046474 Bacteria 5293
571 Ga0495605_0012986 3300046474 Bacteria 4606
572 Ga0495605_0034160 3300046474 Bacteria 2576
573 Ga0495605_0036290 3300046474 Bacteria 2486
574 Ga0495605_0049758 3300046474 Bacteria 2046
575 Ga0495639_0001078 3300046475 Bacteria 12284
576 Ga0495639_0002606 3300046475 Bacteria 7848
577 Ga0495639_0175945 3300046475 Bacteria 1040
578 Ga0495662_0041606 3300046476 Bacteria 2218
579 Ga0495585_0000012 3300046492 Bacteria 203064
580 Ga0495585_0000117 3300046492 Bacteria 85886
581 Ga0495585_0001095 3300046492 Bacteria 22336
582 Ga0495585_0003185 3300046492 Bacteria 11232
583 Ga0495585_0004031 3300046492 Bacteria 9672
584 Ga0495596_0000009 3300046500 Bacteria 145647
585 Ga0495596_0000568 3300046500 Bacteria 23065
586 Ga0495596_0037845 3300046500 Bacteria 1907
587 Ga0495596_0083454 3300046500 Bacteria 1240
588 Ga0495607_0000249 3300046501 Bacteria 57898
589 Ga0495607_0004209 3300046501 Bacteria 10678
590 Ga0495607_0018159 3300046501 Bacteria 4490
591 Ga0495607_0060258 3300046501 Bacteria 2161
592 Ga0495607_0116649 3300046501 Bacteria 1408
593 Ga0495583_0015540 3300046506 Bacteria 4135
594 Ga0495583_0027261 3300046506 Bacteria 2821
595 Ga0495606_0000558 3300046507 Bacteria 59480
596 Ga0495606_0014068 3300046507 Bacteria 6268
597 Ga0495606_0017701 3300046507 Bacteria 5376
598 Ga0495606_0018259 3300046507 Bacteria 5267
599 Ga0495606_0075837 3300046507 Bacteria 2103
600 Ga0495610_0001269 3300046512 Bacteria 22626
601 Ga0495610_0004430 3300046512 Bacteria 10385
602 Ga0495610_0017323 3300046512 Bacteria 4111
603 Ga0495616_0001057 3300046513 Bacteria 19695
604 Ga0495616_0004925 3300046513 Bacteria 8343
605 Ga0495616_0012978 3300046513 Bacteria 4711
606 Ga0495616_0018672 3300046513 Bacteria 3800
607 Ga0495616_0033376 3300046513 Bacteria 2682
608 Ga0495620_0009726 3300046515 Bacteria 5103
609 Ga0495620_0016364 3300046515 Bacteria 3723
610 Ga0495620_0050109 3300046515 Bacteria 1783
611 Ga0495628_0014834 3300046516 Bacteria 6518
612 Ga0495628_0022233 3300046516 Bacteria 5211
613 Ga0495628_0099205 3300046516 Bacteria 2249
614 Ga0495628_0153621 3300046516 Bacteria 1752
615 Ga0495628_0187084 3300046516 Bacteria 1564
616 Ga0495630_0018097 3300046517 Bacteria 5171
617 Ga0495630_0046708 3300046517 Bacteria 3237
618 Ga0495631_0001503 3300046518 Bacteria 14054
619 Ga0495631_0004180 3300046518 Bacteria 7726
620 Ga0495632_0001429 3300046519 Bacteria 19891
621 Ga0495632_0002562 3300046519 Bacteria 13767
622 Ga0495632_0003293 3300046519 Bacteria 11535
623 Ga0495632_0011118 3300046519 Bacteria 5271
624 Ga0495632_0020699 3300046519 Bacteria 3556
625 Ga0495632_0033227 3300046519 Bacteria 2650
626 Ga0495637_0000440 3300046520 Bacteria 30318
627 Ga0495637_0004804 3300046520 Bacteria 6969
628 Ga0495637_0029286 3300046520 Bacteria 2452
629 Ga0495637_0040028 3300046520 Bacteria 2019
630 Ga0495643_0000251 3300046522 Bacteria 78874
631 Ga0495643_0002035 3300046522 Bacteria 16807
632 Ga0495643_0002080 3300046522 Bacteria 16559
633 Ga0495643_0006649 3300046522 Bacteria 7580
634 Ga0495644_0000615 3300046523 Bacteria 14953
635 Ga0495648_0002417 3300046524 Bacteria 17307
636 Ga0495648_0024092 3300046524 Bacteria 4154
637 Ga0495648_0032451 3300046524 Bacteria 3425
638 Ga0495648_0042825 3300046524 Bacteria 2845
639 Ga0495648_0081764 3300046524 Bacteria 1836
640 Ga0495648_0084970 3300046524 Bacteria 1789
641 Ga0495663_0000973 3300046525 Bacteria 9505
642 Ga0495666_0000639 3300046526 Bacteria 15783
643 Ga0495666_0013027 3300046526 Bacteria 4143
644 Ga0495666_0106302 3300046526 Bacteria 1320
645 Ga0495642_0003764 3300046528 Bacteria 5937
646 Ga0495642_0022832 3300046528 Bacteria 2467
647 Ga0495642_0043021 3300046528 Bacteria 1842
648 Ga0495642_0075809 3300046528 Bacteria 1411
649 Ga0495652_0041516 3300046529 Bacteria 3970
650 Ga0495654_0000307 3300046530 Bacteria 43179
651 Ga0495654_0002236 3300046530 Bacteria 12533
652 Ga0495654_0022057 3300046530 Bacteria 3311
653 Ga0495654_0031657 3300046530 Bacteria 2685
654 Ga0495665_0000723 3300046531 Bacteria 17061
655 Ga0495665_0068272 3300046531 Bacteria 1874
656 Ga0495640_0006926 3300046533 Bacteria 8927
657 Ga0495586_0010597 3300046535 Bacteria 4905
658 Ga0495586_0053592 3300046535 Bacteria 2185
659 Ga0495586_0056716 3300046535 Bacteria 2125
660 Ga0495587_0014936 3300046536 Bacteria 4858
661 Ga0495587_0019203 3300046536 Bacteria 4234
662 Ga0495587_0133415 3300046536 Bacteria 1419
663 Ga0495609_0000858 3300046538 Bacteria 22418
664 Ga0495609_0001256 3300046538 Bacteria 17410
665 Ga0495609_0003849 3300046538 Bacteria 8440
666 Ga0495597_0003895 3300046542 Bacteria 8432
667 Ga0495597_0006880 3300046542 Bacteria 5837
668 Ga0495597_0013121 3300046542 Bacteria 3977
669 Ga0495597_0016339 3300046542 Bacteria 3504
670 Ga0495597_0036669 3300046542 Bacteria 2206
671 Ga0495597_0063449 3300046542 Bacteria 1605
672 Ga0495645_0001771 3300046543 Bacteria 14694
673 Ga0495645_0034507 3300046543 Bacteria 3690
674 Ga0495645_0039935 3300046543 Bacteria 3422
675 Ga0495645_0174374 3300046543 Bacteria 1478
676 Ga0495622_0000238 3300046557 Bacteria 42866
677 Ga0495633_0051969 3300046558 Bacteria 1930
678 Ga0495656_0000109 3300046615 Bacteria 32861
679 Ga0495656_0095969 3300046615 Bacteria 1364
680 Ga0495668_0000008 3300046616 Bacteria 498364
681 Ga0495668_0000902 3300046616 Bacteria 33419
682 Ga0495668_0034135 3300046616 Bacteria 2856
683 Ga0495634_0029460 3300046642 Bacteria 3800
684 Ga0495634_0269812 3300046642 Bacteria 1036
685 Ga0495611_0001493 3300046648 Bacteria 11605
686 Ga0495611_0092048 3300046648 Bacteria 1402
687 Ga0495625_0001896 3300046660 Bacteria 23650
688 Ga0495625_0003794 3300046660 Bacteria 14641
689 Ga0495625_0019244 3300046660 Bacteria 5302
690 Ga0495625_0051609 3300046660 Bacteria 2948
691 Ga0495625_0116613 3300046660 Bacteria 1821
692 Ga0495635_0013024 3300046663 Bacteria 5822
693 Ga0495635_0093640 3300046663 Bacteria 2054
694 Ga0495659_0000007 3300046664 Bacteria 105393
695 Ga0495659_0000941 3300046664 Bacteria 10329
696 Ga0495659_0019399 3300046664 Bacteria 2275
697 Ga0495661_0000030 3300046665 Bacteria 171980
698 Ga0495661_0001352 3300046665 Bacteria 20780
699 Ga0495661_0011961 3300046665 Bacteria 5872
700 Ga0495661_0024388 3300046665 Bacteria 3915
701 Ga0495661_0038889 3300046665 Bacteria 2959
702 Ga0495661_0052610 3300046665 Bacteria 2452
703 Ga0495661_0071655 3300046665 Bacteria 2024
704 Ga0495599_0007701 3300046678 Bacteria 6538
705 Ga0495599_0101772 3300046678 Bacteria 1790
706 Ga0495623_0006606 3300046679 Bacteria 7549
707 Ga0495623_0013171 3300046679 Bacteria 5361
708 Ga0495623_0034783 3300046679 Bacteria 3230
709 Ga0495623_0039349 3300046679 Bacteria 3022
710 Ga0495646_0069646 3300046680 Bacteria 2075
711 Ga0495646_0073169 3300046680 Bacteria 2014
712 Ga0495669_0004287 3300046684 Bacteria 5884
713 Ga0495669_0014788 3300046684 Bacteria 3338
714 Ga0495624_0003593 3300046690 Bacteria 11482
715 Ga0495624_0007720 3300046690 Bacteria 7548
716 Ga0495624_0013199 3300046690 Bacteria 5633
717 Ga0495624_0135493 3300046690 Bacteria 1509
718 Ga0495624_0144385 3300046690 Bacteria 1457
719 Ga0495670_0000214 3300046691 Bacteria 26486
720 Ga0495670_0001274 3300046691 Bacteria 12308
721 Ga0495671_0000089 3300046692 Bacteria 85775
722 Ga0495671_0005874 3300046692 Bacteria 7142
723 Ga0495671_0009497 3300046692 Bacteria 5432
724 Ga0495671_0027207 3300046692 Bacteria 2954
725 Ga0495671_0028276 3300046692 Bacteria 2891
726 Ga0495671_0086621 3300046692 Bacteria 1534
727 Ga0495649_0003519 3300046694 Bacteria 10540
728 Ga0495649_0005066 3300046694 Bacteria 8460
729 Ga0495649_0057032 3300046694 Bacteria 2107
730 Ga0495649_0103240 3300046694 Bacteria 1514
731 Ga0495589_0000826 3300046794 Bacteria 19467
732 Ga0495589_0002148 3300046794 Bacteria 11119
733 Ga0495589_0041417 3300046794 Bacteria 2298
734 Ga0495589_0041494 3300046794 Bacteria 2296
735 Ga0495589_0062596 3300046794 Bacteria 1825
736 Ga0495600_0000462 3300046809 Bacteria 21090
737 Ga0495600_0024520 3300046809 Bacteria 3883
738 Ga0495660_0000569 3300046810 Bacteria 29833
739 Ga0495660_0001245 3300046810 Bacteria 17731
740 Ga0495660_0003105 3300046810 Bacteria 10357
741 Ga0495660_0005454 3300046810 Bacteria 7616
742 Ga0495660_0011164 3300046810 Bacteria 5215
743 Ga0495660_0046606 3300046810 Bacteria 2376
744 Ga0495660_0060969 3300046810 Bacteria 2025
745 Ga0495581_0027898 3300047315 Bacteria 3274
746 Ga0495581_0041159 3300047315 Bacteria 2673
747 Ga0495604_0003957 3300047317 Bacteria 11794
748 Ga0495604_0004100 3300047317 Bacteria 11577
749 Ga0495604_0005896 3300047317 Bacteria 9717
750 Ga0495604_0055967 3300047317 Bacteria 3038
751 Ga0495604_0178005 3300047317 Bacteria 1489
752 Ga0495636_0002953 3300047318 Bacteria 6575
753 Ga0495636_0003251 3300047318 Bacteria 6301
754 Ga0495636_0044296 3300047318 Bacteria 1852
755 Ga0495674_0006200 3300047319 Bacteria 11470
756 Ga0495674_0017563 3300047319 Bacteria 6659
757 Ga0495674_0030020 3300047319 Bacteria 4945
758 Ga0495674_0038994 3300047319 Bacteria 4259
759 Ga0495674_0128402 3300047319 Bacteria 2137
760 Ga0495674_0164297 3300047319 Bacteria 1856
761 Ga0495672_0002162 3300047320 Bacteria 18339
762 Ga0495672_0003927 3300047320 Bacteria 12475
763 Ga0495672_0009741 3300047320 Bacteria 6925
764 Ga0495672_0012390 3300047320 Bacteria 5952
765 Ga0495672_0067204 3300047320 Bacteria 2042
766 Ga0495676_0018478 3300047321 Bacteria 6147
767 Ga0495680_0007784 3300047322 Bacteria 9782
768 Ga0495680_0019784 3300047322 Bacteria 5677
769 Ga0495680_0030881 3300047322 Bacteria 4366
770 Ga0495680_0290324 3300047322 Bacteria 1150
771 Ga0495683_0003072 3300047323 Bacteria 9789
772 Ga0495683_0005277 3300047323 Bacteria 7181
773 Ga0495683_0020913 3300047323 Bacteria 3373
774 Ga0495683_0061698 3300047323 Bacteria 1856
775 Ga0495683_0106197 3300047323 Bacteria 1345
776 Ga0495683_0111084 3300047323 Bacteria 1308
777 Ga0495687_006900 3300047443 Bacteria 6839
778 Ga0495687_013806 3300047443 Bacteria 4191
779 Ga0495687_077393 3300047443 Bacteria 1313
780 Ga0495675_0001279 3300047444 Bacteria 15255
781 Ga0495675_0013098 3300047444 Bacteria 5231
782 Ga0495675_0092370 3300047444 Bacteria 1899
783 Ga0495677_0004045 3300047445 Bacteria 5659
784 Ga0495679_000012 3300047446 Bacteria 319098
785 Ga0495679_004564 3300047446 Bacteria 6331
786 Ga0495685_043549 3300047447 Bacteria 1531
787 Ga0495673_0025949 3300047469 Bacteria 2808
788 Ga0495673_0029077 3300047469 Bacteria 2611
789 Ga0495681_0000276 3300047470 Bacteria 40998
790 Ga0495681_0001131 3300047470 Bacteria 20285
791 Ga0495681_0017993 3300047470 Bacteria 3908
792 Ga0495681_0123772 3300047470 Bacteria 1107
793 Ga0495684_0017774 3300047471 Bacteria 5478
794 Ga0495684_0138485 3300047471 Bacteria 1826
795 Ga0495686_0001473 3300047472 Bacteria 25606
796 Ga0495686_0001851 3300047472 Bacteria 21219
797 Ga0495686_0007666 3300047472 Bacteria 8057
798 Ga0495686_0168969 3300047472 Bacteria 1273
799 Ga0495593_0006403 3300047673 Bacteria 6905
800 Ga0495593_0010286 3300047673 Bacteria 5409
801 Ga0495593_0089126 3300047673 Bacteria 1590
802 Ga0495602_0001170 3300048088 Bacteria 25716
803 Ga0495602_0064341 3300048088 Bacteria 3171
804 Ga0495602_0066296 3300048088 Bacteria 3111
805 Ga0495602_0119226 3300048088 Bacteria 2126
806 Ga0495614_0002491 3300048089 Bacteria 8187
807 Ga0495614_0031760 3300048089 Bacteria 2273
808 Ga0495626_0001097 3300048091 Bacteria 22922
809 Ga0495626_0002678 3300048091 Bacteria 12044
810 Ga0495626_0050938 3300048091 Bacteria 1911
811 Ga0495626_0057688 3300048091 Bacteria 1776
812 Ga0495626_0064970 3300048091 Bacteria 1652
813 Ga0495626_0104856 3300048091 Bacteria 1229
814 Ga0496100_0000462 3300048903 Bacteria 19479
815 Ga0496100_0013731 3300048903 Bacteria 4683
816 Ga0496100_0014235 3300048903 Bacteria 4613
817 Ga0496100_0081929 3300048903 Bacteria 2181
818 Ga0496101_0003095 3300048904 Bacteria 10287
819 Ga0496101_0004822 3300048904 Bacteria 8557
820 Ga0496101_0027306 3300048904 Bacteria 3975
821 Ga0496101_0150744 3300048904 Bacteria 1778
822 Ga0496102_0000128 3300048905 Bacteria 104717
823 Ga0496102_0013844 3300048905 Bacteria 7000
824 Ga0496102_0064098 3300048905 Bacteria 3366
825 Ga0496102_0228923 3300048905 Bacteria 1753
826 Ga0496103_0000852 3300048906 Bacteria 22313
827 Ga0496103_0012811 3300048906 Bacteria 4973
828 Ga0496103_0137921 3300048906 Bacteria 1559
829 Ga0496104_0020210 3300048907 Bacteria 6101
830 Ga0496104_0060133 3300048907 Bacteria 3599
831 Ga0496104_0071708 3300048907 Bacteria 3293
832 Ga0496104_0403881 3300048907 Bacteria 1278
833 Ga0496105_0001248 3300048908 Bacteria 17765
834 Ga0496105_0211561 3300048908 Bacteria 1580
835 Ga0496106_0101960 3300048909 Bacteria 2226
836 Ga0496106_0291016 3300048909 Bacteria 1309
837 Ga0496109_0007956 3300048912 Bacteria 8987
838 Ga0496110_0005888 3300048913 Bacteria 9650
839 Ga0496110_0078584 3300048913 Bacteria 2937
840 Ga0496111_0009596 3300048914 Bacteria 6466
841 Ga0496112_0098100 3300048915 Bacteria 2900
842 Ga0496113_0006760 3300048916 Bacteria 7312
843 Ga0496113_0022475 3300048916 Bacteria 4462
844 Ga0496114_0001558 3300048917 Bacteria 17402
845 Ga0496114_0032838 3300048917 Bacteria 4274
846 Ga0496115_0033629 3300048918 Bacteria 4049
847 Ga0496115_0170141 3300048918 Bacteria 1802
848 Ga0496116_0004910 3300048919 Bacteria 12599
849 Ga0496116_0005292 3300048919 Bacteria 12038
850 Ga0496116_0014246 3300048919 Bacteria 6360
851 Ga0496116_0017297 3300048919 Bacteria 5604
852 Ga0496116_0030472 3300048919 Bacteria 3874
853 Ga0496117_0000906 3300048920 Bacteria 45515
854 Ga0496117_0002055 3300048920 Bacteria 26638
855 Ga0496117_0013486 3300048920 Bacteria 7126
856 Ga0496117_0034715 3300048920 Bacteria 3796
857 Ga0496117_0035438 3300048920 Bacteria 3745
858 Ga0496117_0038822 3300048920 Bacteria 3523
859 Ga0496117_0122792 3300048920 Bacteria 1592
860 Ga0496117_0136858 3300048920 Bacteria 1474
861 Ga0496118_0000079 3300048921 Bacteria 190113
862 Ga0496118_0001611 3300048921 Bacteria 33377
863 Ga0496118_0003533 3300048921 Bacteria 19575
864 Ga0496118_0007757 3300048921 Bacteria 11268
865 Ga0496118_0013681 3300048921 Bacteria 7656
866 Ga0496118_0028522 3300048921 Bacteria 4698
867 Ga0496118_0040904 3300048921 Bacteria 3677
868 Ga0496121_0000860 3300048924 Bacteria 54968
869 Ga0496121_0065118 3300048924 Bacteria 2967
870 Ga0496121_0075406 3300048924 Bacteria 2694
871 Ga0496121_0076790 3300048924 Bacteria 2662
872 Ga0496121_0137546 3300048924 Bacteria 1817
873 Ga0496121_0144237 3300048924 Bacteria 1762
874 Ga0496121_0242551 3300048924 Bacteria 1255
875 Ga0496122_0000210 3300048925 Bacteria 130178
876 Ga0496122_0000471 3300048925 Bacteria 83983
877 Ga0496122_0009575 3300048925 Bacteria 10165
878 Ga0496122_0011814 3300048925 Bacteria 8781
879 Ga0496122_0059552 3300048925 Bacteria 2818
880 Ga0496123_0000259 3300048926 Bacteria 107355
881 Ga0496123_0000597 3300048926 Bacteria 61302
882 Ga0496123_0002298 3300048926 Bacteria 23994
883 Ga0496123_0005120 3300048926 Bacteria 13379
884 Ga0496123_0058317 3300048926 Bacteria 2505
885 Ga0496123_0121576 3300048926 Bacteria 1467
886 Ga0496124_0002813 3300048927 Bacteria 22039
887 Ga0496124_0027032 3300048927 Bacteria 5161
888 Ga0496124_0053851 3300048927 Bacteria 3408
889 Ga0496125_0004747 3300048928 Bacteria 15487
890 Ga0496125_0005386 3300048928 Bacteria 14267
891 Ga0496125_0009624 3300048928 Bacteria 9883
892 Ga0496125_0023627 3300048928 Bacteria 5669
893 Ga0496125_0051692 3300048928 Bacteria 3386
894 Ga0496125_0089521 3300048928 Bacteria 2314
895 Ga0496125_0107296 3300048928 Bacteria 2035
896 Ga0496125_0227140 3300048928 Bacteria 1197
897 Ga0496126_0004892 3300048929 Bacteria 15657
898 Ga0496126_0009877 3300048929 Bacteria 10094
899 Ga0496126_0035961 3300048929 Bacteria 4636
900 Ga0495678_002068 3300049459 Bacteria 14314
901 Ga0495678_008401 3300049459 Bacteria 5209
902 Ga0495678_015277 3300049459 Bacteria 3539
903 Ga0495678_030693 3300049459 Bacteria 2247
904 Ga0495678_037545 3300049459 Bacteria 1967
905 Ga0495682_0000807 3300049460 Bacteria 19797
906 Ga0495682_0046268 3300049460 Bacteria 1588
907 Ga0495682_0066329 3300049460 Bacteria 1301
908 Ga0501032_0020271 3300049569 Bacteria 4634
909 Ga0501033_0076248 3300049570 Bacteria 2461
910 Ga0501034_0000423 3300049571 Bacteria 70979
911 Ga0501034_0081791 3300049571 Bacteria 3232
912 Ga0501034_0161318 3300049571 Bacteria 2213
913 Ga0501036_0006485 3300049572 Bacteria 9508
914 Ga0501036_0027619 3300049572 Bacteria 4796
915 Ga0501038_0056649 3300049574 Bacteria 3366
916 Ga0501038_0128011 3300049574 Bacteria 2088
917 Ga0501039_0012210 3300049575 Bacteria 6548
918 Ga0501039_0068568 3300049575 Bacteria 2754
919 Ga0501039_0083774 3300049575 Bacteria 2483
920 Ga0501040_0015261 3300049576 Bacteria 5077
921 Ga0501040_0129820 3300049576 Bacteria 1771
922 Ga0501041_0002116 3300049577 Bacteria 11184
923 Ga0501041_0003405 3300049577 Bacteria 9149
924 Ga0501042_0007432 3300049578 Bacteria 7176
925 Ga0501042_0100632 3300049578 Bacteria 2078
926 Ga0501046_0111521 3300049580 Bacteria 2089
927 Ga0501048_0009612 3300049582 Bacteria 7256
928 Ga0501048_0031814 3300049582 Bacteria 3815
929 Ga0501048_0086719 3300049582 Bacteria 2208
930 Ga0501068_0066163 3300049584 Bacteria 2201
931 Ga0501071_0009587 3300049587 Bacteria 6457
932 Ga0501071_0123454 3300049587 Bacteria 1920
933 Ga0501072_0095127 3300049588 Bacteria 2367
934 Ga0501072_0196745 3300049588 Bacteria 1607
935 Ga0501073_0023232 3300049589 Bacteria 4455
936 Ga0501074_0200991 3300049590 Bacteria 1420
937 Ga0501075_0010567 3300049591 Bacteria 6490
938 Ga0501075_0015288 3300049591 Bacteria 5505
939 Ga0501075_0057474 3300049591 Bacteria 2929
940 Ga0501076_0000806 3300049592 Bacteria 20323
941 Ga0501076_0023925 3300049592 Bacteria 4713
942 Ga0501077_0008625 3300049593 Bacteria 6318
943 Ga0501077_0019096 3300049593 Bacteria 4334
944 Ga0501077_0022884 3300049593 Bacteria 3961
945 Ga0501079_0000547 3300049741 Bacteria 24534
946 Ga0501080_0037516 3300049742 Bacteria 4527
947 Ga0501080_0121672 3300049742 Bacteria 2418
948 Ga0501081_0006816 3300049743 Bacteria 7428
949 Ga0501081_0039599 3300049743 Bacteria 3226
950 Ga0501083_0024658 3300049744 Bacteria 4166
951 Ga0501035_0293478 3300049822 Bacteria 1372
952 Ga0501045_0000985 3300049824 Bacteria 18653
953 Ga0501045_0019076 3300049824 Bacteria 4884
954 nmdc:mga03n38_24048_c1 3300050490 Bacteria 2487
955 nmdc:mga00v17_26680_c1 3300050491 Bacteria 3369
956 nmdc:mga0k408_12438_c1 3300050493 Bacteria 4653
957 nmdc:mga0k408_44348_c1 3300050493 Bacteria 2564
958 nmdc:mga06z11_126713_c1 3300050494 Bacteria 1430
959 nmdc:mga07m45_6982_c1 3300050496 Bacteria 5743
960 nmdc:mga08x19_23578_c1 3300050514 Bacteria 3818
961 nmdc:mga08x19_24566_c1 3300050514 Bacteria 3747
962 nmdc:mga0sz30_69721_c1 3300050516 Bacteria 1512
963 Ga0500610_0001394 3300053079 Bacteria 8204
964 Ga0500610_0005581 3300053079 Bacteria 5175
965 Ga0500610_0117281 3300053079 Bacteria 1364
966 Ga0500646_0004197 3300053090 Bacteria 3656
967 Ga0500583_0001751 3300053092 Bacteria 6352
968 Ga0500651_0000038 3300053093 Bacteria 101707
969 Ga0500571_000054 3300053110 Bacteria 35459
970 Ga0500593_041892 3300053117 Bacteria 2045
971 Ga0500607_013519 3300053121 Bacteria 4764
972 Ga0500608_003408 3300053122 Bacteria 5954
973 Ga0500618_012922 3300053125 Bacteria 2173
974 Ga0500618_026456 3300053125 Bacteria 1386
975 Ga0500655_000123 3300053133 Bacteria 19862
976 Ga0500655_003723 3300053133 Bacteria 2749
977 Ga0500658_0000237 3300053134 Bacteria 25766
978 Ga0500658_0000266 3300053134 Bacteria 23921
979 Ga0500559_0008198 3300053136 Bacteria 4594
980 Ga0500559_0013561 3300053136 Bacteria 3450
981 Ga0500561_0011937 3300053137 Bacteria 1840
982 Ga0500568_0005096 3300053139 Bacteria 6870
983 Ga0500586_078820 3300053145 Bacteria 1155
984 Ga0500604_0009274 3300053151 Bacteria 2621
985 Ga0500634_0015722 3300053161 Bacteria 4025
986 Ga0501084_0013310 3300054114 Bacteria 6807
987 Ga0501084_0053300 3300054114 Bacteria 3383
988 Ga0501084_0345257 3300054114 Bacteria 1257
989 Ga0501082_0012874 3300060353 Bacteria 7190
990 Ga0501082_0154828 3300060353 Bacteria 1991
991 Ga0466962_0017363 3300061719 Bacteria 3465
992 Ga0530510_0001909 3300061734 Bacteria 14255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0269812 Ga0495634_0269812_11_826 267
2 3300046473 Ga0495582_0014248 Ga0495582_0014248_3527_4342 269
3 3300046660 Ga0495625_0051609 Ga0495625_0051609_2112_2936 272
4 3300037312 Ga0395899_0047125 Ga0395899_0047125_1486_2364 292
5 3300037466 Ga0395898_0099992 Ga0395898_0099992_1092_1970 292
6 3300042005 Ga0439448_0031397 Ga0439448_0031397_720_1598 292
7 3300046471 Ga0495650_0019956 Ga0495650_0019956_24_920 292
8 3300047469 Ga0495673_0029077 Ga0495673_0029077_1698_2579 292
9 3300006042 Ga0075368_10054113 Ga0075368_100541132 293
10 3300048928 Ga0496125_0227140 Ga0496125_0227140_174_1091 293
11 3300013105 Ga0157369_10299406 Ga0157369_102994062 294
12 3300025913 Ga0207695_10373365 Ga0207695_103733651 294
13 3300025981 Ga0207640_10028815 Ga0207640_100288152 294
14 3300045836 Ga0466958_0002829 Ga0466958_0002829_7911_8813 294
15 3300046794 Ga0495589_0062596 Ga0495589_0062596_819_1712 295
16 3300006038 Ga0075365_10092622 Ga0075365_100926222 304
17 3300006042 Ga0075368_10003356 Ga0075368_100033563 304
18 3300006048 Ga0075363_100050814 Ga0075363_1000508142 304
19 3300006177 Ga0075362_10032174 Ga0075362_100321742 304
20 3300006178 Ga0075367_10129328 Ga0075367_101293281 304
21 3300006186 Ga0075369_10014050 Ga0075369_100140502 304
22 3300006186 Ga0075369_10038864 Ga0075369_100388642 304
23 3300006195 Ga0075366_10052980 Ga0075366_100529802 304
24 3300030521 Ga0307511_10000043 Ga0307511_1000004351 304
25 3300050490 nmdc:mga03n38_24048_c1 nmdc:mga03n38_24048_c1_538_1461 304
26 3300050491 nmdc:mga00v17_26680_c1 nmdc:mga00v17_26680_c1_2326_3249 304
27 3300050493 nmdc:mga0k408_12438_c1 nmdc:mga0k408_12438_c1_2973_3896 304
28 3300050494 nmdc:mga06z11_126713_c1 nmdc:mga06z11_126713_c1_279_1202 304
29 3300050516 nmdc:mga0sz30_69721_c1 nmdc:mga0sz30_69721_c1_304_1239 304
30 3300053090 Ga0500646_0004197 Ga0500646_0004197_1487_2410 304
31 3300053092 Ga0500583_0001751 Ga0500583_0001751_2400_3323 304
32 3300053133 Ga0500655_003723 Ga0500655_003723_1227_2150 304
33 3300053151 Ga0500604_0009274 Ga0500604_0009274_1625_2548 304
34 3300006914 Ga0075436_100011170 Ga0075436_1000111703 306
35 3300049570 Ga0501033_0076248 Ga0501033_0076248_535_1464 306
36 3300049572 Ga0501036_0006485 Ga0501036_0006485_1050_1979 306
37 3300049572 Ga0501036_0027619 Ga0501036_0027619_1236_2165 306
38 3300049574 Ga0501038_0056649 Ga0501038_0056649_962_1891 306
39 3300049574 Ga0501038_0128011 Ga0501038_0128011_898_1827 306
40 3300049575 Ga0501039_0012210 Ga0501039_0012210_5018_5947 306
41 3300049575 Ga0501039_0068568 Ga0501039_0068568_1158_2087 306
42 3300049575 Ga0501039_0083774 Ga0501039_0083774_421_1350 306
43 3300049576 Ga0501040_0015261 Ga0501040_0015261_2753_3682 306
44 3300049577 Ga0501041_0002116 Ga0501041_0002116_7290_8219 306
45 3300049577 Ga0501041_0003405 Ga0501041_0003405_2880_3809 306
46 3300049578 Ga0501042_0007432 Ga0501042_0007432_5854_6783 306
47 3300049578 Ga0501042_0100632 Ga0501042_0100632_962_1891 306
48 3300049580 Ga0501046_0111521 Ga0501046_0111521_578_1507 306
49 3300049582 Ga0501048_0009612 Ga0501048_0009612_2253_3182 306
50 3300049582 Ga0501048_0031814 Ga0501048_0031814_1840_2769 306
51 3300049584 Ga0501068_0066163 Ga0501068_0066163_27_956 306
52 3300049587 Ga0501071_0009587 Ga0501071_0009587_908_1837 306
53 3300049587 Ga0501071_0123454 Ga0501071_0123454_56_985 306
54 3300049588 Ga0501072_0095127 Ga0501072_0095127_1029_1958 306
55 3300049588 Ga0501072_0196745 Ga0501072_0196745_197_1126 306
56 3300049589 Ga0501073_0023232 Ga0501073_0023232_2915_3844 306
57 3300049590 Ga0501074_0200991 Ga0501074_0200991_395_1324 306
58 3300049591 Ga0501075_0010567 Ga0501075_0010567_4801_5730 306
59 3300049591 Ga0501075_0015288 Ga0501075_0015288_566_1495 306
60 3300049592 Ga0501076_0000806 Ga0501076_0000806_10620_11549 306
61 3300049592 Ga0501076_0023925 Ga0501076_0023925_1031_1960 306
62 3300049593 Ga0501077_0008625 Ga0501077_0008625_4581_5510 306
63 3300049593 Ga0501077_0022884 Ga0501077_0022884_676_1605 306
64 3300049741 Ga0501079_0000547 Ga0501079_0000547_10538_11467 306
65 3300049742 Ga0501080_0037516 Ga0501080_0037516_3310_4239 306
66 3300049742 Ga0501080_0121672 Ga0501080_0121672_817_1746 306
67 3300049743 Ga0501081_0006816 Ga0501081_0006816_5335_6264 306
68 3300049743 Ga0501081_0039599 Ga0501081_0039599_1707_2636 306
69 3300049744 Ga0501083_0024658 Ga0501083_0024658_1002_1931 306
70 3300049822 Ga0501035_0293478 Ga0501035_0293478_216_1145 306
71 3300049824 Ga0501045_0000985 Ga0501045_0000985_3880_4809 306
72 3300049824 Ga0501045_0019076 Ga0501045_0019076_3881_4810 306
73 3300050514 nmdc:mga08x19_23578_c1 nmdc:mga08x19_23578_c1_2419_3342 306
74 3300054114 Ga0501084_0013310 Ga0501084_0013310_322_1251 306
75 3300054114 Ga0501084_0053300 Ga0501084_0053300_1975_2904 306
76 3300060353 Ga0501082_0012874 Ga0501082_0012874_5244_6173 306
77 3300060353 Ga0501082_0154828 Ga0501082_0154828_946_1875 306
78 3300061734 Ga0530510_0001909 Ga0530510_0001909_5894_6823 306
79 3300049576 Ga0501040_0129820 Ga0501040_0129820_587_1519 307
80 3300049582 Ga0501048_0086719 Ga0501048_0086719_1094_2026 307
81 3300049591 Ga0501075_0057474 Ga0501075_0057474_731_1663 307
82 3300049593 Ga0501077_0019096 Ga0501077_0019096_1055_1987 307
83 3300054114 Ga0501084_0345257 Ga0501084_0345257_261_1193 307
84 3300005444 Ga0070694_100088395 Ga0070694_1000883952 309
85 3300032002 Ga0307416_100406257 Ga0307416_1004062572 309
86 3300046525 Ga0495663_0000973 Ga0495663_0000973_291_1244 310
87 3300048924 Ga0496121_0242551 Ga0496121_0242551_158_1111 313
88 iso_pu_bacteria 2511231003 2511251153 314
89 iso_pu_bacteria 2511231026 2511383267 314
90 iso_pu_bacteria 2521172590 2521557414 314
91 iso_pu_bacteria 2551306416 2553005237 314
92 iso_pu_bacteria 2839094727 2839098844 314
93 iso_pu_bacteria 2904439833 2904439846 314
94 iso_pu_bacteria 2904530477 2904531201 314
95 iso_pu_bacteria 2904584206 2904587144 314
96 iso_pu_bacteria 2904589729 2904592822 314
97 iso_pu_bacteria 2904601388 2904604405 314
98 iso_pu_bacteria 2919046199 2919050164 314
99 iso_pu_bacteria 2919079590 2919082217 314
100 iso_pu_bacteria 2923510766 2923516078 314
101 iso_pu_bacteria 2928115317 2928120275 314
102 3300009551 Ga0105238_10260686 Ga0105238_102606862 315
103 3300028794 Ga0307515_10000028 Ga0307515_10000028175 315
104 iso_pu_bacteria 2510917015 2511105313 315
105 iso_pu_bacteria 2511231006 2511266955 315
106 iso_pu_bacteria 2511231021 2511353855 315
107 iso_pu_bacteria 2512047030 2512349701 315
108 iso_pu_bacteria 2513020051 2513229854 315
109 iso_pu_bacteria 2513237151 2513958238 315
110 iso_pu_bacteria 2513237166 2514050046 315
111 iso_pu_bacteria 2515154189 2516022982 315
112 iso_pu_bacteria 2526164713 2527078259 315
113 iso_pu_bacteria 2562617112 2563060197 315
114 iso_pu_bacteria 2597489888 2597866836 315
115 iso_pu_bacteria 2599185214 2599624724 315
116 iso_pu_bacteria 2599185226 2599672414 315
117 iso_pu_bacteria 2599185227 2599685004 315
118 iso_pu_bacteria 2599185229 2599694023 315
119 iso_pu_bacteria 2599185239 2599734523 315
120 iso_pu_bacteria 2599185240 2599747893 315
121 iso_pu_bacteria 2599185257 2599804449 315
122 iso_pu_bacteria 2599185355 2600209956 315
123 iso_pu_bacteria 2600254931 2600363335 315
124 iso_pu_bacteria 2600255067 2600811262 315
125 iso_pu_bacteria 2643221633 2644189499 315
126 iso_pu_bacteria 2643221645 2644249189 315
127 iso_pu_bacteria 2643221658 2644329404 315
128 iso_pu_bacteria 2643221664 2644355883 315
129 iso_pu_bacteria 2643221672 2644398458 315
130 iso_pu_bacteria 2643221683 2644468796 315
131 iso_pu_bacteria 2671180172 2671771457 315
132 iso_pu_bacteria 2675903129 2676741385 315
133 iso_pu_bacteria 2711768613 2713475371 315
134 iso_pu_bacteria 2721755523 2722886203 315
135 iso_pu_bacteria 2721755763 2723876616 315
136 iso_pu_bacteria 2738541280 2738740617 315
137 iso_pu_bacteria 2738541296 2738819652 315
138 iso_pu_bacteria 2738541298 2738832131 315
139 iso_pu_bacteria 2738541300 2738844939 315
140 iso_pu_bacteria 2738541306 2738873659 315
141 iso_pu_bacteria 2738541307 2738881543 315
142 iso_pu_bacteria 2738543002 2739185289 315
143 iso_pu_bacteria 2738543008 2739220258 315
144 iso_pu_bacteria 2738543013 2739249235 315
145 iso_pu_bacteria 2738543018 2739277354 315
146 iso_pu_bacteria 2738543030 2739346397 315
147 iso_pu_bacteria 2744054900 2746090922 315
148 iso_pu_bacteria 2744054901 2746093543 315
149 iso_pu_bacteria 2791355137 2792837168 315
150 iso_pu_bacteria 2808606384 2808969247 315
151 iso_pu_bacteria 2808606390 2809004078 315
152 iso_pu_bacteria 2818991446 2819596102 315
153 iso_pu_bacteria 2818991450 2819619729 315
154 iso_pu_bacteria 2818991452 2819634326 315
155 iso_pu_bacteria 2831265667 2831270586 315
156 iso_pu_bacteria 2838054893 2838056810 315
157 iso_pu_bacteria 2839138175 2839144649 315
158 iso_pu_bacteria 2842324504 2842326324 315
159 iso_pu_bacteria 2842348783 2842351157 315
160 iso_pu_bacteria 2842454564 2842455635 315
161 iso_pu_bacteria 2842826826 2842828563 315
162 iso_pu_bacteria 2856287931 2856288618 315
163 iso_pu_bacteria 2857537821 2857541981 315
164 iso_pu_bacteria 2863421361 2863426855 315
165 iso_pu_bacteria 2870068957 2870075139 315
166 iso_pu_bacteria 2883087390 2883092498 315
167 iso_pu_bacteria 2885198086 2885201163 315
168 iso_pu_bacteria 2885211737 2885214797 315
169 iso_pu_bacteria 2885270888 2885273394 315
170 iso_pu_bacteria 2899924645 2899925453 315
171 iso_pu_bacteria 2900634093 2900639106 315
172 iso_pu_bacteria 2904449895 2904455340 315
173 iso_pu_bacteria 2904456579 2904460508 315
174 iso_pu_bacteria 2904483920 2904489522 315
175 iso_pu_bacteria 2904541872 2904546170 315
176 iso_pu_bacteria 2904564687 2904570539 315
177 iso_pu_bacteria 2904571731 2904577716 315
178 iso_pu_bacteria 2919527303 2919531892 315
179 iso_pu_bacteria 2921643360 2921644563 315
180 iso_pu_bacteria 2928037797 2928038431 315
181 iso_pu_bacteria 2928044640 2928045963 315
182 iso_pu_bacteria 2928051484 2928053643 315
183 iso_pu_bacteria 2928064002 2928067190 315
184 iso_pu_bacteria 2928070936 2928076152 315
185 iso_pu_bacteria 2928084124 2928085135 315
186 iso_pu_bacteria 2928108538 2928111251 315
187 iso_pu_bacteria 2928135762 2928138054 315
188 iso_pu_bacteria 2928157003 2928158930 315
189 iso_pu_bacteria 2928163908 2928167751 315
190 iso_pu_bacteria 2928170801 2928177448 315
191 iso_pu_bacteria 2928503688 2928506780 315
192 iso_pu_bacteria 2928536128 2928541917 315
193 iso_pu_bacteria 2929160207 2929163989 315
194 iso_pu_bacteria 2929520902 2929524712 315
195 iso_pu_bacteria 2932422444 2932422456 315
196 iso_pu_bacteria 2939651529 2939653512 315
197 iso_pu_bacteria 2945909444 2945912663 315
198 iso_pu_bacteria 2945934425 2945940663 315
199 iso_pu_bacteria 2945972063 2945976822 315
200 iso_pu_bacteria 2945984333 2945985048 315
201 iso_pu_bacteria 2981990288 2981992319 315
202 iso_pu_bacteria 2990703756 2990707792 315
203 iso_pu_bacteria 3007395558 3007399185 315
204 iso_pu_bacteria 641736151 642421664 315
205 iso_pu_bacteria 641736154 642415969 315
206 iso_pu_bacteria 642555112 642596001 315
207 iso_pu_bacteria 642555113 642618091 315
208 iso_pu_bacteria 8018845410 8018852481 315
209 iso_pu_bacteria 8020938398 8020941699 315
210 iso_pu_bacteria 8020945358 8020949108 315
211 iso_pu_bacteria 8020953355 8020958828 315
212 iso_pu_bacteria 8021120328 8021121557 315
213 iso_pu_bacteria 8039098773 8039103800 315
214 iso_pu_bacteria 8054929484 8054933904 315
215 iso_pu_bacteria 8055301274 8055305461 315
216 iso_pu_bacteria 8056177738 8056182737 315
217 3300037312 Ga0395899_0001705 Ga0395899_0001705_8738_9688 316
218 3300037418 Ga0395900_0001713 Ga0395900_0001713_8497_9447 316
219 3300038443 Ga0395901_0004147 Ga0395901_0004147_8622_9572 316
220 3300046522 Ga0495643_0000251 Ga0495643_0000251_3479_4429 316
221 iso_pu_bacteria 2513237150 2513957480 316
222 iso_pu_bacteria 2513237165 2514040308 316
223 iso_pu_bacteria 2596583598 2597031402 316
224 iso_pu_bacteria 2599185178 2599445261 316
225 iso_pu_bacteria 2858688981 2858689204 316
226 iso_pu_bacteria 2885266251 2885270637 316
227 iso_pu_bacteria 2900577576 2900581557 316
228 iso_pu_bacteria 2928058823 2928063835 316
229 iso_pu_bacteria 644736347 644750626 316
230 iso_pu_bacteria 8003400568 8003405212 316
231 3300003187 JGI25151J46595_10008892 JGI25151J46595_100088923 317
232 3300006353 Ga0075370_10049018 Ga0075370_100490183 317
233 3300021361 Ga0213872_10003137 Ga0213872_100031373 317
234 3300025294 Ga0209025_1003078 Ga0209025_10030786 317
235 3300039447 Ga0436361_0767394 Ga0436361_0767394_29050_30015 317
236 3300044658 Ga0466972_0013678 Ga0466972_0013678_2480_3436 317
237 iso_pu_bacteria 2501025501 2501071702 317
238 iso_pu_bacteria 2548876994 2550697111 317
239 iso_pu_bacteria 2857357740 2857362736 317
240 3300002704 JGI25155J39150_1000737 JGI25155J39150_10007372 318
241 3300002704 JGI25155J39150_1000769 JGI25155J39150_10007697 318
242 3300002705 JGI25156J39149_1003507 JGI25156J39149_10035074 318
243 3300002737 JGI25162J39368_1007559 JGI25162J39368_10075592 318
244 3300002738 JGI25154J39366_1002177 JGI25154J39366_10021772 318
245 3300003187 JGI25151J46595_10005097 JGI25151J46595_100050973 318
246 3300003762 Ga0055542_1004738 Ga0055542_10047382 318
247 3300003771 Ga0055526_1001983 Ga0055526_10019837 318
248 3300003773 Ga0055537_1000174 Ga0055537_100017416 318
249 3300003781 Ga0055536_1000201 Ga0055536_10002017 318
250 3300003784 Ga0055534_1000173 Ga0055534_100017332 318
251 3300003790 Ga0055528_1000221 Ga0055528_100022116 318
252 3300005563 Ga0068855_100003015 Ga0068855_10000301510 318
253 3300005577 Ga0068857_100207537 Ga0068857_1002075372 318
254 3300005578 Ga0068854_100000568 Ga0068854_10000056812 318
255 3300005616 Ga0068852_100003058 Ga0068852_10000305811 318
256 3300009093 Ga0105240_10016683 Ga0105240_100166839 318
257 3300009545 Ga0105237_10194897 Ga0105237_101948972 318
258 3300009551 Ga0105238_10068160 Ga0105238_100681604 318
259 3300015262 Ga0182007_10001834 Ga0182007_100018345 318
260 3300021361 Ga0213872_10000722 Ga0213872_100007224 318
261 3300021361 Ga0213872_10006128 Ga0213872_100061286 318
262 3300025206 Ga0209435_100060 Ga0209435_10006067 318
263 3300025206 Ga0209435_100681 Ga0209435_1006815 318
264 3300025229 Ga0209147_100165 Ga0209147_10016575 318
265 3300025233 Ga0209437_100595 Ga0209437_10059519 318
266 3300025242 Ga0209258_100573 Ga0209258_10057313 318
267 3300025246 Ga0209646_1000143 Ga0209646_100014389 318
268 3300025246 Ga0209646_1000181 Ga0209646_100018167 318
269 3300025250 Ga0209026_1000217 Ga0209026_100021767 318
270 3300025250 Ga0209026_1002525 Ga0209026_10025252 318
271 3300025254 Ga0209148_1002495 Ga0209148_10024954 318
272 3300025256 Ga0209759_1000791 Ga0209759_100079119 318
273 3300025256 Ga0209759_1001072 Ga0209759_100107213 318
274 3300025263 Ga0209565_1000006 Ga0209565_1000006760 318
275 3300025273 Ga0209673_1000004 Ga0209673_100000469 318
276 3300025291 Ga0209675_1000123 Ga0209675_100012369 318
277 3300025292 Ga0209676_1000121 Ga0209676_100012176 318
278 3300025294 Ga0209025_1000051 Ga0209025_1000051112 318
279 3300025295 Ga0209564_1001147 Ga0209564_100114732 318
280 3300025299 Ga0209256_1000219 Ga0209256_100021969 318
281 3300025913 Ga0207695_10002153 Ga0207695_100021539 318
282 3300025913 Ga0207695_10022412 Ga0207695_100224125 318
283 3300025924 Ga0207694_10000286 Ga0207694_1000028637 318
284 3300025949 Ga0207667_10003683 Ga0207667_1000368311 318
285 3300025949 Ga0207667_10059518 Ga0207667_100595182 318
286 3300025981 Ga0207640_10005912 Ga0207640_100059122 318
287 3300026142 Ga0207698_10002086 Ga0207698_100020862 318
288 3300031456 Ga0307513_10070491 Ga0307513_100704914 318
289 3300037471 Ga0395905_0000144 Ga0395905_0000144_102221_103186 318
290 3300037471 Ga0395905_0020038 Ga0395905_0020038_454_1434 318
291 3300037471 Ga0395905_0050165 Ga0395905_0050165_956_1936 318
292 3300039447 Ga0436361_0139980 Ga0436361_0139980_4197_5168 318
293 3300039447 Ga0436361_0995447 Ga0436361_0995447_9663_10628 318
294 3300044765 Ga0466970_0001601 Ga0466970_0001601_5916_6893 318
295 3300045049 Ga0466959_0026452 Ga0466959_0026452_1111_2088 318
296 3300046507 Ga0495606_0014068 Ga0495606_0014068_4212_5174 318
297 3300046660 Ga0495625_0001896 Ga0495625_0001896_3815_4840 318
298 3300048919 Ga0496116_0004910 Ga0496116_0004910_6706_7731 318
299 3300048925 Ga0496122_0000471 Ga0496122_0000471_61885_62910 318
300 3300048926 Ga0496123_0000259 Ga0496123_0000259_21193_22218 318
301 3300048928 Ga0496125_0051692 Ga0496125_0051692_1944_2969 318
302 3300049571 Ga0501034_0161318 Ga0501034_0161318_1007_1978 318
303 3300053125 Ga0500618_012922 Ga0500618_012922_194_1165 318
304 3300053145 Ga0500586_078820 Ga0500586_078820_89_1048 318
305 iso_pu_bacteria 2884811622 2884816573 318
306 iso_pu_bacteria 2884836552 2884841059 318
307 iso_pu_bacteria 2884852848 2884857345 318
308 iso_pu_bacteria 2896154374 2896158285 318
309 3300001979 JGI24740J21852_10000911 JGI24740J21852_100009114 319
310 3300001989 JGI24739J22299_10005556 JGI24739J22299_100055562 319
311 3300001989 JGI24739J22299_10023299 JGI24739J22299_100232992 319
312 3300001989 JGI24739J22299_10041068 JGI24739J22299_100410682 319
313 3300001990 JGI24737J22298_10034905 JGI24737J22298_100349052 319
314 3300002067 JGI24735J21928_10006651 JGI24735J21928_100066513 319
315 3300002067 JGI24735J21928_10010353 JGI24735J21928_100103532 319
316 3300002705 JGI25156J39149_1000521 JGI25156J39149_100052110 319
317 3300002705 JGI25156J39149_1000586 JGI25156J39149_10005867 319
318 3300002705 JGI25156J39149_1001544 JGI25156J39149_10015447 319
319 3300002738 JGI25154J39366_1001257 JGI25154J39366_10012574 319
320 3300002741 JGI25157J39369_1000593 JGI25157J39369_100059317 319
321 3300002741 JGI25157J39369_1000711 JGI25157J39369_10007117 319
322 3300002987 JGI25159J45721_1007642 JGI25159J45721_10076424 319
323 3300003187 JGI25151J46595_10000360 JGI25151J46595_1000036033 319
324 3300003187 JGI25151J46595_10000362 JGI25151J46595_100003624 319
325 3300003187 JGI25151J46595_10001007 JGI25151J46595_100010072 319
326 3300003187 JGI25151J46595_10003059 JGI25151J46595_100030598 319
327 3300003187 JGI25151J46595_10011276 JGI25151J46595_100112762 319
328 3300003187 JGI25151J46595_10023197 JGI25151J46595_100231972 319
329 3300003187 JGI25151J46595_10027170 JGI25151J46595_100271703 319
330 3300003187 JGI25151J46595_10052046 JGI25151J46595_100520462 319
331 3300003214 JGI25165J46597_1000875 JGI25165J46597_10008756 319
332 3300003215 JGI25153J46596_10028440 JGI25153J46596_100284402 319
333 3300003316 rootH1_10131663 rootH1_101316631 319
334 3300003354 JGI25160J50197_1005351 JGI25160J50197_10053513 319
335 3300003374 JGI25161J50226_1001166 JGI25161J50226_10011665 319
336 3300003374 JGI25161J50226_1003857 JGI25161J50226_10038573 319
337 3300003756 Ga0055533_1000173 Ga0055533_10001732 319
338 3300003756 Ga0055533_1000463 Ga0055533_10004635 319
339 3300003758 Ga0055532_1000014 Ga0055532_1000014254 319
340 3300003758 Ga0055532_1000310 Ga0055532_100031017 319
341 3300003758 Ga0055532_1000534 Ga0055532_10005349 319
342 3300003758 Ga0055532_1001391 Ga0055532_10013914 319
343 3300003758 Ga0055532_1001394 Ga0055532_10013944 319
344 3300003760 Ga0055527_1000013 Ga0055527_100001385 319
345 3300003760 Ga0055527_1000444 Ga0055527_10004449 319
346 3300003761 Ga0055535_1000011 Ga0055535_100001183 319
347 3300003761 Ga0055535_1001100 Ga0055535_10011009 319
348 3300003761 Ga0055535_1001288 Ga0055535_10012886 319
349 3300003761 Ga0055535_1001794 Ga0055535_10017948 319
350 3300003761 Ga0055535_1006942 Ga0055535_10069421 319
351 3300003762 Ga0055542_1000004 Ga0055542_1000004304 319
352 3300003762 Ga0055542_1000018 Ga0055542_100001885 319
353 3300003762 Ga0055542_1001322 Ga0055542_10013228 319
354 3300003762 Ga0055542_1002010 Ga0055542_10020108 319
355 3300003763 Ga0055529_1000017 Ga0055529_1000017256 319
356 3300003763 Ga0055529_1000470 Ga0055529_10004706 319
357 3300003771 Ga0055526_1010824 Ga0055526_10108245 319
358 3300003771 Ga0055526_1023599 Ga0055526_10235992 319
359 3300003773 Ga0055537_1000975 Ga0055537_10009755 319
360 3300003773 Ga0055537_1004186 Ga0055537_10041865 319
361 3300003775 Ga0055524_1000236 Ga0055524_100023625 319
362 3300003775 Ga0055524_1008320 Ga0055524_10083202 319
363 3300003775 Ga0055524_1030895 Ga0055524_10308952 319
364 3300003784 Ga0055534_1000143 Ga0055534_10001435 319
365 3300003784 Ga0055534_1000191 Ga0055534_10001914 319
366 3300003784 Ga0055534_1000233 Ga0055534_100023335 319
367 3300003784 Ga0055534_1014108 Ga0055534_10141082 319
368 3300003790 Ga0055528_1004569 Ga0055528_10045693 319
369 3300003790 Ga0055528_1028258 Ga0055528_10282582 319
370 3300003791 Ga0055530_10002962 Ga0055530_100029628 319
371 3300003792 Ga0055540_1002232 Ga0055540_10022328 319
372 3300004625 Ga0055543_1001238 Ga0055543_10012384 319
373 3300004625 Ga0055543_1007444 Ga0055543_10074443 319
374 3300005262 Ga0065165_1000067 Ga0065165_1000067106 319
375 3300005262 Ga0065165_1000191 Ga0065165_100019177 319
376 3300005262 Ga0065165_1003020 Ga0065165_10030209 319
377 3300005288 Ga0065714_10006689 Ga0065714_100066892 319
378 3300005288 Ga0065714_10064920 Ga0065714_100649206 319
379 3300005288 Ga0065714_10078094 Ga0065714_100780942 319
380 3300005293 Ga0065715_10141291 Ga0065715_101412911 319
381 3300005339 Ga0070660_100160112 Ga0070660_1001601122 319
382 3300005344 Ga0070661_100071842 Ga0070661_1000718422 319
383 3300005344 Ga0070661_100167450 Ga0070661_1001674502 319
384 3300005347 Ga0070668_100270277 Ga0070668_1002702772 319
385 3300005366 Ga0070659_100000181 Ga0070659_10000018110 319
386 3300005367 Ga0070667_100525852 Ga0070667_1005258521 319
387 3300005455 Ga0070663_100001146 Ga0070663_10000114612 319
388 3300005455 Ga0070663_100250752 Ga0070663_1002507522 319
389 3300005459 Ga0068867_100435125 Ga0068867_1004351251 319
390 3300005563 Ga0068855_100173681 Ga0068855_1001736812 319
391 3300005577 Ga0068857_100106054 Ga0068857_1001060542 319
392 3300005578 Ga0068854_100060076 Ga0068854_1000600762 319
393 3300005616 Ga0068852_100085179 Ga0068852_1000851792 319
394 3300005834 Ga0068851_10003560 Ga0068851_100035606 319
395 3300005834 Ga0068851_10205462 Ga0068851_102054621 319
396 3300005842 Ga0068858_100238120 Ga0068858_1002381202 319
397 3300005844 Ga0068862_100115715 Ga0068862_1001157152 319
398 3300006058 Ga0075432_10000001 Ga0075432_1000000142 319
399 3300006058 Ga0075432_10002256 Ga0075432_100022564 319
400 3300006058 Ga0075432_10032843 Ga0075432_100328432 319
401 3300006195 Ga0075366_10006898 Ga0075366_100068982 319
402 3300006353 Ga0075370_10002278 Ga0075370_100022788 319
403 3300006353 Ga0075370_10003866 Ga0075370_100038667 319
404 3300006353 Ga0075370_10011877 Ga0075370_100118774 319
405 3300006353 Ga0075370_10056001 Ga0075370_100560012 319
406 3300006914 Ga0075436_100033512 Ga0075436_1000335123 319
407 3300006946 Ga0079104_1000226 Ga0079104_10002266 319
408 3300006948 Ga0099826_10000031 Ga0099826_1000003149 319
409 3300009011 Ga0105251_10000674 Ga0105251_1000067421 319
410 3300009011 Ga0105251_10003817 Ga0105251_1000381712 319
411 3300009011 Ga0105251_10006641 Ga0105251_100066414 319
412 3300009011 Ga0105251_10015428 Ga0105251_100154282 319
413 3300009011 Ga0105251_10060849 Ga0105251_100608492 319
414 3300009011 Ga0105251_10085981 Ga0105251_100859811 319
415 3300009036 Ga0105244_10001011 Ga0105244_1000101113 319
416 3300009036 Ga0105244_10001337 Ga0105244_1000133715 319
417 3300009036 Ga0105244_10019526 Ga0105244_100195264 319
418 3300009092 Ga0105250_10000138 Ga0105250_1000013856 319
419 3300009092 Ga0105250_10002381 Ga0105250_100023817 319
420 3300009092 Ga0105250_10036398 Ga0105250_100363983 319
421 3300009093 Ga0105240_10013189 Ga0105240_100131896 319
422 3300009093 Ga0105240_10047755 Ga0105240_100477554 319
423 3300009093 Ga0105240_10060433 Ga0105240_100604334 319
424 3300009093 Ga0105240_10126762 Ga0105240_101267622 319
425 3300009093 Ga0105240_10148726 Ga0105240_101487263 319
426 3300009098 Ga0105245_10186035 Ga0105245_101860352 319
427 3300009148 Ga0105243_10002670 Ga0105243_1000267013 319
428 3300009148 Ga0105243_10007533 Ga0105243_100075332 319
429 3300009545 Ga0105237_10023997 Ga0105237_100239972 319
430 3300009545 Ga0105237_10038427 Ga0105237_100384272 319
431 3300009545 Ga0105237_10573072 Ga0105237_105730722 319
432 3300009551 Ga0105238_10000065 Ga0105238_1000006592 319
433 3300009551 Ga0105238_10036956 Ga0105238_100369564 319
434 3300009551 Ga0105238_10279753 Ga0105238_102797532 319
435 3300009551 Ga0105238_10285253 Ga0105238_102852532 319
436 3300010375 Ga0105239_10005960 Ga0105239_1000596010 319
437 3300013100 Ga0157373_10054161 Ga0157373_100541613 319
438 3300013104 Ga0157370_10069039 Ga0157370_100690392 319
439 3300013105 Ga0157369_10034904 Ga0157369_100349044 319
440 3300013296 Ga0157374_10029992 Ga0157374_100299924 319
441 3300013306 Ga0163162_10004924 Ga0163162_1000492413 319
442 3300013306 Ga0163162_10008588 Ga0163162_100085885 319
443 3300013307 Ga0157372_10053850 Ga0157372_100538502 319
444 3300013308 Ga0157375_10418713 Ga0157375_104187132 319
445 3300014497 Ga0182008_10003799 Ga0182008_100037999 319
446 3300014497 Ga0182008_10005597 Ga0182008_100055972 319
447 3300014497 Ga0182008_10013054 Ga0182008_100130545 319
448 3300014497 Ga0182008_10037122 Ga0182008_100371222 319
449 3300014497 Ga0182008_10041086 Ga0182008_100410862 319
450 3300015261 Ga0182006_1000955 Ga0182006_10009556 319
451 3300015261 Ga0182006_1002044 Ga0182006_100204412 319
452 3300015261 Ga0182006_1028209 Ga0182006_10282092 319
453 3300015261 Ga0182006_1046589 Ga0182006_10465892 319
454 3300015262 Ga0182007_10000501 Ga0182007_100005019 319
455 3300015262 Ga0182007_10000617 Ga0182007_1000061712 319
456 3300015262 Ga0182007_10010306 Ga0182007_100103062 319
457 3300015262 Ga0182007_10079780 Ga0182007_100797801 319
458 3300015265 Ga0182005_1018440 Ga0182005_10184402 319
459 3300015265 Ga0182005_1041229 Ga0182005_10412292 319
460 3300015683 Ga0183362_10001 Ga0183362_100011678 319
461 3300017792 Ga0163161_10000065 Ga0163161_10000065108 319
462 3300017792 Ga0163161_10001330 Ga0163161_1000133014 319
463 3300017792 Ga0163161_10030339 Ga0163161_100303392 319
464 3300017792 Ga0163161_10236727 Ga0163161_102367272 319
465 3300021361 Ga0213872_10000365 Ga0213872_1000036515 319
466 3300021361 Ga0213872_10023546 Ga0213872_100235463 319
467 3300025206 Ga0209435_101516 Ga0209435_1015162 319
468 3300025208 Ga0209436_113824 Ga0209436_1138241 319
469 3300025225 Ga0209566_101069 Ga0209566_1010693 319
470 3300025226 Ga0209674_100049 Ga0209674_100049213 319
471 3300025226 Ga0209674_100051 Ga0209674_100051262 319
472 3300025226 Ga0209674_101112 Ga0209674_1011122 319
473 3300025228 Ga0209672_100027 Ga0209672_100027247 319
474 3300025228 Ga0209672_100042 Ga0209672_10004242 319
475 3300025228 Ga0209672_100131 Ga0209672_10013133 319
476 3300025228 Ga0209672_100961 Ga0209672_10096111 319
477 3300025229 Ga0209147_100012 Ga0209147_100012325 319
478 3300025229 Ga0209147_100035 Ga0209147_100035247 319
479 3300025229 Ga0209147_100046 Ga0209147_10004621 319
480 3300025229 Ga0209147_100052 Ga0209147_10005242 319
481 3300025230 Ga0209563_102345 Ga0209563_1023452 319
482 3300025231 Ga0207427_100722 Ga0207427_1007227 319
483 3300025242 Ga0209258_100022 Ga0209258_100022305 319
484 3300025242 Ga0209258_100030 Ga0209258_100030322 319
485 3300025242 Ga0209258_100052 Ga0209258_10005272 319
486 3300025242 Ga0209258_100073 Ga0209258_10007342 319
487 3300025245 Ga0207425_1000138 Ga0207425_10001384 319
488 3300025254 Ga0209148_1000022 Ga0209148_1000022302 319
489 3300025254 Ga0209148_1000034 Ga0209148_1000034305 319
490 3300025254 Ga0209148_1000064 Ga0209148_100006472 319
491 3300025254 Ga0209148_1000524 Ga0209148_10005247 319
492 3300025256 Ga0209759_1000015 Ga0209759_1000015262 319
493 3300025256 Ga0209759_1000041 Ga0209759_100004118 319
494 3300025256 Ga0209759_1000044 Ga0209759_1000044171 319
495 3300025258 Ga0209129_1000023 Ga0209129_1000023378 319
496 3300025258 Ga0209129_1004158 Ga0209129_10041585 319
497 3300025258 Ga0209129_1007672 Ga0209129_10076723 319
498 3300025261 Ga0209233_1000073 Ga0209233_1000073259 319
499 3300025263 Ga0209565_1000053 Ga0209565_100005348 319
500 3300025263 Ga0209565_1000649 Ga0209565_100064910 319
501 3300025272 Ga0209455_1000024 Ga0209455_1000024321 319
502 3300025272 Ga0209455_1000057 Ga0209455_100005772 319
503 3300025272 Ga0209455_1000505 Ga0209455_10005058 319
504 3300025273 Ga0209673_1000021 Ga0209673_1000021256 319
505 3300025273 Ga0209673_1001445 Ga0209673_100144513 319
506 3300025273 Ga0209673_1001448 Ga0209673_100144810 319
507 3300025273 Ga0209673_1010458 Ga0209673_10104584 319
508 3300025284 Ga0209130_1000222 Ga0209130_100022259 319
509 3300025284 Ga0209130_1000476 Ga0209130_100047627 319
510 3300025284 Ga0209130_1001231 Ga0209130_10012315 319
511 3300025284 Ga0209130_1006194 Ga0209130_10061943 319
512 3300025291 Ga0209675_1000078 Ga0209675_1000078108 319
513 3300025291 Ga0209675_1000091 Ga0209675_100009148 319
514 3300025291 Ga0209675_1002241 Ga0209675_10022412 319
515 3300025291 Ga0209675_1002494 Ga0209675_10024948 319
516 3300025291 Ga0209675_1010439 Ga0209675_10104393 319
517 3300025291 Ga0209675_1011454 Ga0209675_10114543 319
518 3300025292 Ga0209676_1000005 Ga0209676_1000005419 319
519 3300025292 Ga0209676_1001320 Ga0209676_10013203 319
520 3300025292 Ga0209676_1001396 Ga0209676_10013964 319
521 3300025294 Ga0209025_1000085 Ga0209025_1000085142 319
522 3300025294 Ga0209025_1000096 Ga0209025_100009637 319
523 3300025294 Ga0209025_1000157 Ga0209025_1000157102 319
524 3300025294 Ga0209025_1000476 Ga0209025_100047617 319
525 3300025294 Ga0209025_1001087 Ga0209025_10010874 319
526 3300025294 Ga0209025_1016183 Ga0209025_10161835 319
527 3300025294 Ga0209025_1023843 Ga0209025_10238432 319
528 3300025294 Ga0209025_1023882 Ga0209025_10238823 319
529 3300025295 Ga0209564_1000133 Ga0209564_100013371 319
530 3300025295 Ga0209564_1000400 Ga0209564_100040013 319
531 3300025295 Ga0209564_1001022 Ga0209564_100102215 319
532 3300025295 Ga0209564_1001357 Ga0209564_10013574 319
533 3300025295 Ga0209564_1005727 Ga0209564_10057275 319
534 3300025297 Ga0209758_1000064 Ga0209758_1000064279 319
535 3300025297 Ga0209758_1020079 Ga0209758_10200792 319
536 3300025297 Ga0209758_1020110 Ga0209758_10201103 319
537 3300025298 Ga0209050_1000007 Ga0209050_1000007678 319
538 3300025298 Ga0209050_1016709 Ga0209050_10167092 319
539 3300025299 Ga0209256_1000038 Ga0209256_1000038285 319
540 3300025299 Ga0209256_1000115 Ga0209256_100011518 319
541 3300025299 Ga0209256_1000400 Ga0209256_100040035 319
542 3300025299 Ga0209256_1005371 Ga0209256_10053712 319
543 3300025302 Ga0207426_1000001 Ga0207426_10000011286 319
544 3300025302 Ga0207426_1000021 Ga0207426_1000021115 319
545 3300025302 Ga0207426_1000090 Ga0207426_1000090236 319
546 3300025302 Ga0207426_1001543 Ga0207426_10015433 319
547 3300025303 Ga0209051_1000009 Ga0209051_1000009419 319
548 3300025303 Ga0209051_1000092 Ga0209051_1000092139 319
549 3300025303 Ga0209051_1000490 Ga0209051_100049046 319
550 3300025303 Ga0209051_1000944 Ga0209051_10009444 319
551 3300025303 Ga0209051_1008125 Ga0209051_10081255 319
552 3300025303 Ga0209051_1012472 Ga0209051_10124724 319
553 3300025303 Ga0209051_1049257 Ga0209051_10492572 319
554 3300025304 Ga0209257_1000011 Ga0209257_1000011393 319
555 3300025304 Ga0209257_1000508 Ga0209257_100050856 319
556 3300025304 Ga0209257_1028013 Ga0209257_10280131 319
557 3300025321 Ga0207656_10158101 Ga0207656_101581011 319
558 3300025711 Ga0207696_1000078 Ga0207696_100007855 319
559 3300025711 Ga0207696_1001349 Ga0207696_10013498 319
560 3300025711 Ga0207696_1004805 Ga0207696_10048054 319
561 3300025711 Ga0207696_1011995 Ga0207696_10119952 319
562 3300025728 Ga0207655_1000151 Ga0207655_100015131 319
563 3300025735 Ga0207713_1000010 Ga0207713_1000010450 319
564 3300025735 Ga0207713_1000183 Ga0207713_100018314 319
565 3300025735 Ga0207713_1001684 Ga0207713_100168413 319
566 3300025735 Ga0207713_1003679 Ga0207713_10036794 319
567 3300025735 Ga0207713_1016167 Ga0207713_10161672 319
568 3300025904 Ga0207647_10007818 Ga0207647_100078185 319
569 3300025904 Ga0207647_10012166 Ga0207647_100121663 319
570 3300025904 Ga0207647_10026028 Ga0207647_100260284 319
571 3300025907 Ga0207645_10212143 Ga0207645_102121431 319
572 3300025913 Ga0207695_10000815 Ga0207695_100008156 319
573 3300025914 Ga0207671_10020333 Ga0207671_100203333 319
574 3300025914 Ga0207671_10058750 Ga0207671_100587502 319
575 3300025919 Ga0207657_10000111 Ga0207657_1000011141 319
576 3300025919 Ga0207657_10273236 Ga0207657_102732361 319
577 3300025920 Ga0207649_10168579 Ga0207649_101685791 319
578 3300025932 Ga0207690_10000009 Ga0207690_10000009288 319
579 3300025933 Ga0207706_10010532 Ga0207706_100105327 319
580 3300025933 Ga0207706_10322155 Ga0207706_103221552 319
581 3300025934 Ga0207686_10013312 Ga0207686_100133123 319
582 3300025934 Ga0207686_10212201 Ga0207686_102122012 319
583 3300025935 Ga0207709_10000165 Ga0207709_1000016529 319
584 3300025935 Ga0207709_10000785 Ga0207709_100007852 319
585 3300025935 Ga0207709_10001556 Ga0207709_1000155611 319
586 3300026041 Ga0207639_10004693 Ga0207639_100046937 319
587 3300026067 Ga0207678_10000347 Ga0207678_1000034728 319
588 3300026067 Ga0207678_10138140 Ga0207678_101381402 319
589 3300026142 Ga0207698_10002808 Ga0207698_100028086 319
590 3300027111 Ga0209281_1000002 Ga0209281_1000002222 319
591 3300027312 Ga0209371_1000881 Ga0209371_100088113 319
592 3300027312 Ga0209371_1003481 Ga0209371_10034815 319
593 3300027666 Ga0209282_1000011 Ga0209282_1000011156 319
594 3300027907 Ga0207428_10000155 Ga0207428_1000015559 319
595 3300027907 Ga0207428_10172630 Ga0207428_101726302 319
596 3300028379 Ga0268266_10039347 Ga0268266_100393472 319
597 3300028380 Ga0268265_10214087 Ga0268265_102140871 319
598 3300028794 Ga0307515_10001264 Ga0307515_1000126446 319
599 3300030500 Ga0268256_1000741 Ga0268256_100074113 319
600 3300030500 Ga0268256_1003164 Ga0268256_10031645 319
601 3300031251 Ga0265327_10000465 Ga0265327_1000046558 319
602 3300031456 Ga0307513_10196183 Ga0307513_101961832 319
603 3300031548 Ga0307408_100001688 Ga0307408_1000016884 319
604 3300031548 Ga0307408_100013471 Ga0307408_1000134714 319
605 3300031649 Ga0307514_10001952 Ga0307514_100019523 319
606 3300031731 Ga0307405_10017284 Ga0307405_100172843 319
607 3300031731 Ga0307405_10239301 Ga0307405_102393011 319
608 3300031901 Ga0307406_10000194 Ga0307406_1000019418 319
609 3300031911 Ga0307412_10000010 Ga0307412_10000010238 319
610 3300031911 Ga0307412_10005778 Ga0307412_100057785 319
611 3300031911 Ga0307412_10015702 Ga0307412_100157022 319
612 3300031911 Ga0307412_10330692 Ga0307412_103306922 319
613 3300032005 Ga0307411_10044619 Ga0307411_100446192 319
614 3300037418 Ga0395900_0017362 Ga0395900_0017362_3263_4225 319
615 3300037418 Ga0395900_0068092 Ga0395900_0068092_2057_3022 319
616 3300037466 Ga0395898_0025789 Ga0395898_0025789_3233_4195 319
617 3300037471 Ga0395905_0000004 Ga0395905_0000004_65651_66613 319
618 3300037471 Ga0395905_0116042 Ga0395905_0116042_1315_2280 319
619 3300037471 Ga0395905_0122125 Ga0395905_0122125_949_1908 319
620 3300037471 Ga0395905_0182200 Ga0395905_0182200_232_1197 319
621 3300037471 Ga0395905_0288913 Ga0395905_0288913_391_1356 319
622 3300039447 Ga0436361_0408019 Ga0436361_0408019_2384_3355 319
623 3300039447 Ga0436361_0480402 Ga0436361_0480402_1827_2789 319
624 3300039447 Ga0436361_0602324 Ga0436361_0602324_20429_21406 319
625 3300039447 Ga0436361_1187046 Ga0436361_1187046_290_1261 319
626 3300041404 Ga0439436_0002482 Ga0439436_0002482_4469_5434 319
627 3300041405 Ga0439438_001193 Ga0439438_001193_1792_2772 319
628 3300041405 Ga0439438_001381 Ga0439438_001381_4907_5872 319
629 3300041405 Ga0439438_011801 Ga0439438_011801_1717_2688 319
630 3300041407 Ga0439447_000064 Ga0439447_000064_12668_13633 319
631 3300041407 Ga0439447_001131 Ga0439447_001131_2995_3960 319
632 3300041411 Ga0439466_0000097 Ga0439466_0000097_18031_18996 319
633 3300041411 Ga0439466_0000247 Ga0439466_0000247_7642_8607 319
634 3300041411 Ga0439466_0002262 Ga0439466_0002262_1956_2936 319
635 3300041411 Ga0439466_0051904 Ga0439466_0051904_192_1163 319
636 3300042002 Ga0439442_006629 Ga0439442_006629_991_1962 319
637 3300042006 Ga0439432_004127 Ga0439432_004127_896_1867 319
638 3300042006 Ga0439432_006936 Ga0439432_006936_499_1464 319
639 3300042009 Ga0439451_000625 Ga0439451_000625_2389_3354 319
640 3300042009 Ga0439451_001656 Ga0439451_001656_1645_2610 319
641 3300042010 Ga0439452_002519 Ga0439452_002519_2070_3035 319
642 3300042010 Ga0439452_006105 Ga0439452_006105_2681_3652 319
643 3300042125 Ga0450923_001538 Ga0450923_001538_875_1846 319
644 3300042125 Ga0450923_005158 Ga0450923_005158_373_1338 319
645 3300042136 Ga0450900_001585 Ga0450900_001585_821_1789 319
646 3300042137 Ga0450902_000888 Ga0450902_000888_2152_3120 319
647 3300042138 Ga0450903_005681 Ga0450903_005681_1006_1971 319
648 3300042142 Ga0450905_000029 Ga0450905_000029_9800_10768 319
649 3300042146 Ga0450907_000003 Ga0450907_000003_71327_72292 319
650 3300042156 Ga0439446_0000206 Ga0439446_0000206_3240_4205 319
651 3300042156 Ga0439446_0002193 Ga0439446_0002193_545_1510 319
652 3300042184 Ga0450908_003708 Ga0450908_003708_38_1009 319
653 3300042185 Ga0450909_000288 Ga0450909_000288_347_1312 319
654 3300042435 Ga0439434_0000017 Ga0439434_0000017_29941_30906 319
655 3300042435 Ga0439434_0001685 Ga0439434_0001685_849_1814 319
656 3300042435 Ga0439434_0001880 Ga0439434_0001880_4189_5160 319
657 3300042439 Ga0439464_0011618 Ga0439464_0011618_1134_2093 319
658 3300042533 Ga0450901_000115 Ga0450901_000115_3977_4945 319
659 3300042993 Ga0439440_0000015 Ga0439440_0000015_11430_12395 319
660 3300044842 Ga0466957_0181467 Ga0466957_0181467_176_1141 319
661 3300045836 Ga0466958_0005703 Ga0466958_0005703_949_1917 319
662 3300046452 Ga0495617_000214 Ga0495617_000214_25471_26436 319
663 3300046452 Ga0495617_000472 Ga0495617_000472_15639_16604 319
664 3300046452 Ga0495617_003864 Ga0495617_003864_2887_3867 319
665 3300046452 Ga0495617_006162 Ga0495617_006162_2085_3065 319
666 3300046453 Ga0495627_007772 Ga0495627_007772_1469_2440 319
667 3300046453 Ga0495627_008647 Ga0495627_008647_2304_3275 319
668 3300046453 Ga0495627_031813 Ga0495627_031813_435_1415 319
669 3300046454 Ga0495592_0024207 Ga0495592_0024207_2042_3007 319
670 3300046454 Ga0495592_0082130 Ga0495592_0082130_198_1163 319
671 3300046454 Ga0495592_0137472 Ga0495592_0137472_633_1604 319
672 3300046455 Ga0495603_0024902 Ga0495603_0024902_222_1187 319
673 3300046457 Ga0495590_0008326 Ga0495590_0008326_1837_2817 319
674 3300046458 Ga0495591_000266 Ga0495591_000266_19357_20337 319
675 3300046458 Ga0495591_000724 Ga0495591_000724_707_1672 319
676 3300046458 Ga0495591_012626 Ga0495591_012626_825_1805 319
677 3300046459 Ga0495629_0000021 Ga0495629_0000021_56026_56991 319
678 3300046459 Ga0495629_0000554 Ga0495629_0000554_10019_10984 319
679 3300046459 Ga0495629_0010016 Ga0495629_0010016_3111_4076 319
680 3300046459 Ga0495629_0012539 Ga0495629_0012539_953_1918 319
681 3300046459 Ga0495629_0150970 Ga0495629_0150970_203_1168 319
682 3300046460 Ga0495638_0000921 Ga0495638_0000921_8547_9512 319
683 3300046460 Ga0495638_0002886 Ga0495638_0002886_798_1760 319
684 3300046460 Ga0495638_0038991 Ga0495638_0038991_1953_2924 319
685 3300046460 Ga0495638_0055017 Ga0495638_0055017_1292_2257 319
686 3300046460 Ga0495638_0059035 Ga0495638_0059035_142_1107 319
687 3300046460 Ga0495638_0191955 Ga0495638_0191955_91_1056 319
688 3300046461 Ga0495641_0033656 Ga0495641_0033656_75_1040 319
689 3300046462 Ga0495651_0008247 Ga0495651_0008247_283_1248 319
690 3300046463 Ga0495653_0003419 Ga0495653_0003419_2928_3893 319
691 3300046463 Ga0495653_0005597 Ga0495653_0005597_8162_9127 319
692 3300046463 Ga0495653_0056210 Ga0495653_0056210_1442_2407 319
693 3300046463 Ga0495653_0064185 Ga0495653_0064185_792_1757 319
694 3300046471 Ga0495650_0000512 Ga0495650_0000512_46764_47729 319
695 3300046471 Ga0495650_0002591 Ga0495650_0002591_2313_3275 319
696 3300046472 Ga0495580_0000565 Ga0495580_0000565_27084_28046 319
697 3300046472 Ga0495580_0000732 Ga0495580_0000732_3821_4786 319
698 3300046472 Ga0495580_0001414 Ga0495580_0001414_17938_18903 319
699 3300046472 Ga0495580_0004872 Ga0495580_0004872_4770_5735 319
700 3300046472 Ga0495580_0005358 Ga0495580_0005358_7334_8299 319
701 3300046472 Ga0495580_0112619 Ga0495580_0112619_796_1758 319
702 3300046473 Ga0495582_0003844 Ga0495582_0003844_4657_5622 319
703 3300046473 Ga0495582_0007274 Ga0495582_0007274_660_1625 319
704 3300046474 Ga0495605_0009040 Ga0495605_0009040_797_1762 319
705 3300046474 Ga0495605_0010080 Ga0495605_0010080_565_1530 319
706 3300046474 Ga0495605_0012986 Ga0495605_0012986_1071_2051 319
707 3300046474 Ga0495605_0034160 Ga0495605_0034160_1569_2549 319
708 3300046474 Ga0495605_0036290 Ga0495605_0036290_1056_2021 319
709 3300046474 Ga0495605_0049758 Ga0495605_0049758_612_1574 319
710 3300046475 Ga0495639_0001078 Ga0495639_0001078_6933_7898 319
711 3300046475 Ga0495639_0002606 Ga0495639_0002606_3699_4670 319
712 3300046475 Ga0495639_0175945 Ga0495639_0175945_15_980 319
713 3300046476 Ga0495662_0041606 Ga0495662_0041606_732_1697 319
714 3300046492 Ga0495585_0000012 Ga0495585_0000012_160167_161132 319
715 3300046492 Ga0495585_0000117 Ga0495585_0000117_33544_34509 319
716 3300046492 Ga0495585_0001095 Ga0495585_0001095_4860_5825 319
717 3300046492 Ga0495585_0003185 Ga0495585_0003185_6773_7738 319
718 3300046492 Ga0495585_0004031 Ga0495585_0004031_7513_8493 319
719 3300046500 Ga0495596_0000009 Ga0495596_0000009_19147_20127 319
720 3300046500 Ga0495596_0000568 Ga0495596_0000568_3842_4807 319
721 3300046500 Ga0495596_0037845 Ga0495596_0037845_587_1552 319
722 3300046500 Ga0495596_0083454 Ga0495596_0083454_16_981 319
723 3300046501 Ga0495607_0000249 Ga0495607_0000249_18016_18981 319
724 3300046501 Ga0495607_0004209 Ga0495607_0004209_5585_6550 319
725 3300046501 Ga0495607_0018159 Ga0495607_0018159_3329_4294 319
726 3300046501 Ga0495607_0060258 Ga0495607_0060258_658_1623 319
727 3300046501 Ga0495607_0116649 Ga0495607_0116649_92_1063 319
728 3300046506 Ga0495583_0015540 Ga0495583_0015540_2324_3286 319
729 3300046506 Ga0495583_0027261 Ga0495583_0027261_1535_2503 319
730 3300046507 Ga0495606_0000558 Ga0495606_0000558_19747_20712 319
731 3300046507 Ga0495606_0017701 Ga0495606_0017701_3847_4809 319
732 3300046507 Ga0495606_0018259 Ga0495606_0018259_3528_4490 319
733 3300046512 Ga0495610_0001269 Ga0495610_0001269_591_1556 319
734 3300046512 Ga0495610_0004430 Ga0495610_0004430_6481_7446 319
735 3300046512 Ga0495610_0017323 Ga0495610_0017323_401_1381 319
736 3300046513 Ga0495616_0001057 Ga0495616_0001057_1898_2863 319
737 3300046513 Ga0495616_0004925 Ga0495616_0004925_6847_7812 319
738 3300046513 Ga0495616_0012978 Ga0495616_0012978_2944_3924 319
739 3300046513 Ga0495616_0018672 Ga0495616_0018672_1414_2382 319
740 3300046513 Ga0495616_0033376 Ga0495616_0033376_352_1320 319
741 3300046515 Ga0495620_0009726 Ga0495620_0009726_1560_2531 319
742 3300046515 Ga0495620_0016364 Ga0495620_0016364_500_1462 319
743 3300046515 Ga0495620_0050109 Ga0495620_0050109_186_1151 319
744 3300046516 Ga0495628_0014834 Ga0495628_0014834_2435_3400 319
745 3300046516 Ga0495628_0022233 Ga0495628_0022233_768_1733 319
746 3300046516 Ga0495628_0099205 Ga0495628_0099205_674_1639 319
747 3300046516 Ga0495628_0153621 Ga0495628_0153621_747_1709 319
748 3300046516 Ga0495628_0187084 Ga0495628_0187084_94_1059 319
749 3300046517 Ga0495630_0018097 Ga0495630_0018097_364_1326 319
750 3300046517 Ga0495630_0046708 Ga0495630_0046708_2170_3135 319
751 3300046518 Ga0495631_0001503 Ga0495631_0001503_3026_4006 319
752 3300046518 Ga0495631_0004180 Ga0495631_0004180_3796_4767 319
753 3300046519 Ga0495632_0001429 Ga0495632_0001429_11328_12296 319
754 3300046519 Ga0495632_0002562 Ga0495632_0002562_1216_2181 319
755 3300046519 Ga0495632_0003293 Ga0495632_0003293_2519_3484 319
756 3300046519 Ga0495632_0011118 Ga0495632_0011118_3040_4020 319
757 3300046519 Ga0495632_0020699 Ga0495632_0020699_1686_2651 319
758 3300046519 Ga0495632_0033227 Ga0495632_0033227_1401_2381 319
759 3300046520 Ga0495637_0000440 Ga0495637_0000440_12099_13079 319
760 3300046520 Ga0495637_0004804 Ga0495637_0004804_4321_5286 319
761 3300046520 Ga0495637_0029286 Ga0495637_0029286_1394_2365 319
762 3300046520 Ga0495637_0040028 Ga0495637_0040028_418_1389 319
763 3300046522 Ga0495643_0002035 Ga0495643_0002035_4913_5878 319
764 3300046522 Ga0495643_0002080 Ga0495643_0002080_4035_5003 319
765 3300046522 Ga0495643_0006649 Ga0495643_0006649_5781_6746 319
766 3300046523 Ga0495644_0000615 Ga0495644_0000615_7243_8223 319
767 3300046524 Ga0495648_0002417 Ga0495648_0002417_5385_6350 319
768 3300046524 Ga0495648_0024092 Ga0495648_0024092_2298_3263 319
769 3300046524 Ga0495648_0032451 Ga0495648_0032451_796_1758 319
770 3300046524 Ga0495648_0042825 Ga0495648_0042825_605_1570 319
771 3300046524 Ga0495648_0081764 Ga0495648_0081764_792_1757 319
772 3300046524 Ga0495648_0084970 Ga0495648_0084970_142_1122 319
773 3300046526 Ga0495666_0000639 Ga0495666_0000639_3470_4435 319
774 3300046526 Ga0495666_0013027 Ga0495666_0013027_2880_3845 319
775 3300046526 Ga0495666_0106302 Ga0495666_0106302_221_1186 319
776 3300046528 Ga0495642_0003764 Ga0495642_0003764_4627_5592 319
777 3300046528 Ga0495642_0022832 Ga0495642_0022832_630_1595 319
778 3300046528 Ga0495642_0043021 Ga0495642_0043021_568_1536 319
779 3300046528 Ga0495642_0075809 Ga0495642_0075809_216_1181 319
780 3300046529 Ga0495652_0041516 Ga0495652_0041516_1779_2744 319
781 3300046530 Ga0495654_0000307 Ga0495654_0000307_34756_35724 319
782 3300046530 Ga0495654_0002236 Ga0495654_0002236_167_1138 319
783 3300046530 Ga0495654_0022057 Ga0495654_0022057_1693_2658 319
784 3300046530 Ga0495654_0031657 Ga0495654_0031657_528_1499 319
785 3300046531 Ga0495665_0000723 Ga0495665_0000723_4889_5854 319
786 3300046531 Ga0495665_0068272 Ga0495665_0068272_69_1034 319
787 3300046533 Ga0495640_0006926 Ga0495640_0006926_6899_7864 319
788 3300046535 Ga0495586_0010597 Ga0495586_0010597_1940_2905 319
789 3300046535 Ga0495586_0053592 Ga0495586_0053592_1064_2029 319
790 3300046535 Ga0495586_0056716 Ga0495586_0056716_181_1146 319
791 3300046536 Ga0495587_0014936 Ga0495587_0014936_1583_2548 319
792 3300046536 Ga0495587_0019203 Ga0495587_0019203_48_1013 319
793 3300046536 Ga0495587_0133415 Ga0495587_0133415_43_1008 319
794 3300046538 Ga0495609_0000858 Ga0495609_0000858_16595_17560 319
795 3300046538 Ga0495609_0001256 Ga0495609_0001256_776_1741 319
796 3300046538 Ga0495609_0003849 Ga0495609_0003849_2034_3002 319
797 3300046542 Ga0495597_0003895 Ga0495597_0003895_3091_4056 319
798 3300046542 Ga0495597_0006880 Ga0495597_0006880_2680_3645 319
799 3300046542 Ga0495597_0013121 Ga0495597_0013121_2102_3067 319
800 3300046542 Ga0495597_0016339 Ga0495597_0016339_1533_2513 319
801 3300046542 Ga0495597_0063449 Ga0495597_0063449_116_1087 319
802 3300046543 Ga0495645_0001771 Ga0495645_0001771_6643_7608 319
803 3300046543 Ga0495645_0034507 Ga0495645_0034507_177_1142 319
804 3300046543 Ga0495645_0039935 Ga0495645_0039935_498_1463 319
805 3300046543 Ga0495645_0174374 Ga0495645_0174374_408_1373 319
806 3300046557 Ga0495622_0000238 Ga0495622_0000238_30252_31217 319
807 3300046558 Ga0495633_0051969 Ga0495633_0051969_242_1204 319
808 3300046615 Ga0495656_0000109 Ga0495656_0000109_30097_31068 319
809 3300046615 Ga0495656_0095969 Ga0495656_0095969_323_1294 319
810 3300046616 Ga0495668_0000008 Ga0495668_0000008_427357_428334 319
811 3300046616 Ga0495668_0000902 Ga0495668_0000902_14003_14983 319
812 3300046642 Ga0495634_0029460 Ga0495634_0029460_287_1252 319
813 3300046648 Ga0495611_0001493 Ga0495611_0001493_1253_2218 319
814 3300046648 Ga0495611_0092048 Ga0495611_0092048_171_1136 319
815 3300046660 Ga0495625_0003794 Ga0495625_0003794_10412_11395 319
816 3300046660 Ga0495625_0019244 Ga0495625_0019244_4053_5033 319
817 3300046660 Ga0495625_0116613 Ga0495625_0116613_320_1291 319
818 3300046663 Ga0495635_0013024 Ga0495635_0013024_3801_4766 319
819 3300046663 Ga0495635_0093640 Ga0495635_0093640_366_1325 319
820 3300046664 Ga0495659_0000007 Ga0495659_0000007_55113_56084 319
821 3300046664 Ga0495659_0000941 Ga0495659_0000941_4713_5678 319
822 3300046664 Ga0495659_0019399 Ga0495659_0019399_642_1610 319
823 3300046665 Ga0495661_0000030 Ga0495661_0000030_130691_131656 319
824 3300046665 Ga0495661_0001352 Ga0495661_0001352_1353_2321 319
825 3300046665 Ga0495661_0011961 Ga0495661_0011961_3240_4205 319
826 3300046665 Ga0495661_0024388 Ga0495661_0024388_67_1032 319
827 3300046665 Ga0495661_0038889 Ga0495661_0038889_1515_2495 319
828 3300046665 Ga0495661_0052610 Ga0495661_0052610_1203_2183 319
829 3300046665 Ga0495661_0071655 Ga0495661_0071655_658_1623 319
830 3300046678 Ga0495599_0007701 Ga0495599_0007701_3571_4536 319
831 3300046678 Ga0495599_0101772 Ga0495599_0101772_404_1366 319
832 3300046679 Ga0495623_0006606 Ga0495623_0006606_225_1187 319
833 3300046679 Ga0495623_0013171 Ga0495623_0013171_3347_4312 319
834 3300046679 Ga0495623_0034783 Ga0495623_0034783_279_1244 319
835 3300046679 Ga0495623_0039349 Ga0495623_0039349_733_1698 319
836 3300046680 Ga0495646_0069646 Ga0495646_0069646_969_1934 319
837 3300046680 Ga0495646_0073169 Ga0495646_0073169_838_1803 319
838 3300046684 Ga0495669_0004287 Ga0495669_0004287_307_1275 319
839 3300046684 Ga0495669_0014788 Ga0495669_0014788_1548_2513 319
840 3300046690 Ga0495624_0003593 Ga0495624_0003593_6297_7262 319
841 3300046690 Ga0495624_0007720 Ga0495624_0007720_2852_3817 319
842 3300046690 Ga0495624_0013199 Ga0495624_0013199_682_1644 319
843 3300046690 Ga0495624_0135493 Ga0495624_0135493_502_1467 319
844 3300046690 Ga0495624_0144385 Ga0495624_0144385_160_1131 319
845 3300046691 Ga0495670_0000214 Ga0495670_0000214_7553_8518 319
846 3300046691 Ga0495670_0001274 Ga0495670_0001274_8782_9762 319
847 3300046692 Ga0495671_0000089 Ga0495671_0000089_48272_49243 319
848 3300046692 Ga0495671_0005874 Ga0495671_0005874_5131_6096 319
849 3300046692 Ga0495671_0009497 Ga0495671_0009497_3544_4524 319
850 3300046692 Ga0495671_0027207 Ga0495671_0027207_1789_2754 319
851 3300046692 Ga0495671_0028276 Ga0495671_0028276_1808_2776 319
852 3300046692 Ga0495671_0086621 Ga0495671_0086621_39_1004 319
853 3300046694 Ga0495649_0003519 Ga0495649_0003519_6823_7791 319
854 3300046694 Ga0495649_0005066 Ga0495649_0005066_1935_2900 319
855 3300046694 Ga0495649_0057032 Ga0495649_0057032_851_1816 319
856 3300046694 Ga0495649_0103240 Ga0495649_0103240_508_1473 319
857 3300046794 Ga0495589_0000826 Ga0495589_0000826_10954_11919 319
858 3300046794 Ga0495589_0002148 Ga0495589_0002148_9610_10590 319
859 3300046794 Ga0495589_0041417 Ga0495589_0041417_504_1469 319
860 3300046794 Ga0495589_0041494 Ga0495589_0041494_358_1323 319
861 3300046809 Ga0495600_0000462 Ga0495600_0000462_8749_9714 319
862 3300046809 Ga0495600_0024520 Ga0495600_0024520_345_1310 319
863 3300046810 Ga0495660_0000569 Ga0495660_0000569_16971_17942 319
864 3300046810 Ga0495660_0001245 Ga0495660_0001245_10804_11769 319
865 3300046810 Ga0495660_0003105 Ga0495660_0003105_5297_6262 319
866 3300046810 Ga0495660_0005454 Ga0495660_0005454_3687_4652 319
867 3300046810 Ga0495660_0011164 Ga0495660_0011164_4096_5061 319
868 3300046810 Ga0495660_0046606 Ga0495660_0046606_466_1446 319
869 3300046810 Ga0495660_0060969 Ga0495660_0060969_740_1711 319
870 3300047315 Ga0495581_0027898 Ga0495581_0027898_510_1475 319
871 3300047315 Ga0495581_0041159 Ga0495581_0041159_367_1332 319
872 3300047317 Ga0495604_0003957 Ga0495604_0003957_10627_11592 319
873 3300047317 Ga0495604_0004100 Ga0495604_0004100_7292_8257 319
874 3300047317 Ga0495604_0005896 Ga0495604_0005896_8611_9576 319
875 3300047317 Ga0495604_0055967 Ga0495604_0055967_107_1069 319
876 3300047318 Ga0495636_0003251 Ga0495636_0003251_1242_2207 319
877 3300047318 Ga0495636_0044296 Ga0495636_0044296_768_1736 319
878 3300047319 Ga0495674_0006200 Ga0495674_0006200_6408_7370 319
879 3300047319 Ga0495674_0017563 Ga0495674_0017563_3365_4330 319
880 3300047319 Ga0495674_0030020 Ga0495674_0030020_895_1860 319
881 3300047319 Ga0495674_0038994 Ga0495674_0038994_958_1923 319
882 3300047319 Ga0495674_0128402 Ga0495674_0128402_1009_1974 319
883 3300047319 Ga0495674_0164297 Ga0495674_0164297_767_1732 319
884 3300047320 Ga0495672_0002162 Ga0495672_0002162_8948_9919 319
885 3300047320 Ga0495672_0003927 Ga0495672_0003927_4025_5005 319
886 3300047320 Ga0495672_0009741 Ga0495672_0009741_4861_5826 319
887 3300047320 Ga0495672_0012390 Ga0495672_0012390_3364_4326 319
888 3300047320 Ga0495672_0067204 Ga0495672_0067204_546_1511 319
889 3300047321 Ga0495676_0018478 Ga0495676_0018478_115_1086 319
890 3300047322 Ga0495680_0007784 Ga0495680_0007784_8749_9714 319
891 3300047322 Ga0495680_0019784 Ga0495680_0019784_3980_4945 319
892 3300047322 Ga0495680_0030881 Ga0495680_0030881_969_1934 319
893 3300047322 Ga0495680_0290324 Ga0495680_0290324_117_1082 319
894 3300047323 Ga0495683_0003072 Ga0495683_0003072_5276_6256 319
895 3300047323 Ga0495683_0005277 Ga0495683_0005277_91_1056 319
896 3300047323 Ga0495683_0020913 Ga0495683_0020913_990_1955 319
897 3300047323 Ga0495683_0061698 Ga0495683_0061698_593_1558 319
898 3300047323 Ga0495683_0106197 Ga0495683_0106197_40_1005 319
899 3300047323 Ga0495683_0111084 Ga0495683_0111084_30_1010 319
900 3300047443 Ga0495687_006900 Ga0495687_006900_2874_3839 319
901 3300047443 Ga0495687_077393 Ga0495687_077393_26_994 319
902 3300047444 Ga0495675_0001279 Ga0495675_0001279_2914_3879 319
903 3300047444 Ga0495675_0013098 Ga0495675_0013098_4012_4977 319
904 3300047444 Ga0495675_0092370 Ga0495675_0092370_877_1842 319
905 3300047445 Ga0495677_0004045 Ga0495677_0004045_4162_5130 319
906 3300047446 Ga0495679_000012 Ga0495679_000012_169473_170435 319
907 3300047446 Ga0495679_004564 Ga0495679_004564_4025_4990 319
908 3300047447 Ga0495685_043549 Ga0495685_043549_553_1521 319
909 3300047469 Ga0495673_0025949 Ga0495673_0025949_1728_2693 319
910 3300047470 Ga0495681_0000276 Ga0495681_0000276_8084_9064 319
911 3300047470 Ga0495681_0001131 Ga0495681_0001131_13617_14597 319
912 3300047470 Ga0495681_0017993 Ga0495681_0017993_2417_3385 319
913 3300047470 Ga0495681_0123772 Ga0495681_0123772_82_1047 319
914 3300047471 Ga0495684_0017774 Ga0495684_0017774_3778_4743 319
915 3300047471 Ga0495684_0138485 Ga0495684_0138485_800_1765 319
916 3300047472 Ga0495686_0001473 Ga0495686_0001473_23082_24047 319
917 3300047472 Ga0495686_0001851 Ga0495686_0001851_20119_21084 319
918 3300047472 Ga0495686_0007666 Ga0495686_0007666_4218_5189 319
919 3300047472 Ga0495686_0168969 Ga0495686_0168969_88_1053 319
920 3300047673 Ga0495593_0006403 Ga0495593_0006403_1179_2144 319
921 3300047673 Ga0495593_0010286 Ga0495593_0010286_882_1853 319
922 3300047673 Ga0495593_0089126 Ga0495593_0089126_301_1266 319
923 3300048088 Ga0495602_0001170 Ga0495602_0001170_7396_8361 319
924 3300048088 Ga0495602_0064341 Ga0495602_0064341_256_1221 319
925 3300048088 Ga0495602_0066296 Ga0495602_0066296_90_1052 319
926 3300048088 Ga0495602_0119226 Ga0495602_0119226_964_1929 319
927 3300048089 Ga0495614_0002491 Ga0495614_0002491_4425_5390 319
928 3300048089 Ga0495614_0031760 Ga0495614_0031760_1039_2010 319
929 3300048091 Ga0495626_0001097 Ga0495626_0001097_3111_4091 319
930 3300048091 Ga0495626_0002678 Ga0495626_0002678_1590_2558 319
931 3300048091 Ga0495626_0050938 Ga0495626_0050938_613_1575 319
932 3300048091 Ga0495626_0057688 Ga0495626_0057688_425_1405 319
933 3300048091 Ga0495626_0064970 Ga0495626_0064970_392_1357 319
934 3300048091 Ga0495626_0104856 Ga0495626_0104856_222_1187 319
935 3300048903 Ga0496100_0000462 Ga0496100_0000462_3930_4895 319
936 3300048903 Ga0496100_0013731 Ga0496100_0013731_3136_4101 319
937 3300048903 Ga0496100_0014235 Ga0496100_0014235_2783_3754 319
938 3300048903 Ga0496100_0081929 Ga0496100_0081929_312_1277 319
939 3300048904 Ga0496101_0003095 Ga0496101_0003095_3910_4875 319
940 3300048904 Ga0496101_0004822 Ga0496101_0004822_729_1700 319
941 3300048904 Ga0496101_0027306 Ga0496101_0027306_2041_3006 319
942 3300048904 Ga0496101_0150744 Ga0496101_0150744_125_1090 319
943 3300048905 Ga0496102_0000128 Ga0496102_0000128_30394_31359 319
944 3300048905 Ga0496102_0013844 Ga0496102_0013844_3426_4391 319
945 3300048905 Ga0496102_0064098 Ga0496102_0064098_413_1384 319
946 3300048905 Ga0496102_0228923 Ga0496102_0228923_573_1544 319
947 3300048906 Ga0496103_0000852 Ga0496103_0000852_3906_4871 319
948 3300048906 Ga0496103_0012811 Ga0496103_0012811_1634_2599 319
949 3300048906 Ga0496103_0137921 Ga0496103_0137921_501_1472 319
950 3300048907 Ga0496104_0020210 Ga0496104_0020210_4559_5530 319
951 3300048907 Ga0496104_0060133 Ga0496104_0060133_1954_2919 319
952 3300048907 Ga0496104_0071708 Ga0496104_0071708_1330_2295 319
953 3300048907 Ga0496104_0403881 Ga0496104_0403881_191_1156 319
954 3300048908 Ga0496105_0001248 Ga0496105_0001248_4039_5010 319
955 3300048908 Ga0496105_0211561 Ga0496105_0211561_465_1430 319
956 3300048909 Ga0496106_0101960 Ga0496106_0101960_714_1679 319
957 3300048909 Ga0496106_0291016 Ga0496106_0291016_52_1023 319
958 3300048912 Ga0496109_0007956 Ga0496109_0007956_886_1854 319
959 3300048913 Ga0496110_0005888 Ga0496110_0005888_7676_8641 319
960 3300048913 Ga0496110_0078584 Ga0496110_0078584_1918_2889 319
961 3300048914 Ga0496111_0009596 Ga0496111_0009596_1857_2822 319
962 3300048915 Ga0496112_0098100 Ga0496112_0098100_799_1764 319
963 3300048916 Ga0496113_0006760 Ga0496113_0006760_664_1632 319
964 3300048916 Ga0496113_0022475 Ga0496113_0022475_717_1682 319
965 3300048917 Ga0496114_0001558 Ga0496114_0001558_4182_5147 319
966 3300048917 Ga0496114_0032838 Ga0496114_0032838_2386_3354 319
967 3300048918 Ga0496115_0033629 Ga0496115_0033629_2619_3584 319
968 3300048918 Ga0496115_0170141 Ga0496115_0170141_680_1645 319
969 3300048919 Ga0496116_0005292 Ga0496116_0005292_10301_11266 319
970 3300048919 Ga0496116_0014246 Ga0496116_0014246_2888_3859 319
971 3300048919 Ga0496116_0017297 Ga0496116_0017297_427_1392 319
972 3300048919 Ga0496116_0030472 Ga0496116_0030472_145_1116 319
973 3300048920 Ga0496117_0000906 Ga0496117_0000906_36538_37503 319
974 3300048920 Ga0496117_0002055 Ga0496117_0002055_5133_6101 319
975 3300048920 Ga0496117_0013486 Ga0496117_0013486_144_1109 319
976 3300048920 Ga0496117_0034715 Ga0496117_0034715_1053_2024 319
977 3300048920 Ga0496117_0035438 Ga0496117_0035438_99_1070 319
978 3300048920 Ga0496117_0038822 Ga0496117_0038822_1916_2878 319
979 3300048920 Ga0496117_0122792 Ga0496117_0122792_188_1195 319
980 3300048920 Ga0496117_0136858 Ga0496117_0136858_220_1185 319
981 3300048921 Ga0496118_0000079 Ga0496118_0000079_41223_42188 319
982 3300048921 Ga0496118_0001611 Ga0496118_0001611_31589_32554 319
983 3300048921 Ga0496118_0003533 Ga0496118_0003533_2305_3273 319
984 3300048921 Ga0496118_0007757 Ga0496118_0007757_9652_10623 319
985 3300048921 Ga0496118_0013681 Ga0496118_0013681_3151_4113 319
986 3300048921 Ga0496118_0028522 Ga0496118_0028522_818_1783 319
987 3300048921 Ga0496118_0040904 Ga0496118_0040904_820_1785 319
988 3300048924 Ga0496121_0000860 Ga0496121_0000860_22245_23210 319
989 3300048924 Ga0496121_0065118 Ga0496121_0065118_1775_2740 319
990 3300048924 Ga0496121_0075406 Ga0496121_0075406_1010_1975 319
991 3300048924 Ga0496121_0076790 Ga0496121_0076790_1315_2322 319
992 3300048924 Ga0496121_0137546 Ga0496121_0137546_830_1801 319
993 3300048924 Ga0496121_0144237 Ga0496121_0144237_442_1419 319
994 3300048925 Ga0496122_0000210 Ga0496122_0000210_110314_111282 319
995 3300048925 Ga0496122_0009575 Ga0496122_0009575_674_1639 319
996 3300048925 Ga0496122_0011814 Ga0496122_0011814_3169_4137 319
997 3300048925 Ga0496122_0059552 Ga0496122_0059552_832_1797 319
998 3300048926 Ga0496123_0000597 Ga0496123_0000597_16054_17022 319
999 3300048926 Ga0496123_0002298 Ga0496123_0002298_22034_22999 319
1000 3300048926 Ga0496123_0005120 Ga0496123_0005120_7767_8735 319
1001 3300048926 Ga0496123_0058317 Ga0496123_0058317_742_1707 319
1002 3300048926 Ga0496123_0121576 Ga0496123_0121576_362_1333 319
1003 3300048927 Ga0496124_0002813 Ga0496124_0002813_767_1735 319
1004 3300048927 Ga0496124_0027032 Ga0496124_0027032_545_1510 319
1005 3300048927 Ga0496124_0053851 Ga0496124_0053851_1091_2062 319
1006 3300048928 Ga0496125_0004747 Ga0496125_0004747_11850_12818 319
1007 3300048928 Ga0496125_0005386 Ga0496125_0005386_6335_7303 319
1008 3300048928 Ga0496125_0023627 Ga0496125_0023627_797_1768 319
1009 3300048928 Ga0496125_0089521 Ga0496125_0089521_776_1747 319
1010 3300048928 Ga0496125_0107296 Ga0496125_0107296_209_1174 319
1011 3300048929 Ga0496126_0004892 Ga0496126_0004892_63_1028 319
1012 3300048929 Ga0496126_0009877 Ga0496126_0009877_1010_1975 319
1013 3300048929 Ga0496126_0035961 Ga0496126_0035961_1965_2942 319
1014 3300049459 Ga0495678_002068 Ga0495678_002068_2869_3834 319
1015 3300049459 Ga0495678_008401 Ga0495678_008401_2538_3500 319
1016 3300049459 Ga0495678_015277 Ga0495678_015277_1058_2023 319
1017 3300049459 Ga0495678_030693 Ga0495678_030693_1201_2178 319
1018 3300049459 Ga0495678_037545 Ga0495678_037545_285_1250 319
1019 3300049460 Ga0495682_0000807 Ga0495682_0000807_17698_18663 319
1020 3300049460 Ga0495682_0046268 Ga0495682_0046268_584_1549 319
1021 3300049460 Ga0495682_0066329 Ga0495682_0066329_62_1027 319
1022 3300049569 Ga0501032_0020271 Ga0501032_0020271_741_1706 319
1023 3300049571 Ga0501034_0081791 Ga0501034_0081791_609_1574 319
1024 3300050493 nmdc:mga0k408_44348_c1 nmdc:mga0k408_44348_c1_1103_2074 319
1025 3300050496 nmdc:mga07m45_6982_c1 nmdc:mga07m45_6982_c1_3377_4348 319
1026 3300050514 nmdc:mga08x19_24566_c1 nmdc:mga08x19_24566_c1_794_1759 319
1027 3300053079 Ga0500610_0001394 Ga0500610_0001394_2306_3277 319
1028 3300053079 Ga0500610_0005581 Ga0500610_0005581_1773_2744 319
1029 3300053079 Ga0500610_0117281 Ga0500610_0117281_103_1074 319
1030 3300053093 Ga0500651_0000038 Ga0500651_0000038_32605_33576 319
1031 3300053110 Ga0500571_000054 Ga0500571_000054_20621_21592 319
1032 3300053117 Ga0500593_041892 Ga0500593_041892_215_1186 319
1033 3300053121 Ga0500607_013519 Ga0500607_013519_2955_3926 319
1034 3300053122 Ga0500608_003408 Ga0500608_003408_4264_5235 319
1035 3300053125 Ga0500618_026456 Ga0500618_026456_356_1330 319
1036 3300053133 Ga0500655_000123 Ga0500655_000123_18069_19040 319
1037 3300053134 Ga0500658_0000237 Ga0500658_0000237_20206_21177 319
1038 3300053134 Ga0500658_0000266 Ga0500658_0000266_14218_15189 319
1039 3300053136 Ga0500559_0008198 Ga0500559_0008198_3059_4030 319
1040 3300053136 Ga0500559_0013561 Ga0500559_0013561_90_1064 319
1041 3300053137 Ga0500561_0011937 Ga0500561_0011937_448_1419 319
1042 3300053139 Ga0500568_0005096 Ga0500568_0005096_1495_2466 319
1043 3300053161 Ga0500634_0015722 Ga0500634_0015722_2364_3335 319
1044 iso_pu_bacteria 2818991445 2819595163 319
1045 3300001915 JGI24741J21665_1000536 JGI24741J21665_10005364 320
1046 3300001979 JGI24740J21852_10000036 JGI24740J21852_1000003613 320
1047 3300001979 JGI24740J21852_10000873 JGI24740J21852_1000087310 320
1048 3300002705 JGI25156J39149_1009393 JGI25156J39149_10093931 320
1049 3300002738 JGI25154J39366_1000382 JGI25154J39366_10003821 320
1050 3300003187 JGI25151J46595_10004421 JGI25151J46595_100044215 320
1051 3300003751 Ga0055538_1001443 Ga0055538_10014433 320
1052 3300003751 Ga0055538_1001482 Ga0055538_10014823 320
1053 3300003751 Ga0055538_1004435 Ga0055538_10044352 320
1054 3300003752 Ga0055539_1000178 Ga0055539_100017810 320
1055 3300003756 Ga0055533_1000533 Ga0055533_10005337 320
1056 3300003756 Ga0055533_1002281 Ga0055533_10022813 320
1057 3300003756 Ga0055533_1007318 Ga0055533_10073182 320
1058 3300003758 Ga0055532_1000041 Ga0055532_100004110 320
1059 3300003759 Ga0055525_1000504 Ga0055525_100050411 320
1060 3300003761 Ga0055535_1000030 Ga0055535_1000030167 320
1061 3300003762 Ga0055542_1001883 Ga0055542_10018832 320
1062 3300003763 Ga0055529_1000058 Ga0055529_100005810 320
1063 3300003841 Ga0055541_1000264 Ga0055541_10002645 320
1064 3300003841 Ga0055541_1001811 Ga0055541_10018113 320
1065 3300005337 Ga0070682_100348359 Ga0070682_1003483591 320
1066 3300005344 Ga0070661_100000072 Ga0070661_10000007210 320
1067 3300005366 Ga0070659_100000307 Ga0070659_1000003072 320
1068 3300005455 Ga0070663_100000015 Ga0070663_100000015110 320
1069 3300005564 Ga0070664_100000058 Ga0070664_10000005854 320
1070 3300005577 Ga0068857_100009908 Ga0068857_1000099082 320
1071 3300005578 Ga0068854_100000025 Ga0068854_10000002511 320
1072 3300005614 Ga0068856_100000084 Ga0068856_10000008410 320
1073 3300009092 Ga0105250_10000526 Ga0105250_1000052620 320
1074 3300009093 Ga0105240_10025173 Ga0105240_100251733 320
1075 3300009176 Ga0105242_10001195 Ga0105242_100011959 320
1076 3300013100 Ga0157373_10008272 Ga0157373_100082722 320
1077 3300013102 Ga0157371_10000100 Ga0157371_1000010010 320
1078 3300013104 Ga0157370_10000004 Ga0157370_1000000410 320
1079 3300013105 Ga0157369_10014095 Ga0157369_100140954 320
1080 3300013306 Ga0163162_10318029 Ga0163162_103180291 320
1081 3300013307 Ga0157372_10001269 Ga0157372_1000126910 320
1082 3300015261 Ga0182006_1002577 Ga0182006_10025779 320
1083 3300020077 Ga0206351_10922417 Ga0206351_109224172 320
1084 3300020610 Ga0154015_1039511 Ga0154015_103951110 320
1085 3300025224 Ga0209784_100029 Ga0209784_100029328 320
1086 3300025224 Ga0209784_100768 Ga0209784_1007687 320
1087 3300025225 Ga0209566_100030 Ga0209566_10003010 320
1088 3300025225 Ga0209566_100662 Ga0209566_10066215 320
1089 3300025225 Ga0209566_102557 Ga0209566_1025573 320
1090 3300025226 Ga0209674_100081 Ga0209674_10008127 320
1091 3300025226 Ga0209674_100089 Ga0209674_10008979 320
1092 3300025226 Ga0209674_100123 Ga0209674_100123109 320
1093 3300025226 Ga0209674_102107 Ga0209674_1021072 320
1094 3300025228 Ga0209672_101173 Ga0209672_10117311 320
1095 3300025229 Ga0209147_100008 Ga0209147_100008712 320
1096 3300025230 Ga0209563_100186 Ga0209563_10018626 320
1097 3300025230 Ga0209563_107461 Ga0209563_1074612 320
1098 3300025242 Ga0209258_100013 Ga0209258_100013712 320
1099 3300025246 Ga0209646_1000065 Ga0209646_100006565 320
1100 3300025250 Ga0209026_1003642 Ga0209026_10036423 320
1101 3300025253 Ga0209677_100030 Ga0209677_10003010 320
1102 3300025254 Ga0209148_1000113 Ga0209148_1000113160 320
1103 3300025256 Ga0209759_1001115 Ga0209759_100111511 320
1104 3300025256 Ga0209759_1003524 Ga0209759_10035244 320
1105 3300025256 Ga0209759_1003635 Ga0209759_10036355 320
1106 3300025272 Ga0209455_1000106 Ga0209455_100010611 320
1107 3300025294 Ga0209025_1000034 Ga0209025_1000034369 320
1108 3300025303 Ga0209051_1012375 Ga0209051_10123752 320
1109 3300025913 Ga0207695_10002680 Ga0207695_100026805 320
1110 3300025920 Ga0207649_10002587 Ga0207649_1000258710 320
1111 3300025932 Ga0207690_10000722 Ga0207690_100007222 320
1112 3300025945 Ga0207679_10000038 Ga0207679_10000038110 320
1113 3300025981 Ga0207640_10000828 Ga0207640_1000082811 320
1114 3300026067 Ga0207678_10000021 Ga0207678_10000021109 320
1115 3300026078 Ga0207702_10000563 Ga0207702_1000056329 320
1116 3300026116 Ga0207674_10026194 Ga0207674_100261942 320
1117 3300037312 Ga0395899_0120476 Ga0395899_0120476_343_1305 320
1118 3300037418 Ga0395900_0029973 Ga0395900_0029973_2212_3180 320
1119 3300039447 Ga0436361_0126106 Ga0436361_0126106_135_1103 320
1120 3300044650 Ga0466986_0154337 Ga0466986_0154337_557_1525 320
1121 3300044658 Ga0466972_0003068 Ga0466972_0003068_4022_4990 320
1122 3300044671 Ga0466978_0000544 Ga0466978_0000544_8418_9386 320
1123 3300044693 Ga0466961_0000294 Ga0466961_0000294_22423_23391 320
1124 3300044706 Ga0466964_0009193 Ga0466964_0009193_2551_3519 320
1125 3300044765 Ga0466970_0000253 Ga0466970_0000253_15530_16498 320
1126 3300044842 Ga0466957_0055752 Ga0466957_0055752_541_1509 320
1127 3300045049 Ga0466959_0001112 Ga0466959_0001112_9945_10913 320
1128 3300045976 Ga0466967_0019948 Ga0466967_0019948_3362_4330 320
1129 3300046507 Ga0495606_0075837 Ga0495606_0075837_440_1426 320
1130 3300046542 Ga0495597_0036669 Ga0495597_0036669_337_1317 320
1131 3300046616 Ga0495668_0034135 Ga0495668_0034135_608_1588 320
1132 3300047317 Ga0495604_0178005 Ga0495604_0178005_115_1161 320
1133 3300047318 Ga0495636_0002953 Ga0495636_0002953_2647_3621 320
1134 3300047443 Ga0495687_013806 Ga0495687_013806_2988_3968 320
1135 3300048928 Ga0496125_0009624 Ga0496125_0009624_3857_4825 320
1136 3300049571 Ga0501034_0000423 Ga0501034_0000423_55513_56487 320
1137 3300061719 Ga0466962_0017363 Ga0466962_0017363_1271_2239 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

182

296

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b59-assembly1.cif.gz_F crystal structure of the mn(ii)-bound glyoxalase from novosphingobium aromaticivorans 0.7976 1 296
6l3w-assembly1.cif.gz_A crystal structure of bphc, a halotolerant catechol dioxygenase 0.7842 3 292
1mpy-assembly1.cif.gz_D structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 0.7825 3 291
1dhy-assembly1.cif.gz_A kks102 bphc enzyme 0.7743 6 292
5znh-assembly1.cif.gz_A catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2 0.7622 1 291
ID Description Score Start End Superfamily
3hq0A02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9083 153 283 3.10.180.10
1mpyA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9018 153 283 3.10.180.10
3b59D01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8944 147 269 3.10.180.10
5znhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8835 153 291 3.10.180.10
5zszA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8827 153 283 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6L5DCN2-F1-model_v4 deleted 0.9839 3 252
AF-A0A2E7F6N5-F1-model_v4 Glyoxalase 0.9834 3 305
AF-A0A561JH97-F1-model_v4 deleted 0.981 3 320
AF-A0A2S4T911-F1-model_v4 deleted 0.9796 4 309
AF-A0A2V5BLM7-F1-model_v4 deleted 0.979 4 309

Feature Viewer

pLDDT pTM Quality
93.29 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map