F490640
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1137 | 490 | 2274 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100307815|Ga0070660_1003078152 |
| Length | 235 |
| Sequence | MPSEVVDASPGLEAHHFSDAERDSFYRLIQARRDMRHFTRGARVESAVLARVLGAAHHAPSVGLMQPWRFIRISDGAIRERIATLVDAERLATAAALNQRGEAFLRLKVEGVRDCAELLVAALAPDDGTIFGRRTMPQEMALCSLACAVQNMWLAARAEHLGLGWVSMFEPEALARLLHMPEGARPLAVLCLGPVDRFYDAPMLEVEGWRQRHGVERAVFENAWGHWTPEHRPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 104 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 105 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 106 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 107 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 108 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 124 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 125 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 126 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 127 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 128 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 129 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 130 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 131 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 132 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 133 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 134 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 135 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 136 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 137 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 138 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 139 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 140 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 141 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 142 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 143 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 144 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 145 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 146 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 147 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 148 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 149 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 150 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 151 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 152 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 153 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 154 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 157 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 263 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 267 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 269 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 270 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 271 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 272 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 273 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 274 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 275 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 276 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 277 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 278 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 279 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 280 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 281 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 282 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 283 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 284 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 285 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 286 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 287 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 288 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 289 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 290 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 291 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 292 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 293 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 294 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 295 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 296 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 297 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 298 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 299 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 300 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 301 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 302 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 303 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 304 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 305 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 306 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 307 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 308 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 309 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 310 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 311 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 312 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 313 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 314 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 315 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 316 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 317 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 318 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 319 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 320 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 321 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 322 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 323 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 324 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 325 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 326 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 327 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 328 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 329 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 330 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 331 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 332 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 333 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 334 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 335 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 336 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 337 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 338 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 339 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 340 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 341 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 342 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 343 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 344 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 345 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 346 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 347 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 348 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 349 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 350 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 351 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 352 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 353 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 354 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 355 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 356 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 357 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 358 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 359 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 360 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 361 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 362 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 363 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 364 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 365 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 366 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 367 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 368 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 369 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 370 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 371 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 372 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 373 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 374 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 375 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 376 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 377 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 378 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 379 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 380 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 381 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 382 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 383 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 384 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 385 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 386 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 387 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 388 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 389 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 390 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 391 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 392 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 393 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 394 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 395 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 396 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 397 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 398 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 399 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 400 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 401 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 402 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 403 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 404 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 405 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 406 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 407 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 408 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 409 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 410 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 411 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 412 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 413 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 414 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 415 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 416 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 417 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 418 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 419 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 420 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 421 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 422 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 423 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 424 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 425 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 426 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 427 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 428 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 429 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 430 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 431 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 432 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 433 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 434 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 435 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 436 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 437 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 438 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 439 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 440 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 441 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 442 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 443 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 444 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 445 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 446 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 447 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 448 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 449 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 450 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 451 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 452 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 453 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 454 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 455 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 456 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 457 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 458 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 459 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 460 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 461 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 462 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 463 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 464 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 465 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 466 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 467 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 468 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 469 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 470 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 471 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 472 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 473 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 474 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 475 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 476 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 477 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 478 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 479 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 480 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 481 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 482 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 483 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 484 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 485 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 486 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 487 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 488 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 489 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 490 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.56 |
| Metatranscriptomes | 0 |
| Isolates | 19.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 6.6 |
| Nodule | 2.02 |
| Rhizoplane | 6.86 |
| Rhizosphere | 72.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_100307815 | 3300005339 | Bacteria | 1300 |
| 2 | MRS2a_Contig_22 | 2124908027 | Bacteria | 54424 |
| 3 | JGI25162J39368_1000401 | 3300002737 | Bacteria | 36292 |
| 4 | JGI25162J39368_1000412 | 3300002737 | Bacteria | 34976 |
| 5 | JGI25163J39215_1000492 | 3300002771 | Bacteria | 11795 |
| 6 | JGI25163J39215_1000600 | 3300002771 | Bacteria | 10019 |
| 7 | JGI25164J39214_1000282 | 3300002772 | Bacteria | 36292 |
| 8 | JGI25164J39214_1000291 | 3300002772 | Bacteria | 34976 |
| 9 | JGI25165J46597_1000520 | 3300003214 | Bacteria | 36292 |
| 10 | JGI25165J46597_1000538 | 3300003214 | Bacteria | 34976 |
| 11 | Ga0055539_1000036 | 3300003752 | Bacteria | 216576 |
| 12 | Ga0055533_1000046 | 3300003756 | Bacteria | 216576 |
| 13 | Ga0055532_1000032 | 3300003758 | Bacteria | 216568 |
| 14 | Ga0055525_1000672 | 3300003759 | Bacteria | 13111 |
| 15 | Ga0055536_1000111 | 3300003781 | Bacteria | 71634 |
| 16 | Ga0055536_1002092 | 3300003781 | Bacteria | 11380 |
| 17 | Ga0055536_1002185 | 3300003781 | Bacteria | 11136 |
| 18 | Ga0055530_10000146 | 3300003791 | Bacteria | 63397 |
| 19 | Ga0055530_10000299 | 3300003791 | Bacteria | 45066 |
| 20 | Ga0055530_10000634 | 3300003791 | Bacteria | 30257 |
| 21 | Ga0055530_10043420 | 3300003791 | Bacteria | 1084 |
| 22 | Ga0055540_1000069 | 3300003792 | Bacteria | 119560 |
| 23 | Ga0055540_1000289 | 3300003792 | Bacteria | 45066 |
| 24 | Ga0055540_1000390 | 3300003792 | Bacteria | 36134 |
| 25 | Ga0055540_1005124 | 3300003792 | Bacteria | 5635 |
| 26 | Ga0055531_10000546 | 3300003794 | Bacteria | 33355 |
| 27 | Ga0055531_10000989 | 3300003794 | Bacteria | 22593 |
| 28 | Ga0055541_1000024 | 3300003841 | Bacteria | 216576 |
| 29 | Ga0065714_10000155 | 3300005288 | Bacteria | 8748 |
| 30 | Ga0065714_10003231 | 3300005288 | Bacteria | 8635 |
| 31 | Ga0065714_10007589 | 3300005288 | Bacteria | 3078 |
| 32 | Ga0065714_10069585 | 3300005288 | Bacteria | 4162 |
| 33 | Ga0065714_10069674 | 3300005288 | Bacteria | 4134 |
| 34 | Ga0065714_10088198 | 3300005288 | Bacteria | 2025 |
| 35 | Ga0065714_10097127 | 3300005288 | Bacteria | 1744 |
| 36 | Ga0065712_10004565 | 3300005290 | Bacteria | 8485 |
| 37 | Ga0065715_10048988 | 3300005293 | Bacteria | 1001 |
| 38 | Ga0070670_100001764 | 3300005331 | Bacteria | 17597 |
| 39 | Ga0070661_100000008 | 3300005344 | Bacteria | 183494 |
| 40 | Ga0070661_100006145 | 3300005344 | Bacteria | 8273 |
| 41 | Ga0070669_100011983 | 3300005353 | Bacteria | 6153 |
| 42 | Ga0070669_100034121 | 3300005353 | Bacteria | 3684 |
| 43 | Ga0070659_100000661 | 3300005366 | Bacteria | 25049 |
| 44 | Ga0070713_100043129 | 3300005436 | Bacteria | 3686 |
| 45 | Ga0070713_100152822 | 3300005436 | Bacteria | 2055 |
| 46 | Ga0070662_100000966 | 3300005457 | Bacteria | 17611 |
| 47 | Ga0070662_100034164 | 3300005457 | Bacteria | 3584 |
| 48 | Ga0070665_100062992 | 3300005548 | Bacteria | 3718 |
| 49 | Ga0070664_100000075 | 3300005564 | Bacteria | 62615 |
| 50 | Ga0070664_100096996 | 3300005564 | Bacteria | 2559 |
| 51 | Ga0070664_100116306 | 3300005564 | Bacteria | 2338 |
| 52 | Ga0068854_100009394 | 3300005578 | Bacteria | 6315 |
| 53 | Ga0068851_10000090 | 3300005834 | Bacteria | 50197 |
| 54 | Ga0068860_100388784 | 3300005843 | Bacteria | 1378 |
| 55 | Ga0075364_10045866 | 3300006051 | Bacteria | 2845 |
| 56 | Ga0075364_10068318 | 3300006051 | Bacteria | 2337 |
| 57 | Ga0075364_10127703 | 3300006051 | Bacteria | 1705 |
| 58 | Ga0075364_10291559 | 3300006051 | Bacteria | 1110 |
| 59 | Ga0075432_10000688 | 3300006058 | Bacteria | 10409 |
| 60 | Ga0075432_10009218 | 3300006058 | Bacteria | 3360 |
| 61 | Ga0075432_10009458 | 3300006058 | Bacteria | 3319 |
| 62 | Ga0075432_10027010 | 3300006058 | Bacteria | 1974 |
| 63 | Ga0075432_10053913 | 3300006058 | Bacteria | 1423 |
| 64 | Ga0075362_10021708 | 3300006177 | Bacteria | 2698 |
| 65 | Ga0075362_10106258 | 3300006177 | Bacteria | 1317 |
| 66 | Ga0075369_10041696 | 3300006186 | Bacteria | 1966 |
| 67 | Ga0075436_100284960 | 3300006914 | Bacteria | 1182 |
| 68 | Ga0079104_1000433 | 3300006946 | Bacteria | 47726 |
| 69 | Ga0099826_10074040 | 3300006948 | Bacteria | 2149 |
| 70 | Ga0105251_10000035 | 3300009011 | Bacteria | 117861 |
| 71 | Ga0105251_10002567 | 3300009011 | Bacteria | 14090 |
| 72 | Ga0105251_10002666 | 3300009011 | Bacteria | 13754 |
| 73 | Ga0105251_10003048 | 3300009011 | Bacteria | 12477 |
| 74 | Ga0105251_10003895 | 3300009011 | Bacteria | 10610 |
| 75 | Ga0105251_10005493 | 3300009011 | Bacteria | 8260 |
| 76 | Ga0105251_10022317 | 3300009011 | Bacteria | 3287 |
| 77 | Ga0105251_10029142 | 3300009011 | Bacteria | 2783 |
| 78 | Ga0105251_10128304 | 3300009011 | Bacteria | 1150 |
| 79 | Ga0105251_10140331 | 3300009011 | Bacteria | 1093 |
| 80 | Ga0105244_10001613 | 3300009036 | Bacteria | 17879 |
| 81 | Ga0105244_10001867 | 3300009036 | Bacteria | 16371 |
| 82 | Ga0105244_10002481 | 3300009036 | Bacteria | 13895 |
| 83 | Ga0105244_10014024 | 3300009036 | Bacteria | 4652 |
| 84 | Ga0105244_10016862 | 3300009036 | Bacteria | 4148 |
| 85 | Ga0105244_10032459 | 3300009036 | Bacteria | 2763 |
| 86 | Ga0105244_10038892 | 3300009036 | Bacteria | 2478 |
| 87 | Ga0105244_10057541 | 3300009036 | Bacteria | 1964 |
| 88 | Ga0105244_10063174 | 3300009036 | Bacteria | 1860 |
| 89 | Ga0105244_10081924 | 3300009036 | Bacteria | 1596 |
| 90 | Ga0105250_10000495 | 3300009092 | Bacteria | 27711 |
| 91 | Ga0105250_10002395 | 3300009092 | Bacteria | 9449 |
| 92 | Ga0105250_10003531 | 3300009092 | Bacteria | 7368 |
| 93 | Ga0105250_10057928 | 3300009092 | Bacteria | 1555 |
| 94 | Ga0105250_10081989 | 3300009092 | Bacteria | 1308 |
| 95 | Ga0105250_10159778 | 3300009092 | Bacteria | 941 |
| 96 | Ga0105240_10050963 | 3300009093 | Bacteria | 5213 |
| 97 | Ga0105243_10000582 | 3300009148 | Bacteria | 36687 |
| 98 | Ga0105243_10004457 | 3300009148 | Bacteria | 11067 |
| 99 | Ga0105243_10169678 | 3300009148 | Bacteria | 1888 |
| 100 | Ga0105243_10711144 | 3300009148 | Bacteria | 980 |
| 101 | Ga0105242_10002684 | 3300009176 | Bacteria | 13916 |
| 102 | Ga0105248_10142757 | 3300009177 | Bacteria | 2701 |
| 103 | Ga0105237_10000856 | 3300009545 | Bacteria | 41326 |
| 104 | Ga0105237_10099100 | 3300009545 | Bacteria | 2906 |
| 105 | Ga0105238_10000104 | 3300009551 | Bacteria | 94726 |
| 106 | Ga0105246_10001063 | 3300011119 | Bacteria | 15870 |
| 107 | Ga0105246_10001690 | 3300011119 | Bacteria | 13160 |
| 108 | Ga0105246_10005393 | 3300011119 | Bacteria | 7786 |
| 109 | Ga0105246_10015548 | 3300011119 | Bacteria | 4808 |
| 110 | Ga0157345_1000092 | 3300012498 | Bacteria | 18966 |
| 111 | Ga0157373_10006136 | 3300013100 | Bacteria | 8985 |
| 112 | Ga0157373_10008708 | 3300013100 | Bacteria | 7526 |
| 113 | Ga0157373_10013392 | 3300013100 | Bacteria | 6016 |
| 114 | Ga0157373_10025865 | 3300013100 | Bacteria | 4242 |
| 115 | Ga0157373_10030940 | 3300013100 | Bacteria | 3851 |
| 116 | Ga0157373_10045393 | 3300013100 | Bacteria | 3136 |
| 117 | Ga0157373_10076175 | 3300013100 | Bacteria | 2367 |
| 118 | Ga0157373_10085324 | 3300013100 | Bacteria | 2225 |
| 119 | Ga0157373_10128283 | 3300013100 | Bacteria | 1784 |
| 120 | Ga0157371_10000301 | 3300013102 | Bacteria | 65021 |
| 121 | Ga0157371_10000923 | 3300013102 | Bacteria | 32990 |
| 122 | Ga0157371_10003583 | 3300013102 | Bacteria | 13992 |
| 123 | Ga0157371_10027931 | 3300013102 | Bacteria | 4089 |
| 124 | Ga0157371_10035712 | 3300013102 | Bacteria | 3561 |
| 125 | Ga0157371_10280325 | 3300013102 | Bacteria | 1204 |
| 126 | Ga0157371_10351483 | 3300013102 | Bacteria | 1073 |
| 127 | Ga0157370_10017887 | 3300013104 | Bacteria | 7140 |
| 128 | Ga0157370_10031592 | 3300013104 | Bacteria | 5178 |
| 129 | Ga0157370_10074599 | 3300013104 | Bacteria | 3200 |
| 130 | Ga0157370_10284331 | 3300013104 | Bacteria | 1528 |
| 131 | Ga0157370_10309548 | 3300013104 | Bacteria | 1457 |
| 132 | Ga0157370_10323062 | 3300013104 | Bacteria | 1423 |
| 133 | Ga0157370_10504723 | 3300013104 | Bacteria | 1111 |
| 134 | Ga0157369_10006951 | 3300013105 | Bacteria | 13053 |
| 135 | Ga0157369_10010446 | 3300013105 | Bacteria | 10576 |
| 136 | Ga0157369_10012750 | 3300013105 | Bacteria | 9531 |
| 137 | Ga0157369_10013118 | 3300013105 | Bacteria | 9378 |
| 138 | Ga0157369_10178164 | 3300013105 | Bacteria | 2237 |
| 139 | Ga0157369_10437425 | 3300013105 | Bacteria | 1355 |
| 140 | Ga0163162_10001480 | 3300013306 | Bacteria | 21867 |
| 141 | Ga0163162_10309368 | 3300013306 | Bacteria | 1712 |
| 142 | Ga0157372_10001752 | 3300013307 | Bacteria | 23529 |
| 143 | Ga0157372_10007278 | 3300013307 | Bacteria | 11786 |
| 144 | Ga0157375_10003908 | 3300013308 | Bacteria | 12926 |
| 145 | Ga0157375_10004458 | 3300013308 | Bacteria | 12157 |
| 146 | Ga0157375_10263340 | 3300013308 | Bacteria | 1886 |
| 147 | Ga0182008_10000586 | 3300014497 | Bacteria | 26857 |
| 148 | Ga0182008_10005642 | 3300014497 | Bacteria | 7089 |
| 149 | Ga0182008_10008490 | 3300014497 | Bacteria | 5610 |
| 150 | Ga0182008_10033357 | 3300014497 | Bacteria | 2583 |
| 151 | Ga0182008_10040977 | 3300014497 | Bacteria | 2311 |
| 152 | Ga0182008_10055521 | 3300014497 | Bacteria | 1958 |
| 153 | Ga0182006_1000844 | 3300015261 | Bacteria | 20589 |
| 154 | Ga0182006_1001609 | 3300015261 | Bacteria | 13350 |
| 155 | Ga0182006_1002617 | 3300015261 | Bacteria | 9730 |
| 156 | Ga0182006_1011672 | 3300015261 | Bacteria | 3860 |
| 157 | Ga0182006_1016891 | 3300015261 | Bacteria | 3109 |
| 158 | Ga0182006_1020813 | 3300015261 | Bacteria | 2744 |
| 159 | Ga0182006_1056747 | 3300015261 | Bacteria | 1490 |
| 160 | Ga0182006_1089108 | 3300015261 | Bacteria | 1113 |
| 161 | Ga0182007_10001369 | 3300015262 | Bacteria | 13114 |
| 162 | Ga0182005_1000309 | 3300015265 | Bacteria | 29451 |
| 163 | Ga0182005_1007643 | 3300015265 | Bacteria | 3229 |
| 164 | Ga0182005_1071976 | 3300015265 | Bacteria | 950 |
| 165 | Ga0163161_10002455 | 3300017792 | Bacteria | 13234 |
| 166 | Ga0163161_10006272 | 3300017792 | Bacteria | 8232 |
| 167 | Ga0163161_10024958 | 3300017792 | Bacteria | 4226 |
| 168 | Ga0163161_10065059 | 3300017792 | Bacteria | 2661 |
| 169 | Ga0163161_10075842 | 3300017792 | Bacteria | 2468 |
| 170 | Ga0163161_10085706 | 3300017792 | Bacteria | 2324 |
| 171 | Ga0163161_10198994 | 3300017792 | Bacteria | 1543 |
| 172 | Ga0163161_10449339 | 3300017792 | Bacteria | 1042 |
| 173 | Ga0163161_10488939 | 3300017792 | Bacteria | 1000 |
| 174 | Ga0209435_101107 | 3300025206 | Bacteria | 3731 |
| 175 | Ga0209760_100028 | 3300025207 | Bacteria | 153020 |
| 176 | Ga0209760_100163 | 3300025207 | Bacteria | 39216 |
| 177 | Ga0209784_100017 | 3300025224 | Bacteria | 472003 |
| 178 | Ga0209566_100014 | 3300025225 | Bacteria | 472003 |
| 179 | Ga0209674_100028 | 3300025226 | Bacteria | 472003 |
| 180 | Ga0209147_100038 | 3300025229 | Bacteria | 314497 |
| 181 | Ga0209563_100032 | 3300025230 | Bacteria | 472003 |
| 182 | Ga0209563_101390 | 3300025230 | Bacteria | 6501 |
| 183 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 184 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 185 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 186 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 187 | Ga0209437_103202 | 3300025233 | Bacteria | 2997 |
| 188 | Ga0209258_100197 | 3300025242 | Bacteria | 124028 |
| 189 | Ga0209646_1000171 | 3300025246 | Bacteria | 84951 |
| 190 | Ga0209677_100018 | 3300025253 | Bacteria | 472003 |
| 191 | Ga0209759_1008291 | 3300025256 | Bacteria | 3252 |
| 192 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 193 | Ga0209233_1000086 | 3300025261 | Bacteria | 331687 |
| 194 | Ga0209675_1002687 | 3300025291 | Bacteria | 8958 |
| 195 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 196 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 197 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 198 | Ga0209676_1002053 | 3300025292 | Bacteria | 15749 |
| 199 | Ga0209676_1006188 | 3300025292 | Bacteria | 5988 |
| 200 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 201 | Ga0209050_1000399 | 3300025298 | Bacteria | 81236 |
| 202 | Ga0209050_1000477 | 3300025298 | Bacteria | 70798 |
| 203 | Ga0209050_1001590 | 3300025298 | Bacteria | 23488 |
| 204 | Ga0209051_1000034 | 3300025303 | Bacteria | 371498 |
| 205 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 206 | Ga0209051_1000086 | 3300025303 | Bacteria | 183550 |
| 207 | Ga0209051_1000106 | 3300025303 | Bacteria | 159222 |
| 208 | Ga0209051_1007908 | 3300025303 | Bacteria | 5731 |
| 209 | Ga0209257_1000604 | 3300025304 | Bacteria | 59301 |
| 210 | Ga0209257_1005114 | 3300025304 | Bacteria | 9504 |
| 211 | Ga0207656_10000066 | 3300025321 | Bacteria | 39833 |
| 212 | Ga0207696_1000025 | 3300025711 | Bacteria | 418650 |
| 213 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 214 | Ga0207696_1001836 | 3300025711 | Bacteria | 10916 |
| 215 | Ga0207696_1008639 | 3300025711 | Bacteria | 3870 |
| 216 | Ga0207696_1018130 | 3300025711 | Bacteria | 2317 |
| 217 | Ga0207655_1000095 | 3300025728 | Bacteria | 195899 |
| 218 | Ga0207655_1000113 | 3300025728 | Bacteria | 167376 |
| 219 | Ga0207655_1000448 | 3300025728 | Bacteria | 54335 |
| 220 | Ga0207655_1000863 | 3300025728 | Bacteria | 32224 |
| 221 | Ga0207655_1003193 | 3300025728 | Bacteria | 12347 |
| 222 | Ga0207655_1005111 | 3300025728 | Bacteria | 9044 |
| 223 | Ga0207655_1009586 | 3300025728 | Bacteria | 5998 |
| 224 | Ga0207655_1009939 | 3300025728 | Bacteria | 5842 |
| 225 | Ga0207655_1013219 | 3300025728 | Bacteria | 4754 |
| 226 | Ga0207655_1018885 | 3300025728 | Bacteria | 3633 |
| 227 | Ga0207655_1022579 | 3300025728 | Bacteria | 3148 |
| 228 | Ga0207655_1031638 | 3300025728 | Bacteria | 2434 |
| 229 | Ga0207655_1044735 | 3300025728 | Bacteria | 1857 |
| 230 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 231 | Ga0207713_1000618 | 3300025735 | Bacteria | 34875 |
| 232 | Ga0207713_1000900 | 3300025735 | Bacteria | 26916 |
| 233 | Ga0207713_1002263 | 3300025735 | Bacteria | 14203 |
| 234 | Ga0207713_1004985 | 3300025735 | Bacteria | 8470 |
| 235 | Ga0207713_1005086 | 3300025735 | Bacteria | 8348 |
| 236 | Ga0207713_1013164 | 3300025735 | Bacteria | 4377 |
| 237 | Ga0207713_1015895 | 3300025735 | Bacteria | 3843 |
| 238 | Ga0207713_1029027 | 3300025735 | Bacteria | 2485 |
| 239 | Ga0207695_10003700 | 3300025913 | Bacteria | 21312 |
| 240 | Ga0207671_10000035 | 3300025914 | Bacteria | 237603 |
| 241 | Ga0207671_10069661 | 3300025914 | Bacteria | 2621 |
| 242 | Ga0207657_10312116 | 3300025919 | Bacteria | 1244 |
| 243 | Ga0207649_10000017 | 3300025920 | Bacteria | 225193 |
| 244 | Ga0207649_10009703 | 3300025920 | Bacteria | 5272 |
| 245 | Ga0207681_10000601 | 3300025923 | Bacteria | 24426 |
| 246 | Ga0207681_10074862 | 3300025923 | Bacteria | 2373 |
| 247 | Ga0207694_10000188 | 3300025924 | Bacteria | 62768 |
| 248 | Ga0207650_10000180 | 3300025925 | Bacteria | 74406 |
| 249 | Ga0207650_10000181 | 3300025925 | Bacteria | 73955 |
| 250 | Ga0207664_10865293 | 3300025929 | Bacteria | 812 |
| 251 | Ga0207690_10004527 | 3300025932 | Bacteria | 8209 |
| 252 | Ga0207706_10000796 | 3300025933 | Bacteria | 32646 |
| 253 | Ga0207706_10025652 | 3300025933 | Bacteria | 5280 |
| 254 | Ga0207686_10089845 | 3300025934 | Bacteria | 2025 |
| 255 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 256 | Ga0207709_10007205 | 3300025935 | Bacteria | 6207 |
| 257 | Ga0207709_10024526 | 3300025935 | Bacteria | 3445 |
| 258 | Ga0207709_10126649 | 3300025935 | Bacteria | 1733 |
| 259 | Ga0207711_10089332 | 3300025941 | Bacteria | 2707 |
| 260 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 261 | Ga0207679_10009601 | 3300025945 | Bacteria | 6202 |
| 262 | Ga0207679_10061911 | 3300025945 | Bacteria | 2787 |
| 263 | Ga0207679_10460916 | 3300025945 | Bacteria | 1129 |
| 264 | Ga0207658_10002103 | 3300025986 | Bacteria | 14810 |
| 265 | Ga0207639_10002369 | 3300026041 | Bacteria | 12662 |
| 266 | Ga0207678_10352375 | 3300026067 | Bacteria | 1269 |
| 267 | Ga0209281_1000331 | 3300027111 | Bacteria | 81645 |
| 268 | Ga0209281_1002909 | 3300027111 | Bacteria | 6189 |
| 269 | Ga0207428_10034656 | 3300027907 | Bacteria | 4134 |
| 270 | Ga0207428_10085823 | 3300027907 | Bacteria | 2451 |
| 271 | Ga0207428_10135257 | 3300027907 | Bacteria | 1885 |
| 272 | Ga0207428_10136129 | 3300027907 | Bacteria | 1878 |
| 273 | Ga0207428_10215875 | 3300027907 | Bacteria | 1440 |
| 274 | Ga0207428_10247350 | 3300027907 | Bacteria | 1331 |
| 275 | Ga0268266_10024215 | 3300028379 | Bacteria | 5166 |
| 276 | Ga0268266_10066941 | 3300028379 | Bacteria | 3108 |
| 277 | Ga0316177_1109751 | 3300030731 | Bacteria | 1535 |
| 278 | Ga0314311_1236500 | 3300030733 | Bacteria | 4959 |
| 279 | Ga0316179_1017521 | 3300030734 | Bacteria | 1923 |
| 280 | Ga0316178_1065336 | 3300030735 | Bacteria | 11847 |
| 281 | Ga0316181_1231115 | 3300030744 | Bacteria | 2330 |
| 282 | Ga0307509_10099630 | 3300031507 | Bacteria | 2947 |
| 283 | Ga0307408_100000178 | 3300031548 | Bacteria | 71389 |
| 284 | Ga0307408_100001335 | 3300031548 | Bacteria | 18502 |
| 285 | Ga0307408_100001910 | 3300031548 | Bacteria | 15142 |
| 286 | Ga0307408_100014758 | 3300031548 | Bacteria | 5193 |
| 287 | Ga0307408_100018978 | 3300031548 | Bacteria | 4624 |
| 288 | Ga0307514_10210001 | 3300031649 | Bacteria | 1210 |
| 289 | Ga0307405_10000552 | 3300031731 | Bacteria | 14222 |
| 290 | Ga0307405_10000990 | 3300031731 | Bacteria | 11426 |
| 291 | Ga0307405_10027798 | 3300031731 | Bacteria | 3285 |
| 292 | Ga0307405_10223733 | 3300031731 | Bacteria | 1382 |
| 293 | Ga0307405_10330254 | 3300031731 | Bacteria | 1168 |
| 294 | Ga0307413_10005313 | 3300031824 | Bacteria | 5730 |
| 295 | Ga0307413_10130254 | 3300031824 | Bacteria | 1720 |
| 296 | Ga0307406_10049760 | 3300031901 | Bacteria | 2653 |
| 297 | Ga0307406_10066009 | 3300031901 | Bacteria | 2353 |
| 298 | Ga0307407_10043150 | 3300031903 | Bacteria | 2533 |
| 299 | Ga0307412_10003296 | 3300031911 | Bacteria | 8956 |
| 300 | Ga0307412_10005665 | 3300031911 | Bacteria | 7018 |
| 301 | Ga0307412_10006635 | 3300031911 | Bacteria | 6555 |
| 302 | Ga0307412_10066774 | 3300031911 | Bacteria | 2439 |
| 303 | Ga0307412_10077798 | 3300031911 | Bacteria | 2282 |
| 304 | Ga0307412_10439773 | 3300031911 | Bacteria | 1071 |
| 305 | Ga0307409_100064872 | 3300031995 | Bacteria | 2871 |
| 306 | Ga0307414_10075326 | 3300032004 | Bacteria | 2448 |
| 307 | Ga0307411_10032986 | 3300032005 | Bacteria | 3206 |
| 308 | Ga0307411_10042272 | 3300032005 | Bacteria | 2906 |
| 309 | Ga0307411_10181163 | 3300032005 | Bacteria | 1599 |
| 310 | Ga0307411_10784732 | 3300032005 | Bacteria | 837 |
| 311 | Ga0307510_10003699 | 3300033180 | Bacteria | 17868 |
| 312 | Ga0395899_0564784 | 3300037312 | Bacteria | 729 |
| 313 | Ga0395898_0156071 | 3300037466 | Unclassified | 2183 |
| 314 | Ga0395901_0204380 | 3300038443 | Bacteria | 2070 |
| 315 | Ga0237819_01289 | 3300038705 | Bacteria | 6787 |
| 316 | Ga0439438_000136 | 3300041405 | Bacteria | 33194 |
| 317 | Ga0439438_000334 | 3300041405 | Bacteria | 21115 |
| 318 | Ga0439438_001203 | 3300041405 | Bacteria | 11486 |
| 319 | Ga0439438_001273 | 3300041405 | Bacteria | 11143 |
| 320 | Ga0439438_001571 | 3300041405 | Bacteria | 10033 |
| 321 | Ga0439438_005644 | 3300041405 | Bacteria | 4562 |
| 322 | Ga0439438_009653 | 3300041405 | Bacteria | 3109 |
| 323 | Ga0439438_018487 | 3300041405 | Bacteria | 1984 |
| 324 | Ga0439447_000868 | 3300041407 | Bacteria | 11089 |
| 325 | Ga0439447_003113 | 3300041407 | Bacteria | 5920 |
| 326 | Ga0439447_004927 | 3300041407 | Bacteria | 4516 |
| 327 | Ga0439447_007527 | 3300041407 | Bacteria | 3448 |
| 328 | Ga0439447_008422 | 3300041407 | Bacteria | 3191 |
| 329 | Ga0439447_014814 | 3300041407 | Bacteria | 2176 |
| 330 | Ga0439447_018969 | 3300041407 | Bacteria | 1842 |
| 331 | Ga0439447_034950 | 3300041407 | Bacteria | 1247 |
| 332 | Ga0439447_035378 | 3300041407 | Bacteria | 1238 |
| 333 | Ga0439447_038219 | 3300041407 | Bacteria | 1180 |
| 334 | Ga0439466_0001050 | 3300041411 | Bacteria | 10669 |
| 335 | Ga0439466_0002125 | 3300041411 | Bacteria | 7757 |
| 336 | Ga0439466_0009685 | 3300041411 | Bacteria | 3596 |
| 337 | Ga0439466_0020327 | 3300041411 | Bacteria | 2366 |
| 338 | Ga0439466_0026347 | 3300041411 | Bacteria | 2022 |
| 339 | Ga0439466_0044251 | 3300041411 | Bacteria | 1475 |
| 340 | Ga0439466_0104049 | 3300041411 | Bacteria | 883 |
| 341 | Ga0439431_0002630 | 3300041997 | Bacteria | 3955 |
| 342 | Ga0439437_001473 | 3300042000 | Bacteria | 2472 |
| 343 | Ga0439445_0003136 | 3300042004 | Bacteria | 3708 |
| 344 | Ga0439432_000121 | 3300042006 | Bacteria | 25700 |
| 345 | Ga0439432_000966 | 3300042006 | Bacteria | 10846 |
| 346 | Ga0439432_002110 | 3300042006 | Bacteria | 7506 |
| 347 | Ga0439432_005599 | 3300042006 | Bacteria | 4516 |
| 348 | Ga0439432_007892 | 3300042006 | Bacteria | 3752 |
| 349 | Ga0439432_007912 | 3300042006 | Bacteria | 3747 |
| 350 | Ga0439432_078343 | 3300042006 | Bacteria | 1002 |
| 351 | Ga0439432_089534 | 3300042006 | Bacteria | 927 |
| 352 | Ga0439451_001003 | 3300042009 | Bacteria | 5468 |
| 353 | Ga0439451_005249 | 3300042009 | Bacteria | 2637 |
| 354 | Ga0439451_011675 | 3300042009 | Bacteria | 1772 |
| 355 | Ga0439451_012153 | 3300042009 | Bacteria | 1736 |
| 356 | Ga0439451_019509 | 3300042009 | Bacteria | 1366 |
| 357 | Ga0439452_000244 | 3300042010 | Bacteria | 37543 |
| 358 | Ga0439452_000266 | 3300042010 | Bacteria | 34754 |
| 359 | Ga0439452_001815 | 3300042010 | Bacteria | 8288 |
| 360 | Ga0439452_003146 | 3300042010 | Bacteria | 5846 |
| 361 | Ga0439452_005304 | 3300042010 | Bacteria | 4163 |
| 362 | Ga0439452_007097 | 3300042010 | Bacteria | 3451 |
| 363 | Ga0439452_007621 | 3300042010 | Bacteria | 3308 |
| 364 | Ga0439452_014117 | 3300042010 | Bacteria | 2225 |
| 365 | Ga0439455_0021837 | 3300042012 | Bacteria | 1529 |
| 366 | Ga0439456_002955 | 3300042013 | Bacteria | 3437 |
| 367 | Ga0439456_003157 | 3300042013 | Bacteria | 3334 |
| 368 | Ga0439456_004168 | 3300042013 | Bacteria | 2928 |
| 369 | Ga0439456_009160 | 3300042013 | Bacteria | 2044 |
| 370 | Ga0439456_010323 | 3300042013 | Bacteria | 1929 |
| 371 | Ga0439456_057989 | 3300042013 | Bacteria | 849 |
| 372 | Ga0439463_000075 | 3300042016 | Bacteria | 22808 |
| 373 | Ga0439463_001632 | 3300042016 | Bacteria | 5905 |
| 374 | Ga0439463_017378 | 3300042016 | Bacteria | 1783 |
| 375 | Ga0450911_000002 | 3300042115 | Bacteria | 277703 |
| 376 | Ga0450911_000098 | 3300042115 | Bacteria | 35212 |
| 377 | Ga0450911_000237 | 3300042115 | Bacteria | 20957 |
| 378 | Ga0450911_004412 | 3300042115 | Bacteria | 2309 |
| 379 | Ga0450911_005122 | 3300042115 | Bacteria | 2064 |
| 380 | Ga0450913_000422 | 3300042117 | Bacteria | 1754 |
| 381 | Ga0450919_001258 | 3300042121 | Bacteria | 3310 |
| 382 | Ga0450922_001071 | 3300042124 | Bacteria | 2745 |
| 383 | Ga0450900_000787 | 3300042136 | Bacteria | 2759 |
| 384 | Ga0450900_001236 | 3300042136 | Bacteria | 2431 |
| 385 | Ga0450902_000426 | 3300042137 | Bacteria | 5191 |
| 386 | Ga0450902_002316 | 3300042137 | Bacteria | 2699 |
| 387 | Ga0450903_001500 | 3300042138 | Bacteria | 4360 |
| 388 | Ga0450903_020654 | 3300042138 | Bacteria | 1018 |
| 389 | Ga0450904_000020 | 3300042139 | Bacteria | 39192 |
| 390 | Ga0450904_001733 | 3300042139 | Bacteria | 2878 |
| 391 | Ga0450905_000529 | 3300042142 | Bacteria | 4684 |
| 392 | Ga0450905_006941 | 3300042142 | Bacteria | 1537 |
| 393 | Ga0450906_005293 | 3300042145 | Bacteria | 2662 |
| 394 | Ga0450907_000076 | 3300042146 | Bacteria | 37520 |
| 395 | Ga0450907_001323 | 3300042146 | Bacteria | 5512 |
| 396 | Ga0450907_039519 | 3300042146 | Bacteria | 807 |
| 397 | Ga0450910_001032 | 3300042147 | Bacteria | 3406 |
| 398 | Ga0450910_003499 | 3300042147 | Bacteria | 2085 |
| 399 | Ga0439446_0001807 | 3300042156 | Bacteria | 4995 |
| 400 | Ga0439446_0023851 | 3300042156 | Bacteria | 1742 |
| 401 | Ga0439446_0045070 | 3300042156 | Bacteria | 1306 |
| 402 | Ga0450908_023544 | 3300042184 | Bacteria | 1078 |
| 403 | Ga0439459_0001600 | 3300042438 | Bacteria | 3372 |
| 404 | Ga0439460_0017004 | 3300042461 | Bacteria | 1943 |
| 405 | Ga0439460_0069329 | 3300042461 | Bacteria | 1089 |
| 406 | Ga0450916_000544 | 3300042530 | Bacteria | 3327 |
| 407 | Ga0450893_0003347 | 3300042532 | Bacteria | 2525 |
| 408 | Ga0450893_0009826 | 3300042532 | Bacteria | 1565 |
| 409 | Ga0450901_000007 | 3300042533 | Bacteria | 23102 |
| 410 | Ga0450901_001884 | 3300042533 | Bacteria | 2349 |
| 411 | Ga0451577_0151542 | 3300042876 | Bacteria | 2086 |
| 412 | Ga0439440_0003429 | 3300042993 | Bacteria | 3053 |
| 413 | Ga0466972_0005598 | 3300044658 | Bacteria | 6295 |
| 414 | Ga0466959_0920316 | 3300045049 | Bacteria | 583 |
| 415 | Ga0466967_0544513 | 3300045976 | Bacteria | 1142 |
| 416 | Ga0495617_000141 | 3300046452 | Bacteria | 47430 |
| 417 | Ga0495617_001113 | 3300046452 | Bacteria | 12189 |
| 418 | Ga0495617_003130 | 3300046452 | Bacteria | 6301 |
| 419 | Ga0495617_003953 | 3300046452 | Bacteria | 5458 |
| 420 | Ga0495617_005859 | 3300046452 | Bacteria | 4335 |
| 421 | Ga0495617_018677 | 3300046452 | Bacteria | 2345 |
| 422 | Ga0495617_025948 | 3300046452 | Bacteria | 1973 |
| 423 | Ga0495627_000888 | 3300046453 | Bacteria | 20978 |
| 424 | Ga0495627_001519 | 3300046453 | Bacteria | 13334 |
| 425 | Ga0495627_001689 | 3300046453 | Bacteria | 12125 |
| 426 | Ga0495627_002031 | 3300046453 | Bacteria | 10398 |
| 427 | Ga0495627_002593 | 3300046453 | Bacteria | 8545 |
| 428 | Ga0495627_007147 | 3300046453 | Bacteria | 4314 |
| 429 | Ga0495627_113618 | 3300046453 | Bacteria | 767 |
| 430 | Ga0495603_0068096 | 3300046455 | Bacteria | 2094 |
| 431 | Ga0495590_0000906 | 3300046457 | Bacteria | 13237 |
| 432 | Ga0495590_0001189 | 3300046457 | Bacteria | 11382 |
| 433 | Ga0495590_0002274 | 3300046457 | Bacteria | 8018 |
| 434 | Ga0495590_0003712 | 3300046457 | Bacteria | 6217 |
| 435 | Ga0495590_0167076 | 3300046457 | Bacteria | 801 |
| 436 | Ga0495591_001021 | 3300046458 | Bacteria | 18922 |
| 437 | Ga0495591_001547 | 3300046458 | Bacteria | 14075 |
| 438 | Ga0495591_001548 | 3300046458 | Bacteria | 14066 |
| 439 | Ga0495591_001592 | 3300046458 | Bacteria | 13748 |
| 440 | Ga0495591_002600 | 3300046458 | Bacteria | 9911 |
| 441 | Ga0495591_011863 | 3300046458 | Bacteria | 3275 |
| 442 | Ga0495591_019317 | 3300046458 | Bacteria | 2284 |
| 443 | Ga0495591_027191 | 3300046458 | Bacteria | 1767 |
| 444 | Ga0495591_027635 | 3300046458 | Bacteria | 1747 |
| 445 | Ga0495591_031469 | 3300046458 | Bacteria | 1591 |
| 446 | Ga0495629_0242579 | 3300046459 | Bacteria | 1240 |
| 447 | Ga0495638_0002066 | 3300046460 | Bacteria | 17051 |
| 448 | Ga0495638_0003713 | 3300046460 | Bacteria | 11883 |
| 449 | Ga0495638_0010999 | 3300046460 | Bacteria | 6257 |
| 450 | Ga0495638_0026125 | 3300046460 | Bacteria | 3788 |
| 451 | Ga0495638_0028823 | 3300046460 | Bacteria | 3582 |
| 452 | Ga0495638_0040201 | 3300046460 | Bacteria | 2964 |
| 453 | Ga0495638_0040469 | 3300046460 | Bacteria | 2953 |
| 454 | Ga0495638_0079098 | 3300046460 | Bacteria | 2000 |
| 455 | Ga0495638_0081876 | 3300046460 | Bacteria | 1958 |
| 456 | Ga0495638_0082668 | 3300046460 | Bacteria | 1947 |
| 457 | Ga0495638_0089201 | 3300046460 | Bacteria | 1860 |
| 458 | Ga0495638_0091852 | 3300046460 | Bacteria | 1827 |
| 459 | Ga0495638_0094885 | 3300046460 | Bacteria | 1792 |
| 460 | Ga0495638_0210761 | 3300046460 | Bacteria | 1091 |
| 461 | Ga0495638_0265859 | 3300046460 | Bacteria | 938 |
| 462 | Ga0495653_0025631 | 3300046463 | Bacteria | 4734 |
| 463 | Ga0495653_0067341 | 3300046463 | Bacteria | 2689 |
| 464 | Ga0495653_0114729 | 3300046463 | Bacteria | 1929 |
| 465 | Ga0495653_0183508 | 3300046463 | Bacteria | 1433 |
| 466 | Ga0495650_0005082 | 3300046471 | Bacteria | 8704 |
| 467 | Ga0495650_0010880 | 3300046471 | Bacteria | 5039 |
| 468 | Ga0495650_0042050 | 3300046471 | Bacteria | 1949 |
| 469 | Ga0495650_0076298 | 3300046471 | Bacteria | 1303 |
| 470 | Ga0495650_0076869 | 3300046471 | Bacteria | 1296 |
| 471 | Ga0495650_0156340 | 3300046471 | Bacteria | 815 |
| 472 | Ga0495605_0000503 | 3300046474 | Bacteria | 33522 |
| 473 | Ga0495605_0003296 | 3300046474 | Bacteria | 9664 |
| 474 | Ga0495605_0007234 | 3300046474 | Bacteria | 6306 |
| 475 | Ga0495605_0010323 | 3300046474 | Bacteria | 5227 |
| 476 | Ga0495605_0040482 | 3300046474 | Bacteria | 2326 |
| 477 | Ga0495605_0046336 | 3300046474 | Bacteria | 2138 |
| 478 | Ga0495639_0000065 | 3300046475 | Bacteria | 48194 |
| 479 | Ga0495584_0000587 | 3300046491 | Bacteria | 24562 |
| 480 | Ga0495584_0001133 | 3300046491 | Bacteria | 16501 |
| 481 | Ga0495584_0003123 | 3300046491 | Bacteria | 9198 |
| 482 | Ga0495584_0007020 | 3300046491 | Bacteria | 5882 |
| 483 | Ga0495584_0007535 | 3300046491 | Bacteria | 5672 |
| 484 | Ga0495584_0008301 | 3300046491 | Bacteria | 5379 |
| 485 | Ga0495584_0035491 | 3300046491 | Bacteria | 2520 |
| 486 | Ga0495584_0041235 | 3300046491 | Bacteria | 2330 |
| 487 | Ga0495584_0051875 | 3300046491 | Bacteria | 2064 |
| 488 | Ga0495584_0118524 | 3300046491 | Bacteria | 1340 |
| 489 | Ga0495584_0170998 | 3300046491 | Bacteria | 1104 |
| 490 | Ga0495585_0001301 | 3300046492 | Bacteria | 19906 |
| 491 | Ga0495585_0001381 | 3300046492 | Bacteria | 19179 |
| 492 | Ga0495585_0001879 | 3300046492 | Bacteria | 15825 |
| 493 | Ga0495585_0003225 | 3300046492 | Bacteria | 11129 |
| 494 | Ga0495585_0016011 | 3300046492 | Bacteria | 4348 |
| 495 | Ga0495585_0026686 | 3300046492 | Bacteria | 3298 |
| 496 | Ga0495585_0041221 | 3300046492 | Bacteria | 2589 |
| 497 | Ga0495585_0068961 | 3300046492 | Bacteria | 1930 |
| 498 | Ga0495585_0069103 | 3300046492 | Bacteria | 1928 |
| 499 | Ga0495585_0224667 | 3300046492 | Bacteria | 946 |
| 500 | Ga0495594_0147880 | 3300046499 | Bacteria | 1333 |
| 501 | Ga0495596_0000636 | 3300046500 | Bacteria | 22084 |
| 502 | Ga0495596_0015822 | 3300046500 | Bacteria | 3146 |
| 503 | Ga0495607_0000303 | 3300046501 | Bacteria | 51474 |
| 504 | Ga0495607_0001959 | 3300046501 | Bacteria | 17376 |
| 505 | Ga0495607_0006642 | 3300046501 | Bacteria | 8107 |
| 506 | Ga0495607_0007164 | 3300046501 | Bacteria | 7750 |
| 507 | Ga0495607_0019457 | 3300046501 | Bacteria | 4313 |
| 508 | Ga0495607_0024683 | 3300046501 | Bacteria | 3744 |
| 509 | Ga0495607_0029821 | 3300046501 | Bacteria | 3355 |
| 510 | Ga0495607_0081085 | 3300046501 | Bacteria | 1782 |
| 511 | Ga0495583_0000968 | 3300046506 | Bacteria | 33083 |
| 512 | Ga0495583_0010711 | 3300046506 | Bacteria | 5323 |
| 513 | Ga0495606_0006907 | 3300046507 | Bacteria | 10332 |
| 514 | Ga0495606_0007110 | 3300046507 | Bacteria | 10118 |
| 515 | Ga0495606_0008731 | 3300046507 | Bacteria | 8719 |
| 516 | Ga0495606_0009727 | 3300046507 | Bacteria | 8089 |
| 517 | Ga0495606_0015364 | 3300046507 | Bacteria | 5902 |
| 518 | Ga0495606_0016555 | 3300046507 | Bacteria | 5614 |
| 519 | Ga0495606_0030549 | 3300046507 | Bacteria | 3763 |
| 520 | Ga0495606_0054080 | 3300046507 | Bacteria | 2601 |
| 521 | Ga0495606_0073021 | 3300046507 | Bacteria | 2153 |
| 522 | Ga0495606_0094632 | 3300046507 | Bacteria | 1830 |
| 523 | Ga0495610_0003407 | 3300046512 | Bacteria | 12408 |
| 524 | Ga0495610_0004428 | 3300046512 | Bacteria | 10387 |
| 525 | Ga0495610_0005792 | 3300046512 | Bacteria | 8694 |
| 526 | Ga0495610_0005940 | 3300046512 | Bacteria | 8548 |
| 527 | Ga0495610_0009177 | 3300046512 | Bacteria | 6283 |
| 528 | Ga0495610_0015262 | 3300046512 | Bacteria | 4471 |
| 529 | Ga0495610_0016532 | 3300046512 | Bacteria | 4242 |
| 530 | Ga0495610_0018131 | 3300046512 | Bacteria | 3984 |
| 531 | Ga0495610_0021298 | 3300046512 | Bacteria | 3568 |
| 532 | Ga0495610_0038200 | 3300046512 | Bacteria | 2438 |
| 533 | Ga0495610_0056153 | 3300046512 | Bacteria | 1894 |
| 534 | Ga0495610_0105139 | 3300046512 | Bacteria | 1258 |
| 535 | Ga0495616_0001578 | 3300046513 | Bacteria | 15671 |
| 536 | Ga0495616_0002789 | 3300046513 | Bacteria | 11409 |
| 537 | Ga0495616_0008636 | 3300046513 | Bacteria | 6015 |
| 538 | Ga0495616_0014868 | 3300046513 | Bacteria | 4342 |
| 539 | Ga0495616_0022163 | 3300046513 | Bacteria | 3431 |
| 540 | Ga0495616_0040520 | 3300046513 | Bacteria | 2379 |
| 541 | Ga0495616_0042195 | 3300046513 | Bacteria | 2323 |
| 542 | Ga0495616_0065749 | 3300046513 | Bacteria | 1765 |
| 543 | Ga0495620_0000434 | 3300046515 | Bacteria | 27919 |
| 544 | Ga0495620_0001857 | 3300046515 | Bacteria | 12427 |
| 545 | Ga0495620_0003496 | 3300046515 | Bacteria | 8989 |
| 546 | Ga0495620_0012829 | 3300046515 | Bacteria | 4309 |
| 547 | Ga0495620_0016051 | 3300046515 | Bacteria | 3768 |
| 548 | Ga0495620_0046315 | 3300046515 | Bacteria | 1878 |
| 549 | Ga0495630_0397793 | 3300046517 | Bacteria | 1055 |
| 550 | Ga0495631_0000904 | 3300046518 | Bacteria | 18487 |
| 551 | Ga0495631_0001389 | 3300046518 | Bacteria | 14711 |
| 552 | Ga0495631_0010705 | 3300046518 | Bacteria | 4534 |
| 553 | Ga0495631_0036245 | 3300046518 | Bacteria | 2203 |
| 554 | Ga0495631_0066117 | 3300046518 | Bacteria | 1564 |
| 555 | Ga0495631_0096072 | 3300046518 | Bacteria | 1275 |
| 556 | Ga0495631_0108954 | 3300046518 | Bacteria | 1191 |
| 557 | Ga0495631_0152574 | 3300046518 | Bacteria | 991 |
| 558 | Ga0495632_0000432 | 3300046519 | Bacteria | 39892 |
| 559 | Ga0495632_0000608 | 3300046519 | Bacteria | 33143 |
| 560 | Ga0495632_0005432 | 3300046519 | Bacteria | 8425 |
| 561 | Ga0495632_0011378 | 3300046519 | Bacteria | 5193 |
| 562 | Ga0495632_0017374 | 3300046519 | Bacteria | 3973 |
| 563 | Ga0495632_0018212 | 3300046519 | Bacteria | 3858 |
| 564 | Ga0495632_0032629 | 3300046519 | Bacteria | 2680 |
| 565 | Ga0495632_0041361 | 3300046519 | Bacteria | 2316 |
| 566 | Ga0495632_0116744 | 3300046519 | Bacteria | 1249 |
| 567 | Ga0495632_0181793 | 3300046519 | Bacteria | 963 |
| 568 | Ga0495632_0245389 | 3300046519 | Bacteria | 804 |
| 569 | Ga0495637_0000644 | 3300046520 | Bacteria | 24415 |
| 570 | Ga0495637_0001994 | 3300046520 | Bacteria | 11545 |
| 571 | Ga0495637_0002146 | 3300046520 | Bacteria | 11045 |
| 572 | Ga0495637_0002264 | 3300046520 | Bacteria | 10686 |
| 573 | Ga0495637_0003111 | 3300046520 | Bacteria | 8863 |
| 574 | Ga0495637_0003390 | 3300046520 | Bacteria | 8459 |
| 575 | Ga0495637_0041411 | 3300046520 | Bacteria | 1975 |
| 576 | Ga0495637_0042108 | 3300046520 | Bacteria | 1956 |
| 577 | Ga0495637_0045740 | 3300046520 | Bacteria | 1854 |
| 578 | Ga0495637_0051717 | 3300046520 | Bacteria | 1717 |
| 579 | Ga0495637_0093167 | 3300046520 | Bacteria | 1185 |
| 580 | Ga0495643_0016327 | 3300046522 | Bacteria | 4363 |
| 581 | Ga0495643_0041554 | 3300046522 | Bacteria | 2506 |
| 582 | Ga0495643_0050063 | 3300046522 | Bacteria | 2250 |
| 583 | Ga0495643_0062906 | 3300046522 | Bacteria | 1963 |
| 584 | Ga0495643_0075558 | 3300046522 | Bacteria | 1762 |
| 585 | Ga0495643_0131074 | 3300046522 | Bacteria | 1259 |
| 586 | Ga0495644_0000433 | 3300046523 | Bacteria | 18537 |
| 587 | Ga0495644_0004554 | 3300046523 | Bacteria | 5448 |
| 588 | Ga0495644_0008393 | 3300046523 | Bacteria | 3978 |
| 589 | Ga0495648_0000755 | 3300046524 | Bacteria | 34528 |
| 590 | Ga0495648_0003719 | 3300046524 | Bacteria | 13326 |
| 591 | Ga0495648_0003864 | 3300046524 | Bacteria | 12993 |
| 592 | Ga0495648_0004695 | 3300046524 | Bacteria | 11586 |
| 593 | Ga0495648_0019417 | 3300046524 | Bacteria | 4778 |
| 594 | Ga0495648_0033256 | 3300046524 | Bacteria | 3370 |
| 595 | Ga0495648_0040497 | 3300046524 | Bacteria | 2953 |
| 596 | Ga0495648_0062177 | 3300046524 | Bacteria | 2212 |
| 597 | Ga0495648_0064259 | 3300046524 | Bacteria | 2163 |
| 598 | Ga0495648_0071520 | 3300046524 | Bacteria | 2010 |
| 599 | Ga0495648_0152842 | 3300046524 | Bacteria | 1202 |
| 600 | Ga0495648_0318220 | 3300046524 | Bacteria | 722 |
| 601 | Ga0495666_0000849 | 3300046526 | Bacteria | 14167 |
| 602 | Ga0495666_0015490 | 3300046526 | Bacteria | 3795 |
| 603 | Ga0495666_0019440 | 3300046526 | Bacteria | 3370 |
| 604 | Ga0495666_0154965 | 3300046526 | Bacteria | 1064 |
| 605 | Ga0495642_0000172 | 3300046528 | Bacteria | 37956 |
| 606 | Ga0495642_0000431 | 3300046528 | Bacteria | 22121 |
| 607 | Ga0495642_0001100 | 3300046528 | Bacteria | 12481 |
| 608 | Ga0495654_0001418 | 3300046530 | Bacteria | 16564 |
| 609 | Ga0495654_0001859 | 3300046530 | Bacteria | 14054 |
| 610 | Ga0495654_0002022 | 3300046530 | Bacteria | 13330 |
| 611 | Ga0495654_0004269 | 3300046530 | Bacteria | 8537 |
| 612 | Ga0495654_0005170 | 3300046530 | Bacteria | 7611 |
| 613 | Ga0495654_0020991 | 3300046530 | Bacteria | 3401 |
| 614 | Ga0495654_0043616 | 3300046530 | Bacteria | 2222 |
| 615 | Ga0495654_0052687 | 3300046530 | Bacteria | 1980 |
| 616 | Ga0495654_0062480 | 3300046530 | Bacteria | 1785 |
| 617 | Ga0495654_0163480 | 3300046530 | Bacteria | 975 |
| 618 | Ga0495640_0062550 | 3300046533 | Bacteria | 2524 |
| 619 | Ga0495586_0427395 | 3300046535 | Bacteria | 763 |
| 620 | Ga0495587_0001431 | 3300046536 | Bacteria | 15880 |
| 621 | Ga0495609_0001481 | 3300046538 | Bacteria | 15577 |
| 622 | Ga0495609_0001854 | 3300046538 | Bacteria | 13504 |
| 623 | Ga0495609_0003187 | 3300046538 | Bacteria | 9534 |
| 624 | Ga0495609_0029734 | 3300046538 | Bacteria | 2486 |
| 625 | Ga0495609_0033208 | 3300046538 | Bacteria | 2342 |
| 626 | Ga0495609_0057677 | 3300046538 | Bacteria | 1718 |
| 627 | Ga0495597_0013023 | 3300046542 | Bacteria | 3994 |
| 628 | Ga0495597_0017573 | 3300046542 | Bacteria | 3363 |
| 629 | Ga0495597_0019725 | 3300046542 | Bacteria | 3149 |
| 630 | Ga0495597_0020334 | 3300046542 | Bacteria | 3093 |
| 631 | Ga0495597_0045120 | 3300046542 | Bacteria | 1957 |
| 632 | Ga0495597_0046147 | 3300046542 | Bacteria | 1931 |
| 633 | Ga0495597_0046245 | 3300046542 | Bacteria | 1929 |
| 634 | Ga0495597_0055534 | 3300046542 | Bacteria | 1736 |
| 635 | Ga0495597_0094282 | 3300046542 | Bacteria | 1267 |
| 636 | Ga0495622_0000424 | 3300046557 | Bacteria | 27860 |
| 637 | Ga0495622_0012195 | 3300046557 | Bacteria | 3975 |
| 638 | Ga0495622_0024698 | 3300046557 | Bacteria | 2806 |
| 639 | Ga0495633_0007093 | 3300046558 | Bacteria | 6516 |
| 640 | Ga0495633_0021600 | 3300046558 | Bacteria | 3216 |
| 641 | Ga0495633_0053716 | 3300046558 | Bacteria | 1896 |
| 642 | Ga0495656_0006623 | 3300046615 | Bacteria | 4066 |
| 643 | Ga0495656_0049490 | 3300046615 | Bacteria | 1790 |
| 644 | Ga0495668_0004091 | 3300046616 | Bacteria | 10571 |
| 645 | Ga0495668_0005751 | 3300046616 | Bacteria | 8289 |
| 646 | Ga0495668_0014322 | 3300046616 | Bacteria | 4653 |
| 647 | Ga0495634_0001783 | 3300046642 | Bacteria | 18625 |
| 648 | Ga0495634_0125657 | 3300046642 | Bacteria | 1639 |
| 649 | Ga0495611_0001497 | 3300046648 | Bacteria | 11585 |
| 650 | Ga0495611_0014835 | 3300046648 | Bacteria | 3331 |
| 651 | Ga0495625_0003322 | 3300046660 | Bacteria | 16205 |
| 652 | Ga0495625_0004745 | 3300046660 | Bacteria | 12721 |
| 653 | Ga0495625_0008534 | 3300046660 | Bacteria | 8726 |
| 654 | Ga0495625_0016363 | 3300046660 | Bacteria | 5839 |
| 655 | Ga0495625_0028913 | 3300046660 | Bacteria | 4150 |
| 656 | Ga0495625_0081921 | 3300046660 | Bacteria | 2245 |
| 657 | Ga0495625_0088601 | 3300046660 | Bacteria | 2143 |
| 658 | Ga0495625_0181291 | 3300046660 | Bacteria | 1400 |
| 659 | Ga0495625_0220389 | 3300046660 | Bacteria | 1243 |
| 660 | Ga0495635_0086668 | 3300046663 | Bacteria | 2143 |
| 661 | Ga0495659_0000092 | 3300046664 | Bacteria | 39277 |
| 662 | Ga0495659_0005829 | 3300046664 | Bacteria | 3887 |
| 663 | Ga0495661_0000150 | 3300046665 | Bacteria | 81419 |
| 664 | Ga0495661_0000644 | 3300046665 | Bacteria | 35320 |
| 665 | Ga0495661_0065351 | 3300046665 | Bacteria | 2143 |
| 666 | Ga0495661_0086089 | 3300046665 | Bacteria | 1799 |
| 667 | Ga0495661_0185030 | 3300046665 | Bacteria | 1101 |
| 668 | Ga0495588_0028959 | 3300046674 | Bacteria | 2775 |
| 669 | Ga0495623_0008534 | 3300046679 | Bacteria | 6654 |
| 670 | Ga0495623_0010779 | 3300046679 | Bacteria | 5918 |
| 671 | Ga0495646_0036105 | 3300046680 | Bacteria | 3063 |
| 672 | Ga0495669_0001041 | 3300046684 | Bacteria | 11559 |
| 673 | Ga0495613_0077270 | 3300046689 | Bacteria | 2422 |
| 674 | Ga0495624_0001547 | 3300046690 | Bacteria | 17769 |
| 675 | Ga0495670_0001560 | 3300046691 | Bacteria | 11202 |
| 676 | Ga0495670_0016853 | 3300046691 | Bacteria | 3592 |
| 677 | Ga0495670_0026361 | 3300046691 | Bacteria | 2876 |
| 678 | Ga0495670_0054150 | 3300046691 | Bacteria | 2009 |
| 679 | Ga0495670_0064448 | 3300046691 | Bacteria | 1846 |
| 680 | Ga0495670_0139403 | 3300046691 | Bacteria | 1267 |
| 681 | Ga0495671_0000813 | 3300046692 | Bacteria | 22300 |
| 682 | Ga0495671_0001029 | 3300046692 | Bacteria | 19405 |
| 683 | Ga0495671_0002178 | 3300046692 | Bacteria | 12484 |
| 684 | Ga0495671_0009328 | 3300046692 | Bacteria | 5482 |
| 685 | Ga0495671_0009721 | 3300046692 | Bacteria | 5360 |
| 686 | Ga0495671_0028217 | 3300046692 | Bacteria | 2893 |
| 687 | Ga0495671_0050594 | 3300046692 | Bacteria | 2068 |
| 688 | Ga0495671_0053811 | 3300046692 | Bacteria | 1996 |
| 689 | Ga0495671_0077499 | 3300046692 | Bacteria | 1629 |
| 690 | Ga0495671_0105866 | 3300046692 | Bacteria | 1373 |
| 691 | Ga0495671_0166358 | 3300046692 | Bacteria | 1072 |
| 692 | Ga0495649_0000963 | 3300046694 | Bacteria | 22710 |
| 693 | Ga0495649_0001599 | 3300046694 | Bacteria | 16902 |
| 694 | Ga0495649_0005511 | 3300046694 | Bacteria | 8025 |
| 695 | Ga0495649_0005684 | 3300046694 | Bacteria | 7871 |
| 696 | Ga0495649_0016635 | 3300046694 | Bacteria | 4166 |
| 697 | Ga0495649_0017404 | 3300046694 | Bacteria | 4054 |
| 698 | Ga0495649_0023663 | 3300046694 | Bacteria | 3430 |
| 699 | Ga0495649_0036785 | 3300046694 | Bacteria | 2689 |
| 700 | Ga0495649_0053367 | 3300046694 | Bacteria | 2188 |
| 701 | Ga0495649_0059499 | 3300046694 | Bacteria | 2056 |
| 702 | Ga0495649_0059650 | 3300046694 | Bacteria | 2054 |
| 703 | Ga0495649_0062220 | 3300046694 | Bacteria | 2006 |
| 704 | Ga0495649_0076536 | 3300046694 | Bacteria | 1791 |
| 705 | Ga0495649_0090784 | 3300046694 | Bacteria | 1628 |
| 706 | Ga0495649_0128221 | 3300046694 | Bacteria | 1339 |
| 707 | Ga0495649_0148340 | 3300046694 | Bacteria | 1232 |
| 708 | Ga0495589_0000228 | 3300046794 | Bacteria | 47419 |
| 709 | Ga0495589_0001455 | 3300046794 | Bacteria | 13662 |
| 710 | Ga0495589_0003502 | 3300046794 | Bacteria | 8492 |
| 711 | Ga0495589_0015952 | 3300046794 | Bacteria | 3861 |
| 712 | Ga0495589_0058086 | 3300046794 | Bacteria | 1902 |
| 713 | Ga0495589_0064897 | 3300046794 | Bacteria | 1790 |
| 714 | Ga0495600_0010973 | 3300046809 | Bacteria | 5636 |
| 715 | Ga0495600_0031792 | 3300046809 | Bacteria | 3421 |
| 716 | Ga0495600_0054268 | 3300046809 | Bacteria | 2617 |
| 717 | Ga0495600_0357124 | 3300046809 | Bacteria | 914 |
| 718 | Ga0495660_0016400 | 3300046810 | Bacteria | 4271 |
| 719 | Ga0495660_0021973 | 3300046810 | Bacteria | 3647 |
| 720 | Ga0495660_0027221 | 3300046810 | Bacteria | 3235 |
| 721 | Ga0495660_0037088 | 3300046810 | Bacteria | 2716 |
| 722 | Ga0495660_0042324 | 3300046810 | Bacteria | 2518 |
| 723 | Ga0495660_0052254 | 3300046810 | Bacteria | 2220 |
| 724 | Ga0495660_0067243 | 3300046810 | Bacteria | 1909 |
| 725 | Ga0495660_0133681 | 3300046810 | Bacteria | 1241 |
| 726 | Ga0495660_0143239 | 3300046810 | Bacteria | 1187 |
| 727 | Ga0495604_0053245 | 3300047317 | Bacteria | 3129 |
| 728 | Ga0495604_0105207 | 3300047317 | Bacteria | 2066 |
| 729 | Ga0495604_0112146 | 3300047317 | Bacteria | 1987 |
| 730 | Ga0495636_0002670 | 3300047318 | Bacteria | 6885 |
| 731 | Ga0495636_0130239 | 3300047318 | Bacteria | 1118 |
| 732 | Ga0495674_0059842 | 3300047319 | Bacteria | 3326 |
| 733 | Ga0495672_0000961 | 3300047320 | Bacteria | 29956 |
| 734 | Ga0495672_0001005 | 3300047320 | Bacteria | 29105 |
| 735 | Ga0495672_0002561 | 3300047320 | Bacteria | 16554 |
| 736 | Ga0495672_0002917 | 3300047320 | Bacteria | 15119 |
| 737 | Ga0495672_0003368 | 3300047320 | Bacteria | 13741 |
| 738 | Ga0495672_0003595 | 3300047320 | Bacteria | 13168 |
| 739 | Ga0495672_0005328 | 3300047320 | Bacteria | 10233 |
| 740 | Ga0495672_0007163 | 3300047320 | Bacteria | 8435 |
| 741 | Ga0495672_0028017 | 3300047320 | Bacteria | 3571 |
| 742 | Ga0495672_0043959 | 3300047320 | Bacteria | 2682 |
| 743 | Ga0495672_0194326 | 3300047320 | Bacteria | 1018 |
| 744 | Ga0495676_0098453 | 3300047321 | Bacteria | 2169 |
| 745 | Ga0495680_0002345 | 3300047322 | Bacteria | 19423 |
| 746 | Ga0495680_0054590 | 3300047322 | Bacteria | 3101 |
| 747 | Ga0495680_0106996 | 3300047322 | Bacteria | 2077 |
| 748 | Ga0495683_0000315 | 3300047323 | Bacteria | 40678 |
| 749 | Ga0495683_0001195 | 3300047323 | Bacteria | 17706 |
| 750 | Ga0495683_0002437 | 3300047323 | Bacteria | 11249 |
| 751 | Ga0495683_0003622 | 3300047323 | Bacteria | 8961 |
| 752 | Ga0495683_0007057 | 3300047323 | Bacteria | 6095 |
| 753 | Ga0495683_0008058 | 3300047323 | Bacteria | 5653 |
| 754 | Ga0495687_001061 | 3300047443 | Bacteria | 27140 |
| 755 | Ga0495687_001498 | 3300047443 | Bacteria | 21285 |
| 756 | Ga0495687_008894 | 3300047443 | Bacteria | 5686 |
| 757 | Ga0495687_036429 | 3300047443 | Bacteria | 2201 |
| 758 | Ga0495675_0001269 | 3300047444 | Bacteria | 15286 |
| 759 | Ga0495675_0014428 | 3300047444 | Bacteria | 4992 |
| 760 | Ga0495677_0001027 | 3300047445 | Bacteria | 11222 |
| 761 | Ga0495679_001719 | 3300047446 | Bacteria | 12106 |
| 762 | Ga0495679_002618 | 3300047446 | Bacteria | 9036 |
| 763 | Ga0495679_008334 | 3300047446 | Bacteria | 4224 |
| 764 | Ga0495679_020350 | 3300047446 | Bacteria | 2312 |
| 765 | Ga0495679_022968 | 3300047446 | Bacteria | 2124 |
| 766 | Ga0495679_025868 | 3300047446 | Bacteria | 1956 |
| 767 | Ga0495679_026752 | 3300047446 | Bacteria | 1911 |
| 768 | Ga0495685_007616 | 3300047447 | Bacteria | 3580 |
| 769 | Ga0495673_0001692 | 3300047469 | Bacteria | 16928 |
| 770 | Ga0495673_0002018 | 3300047469 | Bacteria | 14927 |
| 771 | Ga0495673_0008257 | 3300047469 | Bacteria | 5873 |
| 772 | Ga0495673_0009029 | 3300047469 | Bacteria | 5541 |
| 773 | Ga0495673_0014863 | 3300047469 | Bacteria | 4032 |
| 774 | Ga0495673_0020040 | 3300047469 | Bacteria | 3336 |
| 775 | Ga0495673_0034152 | 3300047469 | Bacteria | 2353 |
| 776 | Ga0495673_0045179 | 3300047469 | Bacteria | 1959 |
| 777 | Ga0495673_0067632 | 3300047469 | Bacteria | 1511 |
| 778 | Ga0495673_0071437 | 3300047469 | Bacteria | 1459 |
| 779 | Ga0495681_0000690 | 3300047470 | Bacteria | 25744 |
| 780 | Ga0495681_0001374 | 3300047470 | Bacteria | 18389 |
| 781 | Ga0495681_0003141 | 3300047470 | Bacteria | 11560 |
| 782 | Ga0495681_0003289 | 3300047470 | Bacteria | 11264 |
| 783 | Ga0495681_0006287 | 3300047470 | Bacteria | 7825 |
| 784 | Ga0495681_0008605 | 3300047470 | Bacteria | 6374 |
| 785 | Ga0495681_0018959 | 3300047470 | Bacteria | 3773 |
| 786 | Ga0495681_0027483 | 3300047470 | Bacteria | 2941 |
| 787 | Ga0495681_0028589 | 3300047470 | Bacteria | 2865 |
| 788 | Ga0495681_0076809 | 3300047470 | Bacteria | 1500 |
| 789 | Ga0495681_0076971 | 3300047470 | Bacteria | 1498 |
| 790 | Ga0495681_0167509 | 3300047470 | Bacteria | 911 |
| 791 | Ga0495684_0040862 | 3300047471 | Bacteria | 3554 |
| 792 | Ga0495686_0002188 | 3300047472 | Bacteria | 19018 |
| 793 | Ga0495686_0004465 | 3300047472 | Bacteria | 11513 |
| 794 | Ga0495686_0010346 | 3300047472 | Bacteria | 6641 |
| 795 | Ga0495686_0011308 | 3300047472 | Bacteria | 6292 |
| 796 | Ga0495686_0011468 | 3300047472 | Bacteria | 6240 |
| 797 | Ga0495686_0131256 | 3300047472 | Bacteria | 1485 |
| 798 | Ga0495593_0004293 | 3300047673 | Bacteria | 8477 |
| 799 | Ga0495593_0066496 | 3300047673 | Bacteria | 1878 |
| 800 | Ga0495593_0096865 | 3300047673 | Bacteria | 1515 |
| 801 | Ga0495593_0146786 | 3300047673 | Bacteria | 1193 |
| 802 | Ga0495602_0233125 | 3300048088 | Bacteria | 1381 |
| 803 | Ga0495626_0000548 | 3300048091 | Bacteria | 37317 |
| 804 | Ga0495626_0000625 | 3300048091 | Bacteria | 34456 |
| 805 | Ga0495626_0001985 | 3300048091 | Bacteria | 15103 |
| 806 | Ga0495626_0003314 | 3300048091 | Bacteria | 10392 |
| 807 | Ga0495626_0022330 | 3300048091 | Bacteria | 3126 |
| 808 | Ga0495626_0058117 | 3300048091 | Bacteria | 1768 |
| 809 | Ga0495626_0090246 | 3300048091 | Bacteria | 1348 |
| 810 | Ga0496100_0000089 | 3300048903 | Bacteria | 52071 |
| 811 | Ga0496101_0000086 | 3300048904 | Bacteria | 102149 |
| 812 | Ga0496102_0000823 | 3300048905 | Bacteria | 30109 |
| 813 | Ga0496102_0003503 | 3300048905 | Bacteria | 13313 |
| 814 | Ga0496106_0006013 | 3300048909 | Bacteria | 8977 |
| 815 | Ga0496107_0000566 | 3300048910 | Bacteria | 20649 |
| 816 | Ga0496107_0397025 | 3300048910 | Bacteria | 1026 |
| 817 | Ga0496108_0009925 | 3300048911 | Bacteria | 7719 |
| 818 | Ga0496109_0000104 | 3300048912 | Bacteria | 87994 |
| 819 | Ga0496110_0048721 | 3300048913 | Bacteria | 3714 |
| 820 | Ga0496110_0164906 | 3300048913 | Bacteria | 2009 |
| 821 | Ga0496111_0015765 | 3300048914 | Bacteria | 5198 |
| 822 | Ga0496114_0004029 | 3300048917 | Bacteria | 11347 |
| 823 | Ga0496114_0293039 | 3300048917 | Bacteria | 1436 |
| 824 | Ga0496115_0015204 | 3300048918 | Bacteria | 5833 |
| 825 | Ga0496116_0000792 | 3300048919 | Bacteria | 40176 |
| 826 | Ga0496116_0001281 | 3300048919 | Bacteria | 28911 |
| 827 | Ga0496116_0002066 | 3300048919 | Bacteria | 21467 |
| 828 | Ga0496116_0011064 | 3300048919 | Bacteria | 7505 |
| 829 | Ga0496116_0037559 | 3300048919 | Bacteria | 3375 |
| 830 | Ga0496116_0041737 | 3300048919 | Bacteria | 3144 |
| 831 | Ga0496117_0002238 | 3300048920 | Bacteria | 24976 |
| 832 | Ga0496117_0002790 | 3300048920 | Bacteria | 21334 |
| 833 | Ga0496117_0013323 | 3300048920 | Bacteria | 7184 |
| 834 | Ga0496117_0068980 | 3300048920 | Bacteria | 2383 |
| 835 | Ga0496117_0087212 | 3300048920 | Bacteria | 2023 |
| 836 | Ga0496117_0098082 | 3300048920 | Bacteria | 1864 |
| 837 | Ga0496118_0009034 | 3300048921 | Bacteria | 10159 |
| 838 | Ga0496118_0014247 | 3300048921 | Bacteria | 7456 |
| 839 | Ga0496118_0024414 | 3300048921 | Bacteria | 5216 |
| 840 | Ga0496118_0088070 | 3300048921 | Bacteria | 2149 |
| 841 | Ga0496119_0000380 | 3300048922 | Bacteria | 61208 |
| 842 | Ga0496119_0008624 | 3300048922 | Bacteria | 8921 |
| 843 | Ga0496119_0043979 | 3300048922 | Bacteria | 2817 |
| 844 | Ga0496120_0002903 | 3300048923 | Bacteria | 16379 |
| 845 | Ga0496120_0005346 | 3300048923 | Bacteria | 10281 |
| 846 | Ga0496120_0038604 | 3300048923 | Bacteria | 2823 |
| 847 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 848 | Ga0496121_0001360 | 3300048924 | Bacteria | 41696 |
| 849 | Ga0496121_0001710 | 3300048924 | Bacteria | 35915 |
| 850 | Ga0496121_0043792 | 3300048924 | Bacteria | 3870 |
| 851 | Ga0496121_0077146 | 3300048924 | Bacteria | 2654 |
| 852 | Ga0496121_0096298 | 3300048924 | Bacteria | 2297 |
| 853 | Ga0496122_0000078 | 3300048925 | Bacteria | 214068 |
| 854 | Ga0496122_0002322 | 3300048925 | Bacteria | 27452 |
| 855 | Ga0496122_0054299 | 3300048925 | Bacteria | 3011 |
| 856 | Ga0496122_0054902 | 3300048925 | Bacteria | 2986 |
| 857 | Ga0496122_0072106 | 3300048925 | Bacteria | 2457 |
| 858 | Ga0496122_0081426 | 3300048925 | Bacteria | 2253 |
| 859 | Ga0496123_0003839 | 3300048926 | Bacteria | 16386 |
| 860 | Ga0496123_0007353 | 3300048926 | Bacteria | 10426 |
| 861 | Ga0496123_0028280 | 3300048926 | Bacteria | 4155 |
| 862 | Ga0496123_0044048 | 3300048926 | Bacteria | 3055 |
| 863 | Ga0496123_0064437 | 3300048926 | Bacteria | 2335 |
| 864 | Ga0496123_0131988 | 3300048926 | Bacteria | 1381 |
| 865 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 866 | Ga0496124_0000939 | 3300048927 | Bacteria | 46686 |
| 867 | Ga0496124_0001100 | 3300048927 | Bacteria | 42478 |
| 868 | Ga0496124_0002905 | 3300048927 | Bacteria | 21606 |
| 869 | Ga0496124_0003679 | 3300048927 | Bacteria | 18543 |
| 870 | Ga0496124_0010329 | 3300048927 | Bacteria | 9471 |
| 871 | Ga0496124_0026522 | 3300048927 | Bacteria | 5222 |
| 872 | Ga0496124_0051954 | 3300048927 | Bacteria | 3485 |
| 873 | Ga0496124_0058536 | 3300048927 | Bacteria | 3239 |
| 874 | Ga0496124_0090785 | 3300048927 | Bacteria | 2490 |
| 875 | Ga0496124_0099581 | 3300048927 | Bacteria | 2357 |
| 876 | Ga0496124_0158501 | 3300048927 | Bacteria | 1767 |
| 877 | Ga0496124_0163392 | 3300048927 | Bacteria | 1733 |
| 878 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 879 | Ga0496125_0005259 | 3300048928 | Bacteria | 14494 |
| 880 | Ga0496125_0006162 | 3300048928 | Bacteria | 13073 |
| 881 | Ga0496125_0008532 | 3300048928 | Bacteria | 10712 |
| 882 | Ga0496125_0019041 | 3300048928 | Bacteria | 6495 |
| 883 | Ga0496125_0028979 | 3300048928 | Bacteria | 4986 |
| 884 | Ga0496125_0051671 | 3300048928 | Bacteria | 3387 |
| 885 | Ga0496125_0075475 | 3300048928 | Bacteria | 2608 |
| 886 | Ga0496125_0083261 | 3300048928 | Bacteria | 2434 |
| 887 | Ga0496125_0084356 | 3300048928 | Bacteria | 2413 |
| 888 | Ga0496125_0261548 | 3300048928 | Bacteria | 1084 |
| 889 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 890 | Ga0496126_0016184 | 3300048929 | Bacteria | 7469 |
| 891 | Ga0496126_0052894 | 3300048929 | Bacteria | 3687 |
| 892 | Ga0496126_0083493 | 3300048929 | Bacteria | 2819 |
| 893 | Ga0496126_0122659 | 3300048929 | Bacteria | 2252 |
| 894 | Ga0495678_000911 | 3300049459 | Bacteria | 25984 |
| 895 | Ga0495678_002313 | 3300049459 | Bacteria | 13143 |
| 896 | Ga0495678_007297 | 3300049459 | Bacteria | 5747 |
| 897 | Ga0495678_010778 | 3300049459 | Bacteria | 4415 |
| 898 | Ga0495678_017359 | 3300049459 | Bacteria | 3264 |
| 899 | Ga0495678_020393 | 3300049459 | Bacteria | 2936 |
| 900 | Ga0495678_031130 | 3300049459 | Bacteria | 2227 |
| 901 | Ga0495678_039158 | 3300049459 | Bacteria | 1913 |
| 902 | Ga0495678_170049 | 3300049459 | Bacteria | 690 |
| 903 | Ga0495682_0000234 | 3300049460 | Bacteria | 43711 |
| 904 | Ga0495682_0018563 | 3300049460 | Bacteria | 2619 |
| 905 | Ga0495682_0032306 | 3300049460 | Bacteria | 1933 |
| 906 | Ga0495682_0038342 | 3300049460 | Bacteria | 1761 |
| 907 | Ga0495682_0054012 | 3300049460 | Bacteria | 1458 |
| 908 | Ga0501226_000007 | 3300049853 | Bacteria | 227827 |
| 909 | Ga0500635_0044495 | 3300053080 | Bacteria | 1498 |
| 910 | Ga0500566_0013928 | 3300053094 | Bacteria | 4727 |
| 911 | Ga0500618_001501 | 3300053125 | Bacteria | 10271 |
| 912 | Ga0500568_0035633 | 3300053139 | Bacteria | 2029 |
| 913 | Ga0500588_0026653 | 3300053146 | Bacteria | 1619 |
| 914 | Ga0500603_005561 | 3300053150 | Bacteria | 2715 |
| 915 | Ga0500622_0002043 | 3300053156 | Bacteria | 15042 |
| 916 | Ga0500634_0061656 | 3300053161 | Bacteria | 1988 |
| 917 | 2511254619 | 2511231004 | Bacteria | 6669789 |
| 918 | 2511266584 | 2511231006 | Bacteria | 6794709 |
| 919 | 2511270713 | 2511231007 | Bacteria | 6306603 |
| 920 | 2511277295 | 2511231008 | Bacteria | 6624100 |
| 921 | 2511287321 | 2511231010 | Bacteria | 6373152 |
| 922 | 2511294734 | 2511231011 | Bacteria | 6149768 |
| 923 | 2511303406 | 2511231012 | Bacteria | 6738011 |
| 924 | 2511312790 | 2511231014 | Bacteria | 6462302 |
| 925 | 2511321740 | 2511231015 | Bacteria | 6598026 |
| 926 | 2511328774 | 2511231016 | Bacteria | 6704427 |
| 927 | 2511331725 | 2511231017 | Bacteria | 6503007 |
| 928 | 2511340709 | 2511231018 | Bacteria | 6436256 |
| 929 | 2511343863 | 2511231019 | Bacteria | 6520662 |
| 930 | 2511350224 | 2511231020 | Bacteria | 6115223 |
| 931 | 2511359448 | 2511231021 | Bacteria | 7302637 |
| 932 | 2511362860 | 2511231022 | Bacteria | 6719296 |
| 933 | 2511369816 | 2511231023 | Bacteria | 6808468 |
| 934 | 2511416232 | 2511231031 | Bacteria | 6558529 |
| 935 | 2511826399 | 2511231156 | Bacteria | 6845832 |
| 936 | 2512328465 | 2512047018 | Bacteria | 6663241 |
| 937 | 2555249248 | 2554235231 | Bacteria | 5215788 |
| 938 | 2555671446 | 2554235341 | Bacteria | 6867980 |
| 939 | 2583793908 | 2582580891 | Bacteria | 6800976 |
| 940 | 2597859530 | 2597489887 | Bacteria | 6666321 |
| 941 | 2597865179 | 2597489888 | Bacteria | 6179543 |
| 942 | 2597871042 | 2597489889 | Bacteria | 6297495 |
| 943 | 2599326986 | 2599185155 | Bacteria | 5827168 |
| 944 | 2599354397 | 2599185160 | Bacteria | 6844013 |
| 945 | 2599359889 | 2599185161 | Bacteria | 6960462 |
| 946 | 2599366211 | 2599185162 | Bacteria | 6957254 |
| 947 | 2599373001 | 2599185163 | Bacteria | 6995158 |
| 948 | 2599379505 | 2599185164 | Bacteria | 6841688 |
| 949 | 2599385517 | 2599185165 | Bacteria | 6843250 |
| 950 | 2599391860 | 2599185166 | Bacteria | 6959206 |
| 951 | 2599400311 | 2599185167 | Bacteria | 6353609 |
| 952 | 2599403626 | 2599185168 | Bacteria | 6997636 |
| 953 | 2599451358 | 2599185179 | Bacteria | 6611171 |
| 954 | 2599461231 | 2599185181 | Bacteria | 6844519 |
| 955 | 2599469773 | 2599185182 | Bacteria | 6883168 |
| 956 | 2599482360 | 2599185185 | Bacteria | 6652270 |
| 957 | 2599490251 | 2599185186 | Bacteria | 6831633 |
| 958 | 2599503354 | 2599185188 | Bacteria | 6164180 |
| 959 | 2599508673 | 2599185189 | Bacteria | 5862825 |
| 960 | 2599512532 | 2599185190 | Bacteria | 6285678 |
| 961 | 2599519881 | 2599185191 | Bacteria | 6297582 |
| 962 | 2599614995 | 2599185212 | Bacteria | 6765997 |
| 963 | 2599771167 | 2599185248 | Bacteria | 6696816 |
| 964 | 2599803920 | 2599185257 | Bacteria | 6492581 |
| 965 | 2599886316 | 2599185289 | Bacteria | 6778765 |
| 966 | 2599891208 | 2599185290 | Bacteria | 6289611 |
| 967 | 2599898030 | 2599185291 | Bacteria | 6775623 |
| 968 | 2599934763 | 2599185300 | Bacteria | 6062622 |
| 969 | 2599943922 | 2599185302 | Bacteria | 5954930 |
| 970 | 2599955864 | 2599185304 | Bacteria | 5951361 |
| 971 | 2599960343 | 2599185305 | Bacteria | 6748700 |
| 972 | 2599967903 | 2599185306 | Bacteria | 6637356 |
| 973 | 2599979109 | 2599185308 | Bacteria | 6621546 |
| 974 | 2599986595 | 2599185309 | Bacteria | 5969593 |
| 975 | 2599989590 | 2599185310 | Bacteria | 6014457 |
| 976 | 2599997622 | 2599185311 | Bacteria | 6354990 |
| 977 | 2600000063 | 2599185312 | Bacteria | 5912071 |
| 978 | 2600005002 | 2599185313 | Bacteria | 6658188 |
| 979 | 2600013068 | 2599185314 | Bacteria | 6621749 |
| 980 | 2600017844 | 2599185315 | Bacteria | 6771107 |
| 981 | 2600024721 | 2599185316 | Bacteria | 6320029 |
| 982 | 2600030569 | 2599185317 | Bacteria | 6435722 |
| 983 | 2600038182 | 2599185318 | Bacteria | 6961590 |
| 984 | 2600044496 | 2599185319 | Bacteria | 6637840 |
| 985 | 2600048319 | 2599185320 | Bacteria | 5963263 |
| 986 | 2600055406 | 2599185321 | Bacteria | 6764560 |
| 987 | 2600061524 | 2599185322 | Bacteria | 6763055 |
| 988 | 2600066198 | 2599185323 | Bacteria | 6688755 |
| 989 | 2600070073 | 2599185324 | Bacteria | 6590677 |
| 990 | 2600077964 | 2599185325 | Bacteria | 6324919 |
| 991 | 2600213846 | 2599185356 | Bacteria | 6843884 |
| 992 | 2600360013 | 2600254930 | Bacteria | 6431253 |
| 993 | 2600364434 | 2600254931 | Bacteria | 6734225 |
| 994 | 2600445475 | 2600254954 | Bacteria | 5100516 |
| 995 | 2601689564 | 2600255296 | Bacteria | 5784754 |
| 996 | 2601774014 | 2600255313 | Bacteria | 6842543 |
| 997 | 2601795554 | 2600255318 | Bacteria | 6383414 |
| 998 | 2602009885 | 2600255389 | Bacteria | 5275336 |
| 999 | 2606075624 | 2603880185 | Bacteria | 6379190 |
| 1000 | 2606128465 | 2603880199 | Bacteria | 6377649 |
| 1001 | 2624479491 | 2623620443 | Bacteria | 6427864 |
| 1002 | 2624493513 | 2623620446 | Bacteria | 6500345 |
| 1003 | 2643841701 | 2643221565 | Bacteria | 6216018 |
| 1004 | 2643869296 | 2643221571 | Bacteria | 6228673 |
| 1005 | 2643952625 | 2643221589 | Bacteria | 6250934 |
| 1006 | 2644022387 | 2643221602 | Bacteria | 6249926 |
| 1007 | 2644188593 | 2643221633 | Bacteria | 6733554 |
| 1008 | 2644281872 | 2643221650 | Bacteria | 7029547 |
| 1009 | 2644456803 | 2643221681 | Bacteria | 3707866 |
| 1010 | 2644622012 | 2643221713 | Bacteria | 6554480 |
| 1011 | 2671090124 | 2667528170 | Bacteria | 6786960 |
| 1012 | 2671096978 | 2667528171 | Bacteria | 6900659 |
| 1013 | 2671125236 | 2667528176 | Bacteria | 6724917 |
| 1014 | 2671770511 | 2671180172 | Bacteria | 6495783 |
| 1015 | 2677899963 | 2675903420 | Bacteria | 6247433 |
| 1016 | 2678264740 | 2675903515 | Bacteria | 6580491 |
| 1017 | 2715753884 | 2713897148 | Bacteria | 5883533 |
| 1018 | 2715757758 | 2713897149 | Bacteria | 6506249 |
| 1019 | 2718633340 | 2718217725 | Bacteria | 5758958 |
| 1020 | 2723249932 | 2721755607 | Bacteria | 5841722 |
| 1021 | 2739201273 | 2738543004 | Bacteria | 6381073 |
| 1022 | 2739261163 | 2738543015 | Bacteria | 6750701 |
| 1023 | 2739288362 | 2738543020 | Bacteria | 5718238 |
| 1024 | 2739293674 | 2738543021 | Bacteria | 5718241 |
| 1025 | 2739316707 | 2738543025 | Bacteria | 6600348 |
| 1026 | 2743739061 | 2740892503 | Bacteria | 6855563 |
| 1027 | 2745005194 | 2744054620 | Bacteria | 6551379 |
| 1028 | 2765585511 | 2765235841 | Bacteria | 6137024 |
| 1029 | 2774121287 | 2773857670 | Bacteria | 6407454 |
| 1030 | 2774137648 | 2773857673 | Bacteria | 6513460 |
| 1031 | 2784265599 | 2784132063 | Bacteria | 6262788 |
| 1032 | 2784317419 | 2784132072 | Bacteria | 6596533 |
| 1033 | 2794594989 | 2791355520 | Bacteria | 5948615 |
| 1034 | 2807407098 | 2806310737 | Bacteria | 5751088 |
| 1035 | 2807455429 | 2806310745 | Bacteria | 5742165 |
| 1036 | 2808858398 | 2808606361 | Bacteria | 6136259 |
| 1037 | 2808904511 | 2808606373 | Bacteria | 4423627 |
| 1038 | 2808926272 | 2808606376 | Bacteria | 6248667 |
| 1039 | 2808927421 | 2808606377 | Bacteria | 6646337 |
| 1040 | 2808938531 | 2808606378 | Bacteria | 6177535 |
| 1041 | 2808948355 | 2808606380 | Bacteria | 6248705 |
| 1042 | 2808950040 | 2808606381 | Bacteria | 6646461 |
| 1043 | 2808957701 | 2808606382 | Bacteria | 6841132 |
| 1044 | 2808966883 | 2808606383 | Bacteria | 6138645 |
| 1045 | 2808977888 | 2808606385 | Bacteria | 6711065 |
| 1046 | 2808993368 | 2808606388 | Bacteria | 6706662 |
| 1047 | 2809001713 | 2808606389 | Bacteria | 6138126 |
| 1048 | 2812371283 | 2811994881 | Bacteria | 6298475 |
| 1049 | 2819654741 | 2818991456 | Bacteria | 6123676 |
| 1050 | 2819702071 | 2818991464 | Bacteria | 6907494 |
| 1051 | 2825656372 | 2825651385 | Bacteria | 6715909 |
| 1052 | 2834031816 | 2834028612 | Bacteria | 6354979 |
| 1053 | 2842827596 | 2842826826 | Bacteria | 5974129 |
| 1054 | 2842832637 | 2842832357 | Bacteria | 5959113 |
| 1055 | 2842841296 | 2842837860 | Bacteria | 6066181 |
| 1056 | 2842848277 | 2842843487 | Bacteria | 6004777 |
| 1057 | 2842856759 | 2842854478 | Bacteria | 6143501 |
| 1058 | 2844671968 | 2844665904 | Bacteria | 6817974 |
| 1059 | 2852613041 | 2852612431 | Bacteria | 6885235 |
| 1060 | 2852658975 | 2852657418 | Bacteria | 6472974 |
| 1061 | 2852669224 | 2852667396 | Bacteria | 6885555 |
| 1062 | 2860339963 | 2860339153 | Bacteria | 6846989 |
| 1063 | 2860871681 | 2860867994 | Bacteria | 5645326 |
| 1064 | 2878031495 | 2878029506 | Bacteria | 6418441 |
| 1065 | 2880232365 | 2880230671 | Bacteria | 6140320 |
| 1066 | 2891637124 | 2891633521 | Bacteria | 4602265 |
| 1067 | 2904521744 | 2904518522 | Bacteria | 6068986 |
| 1068 | 2904553141 | 2904550169 | Bacteria | 6221258 |
| 1069 | 2908451090 | 2908446538 | Bacteria | 6829095 |
| 1070 | 2917075313 | 2917070673 | Bacteria | 6868303 |
| 1071 | 2917837204 | 2917832318 | Bacteria | 5346010 |
| 1072 | 2919064034 | 2919063839 | Bacteria | 6302690 |
| 1073 | 2919126794 | 2919125081 | Bacteria | 5385106 |
| 1074 | 2919158731 | 2919155634 | Bacteria | 4860545 |
| 1075 | 2919386459 | 2919385768 | Bacteria | 5897293 |
| 1076 | 2919457058 | 2919456309 | Bacteria | 6586567 |
| 1077 | 2919484269 | 2919481497 | Bacteria | 6907839 |
| 1078 | 2919491259 | 2919487758 | Bacteria | 5929766 |
| 1079 | 2919503999 | 2919501602 | Bacteria | 5286340 |
| 1080 | 2919702814 | 2919697872 | Bacteria | 6553725 |
| 1081 | 2923158141 | 2923153595 | Bacteria | 6870622 |
| 1082 | 2923525395 | 2923519811 | Bacteria | 6298479 |
| 1083 | 2923590207 | 2923586266 | Bacteria | 6565975 |
| 1084 | 2926065428 | 2926063275 | Bacteria | 5285848 |
| 1085 | 2929148673 | 2929144301 | Bacteria | 6622272 |
| 1086 | 2929193720 | 2929189879 | Bacteria | 5930554 |
| 1087 | 2931373894 | 2931369376 | Bacteria | 6847892 |
| 1088 | 2931395045 | 2931390751 | Bacteria | 6273349 |
| 1089 | 2931400144 | 2931396565 | Bacteria | 7251677 |
| 1090 | 2935356301 | 2935353572 | Unclassified | 6955622 |
| 1091 | 2939639685 | 2939636861 | Bacteria | 6297853 |
| 1092 | 2945961881 | 2945961074 | Bacteria | 7342064 |
| 1093 | 2946008452 | 2946006987 | Bacteria | 6705746 |
| 1094 | 2946032187 | 2946027586 | Bacteria | 6049274 |
| 1095 | 2947239021 | 2947233263 | Bacteria | 6439278 |
| 1096 | 2969306278 | 2969304461 | Bacteria | 6601805 |
| 1097 | 2974292067 | 2974289157 | Bacteria | 6080362 |
| 1098 | 2984288036 | 2984286254 | Bacteria | 6702062 |
| 1099 | 2984505006 | 2984504281 | Bacteria | 5262371 |
| 1100 | 2984579534 | 2984576629 | Bacteria | 4248407 |
| 1101 | 2988730255 | 2988728565 | Bacteria | 6124362 |
| 1102 | 2990257143 | 2990256926 | Bacteria | 4252839 |
| 1103 | 2998141673 | 2998139840 | Bacteria | 6073514 |
| 1104 | 3007256724 | 3007252601 | Bacteria | 4559114 |
| 1105 | 3007319035 | 3007315729 | Bacteria | 5076637 |
| 1106 | 3007397443 | 3007395558 | Bacteria | 6755444 |
| 1107 | 3007424607 | 3007419365 | Bacteria | 7026924 |
| 1108 | 3007513069 | 3007511990 | Bacteria | 6481491 |
| 1109 | 3007615871 | 3007614139 | Bacteria | 6053559 |
| 1110 | 3007624820 | 3007619802 | Bacteria | 6411688 |
| 1111 | 3007722458 | 3007718800 | Bacteria | 5971527 |
| 1112 | 3007856263 | 3007855910 | Bacteria | 5637581 |
| 1113 | 3007863088 | 3007861166 | Bacteria | 6045338 |
| 1114 | 3007870596 | 3007866637 | Bacteria | 5899198 |
| 1115 | 637321766 | 637000220 | Bacteria | 7074893 |
| 1116 | 8015692237 | 8015687852 | Bacteria | 6613826 |
| 1117 | 8016733149 | 8016728285 | Bacteria | 5263933 |
| 1118 | 8019772978 | 8019769354 | Bacteria | 6924660 |
| 1119 | 8019780305 | 8019775933 | Bacteria | 6858656 |
| 1120 | 8029999083 | 8029995093 | Bacteria | 5990776 |
| 1121 | 8034965700 | 8034962539 | Bacteria | 4884839 |
| 1122 | 8054290724 | 8054285046 | Bacteria | 6919322 |
| 1123 | 8054350696 | 8054347763 | Bacteria | 5901107 |
| 1124 | 8054507552 | 8054503363 | Bacteria | 6101651 |
| 1125 | 8055775447 | 8055770955 | Bacteria | 6827675 |
| 1126 | 8055822494 | 8055817908 | Bacteria | 6609162 |
| 1127 | 8056122142 | 8056120720 | Bacteria | 5758328 |
| 1128 | 8056130129 | 8056125926 | Bacteria | 6228218 |
| 1129 | 8056135948 | 8056131705 | Bacteria | 6107031 |
| 1130 | 8056144716 | 8056143049 | Bacteria | 6307666 |
| 1131 | 8056153277 | 8056148874 | Bacteria | 6479865 |
| 1132 | 8056156175 | 8056155041 | Bacteria | 6486948 |
| 1133 | 8056169318 | 8056166840 | Bacteria | 5820959 |
| 1134 | 8056175504 | 8056172158 | Bacteria | 6133900 |
| 1135 | 8056181199 | 8056177738 | Bacteria | 6748268 |
| 1136 | 8056573171 | 8056569372 | Bacteria | 5997322 |
| 1137 | 8057804262 | 8057798959 | Bacteria | 6713499 |
| 1138 | Ga0070660_100307815 | |||
| 1139 | MRS2a_Contig_22 | |||
| 1140 | JGI25162J39368_1000401 | |||
| 1141 | JGI25162J39368_1000412 | |||
| 1142 | JGI25163J39215_1000492 | |||
| 1143 | JGI25163J39215_1000600 | |||
| 1144 | JGI25164J39214_1000282 | |||
| 1145 | JGI25164J39214_1000291 | |||
| 1146 | JGI25165J46597_1000520 | |||
| 1147 | JGI25165J46597_1000538 | |||
| 1148 | Ga0055539_1000036 | |||
| 1149 | Ga0055533_1000046 | |||
| 1150 | Ga0055532_1000032 | |||
| 1151 | Ga0055525_1000672 | |||
| 1152 | Ga0055536_1000111 | |||
| 1153 | Ga0055536_1002092 | |||
| 1154 | Ga0055536_1002185 | |||
| 1155 | Ga0055530_10000146 | |||
| 1156 | Ga0055530_10000299 | |||
| 1157 | Ga0055530_10000634 | |||
| 1158 | Ga0055530_10043420 | |||
| 1159 | Ga0055540_1000069 | |||
| 1160 | Ga0055540_1000289 | |||
| 1161 | Ga0055540_1000390 | |||
| 1162 | Ga0055540_1005124 | |||
| 1163 | Ga0055531_10000546 | |||
| 1164 | Ga0055531_10000989 | |||
| 1165 | Ga0055541_1000024 | |||
| 1166 | Ga0065714_10000155 | |||
| 1167 | Ga0065714_10003231 | |||
| 1168 | Ga0065714_10007589 | |||
| 1169 | Ga0065714_10069585 | |||
| 1170 | Ga0065714_10069674 | |||
| 1171 | Ga0065714_10088198 | |||
| 1172 | Ga0065714_10097127 | |||
| 1173 | Ga0065712_10004565 | |||
| 1174 | Ga0065715_10048988 | |||
| 1175 | Ga0070670_100001764 | |||
| 1176 | Ga0070661_100000008 | |||
| 1177 | Ga0070661_100006145 | |||
| 1178 | Ga0070669_100011983 | |||
| 1179 | Ga0070669_100034121 | |||
| 1180 | Ga0070659_100000661 | |||
| 1181 | Ga0070713_100043129 | |||
| 1182 | Ga0070713_100152822 | |||
| 1183 | Ga0070662_100000966 | |||
| 1184 | Ga0070662_100034164 | |||
| 1185 | Ga0070665_100062992 | |||
| 1186 | Ga0070664_100000075 | |||
| 1187 | Ga0070664_100096996 | |||
| 1188 | Ga0070664_100116306 | |||
| 1189 | Ga0068854_100009394 | |||
| 1190 | Ga0068851_10000090 | |||
| 1191 | Ga0068860_100388784 | |||
| 1192 | Ga0075364_10045866 | |||
| 1193 | Ga0075364_10068318 | |||
| 1194 | Ga0075364_10127703 | |||
| 1195 | Ga0075364_10291559 | |||
| 1196 | Ga0075432_10000688 | |||
| 1197 | Ga0075432_10009218 | |||
| 1198 | Ga0075432_10009458 | |||
| 1199 | Ga0075432_10027010 | |||
| 1200 | Ga0075432_10053913 | |||
| 1201 | Ga0075362_10021708 | |||
| 1202 | Ga0075362_10106258 | |||
| 1203 | Ga0075369_10041696 | |||
| 1204 | Ga0075436_100284960 | |||
| 1205 | Ga0079104_1000433 | |||
| 1206 | Ga0099826_10074040 | |||
| 1207 | Ga0105251_10000035 | |||
| 1208 | Ga0105251_10002567 | |||
| 1209 | Ga0105251_10002666 | |||
| 1210 | Ga0105251_10003048 | |||
| 1211 | Ga0105251_10003895 | |||
| 1212 | Ga0105251_10005493 | |||
| 1213 | Ga0105251_10022317 | |||
| 1214 | Ga0105251_10029142 | |||
| 1215 | Ga0105251_10128304 | |||
| 1216 | Ga0105251_10140331 | |||
| 1217 | Ga0105244_10001613 | |||
| 1218 | Ga0105244_10001867 | |||
| 1219 | Ga0105244_10002481 | |||
| 1220 | Ga0105244_10014024 | |||
| 1221 | Ga0105244_10016862 | |||
| 1222 | Ga0105244_10032459 | |||
| 1223 | Ga0105244_10038892 | |||
| 1224 | Ga0105244_10057541 | |||
| 1225 | Ga0105244_10063174 | |||
| 1226 | Ga0105244_10081924 | |||
| 1227 | Ga0105250_10000495 | |||
| 1228 | Ga0105250_10002395 | |||
| 1229 | Ga0105250_10003531 | |||
| 1230 | Ga0105250_10057928 | |||
| 1231 | Ga0105250_10081989 | |||
| 1232 | Ga0105250_10159778 | |||
| 1233 | Ga0105240_10050963 | |||
| 1234 | Ga0105243_10000582 | |||
| 1235 | Ga0105243_10004457 | |||
| 1236 | Ga0105243_10169678 | |||
| 1237 | Ga0105243_10711144 | |||
| 1238 | Ga0105242_10002684 | |||
| 1239 | Ga0105248_10142757 | |||
| 1240 | Ga0105237_10000856 | |||
| 1241 | Ga0105237_10099100 | |||
| 1242 | Ga0105238_10000104 | |||
| 1243 | Ga0105246_10001063 | |||
| 1244 | Ga0105246_10001690 | |||
| 1245 | Ga0105246_10005393 | |||
| 1246 | Ga0105246_10015548 | |||
| 1247 | Ga0157345_1000092 | |||
| 1248 | Ga0157373_10006136 | |||
| 1249 | Ga0157373_10008708 | |||
| 1250 | Ga0157373_10013392 | |||
| 1251 | Ga0157373_10025865 | |||
| 1252 | Ga0157373_10030940 | |||
| 1253 | Ga0157373_10045393 | |||
| 1254 | Ga0157373_10076175 | |||
| 1255 | Ga0157373_10085324 | |||
| 1256 | Ga0157373_10128283 | |||
| 1257 | Ga0157371_10000301 | |||
| 1258 | Ga0157371_10000923 | |||
| 1259 | Ga0157371_10003583 | |||
| 1260 | Ga0157371_10027931 | |||
| 1261 | Ga0157371_10035712 | |||
| 1262 | Ga0157371_10280325 | |||
| 1263 | Ga0157371_10351483 | |||
| 1264 | Ga0157370_10017887 | |||
| 1265 | Ga0157370_10031592 | |||
| 1266 | Ga0157370_10074599 | |||
| 1267 | Ga0157370_10284331 | |||
| 1268 | Ga0157370_10309548 | |||
| 1269 | Ga0157370_10323062 | |||
| 1270 | Ga0157370_10504723 | |||
| 1271 | Ga0157369_10006951 | |||
| 1272 | Ga0157369_10010446 | |||
| 1273 | Ga0157369_10012750 | |||
| 1274 | Ga0157369_10013118 | |||
| 1275 | Ga0157369_10178164 | |||
| 1276 | Ga0157369_10437425 | |||
| 1277 | Ga0163162_10001480 | |||
| 1278 | Ga0163162_10309368 | |||
| 1279 | Ga0157372_10001752 | |||
| 1280 | Ga0157372_10007278 | |||
| 1281 | Ga0157375_10003908 | |||
| 1282 | Ga0157375_10004458 | |||
| 1283 | Ga0157375_10263340 | |||
| 1284 | Ga0182008_10000586 | |||
| 1285 | Ga0182008_10005642 | |||
| 1286 | Ga0182008_10008490 | |||
| 1287 | Ga0182008_10033357 | |||
| 1288 | Ga0182008_10040977 | |||
| 1289 | Ga0182008_10055521 | |||
| 1290 | Ga0182006_1000844 | |||
| 1291 | Ga0182006_1001609 | |||
| 1292 | Ga0182006_1002617 | |||
| 1293 | Ga0182006_1011672 | |||
| 1294 | Ga0182006_1016891 | |||
| 1295 | Ga0182006_1020813 | |||
| 1296 | Ga0182006_1056747 | |||
| 1297 | Ga0182006_1089108 | |||
| 1298 | Ga0182007_10001369 | |||
| 1299 | Ga0182005_1000309 | |||
| 1300 | Ga0182005_1007643 | |||
| 1301 | Ga0182005_1071976 | |||
| 1302 | Ga0163161_10002455 | |||
| 1303 | Ga0163161_10006272 | |||
| 1304 | Ga0163161_10024958 | |||
| 1305 | Ga0163161_10065059 | |||
| 1306 | Ga0163161_10075842 | |||
| 1307 | Ga0163161_10085706 | |||
| 1308 | Ga0163161_10198994 | |||
| 1309 | Ga0163161_10449339 | |||
| 1310 | Ga0163161_10488939 | |||
| 1311 | Ga0209435_101107 | |||
| 1312 | Ga0209760_100028 | |||
| 1313 | Ga0209760_100163 | |||
| 1314 | Ga0209784_100017 | |||
| 1315 | Ga0209566_100014 | |||
| 1316 | Ga0209674_100028 | |||
| 1317 | Ga0209147_100038 | |||
| 1318 | Ga0209563_100032 | |||
| 1319 | Ga0209563_101390 | |||
| 1320 | Ga0207427_100007 | |||
| 1321 | Ga0207427_100008 | |||
| 1322 | Ga0209437_100006 | |||
| 1323 | Ga0209437_100014 | |||
| 1324 | Ga0209437_103202 | |||
| 1325 | Ga0209258_100197 | |||
| 1326 | Ga0209646_1000171 | |||
| 1327 | Ga0209677_100018 | |||
| 1328 | Ga0209759_1008291 | |||
| 1329 | Ga0209233_1000008 | |||
| 1330 | Ga0209233_1000086 | |||
| 1331 | Ga0209675_1002687 | |||
| 1332 | Ga0209676_1000006 | |||
| 1333 | Ga0209676_1000016 | |||
| 1334 | Ga0209676_1000033 | |||
| 1335 | Ga0209676_1002053 | |||
| 1336 | Ga0209676_1006188 | |||
| 1337 | Ga0209050_1000070 | |||
| 1338 | Ga0209050_1000399 | |||
| 1339 | Ga0209050_1000477 | |||
| 1340 | Ga0209050_1001590 | |||
| 1341 | Ga0209051_1000034 | |||
| 1342 | Ga0209051_1000043 | |||
| 1343 | Ga0209051_1000086 | |||
| 1344 | Ga0209051_1000106 | |||
| 1345 | Ga0209051_1007908 | |||
| 1346 | Ga0209257_1000604 | |||
| 1347 | Ga0209257_1005114 | |||
| 1348 | Ga0207656_10000066 | |||
| 1349 | Ga0207696_1000025 | |||
| 1350 | Ga0207696_1000034 | |||
| 1351 | Ga0207696_1001836 | |||
| 1352 | Ga0207696_1008639 | |||
| 1353 | Ga0207696_1018130 | |||
| 1354 | Ga0207655_1000095 | |||
| 1355 | Ga0207655_1000113 | |||
| 1356 | Ga0207655_1000448 | |||
| 1357 | Ga0207655_1000863 | |||
| 1358 | Ga0207655_1003193 | |||
| 1359 | Ga0207655_1005111 | |||
| 1360 | Ga0207655_1009586 | |||
| 1361 | Ga0207655_1009939 | |||
| 1362 | Ga0207655_1013219 | |||
| 1363 | Ga0207655_1018885 | |||
| 1364 | Ga0207655_1022579 | |||
| 1365 | Ga0207655_1031638 | |||
| 1366 | Ga0207655_1044735 | |||
| 1367 | Ga0207713_1000014 | |||
| 1368 | Ga0207713_1000618 | |||
| 1369 | Ga0207713_1000900 | |||
| 1370 | Ga0207713_1002263 | |||
| 1371 | Ga0207713_1004985 | |||
| 1372 | Ga0207713_1005086 | |||
| 1373 | Ga0207713_1013164 | |||
| 1374 | Ga0207713_1015895 | |||
| 1375 | Ga0207713_1029027 | |||
| 1376 | Ga0207695_10003700 | |||
| 1377 | Ga0207671_10000035 | |||
| 1378 | Ga0207671_10069661 | |||
| 1379 | Ga0207657_10312116 | |||
| 1380 | Ga0207649_10000017 | |||
| 1381 | Ga0207649_10009703 | |||
| 1382 | Ga0207681_10000601 | |||
| 1383 | Ga0207681_10074862 | |||
| 1384 | Ga0207694_10000188 | |||
| 1385 | Ga0207650_10000180 | |||
| 1386 | Ga0207650_10000181 | |||
| 1387 | Ga0207664_10865293 | |||
| 1388 | Ga0207690_10004527 | |||
| 1389 | Ga0207706_10000796 | |||
| 1390 | Ga0207706_10025652 | |||
| 1391 | Ga0207686_10089845 | |||
| 1392 | Ga0207709_10000053 | |||
| 1393 | Ga0207709_10007205 | |||
| 1394 | Ga0207709_10024526 | |||
| 1395 | Ga0207709_10126649 | |||
| 1396 | Ga0207711_10089332 | |||
| 1397 | Ga0207679_10000005 | |||
| 1398 | Ga0207679_10009601 | |||
| 1399 | Ga0207679_10061911 | |||
| 1400 | Ga0207679_10460916 | |||
| 1401 | Ga0207658_10002103 | |||
| 1402 | Ga0207639_10002369 | |||
| 1403 | Ga0207678_10352375 | |||
| 1404 | Ga0209281_1000331 | |||
| 1405 | Ga0209281_1002909 | |||
| 1406 | Ga0207428_10034656 | |||
| 1407 | Ga0207428_10085823 | |||
| 1408 | Ga0207428_10135257 | |||
| 1409 | Ga0207428_10136129 | |||
| 1410 | Ga0207428_10215875 | |||
| 1411 | Ga0207428_10247350 | |||
| 1412 | Ga0268266_10024215 | |||
| 1413 | Ga0268266_10066941 | |||
| 1414 | Ga0316177_1109751 | |||
| 1415 | Ga0314311_1236500 | |||
| 1416 | Ga0316179_1017521 | |||
| 1417 | Ga0316178_1065336 | |||
| 1418 | Ga0316181_1231115 | |||
| 1419 | Ga0307509_10099630 | |||
| 1420 | Ga0307408_100000178 | |||
| 1421 | Ga0307408_100001335 | |||
| 1422 | Ga0307408_100001910 | |||
| 1423 | Ga0307408_100014758 | |||
| 1424 | Ga0307408_100018978 | |||
| 1425 | Ga0307514_10210001 | |||
| 1426 | Ga0307405_10000552 | |||
| 1427 | Ga0307405_10000990 | |||
| 1428 | Ga0307405_10027798 | |||
| 1429 | Ga0307405_10223733 | |||
| 1430 | Ga0307405_10330254 | |||
| 1431 | Ga0307413_10005313 | |||
| 1432 | Ga0307413_10130254 | |||
| 1433 | Ga0307406_10049760 | |||
| 1434 | Ga0307406_10066009 | |||
| 1435 | Ga0307407_10043150 | |||
| 1436 | Ga0307412_10003296 | |||
| 1437 | Ga0307412_10005665 | |||
| 1438 | Ga0307412_10006635 | |||
| 1439 | Ga0307412_10066774 | |||
| 1440 | Ga0307412_10077798 | |||
| 1441 | Ga0307412_10439773 | |||
| 1442 | Ga0307409_100064872 | |||
| 1443 | Ga0307414_10075326 | |||
| 1444 | Ga0307411_10032986 | |||
| 1445 | Ga0307411_10042272 | |||
| 1446 | Ga0307411_10181163 | |||
| 1447 | Ga0307411_10784732 | |||
| 1448 | Ga0307510_10003699 | |||
| 1449 | Ga0395899_0564784 | |||
| 1450 | Ga0395898_0156071 | |||
| 1451 | Ga0395901_0204380 | |||
| 1452 | Ga0237819_01289 | |||
| 1453 | Ga0439438_000136 | |||
| 1454 | Ga0439438_000334 | |||
| 1455 | Ga0439438_001203 | |||
| 1456 | Ga0439438_001273 | |||
| 1457 | Ga0439438_001571 | |||
| 1458 | Ga0439438_005644 | |||
| 1459 | Ga0439438_009653 | |||
| 1460 | Ga0439438_018487 | |||
| 1461 | Ga0439447_000868 | |||
| 1462 | Ga0439447_003113 | |||
| 1463 | Ga0439447_004927 | |||
| 1464 | Ga0439447_007527 | |||
| 1465 | Ga0439447_008422 | |||
| 1466 | Ga0439447_014814 | |||
| 1467 | Ga0439447_018969 | |||
| 1468 | Ga0439447_034950 | |||
| 1469 | Ga0439447_035378 | |||
| 1470 | Ga0439447_038219 | |||
| 1471 | Ga0439466_0001050 | |||
| 1472 | Ga0439466_0002125 | |||
| 1473 | Ga0439466_0009685 | |||
| 1474 | Ga0439466_0020327 | |||
| 1475 | Ga0439466_0026347 | |||
| 1476 | Ga0439466_0044251 | |||
| 1477 | Ga0439466_0104049 | |||
| 1478 | Ga0439431_0002630 | |||
| 1479 | Ga0439437_001473 | |||
| 1480 | Ga0439445_0003136 | |||
| 1481 | Ga0439432_000121 | |||
| 1482 | Ga0439432_000966 | |||
| 1483 | Ga0439432_002110 | |||
| 1484 | Ga0439432_005599 | |||
| 1485 | Ga0439432_007892 | |||
| 1486 | Ga0439432_007912 | |||
| 1487 | Ga0439432_078343 | |||
| 1488 | Ga0439432_089534 | |||
| 1489 | Ga0439451_001003 | |||
| 1490 | Ga0439451_005249 | |||
| 1491 | Ga0439451_011675 | |||
| 1492 | Ga0439451_012153 | |||
| 1493 | Ga0439451_019509 | |||
| 1494 | Ga0439452_000244 | |||
| 1495 | Ga0439452_000266 | |||
| 1496 | Ga0439452_001815 | |||
| 1497 | Ga0439452_003146 | |||
| 1498 | Ga0439452_005304 | |||
| 1499 | Ga0439452_007097 | |||
| 1500 | Ga0439452_007621 | |||
| 1501 | Ga0439452_014117 | |||
| 1502 | Ga0439455_0021837 | |||
| 1503 | Ga0439456_002955 | |||
| 1504 | Ga0439456_003157 | |||
| 1505 | Ga0439456_004168 | |||
| 1506 | Ga0439456_009160 | |||
| 1507 | Ga0439456_010323 | |||
| 1508 | Ga0439456_057989 | |||
| 1509 | Ga0439463_000075 | |||
| 1510 | Ga0439463_001632 | |||
| 1511 | Ga0439463_017378 | |||
| 1512 | Ga0450911_000002 | |||
| 1513 | Ga0450911_000098 | |||
| 1514 | Ga0450911_000237 | |||
| 1515 | Ga0450911_004412 | |||
| 1516 | Ga0450911_005122 | |||
| 1517 | Ga0450913_000422 | |||
| 1518 | Ga0450919_001258 | |||
| 1519 | Ga0450922_001071 | |||
| 1520 | Ga0450900_000787 | |||
| 1521 | Ga0450900_001236 | |||
| 1522 | Ga0450902_000426 | |||
| 1523 | Ga0450902_002316 | |||
| 1524 | Ga0450903_001500 | |||
| 1525 | Ga0450903_020654 | |||
| 1526 | Ga0450904_000020 | |||
| 1527 | Ga0450904_001733 | |||
| 1528 | Ga0450905_000529 | |||
| 1529 | Ga0450905_006941 | |||
| 1530 | Ga0450906_005293 | |||
| 1531 | Ga0450907_000076 | |||
| 1532 | Ga0450907_001323 | |||
| 1533 | Ga0450907_039519 | |||
| 1534 | Ga0450910_001032 | |||
| 1535 | Ga0450910_003499 | |||
| 1536 | Ga0439446_0001807 | |||
| 1537 | Ga0439446_0023851 | |||
| 1538 | Ga0439446_0045070 | |||
| 1539 | Ga0450908_023544 | |||
| 1540 | Ga0439459_0001600 | |||
| 1541 | Ga0439460_0017004 | |||
| 1542 | Ga0439460_0069329 | |||
| 1543 | Ga0450916_000544 | |||
| 1544 | Ga0450893_0003347 | |||
| 1545 | Ga0450893_0009826 | |||
| 1546 | Ga0450901_000007 | |||
| 1547 | Ga0450901_001884 | |||
| 1548 | Ga0451577_0151542 | |||
| 1549 | Ga0439440_0003429 | |||
| 1550 | Ga0466972_0005598 | |||
| 1551 | Ga0466959_0920316 | |||
| 1552 | Ga0466967_0544513 | |||
| 1553 | Ga0495617_000141 | |||
| 1554 | Ga0495617_001113 | |||
| 1555 | Ga0495617_003130 | |||
| 1556 | Ga0495617_003953 | |||
| 1557 | Ga0495617_005859 | |||
| 1558 | Ga0495617_018677 | |||
| 1559 | Ga0495617_025948 | |||
| 1560 | Ga0495627_000888 | |||
| 1561 | Ga0495627_001519 | |||
| 1562 | Ga0495627_001689 | |||
| 1563 | Ga0495627_002031 | |||
| 1564 | Ga0495627_002593 | |||
| 1565 | Ga0495627_007147 | |||
| 1566 | Ga0495627_113618 | |||
| 1567 | Ga0495603_0068096 | |||
| 1568 | Ga0495590_0000906 | |||
| 1569 | Ga0495590_0001189 | |||
| 1570 | Ga0495590_0002274 | |||
| 1571 | Ga0495590_0003712 | |||
| 1572 | Ga0495590_0167076 | |||
| 1573 | Ga0495591_001021 | |||
| 1574 | Ga0495591_001547 | |||
| 1575 | Ga0495591_001548 | |||
| 1576 | Ga0495591_001592 | |||
| 1577 | Ga0495591_002600 | |||
| 1578 | Ga0495591_011863 | |||
| 1579 | Ga0495591_019317 | |||
| 1580 | Ga0495591_027191 | |||
| 1581 | Ga0495591_027635 | |||
| 1582 | Ga0495591_031469 | |||
| 1583 | Ga0495629_0242579 | |||
| 1584 | Ga0495638_0002066 | |||
| 1585 | Ga0495638_0003713 | |||
| 1586 | Ga0495638_0010999 | |||
| 1587 | Ga0495638_0026125 | |||
| 1588 | Ga0495638_0028823 | |||
| 1589 | Ga0495638_0040201 | |||
| 1590 | Ga0495638_0040469 | |||
| 1591 | Ga0495638_0079098 | |||
| 1592 | Ga0495638_0081876 | |||
| 1593 | Ga0495638_0082668 | |||
| 1594 | Ga0495638_0089201 | |||
| 1595 | Ga0495638_0091852 | |||
| 1596 | Ga0495638_0094885 | |||
| 1597 | Ga0495638_0210761 | |||
| 1598 | Ga0495638_0265859 | |||
| 1599 | Ga0495653_0025631 | |||
| 1600 | Ga0495653_0067341 | |||
| 1601 | Ga0495653_0114729 | |||
| 1602 | Ga0495653_0183508 | |||
| 1603 | Ga0495650_0005082 | |||
| 1604 | Ga0495650_0010880 | |||
| 1605 | Ga0495650_0042050 | |||
| 1606 | Ga0495650_0076298 | |||
| 1607 | Ga0495650_0076869 | |||
| 1608 | Ga0495650_0156340 | |||
| 1609 | Ga0495605_0000503 | |||
| 1610 | Ga0495605_0003296 | |||
| 1611 | Ga0495605_0007234 | |||
| 1612 | Ga0495605_0010323 | |||
| 1613 | Ga0495605_0040482 | |||
| 1614 | Ga0495605_0046336 | |||
| 1615 | Ga0495639_0000065 | |||
| 1616 | Ga0495584_0000587 | |||
| 1617 | Ga0495584_0001133 | |||
| 1618 | Ga0495584_0003123 | |||
| 1619 | Ga0495584_0007020 | |||
| 1620 | Ga0495584_0007535 | |||
| 1621 | Ga0495584_0008301 | |||
| 1622 | Ga0495584_0035491 | |||
| 1623 | Ga0495584_0041235 | |||
| 1624 | Ga0495584_0051875 | |||
| 1625 | Ga0495584_0118524 | |||
| 1626 | Ga0495584_0170998 | |||
| 1627 | Ga0495585_0001301 | |||
| 1628 | Ga0495585_0001381 | |||
| 1629 | Ga0495585_0001879 | |||
| 1630 | Ga0495585_0003225 | |||
| 1631 | Ga0495585_0016011 | |||
| 1632 | Ga0495585_0026686 | |||
| 1633 | Ga0495585_0041221 | |||
| 1634 | Ga0495585_0068961 | |||
| 1635 | Ga0495585_0069103 | |||
| 1636 | Ga0495585_0224667 | |||
| 1637 | Ga0495594_0147880 | |||
| 1638 | Ga0495596_0000636 | |||
| 1639 | Ga0495596_0015822 | |||
| 1640 | Ga0495607_0000303 | |||
| 1641 | Ga0495607_0001959 | |||
| 1642 | Ga0495607_0006642 | |||
| 1643 | Ga0495607_0007164 | |||
| 1644 | Ga0495607_0019457 | |||
| 1645 | Ga0495607_0024683 | |||
| 1646 | Ga0495607_0029821 | |||
| 1647 | Ga0495607_0081085 | |||
| 1648 | Ga0495583_0000968 | |||
| 1649 | Ga0495583_0010711 | |||
| 1650 | Ga0495606_0006907 | |||
| 1651 | Ga0495606_0007110 | |||
| 1652 | Ga0495606_0008731 | |||
| 1653 | Ga0495606_0009727 | |||
| 1654 | Ga0495606_0015364 | |||
| 1655 | Ga0495606_0016555 | |||
| 1656 | Ga0495606_0030549 | |||
| 1657 | Ga0495606_0054080 | |||
| 1658 | Ga0495606_0073021 | |||
| 1659 | Ga0495606_0094632 | |||
| 1660 | Ga0495610_0003407 | |||
| 1661 | Ga0495610_0004428 | |||
| 1662 | Ga0495610_0005792 | |||
| 1663 | Ga0495610_0005940 | |||
| 1664 | Ga0495610_0009177 | |||
| 1665 | Ga0495610_0015262 | |||
| 1666 | Ga0495610_0016532 | |||
| 1667 | Ga0495610_0018131 | |||
| 1668 | Ga0495610_0021298 | |||
| 1669 | Ga0495610_0038200 | |||
| 1670 | Ga0495610_0056153 | |||
| 1671 | Ga0495610_0105139 | |||
| 1672 | Ga0495616_0001578 | |||
| 1673 | Ga0495616_0002789 | |||
| 1674 | Ga0495616_0008636 | |||
| 1675 | Ga0495616_0014868 | |||
| 1676 | Ga0495616_0022163 | |||
| 1677 | Ga0495616_0040520 | |||
| 1678 | Ga0495616_0042195 | |||
| 1679 | Ga0495616_0065749 | |||
| 1680 | Ga0495620_0000434 | |||
| 1681 | Ga0495620_0001857 | |||
| 1682 | Ga0495620_0003496 | |||
| 1683 | Ga0495620_0012829 | |||
| 1684 | Ga0495620_0016051 | |||
| 1685 | Ga0495620_0046315 | |||
| 1686 | Ga0495630_0397793 | |||
| 1687 | Ga0495631_0000904 | |||
| 1688 | Ga0495631_0001389 | |||
| 1689 | Ga0495631_0010705 | |||
| 1690 | Ga0495631_0036245 | |||
| 1691 | Ga0495631_0066117 | |||
| 1692 | Ga0495631_0096072 | |||
| 1693 | Ga0495631_0108954 | |||
| 1694 | Ga0495631_0152574 | |||
| 1695 | Ga0495632_0000432 | |||
| 1696 | Ga0495632_0000608 | |||
| 1697 | Ga0495632_0005432 | |||
| 1698 | Ga0495632_0011378 | |||
| 1699 | Ga0495632_0017374 | |||
| 1700 | Ga0495632_0018212 | |||
| 1701 | Ga0495632_0032629 | |||
| 1702 | Ga0495632_0041361 | |||
| 1703 | Ga0495632_0116744 | |||
| 1704 | Ga0495632_0181793 | |||
| 1705 | Ga0495632_0245389 | |||
| 1706 | Ga0495637_0000644 | |||
| 1707 | Ga0495637_0001994 | |||
| 1708 | Ga0495637_0002146 | |||
| 1709 | Ga0495637_0002264 | |||
| 1710 | Ga0495637_0003111 | |||
| 1711 | Ga0495637_0003390 | |||
| 1712 | Ga0495637_0041411 | |||
| 1713 | Ga0495637_0042108 | |||
| 1714 | Ga0495637_0045740 | |||
| 1715 | Ga0495637_0051717 | |||
| 1716 | Ga0495637_0093167 | |||
| 1717 | Ga0495643_0016327 | |||
| 1718 | Ga0495643_0041554 | |||
| 1719 | Ga0495643_0050063 | |||
| 1720 | Ga0495643_0062906 | |||
| 1721 | Ga0495643_0075558 | |||
| 1722 | Ga0495643_0131074 | |||
| 1723 | Ga0495644_0000433 | |||
| 1724 | Ga0495644_0004554 | |||
| 1725 | Ga0495644_0008393 | |||
| 1726 | Ga0495648_0000755 | |||
| 1727 | Ga0495648_0003719 | |||
| 1728 | Ga0495648_0003864 | |||
| 1729 | Ga0495648_0004695 | |||
| 1730 | Ga0495648_0019417 | |||
| 1731 | Ga0495648_0033256 | |||
| 1732 | Ga0495648_0040497 | |||
| 1733 | Ga0495648_0062177 | |||
| 1734 | Ga0495648_0064259 | |||
| 1735 | Ga0495648_0071520 | |||
| 1736 | Ga0495648_0152842 | |||
| 1737 | Ga0495648_0318220 | |||
| 1738 | Ga0495666_0000849 | |||
| 1739 | Ga0495666_0015490 | |||
| 1740 | Ga0495666_0019440 | |||
| 1741 | Ga0495666_0154965 | |||
| 1742 | Ga0495642_0000172 | |||
| 1743 | Ga0495642_0000431 | |||
| 1744 | Ga0495642_0001100 | |||
| 1745 | Ga0495654_0001418 | |||
| 1746 | Ga0495654_0001859 | |||
| 1747 | Ga0495654_0002022 | |||
| 1748 | Ga0495654_0004269 | |||
| 1749 | Ga0495654_0005170 | |||
| 1750 | Ga0495654_0020991 | |||
| 1751 | Ga0495654_0043616 | |||
| 1752 | Ga0495654_0052687 | |||
| 1753 | Ga0495654_0062480 | |||
| 1754 | Ga0495654_0163480 | |||
| 1755 | Ga0495640_0062550 | |||
| 1756 | Ga0495586_0427395 | |||
| 1757 | Ga0495587_0001431 | |||
| 1758 | Ga0495609_0001481 | |||
| 1759 | Ga0495609_0001854 | |||
| 1760 | Ga0495609_0003187 | |||
| 1761 | Ga0495609_0029734 | |||
| 1762 | Ga0495609_0033208 | |||
| 1763 | Ga0495609_0057677 | |||
| 1764 | Ga0495597_0013023 | |||
| 1765 | Ga0495597_0017573 | |||
| 1766 | Ga0495597_0019725 | |||
| 1767 | Ga0495597_0020334 | |||
| 1768 | Ga0495597_0045120 | |||
| 1769 | Ga0495597_0046147 | |||
| 1770 | Ga0495597_0046245 | |||
| 1771 | Ga0495597_0055534 | |||
| 1772 | Ga0495597_0094282 | |||
| 1773 | Ga0495622_0000424 | |||
| 1774 | Ga0495622_0012195 | |||
| 1775 | Ga0495622_0024698 | |||
| 1776 | Ga0495633_0007093 | |||
| 1777 | Ga0495633_0021600 | |||
| 1778 | Ga0495633_0053716 | |||
| 1779 | Ga0495656_0006623 | |||
| 1780 | Ga0495656_0049490 | |||
| 1781 | Ga0495668_0004091 | |||
| 1782 | Ga0495668_0005751 | |||
| 1783 | Ga0495668_0014322 | |||
| 1784 | Ga0495634_0001783 | |||
| 1785 | Ga0495634_0125657 | |||
| 1786 | Ga0495611_0001497 | |||
| 1787 | Ga0495611_0014835 | |||
| 1788 | Ga0495625_0003322 | |||
| 1789 | Ga0495625_0004745 | |||
| 1790 | Ga0495625_0008534 | |||
| 1791 | Ga0495625_0016363 | |||
| 1792 | Ga0495625_0028913 | |||
| 1793 | Ga0495625_0081921 | |||
| 1794 | Ga0495625_0088601 | |||
| 1795 | Ga0495625_0181291 | |||
| 1796 | Ga0495625_0220389 | |||
| 1797 | Ga0495635_0086668 | |||
| 1798 | Ga0495659_0000092 | |||
| 1799 | Ga0495659_0005829 | |||
| 1800 | Ga0495661_0000150 | |||
| 1801 | Ga0495661_0000644 | |||
| 1802 | Ga0495661_0065351 | |||
| 1803 | Ga0495661_0086089 | |||
| 1804 | Ga0495661_0185030 | |||
| 1805 | Ga0495588_0028959 | |||
| 1806 | Ga0495623_0008534 | |||
| 1807 | Ga0495623_0010779 | |||
| 1808 | Ga0495646_0036105 | |||
| 1809 | Ga0495669_0001041 | |||
| 1810 | Ga0495613_0077270 | |||
| 1811 | Ga0495624_0001547 | |||
| 1812 | Ga0495670_0001560 | |||
| 1813 | Ga0495670_0016853 | |||
| 1814 | Ga0495670_0026361 | |||
| 1815 | Ga0495670_0054150 | |||
| 1816 | Ga0495670_0064448 | |||
| 1817 | Ga0495670_0139403 | |||
| 1818 | Ga0495671_0000813 | |||
| 1819 | Ga0495671_0001029 | |||
| 1820 | Ga0495671_0002178 | |||
| 1821 | Ga0495671_0009328 | |||
| 1822 | Ga0495671_0009721 | |||
| 1823 | Ga0495671_0028217 | |||
| 1824 | Ga0495671_0050594 | |||
| 1825 | Ga0495671_0053811 | |||
| 1826 | Ga0495671_0077499 | |||
| 1827 | Ga0495671_0105866 | |||
| 1828 | Ga0495671_0166358 | |||
| 1829 | Ga0495649_0000963 | |||
| 1830 | Ga0495649_0001599 | |||
| 1831 | Ga0495649_0005511 | |||
| 1832 | Ga0495649_0005684 | |||
| 1833 | Ga0495649_0016635 | |||
| 1834 | Ga0495649_0017404 | |||
| 1835 | Ga0495649_0023663 | |||
| 1836 | Ga0495649_0036785 | |||
| 1837 | Ga0495649_0053367 | |||
| 1838 | Ga0495649_0059499 | |||
| 1839 | Ga0495649_0059650 | |||
| 1840 | Ga0495649_0062220 | |||
| 1841 | Ga0495649_0076536 | |||
| 1842 | Ga0495649_0090784 | |||
| 1843 | Ga0495649_0128221 | |||
| 1844 | Ga0495649_0148340 | |||
| 1845 | Ga0495589_0000228 | |||
| 1846 | Ga0495589_0001455 | |||
| 1847 | Ga0495589_0003502 | |||
| 1848 | Ga0495589_0015952 | |||
| 1849 | Ga0495589_0058086 | |||
| 1850 | Ga0495589_0064897 | |||
| 1851 | Ga0495600_0010973 | |||
| 1852 | Ga0495600_0031792 | |||
| 1853 | Ga0495600_0054268 | |||
| 1854 | Ga0495600_0357124 | |||
| 1855 | Ga0495660_0016400 | |||
| 1856 | Ga0495660_0021973 | |||
| 1857 | Ga0495660_0027221 | |||
| 1858 | Ga0495660_0037088 | |||
| 1859 | Ga0495660_0042324 | |||
| 1860 | Ga0495660_0052254 | |||
| 1861 | Ga0495660_0067243 | |||
| 1862 | Ga0495660_0133681 | |||
| 1863 | Ga0495660_0143239 | |||
| 1864 | Ga0495604_0053245 | |||
| 1865 | Ga0495604_0105207 | |||
| 1866 | Ga0495604_0112146 | |||
| 1867 | Ga0495636_0002670 | |||
| 1868 | Ga0495636_0130239 | |||
| 1869 | Ga0495674_0059842 | |||
| 1870 | Ga0495672_0000961 | |||
| 1871 | Ga0495672_0001005 | |||
| 1872 | Ga0495672_0002561 | |||
| 1873 | Ga0495672_0002917 | |||
| 1874 | Ga0495672_0003368 | |||
| 1875 | Ga0495672_0003595 | |||
| 1876 | Ga0495672_0005328 | |||
| 1877 | Ga0495672_0007163 | |||
| 1878 | Ga0495672_0028017 | |||
| 1879 | Ga0495672_0043959 | |||
| 1880 | Ga0495672_0194326 | |||
| 1881 | Ga0495676_0098453 | |||
| 1882 | Ga0495680_0002345 | |||
| 1883 | Ga0495680_0054590 | |||
| 1884 | Ga0495680_0106996 | |||
| 1885 | Ga0495683_0000315 | |||
| 1886 | Ga0495683_0001195 | |||
| 1887 | Ga0495683_0002437 | |||
| 1888 | Ga0495683_0003622 | |||
| 1889 | Ga0495683_0007057 | |||
| 1890 | Ga0495683_0008058 | |||
| 1891 | Ga0495687_001061 | |||
| 1892 | Ga0495687_001498 | |||
| 1893 | Ga0495687_008894 | |||
| 1894 | Ga0495687_036429 | |||
| 1895 | Ga0495675_0001269 | |||
| 1896 | Ga0495675_0014428 | |||
| 1897 | Ga0495677_0001027 | |||
| 1898 | Ga0495679_001719 | |||
| 1899 | Ga0495679_002618 | |||
| 1900 | Ga0495679_008334 | |||
| 1901 | Ga0495679_020350 | |||
| 1902 | Ga0495679_022968 | |||
| 1903 | Ga0495679_025868 | |||
| 1904 | Ga0495679_026752 | |||
| 1905 | Ga0495685_007616 | |||
| 1906 | Ga0495673_0001692 | |||
| 1907 | Ga0495673_0002018 | |||
| 1908 | Ga0495673_0008257 | |||
| 1909 | Ga0495673_0009029 | |||
| 1910 | Ga0495673_0014863 | |||
| 1911 | Ga0495673_0020040 | |||
| 1912 | Ga0495673_0034152 | |||
| 1913 | Ga0495673_0045179 | |||
| 1914 | Ga0495673_0067632 | |||
| 1915 | Ga0495673_0071437 | |||
| 1916 | Ga0495681_0000690 | |||
| 1917 | Ga0495681_0001374 | |||
| 1918 | Ga0495681_0003141 | |||
| 1919 | Ga0495681_0003289 | |||
| 1920 | Ga0495681_0006287 | |||
| 1921 | Ga0495681_0008605 | |||
| 1922 | Ga0495681_0018959 | |||
| 1923 | Ga0495681_0027483 | |||
| 1924 | Ga0495681_0028589 | |||
| 1925 | Ga0495681_0076809 | |||
| 1926 | Ga0495681_0076971 | |||
| 1927 | Ga0495681_0167509 | |||
| 1928 | Ga0495684_0040862 | |||
| 1929 | Ga0495686_0002188 | |||
| 1930 | Ga0495686_0004465 | |||
| 1931 | Ga0495686_0010346 | |||
| 1932 | Ga0495686_0011308 | |||
| 1933 | Ga0495686_0011468 | |||
| 1934 | Ga0495686_0131256 | |||
| 1935 | Ga0495593_0004293 | |||
| 1936 | Ga0495593_0066496 | |||
| 1937 | Ga0495593_0096865 | |||
| 1938 | Ga0495593_0146786 | |||
| 1939 | Ga0495602_0233125 | |||
| 1940 | Ga0495626_0000548 | |||
| 1941 | Ga0495626_0000625 | |||
| 1942 | Ga0495626_0001985 | |||
| 1943 | Ga0495626_0003314 | |||
| 1944 | Ga0495626_0022330 | |||
| 1945 | Ga0495626_0058117 | |||
| 1946 | Ga0495626_0090246 | |||
| 1947 | Ga0496100_0000089 | |||
| 1948 | Ga0496101_0000086 | |||
| 1949 | Ga0496102_0000823 | |||
| 1950 | Ga0496102_0003503 | |||
| 1951 | Ga0496106_0006013 | |||
| 1952 | Ga0496107_0000566 | |||
| 1953 | Ga0496107_0397025 | |||
| 1954 | Ga0496108_0009925 | |||
| 1955 | Ga0496109_0000104 | |||
| 1956 | Ga0496110_0048721 | |||
| 1957 | Ga0496110_0164906 | |||
| 1958 | Ga0496111_0015765 | |||
| 1959 | Ga0496114_0004029 | |||
| 1960 | Ga0496114_0293039 | |||
| 1961 | Ga0496115_0015204 | |||
| 1962 | Ga0496116_0000792 | |||
| 1963 | Ga0496116_0001281 | |||
| 1964 | Ga0496116_0002066 | |||
| 1965 | Ga0496116_0011064 | |||
| 1966 | Ga0496116_0037559 | |||
| 1967 | Ga0496116_0041737 | |||
| 1968 | Ga0496117_0002238 | |||
| 1969 | Ga0496117_0002790 | |||
| 1970 | Ga0496117_0013323 | |||
| 1971 | Ga0496117_0068980 | |||
| 1972 | Ga0496117_0087212 | |||
| 1973 | Ga0496117_0098082 | |||
| 1974 | Ga0496118_0009034 | |||
| 1975 | Ga0496118_0014247 | |||
| 1976 | Ga0496118_0024414 | |||
| 1977 | Ga0496118_0088070 | |||
| 1978 | Ga0496119_0000380 | |||
| 1979 | Ga0496119_0008624 | |||
| 1980 | Ga0496119_0043979 | |||
| 1981 | Ga0496120_0002903 | |||
| 1982 | Ga0496120_0005346 | |||
| 1983 | Ga0496120_0038604 | |||
| 1984 | Ga0496121_0000002 | |||
| 1985 | Ga0496121_0001360 | |||
| 1986 | Ga0496121_0001710 | |||
| 1987 | Ga0496121_0043792 | |||
| 1988 | Ga0496121_0077146 | |||
| 1989 | Ga0496121_0096298 | |||
| 1990 | Ga0496122_0000078 | |||
| 1991 | Ga0496122_0002322 | |||
| 1992 | Ga0496122_0054299 | |||
| 1993 | Ga0496122_0054902 | |||
| 1994 | Ga0496122_0072106 | |||
| 1995 | Ga0496122_0081426 | |||
| 1996 | Ga0496123_0003839 | |||
| 1997 | Ga0496123_0007353 | |||
| 1998 | Ga0496123_0028280 | |||
| 1999 | Ga0496123_0044048 | |||
| 2000 | Ga0496123_0064437 | |||
| 2001 | Ga0496123_0131988 | |||
| 2002 | Ga0496124_0000002 | |||
| 2003 | Ga0496124_0000939 | |||
| 2004 | Ga0496124_0001100 | |||
| 2005 | Ga0496124_0002905 | |||
| 2006 | Ga0496124_0003679 | |||
| 2007 | Ga0496124_0010329 | |||
| 2008 | Ga0496124_0026522 | |||
| 2009 | Ga0496124_0051954 | |||
| 2010 | Ga0496124_0058536 | |||
| 2011 | Ga0496124_0090785 | |||
| 2012 | Ga0496124_0099581 | |||
| 2013 | Ga0496124_0158501 | |||
| 2014 | Ga0496124_0163392 | |||
| 2015 | Ga0496125_0000002 | |||
| 2016 | Ga0496125_0005259 | |||
| 2017 | Ga0496125_0006162 | |||
| 2018 | Ga0496125_0008532 | |||
| 2019 | Ga0496125_0019041 | |||
| 2020 | Ga0496125_0028979 | |||
| 2021 | Ga0496125_0051671 | |||
| 2022 | Ga0496125_0075475 | |||
| 2023 | Ga0496125_0083261 | |||
| 2024 | Ga0496125_0084356 | |||
| 2025 | Ga0496125_0261548 | |||
| 2026 | Ga0496126_0000009 | |||
| 2027 | Ga0496126_0016184 | |||
| 2028 | Ga0496126_0052894 | |||
| 2029 | Ga0496126_0083493 | |||
| 2030 | Ga0496126_0122659 | |||
| 2031 | Ga0495678_000911 | |||
| 2032 | Ga0495678_002313 | |||
| 2033 | Ga0495678_007297 | |||
| 2034 | Ga0495678_010778 | |||
| 2035 | Ga0495678_017359 | |||
| 2036 | Ga0495678_020393 | |||
| 2037 | Ga0495678_031130 | |||
| 2038 | Ga0495678_039158 | |||
| 2039 | Ga0495678_170049 | |||
| 2040 | Ga0495682_0000234 | |||
| 2041 | Ga0495682_0018563 | |||
| 2042 | Ga0495682_0032306 | |||
| 2043 | Ga0495682_0038342 | |||
| 2044 | Ga0495682_0054012 | |||
| 2045 | Ga0501226_000007 | |||
| 2046 | Ga0500635_0044495 | |||
| 2047 | Ga0500566_0013928 | |||
| 2048 | Ga0500618_001501 | |||
| 2049 | Ga0500568_0035633 | |||
| 2050 | Ga0500588_0026653 | |||
| 2051 | Ga0500603_005561 | |||
| 2052 | Ga0500622_0002043 | |||
| 2053 | Ga0500634_0061656 | |||
| 2054 | 2511254619 | |||
| 2055 | 2511266584 | |||
| 2056 | 2511270713 | |||
| 2057 | 2511277295 | |||
| 2058 | 2511287321 | |||
| 2059 | 2511294734 | |||
| 2060 | 2511303406 | |||
| 2061 | 2511312790 | |||
| 2062 | 2511321740 | |||
| 2063 | 2511328774 | |||
| 2064 | 2511331725 | |||
| 2065 | 2511340709 | |||
| 2066 | 2511343863 | |||
| 2067 | 2511350224 | |||
| 2068 | 2511359448 | |||
| 2069 | 2511362860 | |||
| 2070 | 2511369816 | |||
| 2071 | 2511416232 | |||
| 2072 | 2511826399 | |||
| 2073 | 2512328465 | |||
| 2074 | 2555249248 | |||
| 2075 | 2555671446 | |||
| 2076 | 2583793908 | |||
| 2077 | 2597859530 | |||
| 2078 | 2597865179 | |||
| 2079 | 2597871042 | |||
| 2080 | 2599326986 | |||
| 2081 | 2599354397 | |||
| 2082 | 2599359889 | |||
| 2083 | 2599366211 | |||
| 2084 | 2599373001 | |||
| 2085 | 2599379505 | |||
| 2086 | 2599385517 | |||
| 2087 | 2599391860 | |||
| 2088 | 2599400311 | |||
| 2089 | 2599403626 | |||
| 2090 | 2599451358 | |||
| 2091 | 2599461231 | |||
| 2092 | 2599469773 | |||
| 2093 | 2599482360 | |||
| 2094 | 2599490251 | |||
| 2095 | 2599503354 | |||
| 2096 | 2599508673 | |||
| 2097 | 2599512532 | |||
| 2098 | 2599519881 | |||
| 2099 | 2599614995 | |||
| 2100 | 2599771167 | |||
| 2101 | 2599803920 | |||
| 2102 | 2599886316 | |||
| 2103 | 2599891208 | |||
| 2104 | 2599898030 | |||
| 2105 | 2599934763 | |||
| 2106 | 2599943922 | |||
| 2107 | 2599955864 | |||
| 2108 | 2599960343 | |||
| 2109 | 2599967903 | |||
| 2110 | 2599979109 | |||
| 2111 | 2599986595 | |||
| 2112 | 2599989590 | |||
| 2113 | 2599997622 | |||
| 2114 | 2600000063 | |||
| 2115 | 2600005002 | |||
| 2116 | 2600013068 | |||
| 2117 | 2600017844 | |||
| 2118 | 2600024721 | |||
| 2119 | 2600030569 | |||
| 2120 | 2600038182 | |||
| 2121 | 2600044496 | |||
| 2122 | 2600048319 | |||
| 2123 | 2600055406 | |||
| 2124 | 2600061524 | |||
| 2125 | 2600066198 | |||
| 2126 | 2600070073 | |||
| 2127 | 2600077964 | |||
| 2128 | 2600213846 | |||
| 2129 | 2600360013 | |||
| 2130 | 2600364434 | |||
| 2131 | 2600445475 | |||
| 2132 | 2601689564 | |||
| 2133 | 2601774014 | |||
| 2134 | 2601795554 | |||
| 2135 | 2602009885 | |||
| 2136 | 2606075624 | |||
| 2137 | 2606128465 | |||
| 2138 | 2624479491 | |||
| 2139 | 2624493513 | |||
| 2140 | 2643841701 | |||
| 2141 | 2643869296 | |||
| 2142 | 2643952625 | |||
| 2143 | 2644022387 | |||
| 2144 | 2644188593 | |||
| 2145 | 2644281872 | |||
| 2146 | 2644456803 | |||
| 2147 | 2644622012 | |||
| 2148 | 2671090124 | |||
| 2149 | 2671096978 | |||
| 2150 | 2671125236 | |||
| 2151 | 2671770511 | |||
| 2152 | 2677899963 | |||
| 2153 | 2678264740 | |||
| 2154 | 2715753884 | |||
| 2155 | 2715757758 | |||
| 2156 | 2718633340 | |||
| 2157 | 2723249932 | |||
| 2158 | 2739201273 | |||
| 2159 | 2739261163 | |||
| 2160 | 2739288362 | |||
| 2161 | 2739293674 | |||
| 2162 | 2739316707 | |||
| 2163 | 2743739061 | |||
| 2164 | 2745005194 | |||
| 2165 | 2765585511 | |||
| 2166 | 2774121287 | |||
| 2167 | 2774137648 | |||
| 2168 | 2784265599 | |||
| 2169 | 2784317419 | |||
| 2170 | 2794594989 | |||
| 2171 | 2807407098 | |||
| 2172 | 2807455429 | |||
| 2173 | 2808858398 | |||
| 2174 | 2808904511 | |||
| 2175 | 2808926272 | |||
| 2176 | 2808927421 | |||
| 2177 | 2808938531 | |||
| 2178 | 2808948355 | |||
| 2179 | 2808950040 | |||
| 2180 | 2808957701 | |||
| 2181 | 2808966883 | |||
| 2182 | 2808977888 | |||
| 2183 | 2808993368 | |||
| 2184 | 2809001713 | |||
| 2185 | 2812371283 | |||
| 2186 | 2819654741 | |||
| 2187 | 2819702071 | |||
| 2188 | 2825656372 | |||
| 2189 | 2834031816 | |||
| 2190 | 2842827596 | |||
| 2191 | 2842832637 | |||
| 2192 | 2842841296 | |||
| 2193 | 2842848277 | |||
| 2194 | 2842856759 | |||
| 2195 | 2844671968 | |||
| 2196 | 2852613041 | |||
| 2197 | 2852658975 | |||
| 2198 | 2852669224 | |||
| 2199 | 2860339963 | |||
| 2200 | 2860871681 | |||
| 2201 | 2878031495 | |||
| 2202 | 2880232365 | |||
| 2203 | 2891637124 | |||
| 2204 | 2904521744 | |||
| 2205 | 2904553141 | |||
| 2206 | 2908451090 | |||
| 2207 | 2917075313 | |||
| 2208 | 2917837204 | |||
| 2209 | 2919064034 | |||
| 2210 | 2919126794 | |||
| 2211 | 2919158731 | |||
| 2212 | 2919386459 | |||
| 2213 | 2919457058 | |||
| 2214 | 2919484269 | |||
| 2215 | 2919491259 | |||
| 2216 | 2919503999 | |||
| 2217 | 2919702814 | |||
| 2218 | 2923158141 | |||
| 2219 | 2923525395 | |||
| 2220 | 2923590207 | |||
| 2221 | 2926065428 | |||
| 2222 | 2929148673 | |||
| 2223 | 2929193720 | |||
| 2224 | 2931373894 | |||
| 2225 | 2931395045 | |||
| 2226 | 2931400144 | |||
| 2227 | 2935356301 | |||
| 2228 | 2939639685 | |||
| 2229 | 2945961881 | |||
| 2230 | 2946008452 | |||
| 2231 | 2946032187 | |||
| 2232 | 2947239021 | |||
| 2233 | 2969306278 | |||
| 2234 | 2974292067 | |||
| 2235 | 2984288036 | |||
| 2236 | 2984505006 | |||
| 2237 | 2984579534 | |||
| 2238 | 2988730255 | |||
| 2239 | 2990257143 | |||
| 2240 | 2998141673 | |||
| 2241 | 3007256724 | |||
| 2242 | 3007319035 | |||
| 2243 | 3007397443 | |||
| 2244 | 3007424607 | |||
| 2245 | 3007513069 | |||
| 2246 | 3007615871 | |||
| 2247 | 3007624820 | |||
| 2248 | 3007722458 | |||
| 2249 | 3007856263 | |||
| 2250 | 3007863088 | |||
| 2251 | 3007870596 | |||
| 2252 | 637321766 | |||
| 2253 | 8015692237 | |||
| 2254 | 8016733149 | |||
| 2255 | 8019772978 | |||
| 2256 | 8019780305 | |||
| 2257 | 8029999083 | |||
| 2258 | 8034965700 | |||
| 2259 | 8054290724 | |||
| 2260 | 8054350696 | |||
| 2261 | 8054507552 | |||
| 2262 | 8055775447 | |||
| 2263 | 8055822494 | |||
| 2264 | 8056122142 | |||
| 2265 | 8056130129 | |||
| 2266 | 8056135948 | |||
| 2267 | 8056144716 | |||
| 2268 | 8056153277 | |||
| 2269 | 8056156175 | |||
| 2270 | 8056169318 | |||
| 2271 | 8056175504 | |||
| 2272 | 8056181199 | |||
| 2273 | 8056573171 | |||
| 2274 | 8057804262 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2isj-assembly1.cif.gz_A | blub bound to oxidized fmn | 0.8661 | 1 | 205 |
| 2isj-assembly1.cif.gz_A | blub bound to oxidized fmn | 0.8546 | 1 | 205 |
| 4xom-assembly2.cif.gz_D | coenzyme f420:l-glutamate ligase (fbib) from mycobacterium tuberculosis (c-terminal domain). | 0.7905 | 21 | 176 |
| 6q1l-assembly1.cif.gz_B | crystal structure of oxidized iodotyrosine deiodinase (iyd) bound to fmn and 3-iodo-l-tyrosine | 0.7893 | 14 | 175 |
| 3e10-assembly1.cif.gz_A | crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution | 0.7593 | 17 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07233_1_181_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.9072 | 5 | 176 | 3.40.109.10 |
| 2isjB01 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8739 | 1 | 179 | 3.40.109.10 |
| af_O07233_1_181_3.40.109.10 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8602 | 5 | 176 | 3.40.109.10 |
| 2isjB01 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.8112 | 1 | 179 | 3.40.109.10 |
| 3gfdA01 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.799 | 7 | 175 | 3.40.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A367LY69-F1-model_v4 | 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) | 0.9403 | 25 | 166 |
GO:0102919
|
| AF-Q1IDK2-F1-model_v4 | Putative nitroreductase putative cobalamine biosynthesis protein (EC 1.16.8.1) | 0.9181 | 24 | 207 |
GO:0016491
|
| AF-A0A2M7IBA7-F1-model_v4 | 5,6-dimethylbenzimidazole synthase | 0.9156 | 15 | 151 |
GO:0016491
|
| AF-F6F1D3-F1-model_v4 | Cob(II)yrinic acid a,c-diamide reductase (EC 1.16.8.1) | 0.9153 | 24 | 201 |
GO:0016491
|
| AF-A0A7C3DGQ9-F1-model_v4 | 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) | 0.9146 | 16 | 192 |
GO:0102919
|