F490642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1137 | 578 | 2274 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10321575|Ga0105249_103215752 |
| Length | 307 |
| Sequence | MMDWTDRHCRVFHRLMTRRSRLYTEMLTTGAIIHGDRRRLLGFDASEHPVALQLGIGEDFGYDEININVGCPSDRVKDGRFGACLMAEPALVADGVAAMKRAVKIPVTVKCRIGIDDQDPEIALDELARGVVAAGADALIVHARKAWLNGLSPKENRDIPPLDYDRVYRLKAALPDVPVIINGGIGSIAEAARHLDHVDGVMLGRAAYQEPWRLLEVDPELFGEAAPYATMKDVFEAMFPYIEDQLAQGARLHSMTRHFVGAFHGVPGARAFRRHLAEKGVKPGAGVDVLRDAIALVEDRAAEAVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 95 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 216 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 222 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 267 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 268 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 269 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 274 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 275 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 278 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 279 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 286 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 287 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 364 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 365 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 366 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 378 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 379 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 380 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 381 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 433 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 436 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 438 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 439 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 440 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 442 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 443 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 444 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 445 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 448 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 450 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 451 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 453 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 457 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 458 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 460 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 461 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 462 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 463 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 465 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 466 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 468 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 469 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 473 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 475 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 476 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 477 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 479 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 481 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 482 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 483 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 484 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 485 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 486 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 487 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 488 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 489 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 490 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 491 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 492 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 493 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 494 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 495 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 496 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 497 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 498 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 499 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 500 | 2791355199 | |||
| 501 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 502 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 503 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 504 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 505 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 506 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 507 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 508 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 509 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 510 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 511 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 512 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 513 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 514 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 515 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 516 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 517 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 518 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 519 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 520 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 521 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 522 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 523 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 524 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 525 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 526 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 527 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 528 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 529 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 530 | 2904699407 | |||
| 531 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 532 | 2906610324 | |||
| 533 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 534 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 535 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 536 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 537 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 538 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 539 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 540 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 541 | 2922425934 | |||
| 542 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 543 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 544 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 545 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 546 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 547 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 548 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 549 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 550 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 551 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 552 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 553 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 554 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 555 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 556 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 557 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 558 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 559 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 560 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 561 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 562 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 563 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 564 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 565 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 566 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 567 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 568 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 569 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 570 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 571 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 572 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 573 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 574 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 575 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 576 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 577 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 578 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.35 |
| Metatranscriptomes | 0.44 |
| Isolates | 8.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.17 |
| Nodule | 6.33 |
| Rhizoplane | 5.8 |
| Rhizosphere | 68.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105249_10321575 | 3300009553 | Bacteria | 1558 |
| 2 | SwRhRL2b_contig_3446018 | 2162886007 | Bacteria | 2073 |
| 3 | 2214767425 | 2209111006 | Bacteria | 2786 |
| 4 | ARcpr5oldR_c000015 | 3300000041 | Bacteria | 37040 |
| 5 | ARcpr5yngRDRAFT_c000041 | 3300000043 | Bacteria | 20456 |
| 6 | ARSoilOldRDRAFT_c000020 | 3300000044 | Bacteria | 36475 |
| 7 | LJQas_1002377 | 3300000549 | Bacteria | 2624 |
| 8 | ARCol0yngRDRAFT_1000465 | 3300000652 | Bacteria | 4874 |
| 9 | JGI24741J21665_1001722 | 3300001915 | Bacteria | 6034 |
| 10 | JGI24751J29686_10011876 | 3300002459 | Bacteria | 1797 |
| 11 | JGI25406J46586_10000107 | 3300003203 | Bacteria | 37037 |
| 12 | JGI25406J46586_10032899 | 3300003203 | Bacteria | 1921 |
| 13 | JGI25153J46596_10003474 | 3300003215 | Bacteria | 8818 |
| 14 | JGI25153J46596_10005518 | 3300003215 | Bacteria | 6619 |
| 15 | JGI25404J52841_10000207 | 3300003659 | Bacteria | 7108 |
| 16 | JGI25404J52841_10004473 | 3300003659 | Bacteria | 2834 |
| 17 | JGI25404J52841_10005027 | 3300003659 | Bacteria | 2717 |
| 18 | Ga0055543_1003572 | 3300004625 | Bacteria | 4506 |
| 19 | Ga0065165_1000611 | 3300005262 | Bacteria | 51919 |
| 20 | Ga0065165_1002289 | 3300005262 | Bacteria | 16803 |
| 21 | Ga0065165_1015899 | 3300005262 | Bacteria | 2847 |
| 22 | Ga0065704_10073457 | 3300005289 | Bacteria | 7145 |
| 23 | Ga0065712_10068673 | 3300005290 | Bacteria | 9438 |
| 24 | Ga0065715_10001423 | 3300005293 | Bacteria | 13648 |
| 25 | Ga0065707_10107116 | 3300005295 | Bacteria | 2568 |
| 26 | Ga0070658_10022153 | 3300005327 | Bacteria | 5097 |
| 27 | Ga0070683_100003299 | 3300005329 | Bacteria | 13045 |
| 28 | Ga0070683_100045550 | 3300005329 | Bacteria | 4048 |
| 29 | Ga0070690_100056719 | 3300005330 | Bacteria | 2512 |
| 30 | Ga0070690_100215155 | 3300005330 | Bacteria | 1344 |
| 31 | Ga0068869_100000020 | 3300005334 | Bacteria | 66561 |
| 32 | Ga0070666_10132804 | 3300005335 | Bacteria | 1731 |
| 33 | Ga0070680_100037477 | 3300005336 | Bacteria | 3918 |
| 34 | Ga0070680_100139630 | 3300005336 | Bacteria | 2031 |
| 35 | Ga0070680_100181669 | 3300005336 | Bacteria | 1772 |
| 36 | Ga0070682_100133537 | 3300005337 | Bacteria | 1683 |
| 37 | Ga0068868_100017417 | 3300005338 | Bacteria | 5353 |
| 38 | Ga0068868_100176754 | 3300005338 | Bacteria | 1769 |
| 39 | Ga0070660_100029209 | 3300005339 | Bacteria | 4130 |
| 40 | Ga0070689_100010928 | 3300005340 | Bacteria | 6487 |
| 41 | Ga0070691_10117181 | 3300005341 | Bacteria | 1338 |
| 42 | Ga0070661_100028424 | 3300005344 | Bacteria | 4033 |
| 43 | Ga0070661_100102336 | 3300005344 | Bacteria | 2132 |
| 44 | Ga0070668_100022422 | 3300005347 | Bacteria | 4773 |
| 45 | Ga0070668_100062995 | 3300005347 | Bacteria | 2874 |
| 46 | Ga0070668_100088766 | 3300005347 | Bacteria | 2434 |
| 47 | Ga0070668_100201586 | 3300005347 | Bacteria | 1633 |
| 48 | Ga0070669_100073632 | 3300005353 | Bacteria | 2531 |
| 49 | Ga0070671_100063509 | 3300005355 | Bacteria | 3075 |
| 50 | Ga0070671_100154893 | 3300005355 | Bacteria | 1936 |
| 51 | Ga0070674_100064973 | 3300005356 | Bacteria | 2559 |
| 52 | Ga0070674_100186794 | 3300005356 | Bacteria | 1591 |
| 53 | Ga0070659_100005453 | 3300005366 | Bacteria | 9138 |
| 54 | Ga0070659_100008448 | 3300005366 | Bacteria | 7523 |
| 55 | Ga0070667_100185575 | 3300005367 | Bacteria | 1841 |
| 56 | Ga0070667_100205680 | 3300005367 | Bacteria | 1748 |
| 57 | Ga0070667_100307819 | 3300005367 | Bacteria | 1427 |
| 58 | Ga0070709_10001024 | 3300005434 | Bacteria | 15464 |
| 59 | Ga0070709_10004772 | 3300005434 | Bacteria | 7325 |
| 60 | Ga0070714_100004819 | 3300005435 | Bacteria | 10234 |
| 61 | Ga0070714_100048263 | 3300005435 | Bacteria | 3621 |
| 62 | Ga0070713_100042563 | 3300005436 | Bacteria | 3708 |
| 63 | Ga0070710_10001247 | 3300005437 | Bacteria | 12077 |
| 64 | Ga0070710_10006126 | 3300005437 | Bacteria | 5753 |
| 65 | Ga0070701_10046340 | 3300005438 | Bacteria | 2234 |
| 66 | Ga0070711_100017928 | 3300005439 | Bacteria | 4512 |
| 67 | Ga0070711_100136718 | 3300005439 | Bacteria | 1832 |
| 68 | Ga0070705_100100101 | 3300005440 | Unclassified | 1828 |
| 69 | Ga0070694_100044923 | 3300005444 | Unclassified | 2958 |
| 70 | Ga0070708_100059799 | 3300005445 | Bacteria | 3398 |
| 71 | Ga0070663_100037485 | 3300005455 | Bacteria | 3375 |
| 72 | Ga0070663_100366628 | 3300005455 | Bacteria | 1170 |
| 73 | Ga0070678_100157561 | 3300005456 | Bacteria | 1836 |
| 74 | Ga0070662_100047028 | 3300005457 | Bacteria | 3102 |
| 75 | Ga0070662_100051625 | 3300005457 | Bacteria | 2970 |
| 76 | Ga0070681_10035094 | 3300005458 | Bacteria | 5038 |
| 77 | Ga0070681_10236456 | 3300005458 | Bacteria | 1741 |
| 78 | Ga0070681_10238950 | 3300005458 | Bacteria | 1730 |
| 79 | Ga0068867_100025717 | 3300005459 | Bacteria | 4225 |
| 80 | Ga0068867_100260518 | 3300005459 | Bacteria | 1413 |
| 81 | Ga0070685_10032452 | 3300005466 | Bacteria | 2924 |
| 82 | Ga0070706_100092084 | 3300005467 | Bacteria | 2812 |
| 83 | Ga0070679_100161976 | 3300005530 | Bacteria | 2211 |
| 84 | Ga0070679_100235841 | 3300005530 | Bacteria | 1788 |
| 85 | Ga0070684_100000621 | 3300005535 | Bacteria | 24483 |
| 86 | Ga0070684_100195103 | 3300005535 | Bacteria | 1844 |
| 87 | Ga0070684_100232719 | 3300005535 | Bacteria | 1682 |
| 88 | Ga0070697_100022711 | 3300005536 | Bacteria | 4984 |
| 89 | Ga0068853_100014191 | 3300005539 | Bacteria | 6522 |
| 90 | Ga0068853_100127434 | 3300005539 | Bacteria | 2275 |
| 91 | Ga0070686_100017885 | 3300005544 | Bacteria | 4149 |
| 92 | Ga0070695_100082202 | 3300005545 | Bacteria | 2132 |
| 93 | Ga0070696_100010123 | 3300005546 | Bacteria | 6311 |
| 94 | Ga0070693_100115959 | 3300005547 | Bacteria | 1655 |
| 95 | Ga0070665_100040138 | 3300005548 | Bacteria | 4705 |
| 96 | Ga0070665_100068317 | 3300005548 | Bacteria | 3563 |
| 97 | Ga0070665_100068706 | 3300005548 | Bacteria | 3552 |
| 98 | Ga0070704_100277718 | 3300005549 | Bacteria | 1386 |
| 99 | Ga0068855_100010870 | 3300005563 | Bacteria | 10991 |
| 100 | Ga0068855_100092380 | 3300005563 | Bacteria | 3490 |
| 101 | Ga0068855_100134825 | 3300005563 | Bacteria | 2817 |
| 102 | Ga0068855_100343359 | 3300005563 | Bacteria | 1646 |
| 103 | Ga0068855_100356659 | 3300005563 | Bacteria | 1610 |
| 104 | Ga0070664_100241143 | 3300005564 | Bacteria | 1623 |
| 105 | Ga0070664_100286860 | 3300005564 | Bacteria | 1485 |
| 106 | Ga0068857_100011094 | 3300005577 | Bacteria | 7840 |
| 107 | Ga0068857_100025261 | 3300005577 | Bacteria | 5232 |
| 108 | Ga0068857_100207844 | 3300005577 | Bacteria | 1785 |
| 109 | Ga0068854_100004158 | 3300005578 | Bacteria | 9099 |
| 110 | Ga0068854_100015658 | 3300005578 | Bacteria | 5033 |
| 111 | Ga0068856_100000201 | 3300005614 | Bacteria | 63742 |
| 112 | Ga0068856_100026854 | 3300005614 | Bacteria | 5615 |
| 113 | Ga0068856_100539336 | 3300005614 | Bacteria | 1188 |
| 114 | Ga0068852_100004502 | 3300005616 | Bacteria | 9856 |
| 115 | Ga0068852_100004666 | 3300005616 | Bacteria | 9717 |
| 116 | Ga0068852_100009858 | 3300005616 | Bacteria | 7107 |
| 117 | Ga0068852_100065320 | 3300005616 | Bacteria | 3174 |
| 118 | Ga0068852_100229610 | 3300005616 | Bacteria | 1769 |
| 119 | Ga0068864_100018108 | 3300005618 | Bacteria | 5878 |
| 120 | Ga0068864_100074094 | 3300005618 | Bacteria | 2970 |
| 121 | Ga0068864_100078232 | 3300005618 | Bacteria | 2894 |
| 122 | Ga0068851_10001869 | 3300005834 | Bacteria | 9249 |
| 123 | Ga0068851_10006397 | 3300005834 | Bacteria | 5376 |
| 124 | Ga0068870_10040471 | 3300005840 | Bacteria | 2417 |
| 125 | Ga0068858_100048576 | 3300005842 | Bacteria | 3930 |
| 126 | Ga0068858_100051923 | 3300005842 | Bacteria | 3793 |
| 127 | Ga0068860_100029434 | 3300005843 | Bacteria | 5282 |
| 128 | Ga0068860_100030255 | 3300005843 | Bacteria | 5207 |
| 129 | Ga0068860_100129197 | 3300005843 | Bacteria | 2423 |
| 130 | Ga0068862_100018125 | 3300005844 | Bacteria | 5862 |
| 131 | Ga0068862_100064781 | 3300005844 | Bacteria | 3146 |
| 132 | Ga0068862_100083946 | 3300005844 | Bacteria | 2767 |
| 133 | Ga0081455_10002927 | 3300005937 | Bacteria | 20020 |
| 134 | Ga0081455_10010701 | 3300005937 | Bacteria | 9278 |
| 135 | Ga0081455_10013922 | 3300005937 | Bacteria | 7906 |
| 136 | Ga0081455_10039117 | 3300005937 | Bacteria | 4195 |
| 137 | Ga0081455_10092991 | 3300005937 | Bacteria | 2439 |
| 138 | Ga0081455_10169820 | 3300005937 | Bacteria | 1663 |
| 139 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 140 | Ga0081540_1000659 | 3300005983 | Bacteria | 32559 |
| 141 | Ga0081540_1001575 | 3300005983 | Bacteria | 19497 |
| 142 | Ga0081540_1001596 | 3300005983 | Bacteria | 19340 |
| 143 | Ga0081540_1003337 | 3300005983 | Bacteria | 12732 |
| 144 | Ga0081540_1014191 | 3300005983 | Bacteria | 5122 |
| 145 | Ga0081540_1014661 | 3300005983 | Bacteria | 5009 |
| 146 | Ga0081540_1032543 | 3300005983 | Bacteria | 2846 |
| 147 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 148 | Ga0081539_10000148 | 3300005985 | Bacteria | 163442 |
| 149 | Ga0081539_10086976 | 3300005985 | Bacteria | 1625 |
| 150 | Ga0070717_10032172 | 3300006028 | Bacteria | 4225 |
| 151 | Ga0070717_10089698 | 3300006028 | Bacteria | 2593 |
| 152 | Ga0075365_10023373 | 3300006038 | Bacteria | 3887 |
| 153 | Ga0075368_10012863 | 3300006042 | Bacteria | 3065 |
| 154 | Ga0075363_100078014 | 3300006048 | Bacteria | 1808 |
| 155 | Ga0075363_100105309 | 3300006048 | Bacteria | 1564 |
| 156 | Ga0075363_100125596 | 3300006048 | Bacteria | 1436 |
| 157 | Ga0075363_100126773 | 3300006048 | Bacteria | 1430 |
| 158 | Ga0075364_10057755 | 3300006051 | Bacteria | 2542 |
| 159 | Ga0075364_10264017 | 3300006051 | Bacteria | 1170 |
| 160 | Ga0070716_100007305 | 3300006173 | Bacteria | 5437 |
| 161 | Ga0070712_100004628 | 3300006175 | Bacteria | 8502 |
| 162 | Ga0070712_100097574 | 3300006175 | Bacteria | 2166 |
| 163 | Ga0075362_10003965 | 3300006177 | Bacteria | 5260 |
| 164 | Ga0075362_10010494 | 3300006177 | Bacteria | 3618 |
| 165 | Ga0075367_10008677 | 3300006178 | Bacteria | 5275 |
| 166 | Ga0075367_10112605 | 3300006178 | Bacteria | 1671 |
| 167 | Ga0075369_10061787 | 3300006186 | Bacteria | 1636 |
| 168 | Ga0075366_10142860 | 3300006195 | Bacteria | 1447 |
| 169 | Ga0075370_10011963 | 3300006353 | Bacteria | 4573 |
| 170 | Ga0075370_10012956 | 3300006353 | Bacteria | 4421 |
| 171 | Ga0075370_10059624 | 3300006353 | Bacteria | 2172 |
| 172 | Ga0075370_10085697 | 3300006353 | Bacteria | 1814 |
| 173 | Ga0075370_10094691 | 3300006353 | Bacteria | 1724 |
| 174 | Ga0075433_10003333 | 3300006852 | Bacteria | 12409 |
| 175 | Ga0075433_10023484 | 3300006852 | Bacteria | 5191 |
| 176 | Ga0075434_100045275 | 3300006871 | Bacteria | 4365 |
| 177 | Ga0075434_100082988 | 3300006871 | Bacteria | 3202 |
| 178 | Ga0075436_100278959 | 3300006914 | Bacteria | 1194 |
| 179 | Ga0099824_1013104 | 3300006942 | Bacteria | 8752 |
| 180 | Ga0099822_1033064 | 3300006943 | Bacteria | 3607 |
| 181 | Ga0099794_10006033 | 3300007265 | Bacteria | 4891 |
| 182 | Ga0099795_10005799 | 3300007788 | Bacteria | 3318 |
| 183 | Ga0105240_10005244 | 3300009093 | Bacteria | 19360 |
| 184 | Ga0105240_10014218 | 3300009093 | Bacteria | 10871 |
| 185 | Ga0105240_10048346 | 3300009093 | Bacteria | 5377 |
| 186 | Ga0105240_10061655 | 3300009093 | Bacteria | 4673 |
| 187 | Ga0105240_10081762 | 3300009093 | Bacteria | 3968 |
| 188 | Ga0105240_10102288 | 3300009093 | Bacteria | 3482 |
| 189 | Ga0105240_10127327 | 3300009093 | Bacteria | 3058 |
| 190 | Ga0105240_10520992 | 3300009093 | Bacteria | 1319 |
| 191 | Ga0111539_10000376 | 3300009094 | Bacteria | 55320 |
| 192 | Ga0111539_10023241 | 3300009094 | Bacteria | 7616 |
| 193 | Ga0111539_10581597 | 3300009094 | Bacteria | 1304 |
| 194 | Ga0105245_10011901 | 3300009098 | Bacteria | 7566 |
| 195 | Ga0105245_10020273 | 3300009098 | Bacteria | 5829 |
| 196 | Ga0105245_10061032 | 3300009098 | Bacteria | 3397 |
| 197 | Ga0105243_10207505 | 3300009148 | Bacteria | 1723 |
| 198 | Ga0105243_10266271 | 3300009148 | Bacteria | 1537 |
| 199 | Ga0105241_10007828 | 3300009174 | Bacteria | 7857 |
| 200 | Ga0105241_10018738 | 3300009174 | Bacteria | 5098 |
| 201 | Ga0105242_10041951 | 3300009176 | Bacteria | 3693 |
| 202 | Ga0105242_10118777 | 3300009176 | Bacteria | 2265 |
| 203 | Ga0105242_10389571 | 3300009176 | Bacteria | 1297 |
| 204 | Ga0105248_10042505 | 3300009177 | Bacteria | 5097 |
| 205 | Ga0105248_10048562 | 3300009177 | Bacteria | 4761 |
| 206 | Ga0105248_10171182 | 3300009177 | Bacteria | 2447 |
| 207 | Ga0105248_10427528 | 3300009177 | Bacteria | 1491 |
| 208 | Ga0105237_10004443 | 3300009545 | Bacteria | 16242 |
| 209 | Ga0105237_10011853 | 3300009545 | Bacteria | 9220 |
| 210 | Ga0105237_10170559 | 3300009545 | Bacteria | 2176 |
| 211 | Ga0105238_10004551 | 3300009551 | Bacteria | 13724 |
| 212 | Ga0105238_10039775 | 3300009551 | Bacteria | 4768 |
| 213 | Ga0105238_10089499 | 3300009551 | Bacteria | 3065 |
| 214 | Ga0105238_10318380 | 3300009551 | Bacteria | 1541 |
| 215 | Ga0105238_10405517 | 3300009551 | Bacteria | 1357 |
| 216 | Ga0105249_10001094 | 3300009553 | Bacteria | 24097 |
| 217 | Ga0105249_10207054 | 3300009553 | Bacteria | 1922 |
| 218 | Ga0105249_10566795 | 3300009553 | Bacteria | 1188 |
| 219 | Ga0099796_10005285 | 3300010159 | Bacteria | 3209 |
| 220 | Ga0099796_10099022 | 3300010159 | Bacteria | 1094 |
| 221 | Ga0105239_10006224 | 3300010375 | Bacteria | 13888 |
| 222 | Ga0105239_10028197 | 3300010375 | Bacteria | 6176 |
| 223 | Ga0105239_10042743 | 3300010375 | Bacteria | 4966 |
| 224 | Ga0105239_10077607 | 3300010375 | Bacteria | 3655 |
| 225 | Ga0105239_10097931 | 3300010375 | Bacteria | 3242 |
| 226 | Ga0105239_10267557 | 3300010375 | Bacteria | 1922 |
| 227 | Ga0105239_10303707 | 3300010375 | Bacteria | 1797 |
| 228 | Ga0105239_10310274 | 3300010375 | Bacteria | 1778 |
| 229 | Ga0105239_10356872 | 3300010375 | Bacteria | 1651 |
| 230 | Ga0105246_10142767 | 3300011119 | Bacteria | 1802 |
| 231 | Ga0105246_10198155 | 3300011119 | Bacteria | 1559 |
| 232 | Ga0157320_1000194 | 3300012481 | Bacteria | 2054 |
| 233 | Ga0157370_10066022 | 3300013104 | Bacteria | 3423 |
| 234 | Ga0157369_10009427 | 3300013105 | Bacteria | 11159 |
| 235 | Ga0157369_10065629 | 3300013105 | Bacteria | 3906 |
| 236 | Ga0157369_10152124 | 3300013105 | Bacteria | 2446 |
| 237 | Ga0157369_10265192 | 3300013105 | Bacteria | 1791 |
| 238 | Ga0157374_10057322 | 3300013296 | Bacteria | 3638 |
| 239 | Ga0157374_10138668 | 3300013296 | Bacteria | 2359 |
| 240 | Ga0157378_10283257 | 3300013297 | Bacteria | 1598 |
| 241 | Ga0163162_10106716 | 3300013306 | Bacteria | 2896 |
| 242 | Ga0163162_10178263 | 3300013306 | Bacteria | 2251 |
| 243 | Ga0163162_10332276 | 3300013306 | Bacteria | 1652 |
| 244 | Ga0157375_10098565 | 3300013308 | Bacteria | 3000 |
| 245 | Ga0157375_10465821 | 3300013308 | Bacteria | 1429 |
| 246 | Ga0163163_10001343 | 3300014325 | Bacteria | 20762 |
| 247 | Ga0163163_10073841 | 3300014325 | Bacteria | 3402 |
| 248 | Ga0157379_10037468 | 3300014968 | Bacteria | 4324 |
| 249 | Ga0157379_10150681 | 3300014968 | Bacteria | 2098 |
| 250 | Ga0157379_10167111 | 3300014968 | Bacteria | 1986 |
| 251 | Ga0157376_10124817 | 3300014969 | Bacteria | 2287 |
| 252 | Ga0206356_11288174 | 3300020070 | Bacteria | 1613 |
| 253 | Ga0206356_11820764 | 3300020070 | Bacteria | 1400 |
| 254 | Ga0206353_11720299 | 3300020082 | Bacteria | 1425 |
| 255 | Ga0213873_10027478 | 3300021358 | Bacteria | 1388 |
| 256 | Ga0213872_10070500 | 3300021361 | Bacteria | 1576 |
| 257 | Ga0213876_10000453 | 3300021384 | Bacteria | 33103 |
| 258 | Ga0213876_10058218 | 3300021384 | Bacteria | 2040 |
| 259 | Ga0213876_10071584 | 3300021384 | Bacteria | 1831 |
| 260 | Ga0213876_10077509 | 3300021384 | Bacteria | 1756 |
| 261 | Ga0213871_10005670 | 3300021441 | Bacteria | 2593 |
| 262 | Ga0209677_100744 | 3300025253 | Bacteria | 16516 |
| 263 | Ga0209564_1008307 | 3300025295 | Bacteria | 5148 |
| 264 | Ga0209758_1000868 | 3300025297 | Bacteria | 41599 |
| 265 | Ga0209758_1001178 | 3300025297 | Bacteria | 33069 |
| 266 | Ga0209758_1003296 | 3300025297 | Bacteria | 14947 |
| 267 | Ga0209758_1009363 | 3300025297 | Bacteria | 6102 |
| 268 | Ga0209758_1033454 | 3300025297 | Bacteria | 2063 |
| 269 | Ga0209256_1033883 | 3300025299 | Bacteria | 1367 |
| 270 | Ga0207426_1000588 | 3300025302 | Bacteria | 48329 |
| 271 | Ga0207697_10016615 | 3300025315 | Bacteria | 3031 |
| 272 | Ga0207656_10002603 | 3300025321 | Bacteria | 6100 |
| 273 | Ga0207656_10006908 | 3300025321 | Bacteria | 4112 |
| 274 | Ga0207653_10016325 | 3300025885 | Bacteria | 2332 |
| 275 | Ga0207682_10001712 | 3300025893 | Bacteria | 10043 |
| 276 | Ga0207692_10061188 | 3300025898 | Bacteria | 1950 |
| 277 | Ga0207710_10062685 | 3300025900 | Bacteria | 1690 |
| 278 | Ga0207688_10043037 | 3300025901 | Bacteria | 2514 |
| 279 | Ga0207688_10218819 | 3300025901 | Bacteria | 1146 |
| 280 | Ga0207680_10069420 | 3300025903 | Bacteria | 2177 |
| 281 | Ga0207699_10006427 | 3300025906 | Bacteria | 5690 |
| 282 | Ga0207645_10061151 | 3300025907 | Bacteria | 2406 |
| 283 | Ga0207645_10174624 | 3300025907 | Bacteria | 1409 |
| 284 | Ga0207643_10104004 | 3300025908 | Bacteria | 1667 |
| 285 | Ga0207705_10039609 | 3300025909 | Bacteria | 3378 |
| 286 | Ga0207705_10208975 | 3300025909 | Bacteria | 1480 |
| 287 | Ga0207654_10000163 | 3300025911 | Bacteria | 42749 |
| 288 | Ga0207707_10002780 | 3300025912 | Bacteria | 15612 |
| 289 | Ga0207707_10092302 | 3300025912 | Bacteria | 2646 |
| 290 | Ga0207707_10110780 | 3300025912 | Bacteria | 2400 |
| 291 | Ga0207707_10163103 | 3300025912 | Bacteria | 1948 |
| 292 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 293 | Ga0207695_10001114 | 3300025913 | Bacteria | 46680 |
| 294 | Ga0207695_10035147 | 3300025913 | Bacteria | 5439 |
| 295 | Ga0207671_10002506 | 3300025914 | Bacteria | 19597 |
| 296 | Ga0207693_10007358 | 3300025915 | Bacteria | 9057 |
| 297 | Ga0207693_10023667 | 3300025915 | Bacteria | 4874 |
| 298 | Ga0207693_10126811 | 3300025915 | Bacteria | 2006 |
| 299 | Ga0207693_10303744 | 3300025915 | Bacteria | 1250 |
| 300 | Ga0207663_10002205 | 3300025916 | Bacteria | 9320 |
| 301 | Ga0207663_10006649 | 3300025916 | Bacteria | 5942 |
| 302 | Ga0207663_10007579 | 3300025916 | Bacteria | 5633 |
| 303 | Ga0207660_10021591 | 3300025917 | Bacteria | 4331 |
| 304 | Ga0207660_10282216 | 3300025917 | Bacteria | 1318 |
| 305 | Ga0207657_10012978 | 3300025919 | Bacteria | 8190 |
| 306 | Ga0207657_10268767 | 3300025919 | Bacteria | 1356 |
| 307 | Ga0207649_10021186 | 3300025920 | Bacteria | 3737 |
| 308 | Ga0207649_10142983 | 3300025920 | Bacteria | 1639 |
| 309 | Ga0207652_10011048 | 3300025921 | Bacteria | 7279 |
| 310 | Ga0207652_10062969 | 3300025921 | Bacteria | 3206 |
| 311 | Ga0207652_10219372 | 3300025921 | Bacteria | 1713 |
| 312 | Ga0207652_10507911 | 3300025921 | Bacteria | 1085 |
| 313 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 314 | Ga0207694_10011867 | 3300025924 | Bacteria | 6570 |
| 315 | Ga0207659_10236931 | 3300025926 | Bacteria | 1474 |
| 316 | Ga0207687_10025900 | 3300025927 | Bacteria | 3926 |
| 317 | Ga0207687_10083883 | 3300025927 | Bacteria | 2308 |
| 318 | Ga0207687_10146208 | 3300025927 | Bacteria | 1799 |
| 319 | Ga0207687_10345014 | 3300025927 | Bacteria | 1212 |
| 320 | Ga0207700_10053108 | 3300025928 | Bacteria | 3034 |
| 321 | Ga0207664_10022494 | 3300025929 | Bacteria | 4709 |
| 322 | Ga0207664_10126588 | 3300025929 | Bacteria | 2146 |
| 323 | Ga0207644_10235831 | 3300025931 | Bacteria | 1455 |
| 324 | Ga0207690_10003164 | 3300025932 | Bacteria | 9891 |
| 325 | Ga0207706_10022632 | 3300025933 | Bacteria | 5640 |
| 326 | Ga0207706_10047907 | 3300025933 | Bacteria | 3780 |
| 327 | Ga0207706_10065472 | 3300025933 | Bacteria | 3200 |
| 328 | Ga0207706_10183448 | 3300025933 | Bacteria | 1838 |
| 329 | Ga0207686_10070889 | 3300025934 | Bacteria | 2241 |
| 330 | Ga0207709_10008908 | 3300025935 | Bacteria | 5540 |
| 331 | Ga0207670_10010357 | 3300025936 | Bacteria | 5365 |
| 332 | Ga0207669_10000188 | 3300025937 | Bacteria | 28047 |
| 333 | Ga0207669_10028328 | 3300025937 | Bacteria | 3080 |
| 334 | Ga0207704_10090406 | 3300025938 | Bacteria | 2009 |
| 335 | Ga0207665_10006821 | 3300025939 | Bacteria | 7563 |
| 336 | Ga0207665_10008768 | 3300025939 | Bacteria | 6652 |
| 337 | Ga0207665_10074551 | 3300025939 | Bacteria | 2322 |
| 338 | Ga0207665_10137516 | 3300025939 | Bacteria | 1740 |
| 339 | Ga0207691_10024979 | 3300025940 | Bacteria | 5614 |
| 340 | Ga0207691_10060665 | 3300025940 | Bacteria | 3436 |
| 341 | Ga0207711_10038548 | 3300025941 | Bacteria | 4064 |
| 342 | Ga0207689_10021584 | 3300025942 | Bacteria | 5413 |
| 343 | Ga0207661_10090076 | 3300025944 | Bacteria | 2553 |
| 344 | Ga0207667_10021363 | 3300025949 | Bacteria | 7173 |
| 345 | Ga0207667_10031627 | 3300025949 | Bacteria | 5711 |
| 346 | Ga0207667_10033121 | 3300025949 | Bacteria | 5559 |
| 347 | Ga0207667_10090534 | 3300025949 | Bacteria | 3161 |
| 348 | Ga0207667_10242446 | 3300025949 | Bacteria | 1844 |
| 349 | Ga0207667_10305912 | 3300025949 | Bacteria | 1624 |
| 350 | Ga0207712_10056403 | 3300025961 | Bacteria | 2767 |
| 351 | Ga0207712_10085897 | 3300025961 | Bacteria | 2304 |
| 352 | Ga0207668_10058127 | 3300025972 | Bacteria | 2701 |
| 353 | Ga0207668_10323755 | 3300025972 | Bacteria | 1280 |
| 354 | Ga0207668_10354588 | 3300025972 | Bacteria | 1227 |
| 355 | Ga0207640_10005819 | 3300025981 | Bacteria | 6723 |
| 356 | Ga0207640_10072968 | 3300025981 | Bacteria | 2317 |
| 357 | Ga0207640_10286772 | 3300025981 | Bacteria | 1296 |
| 358 | Ga0207640_10446453 | 3300025981 | Bacteria | 1065 |
| 359 | Ga0207658_10400496 | 3300025986 | Bacteria | 1206 |
| 360 | Ga0207677_10062176 | 3300026023 | Bacteria | 2589 |
| 361 | Ga0207677_10374372 | 3300026023 | Bacteria | 1200 |
| 362 | Ga0207703_10000418 | 3300026035 | Bacteria | 45072 |
| 363 | Ga0207703_10021608 | 3300026035 | Bacteria | 5039 |
| 364 | Ga0207703_10195268 | 3300026035 | Bacteria | 1795 |
| 365 | Ga0207703_10276590 | 3300026035 | Bacteria | 1523 |
| 366 | Ga0207639_10021830 | 3300026041 | Bacteria | 4602 |
| 367 | Ga0207639_10032453 | 3300026041 | Bacteria | 3844 |
| 368 | Ga0207639_10182945 | 3300026041 | Bacteria | 1784 |
| 369 | Ga0207678_10002589 | 3300026067 | Bacteria | 16491 |
| 370 | Ga0207678_10010327 | 3300026067 | Bacteria | 8194 |
| 371 | Ga0207678_10054616 | 3300026067 | Bacteria | 3440 |
| 372 | Ga0207678_10105935 | 3300026067 | Bacteria | 2399 |
| 373 | Ga0207678_10108825 | 3300026067 | Bacteria | 2364 |
| 374 | Ga0207708_10080352 | 3300026075 | Bacteria | 2505 |
| 375 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 376 | Ga0207702_10003278 | 3300026078 | Bacteria | 14933 |
| 377 | Ga0207702_10071150 | 3300026078 | Bacteria | 2994 |
| 378 | Ga0207702_10118293 | 3300026078 | Bacteria | 2367 |
| 379 | Ga0207641_10313841 | 3300026088 | Bacteria | 1485 |
| 380 | Ga0207648_10006918 | 3300026089 | Bacteria | 11239 |
| 381 | Ga0207648_10104489 | 3300026089 | Bacteria | 2484 |
| 382 | Ga0207674_10002309 | 3300026116 | Bacteria | 24153 |
| 383 | Ga0207674_10003185 | 3300026116 | Bacteria | 20207 |
| 384 | Ga0207674_10023962 | 3300026116 | Bacteria | 6527 |
| 385 | Ga0207674_10281647 | 3300026116 | Bacteria | 1610 |
| 386 | Ga0207675_100043175 | 3300026118 | Bacteria | 4210 |
| 387 | Ga0207683_10172965 | 3300026121 | Bacteria | 1957 |
| 388 | Ga0207698_10005259 | 3300026142 | Bacteria | 7962 |
| 389 | Ga0207698_10032001 | 3300026142 | Bacteria | 3805 |
| 390 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 391 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 392 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 393 | Ga0209995_1009205 | 3300027471 | Bacteria | 1597 |
| 394 | Ga0209588_1006513 | 3300027671 | Bacteria | 3398 |
| 395 | Ga0209966_1001288 | 3300027695 | Bacteria | 4443 |
| 396 | Ga0209813_10008256 | 3300027866 | Bacteria | 2624 |
| 397 | Ga0209974_10055118 | 3300027876 | Bacteria | 1340 |
| 398 | Ga0207428_10000777 | 3300027907 | Bacteria | 36251 |
| 399 | Ga0207428_10044934 | 3300027907 | Bacteria | 3562 |
| 400 | Ga0207428_10069706 | 3300027907 | Bacteria | 2765 |
| 401 | Ga0268266_10010402 | 3300028379 | Bacteria | 8131 |
| 402 | Ga0268266_10014306 | 3300028379 | Bacteria | 6824 |
| 403 | Ga0268266_10088365 | 3300028379 | Bacteria | 2712 |
| 404 | Ga0268266_10239766 | 3300028379 | Bacteria | 1673 |
| 405 | Ga0268265_10063302 | 3300028380 | Bacteria | 2845 |
| 406 | Ga0268265_10073429 | 3300028380 | Bacteria | 2671 |
| 407 | Ga0268265_10077006 | 3300028380 | Bacteria | 2618 |
| 408 | Ga0268264_10134481 | 3300028381 | Bacteria | 2196 |
| 409 | Ga0268264_10262584 | 3300028381 | Bacteria | 1609 |
| 410 | Ga0268264_10353858 | 3300028381 | Bacteria | 1399 |
| 411 | Ga0265326_10038791 | 3300028558 | Bacteria | 1353 |
| 412 | Ga0265323_10002280 | 3300028653 | Bacteria | 8896 |
| 413 | Ga0265336_10000093 | 3300028666 | Bacteria | 68442 |
| 414 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 415 | Ga0265338_10000078 | 3300028800 | Bacteria | 177516 |
| 416 | Ga0265324_10002197 | 3300029957 | Bacteria | 10202 |
| 417 | Ga0265332_10000391 | 3300031238 | Bacteria | 32025 |
| 418 | Ga0265332_10019628 | 3300031238 | Bacteria | 2983 |
| 419 | Ga0265332_10099969 | 3300031238 | Bacteria | 1224 |
| 420 | Ga0265325_10005389 | 3300031241 | Bacteria | 7903 |
| 421 | Ga0265325_10129919 | 3300031241 | Bacteria | 1207 |
| 422 | Ga0265340_10000390 | 3300031247 | Bacteria | 23441 |
| 423 | Ga0265339_10000861 | 3300031249 | Bacteria | 23321 |
| 424 | Ga0265339_10002237 | 3300031249 | Bacteria | 13988 |
| 425 | Ga0265331_10009051 | 3300031250 | Bacteria | 5624 |
| 426 | Ga0265316_10198655 | 3300031344 | Bacteria | 1487 |
| 427 | Ga0265316_10303191 | 3300031344 | Bacteria | 1163 |
| 428 | Ga0307513_10177284 | 3300031456 | Bacteria | 2000 |
| 429 | Ga0307509_10010585 | 3300031507 | Bacteria | 11276 |
| 430 | Ga0307509_10307918 | 3300031507 | Bacteria | 1328 |
| 431 | Ga0265313_10039367 | 3300031595 | Bacteria | 2345 |
| 432 | Ga0265313_10066159 | 3300031595 | Bacteria | 1676 |
| 433 | Ga0316575_10035097 | 3300031665 | Bacteria | 1970 |
| 434 | Ga0316579_10100236 | 3300031691 | Bacteria | 1386 |
| 435 | Ga0265314_10002400 | 3300031711 | Bacteria | 19257 |
| 436 | Ga0265314_10160904 | 3300031711 | Bacteria | 1366 |
| 437 | Ga0265342_10000069 | 3300031712 | Bacteria | 110550 |
| 438 | Ga0265342_10005077 | 3300031712 | Bacteria | 10147 |
| 439 | Ga0265342_10030151 | 3300031712 | Bacteria | 3364 |
| 440 | Ga0265342_10100432 | 3300031712 | Bacteria | 1649 |
| 441 | Ga0307516_10012122 | 3300031730 | Bacteria | 9313 |
| 442 | Ga0307516_10082323 | 3300031730 | Bacteria | 3060 |
| 443 | Ga0307411_10251467 | 3300032005 | Bacteria | 1390 |
| 444 | Ga0316583_10017748 | 3300032133 | Bacteria | 2556 |
| 445 | Ga0316593_10036170 | 3300032168 | Bacteria | 1627 |
| 446 | Ga0307510_10003985 | 3300033180 | Bacteria | 17298 |
| 447 | Ga0307510_10255048 | 3300033180 | Bacteria | 1239 |
| 448 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 449 | Ga0373930_0001167 | 3300034816 | Bacteria | 3842 |
| 450 | Ga0373948_0000190 | 3300034817 | Bacteria | 7039 |
| 451 | Ga0373950_0000342 | 3300034818 | Bacteria | 5805 |
| 452 | Ga0373958_0000055 | 3300034819 | Bacteria | 11096 |
| 453 | Ga0373928_0000361 | 3300035084 | Bacteria | 9079 |
| 454 | Ga0373928_0018372 | 3300035084 | Bacteria | 1448 |
| 455 | Ga0373928_0027697 | 3300035084 | Bacteria | 1235 |
| 456 | Ga0373929_0000927 | 3300035085 | Bacteria | 5708 |
| 457 | Ga0373940_0000594 | 3300035088 | Bacteria | 5745 |
| 458 | Ga0373940_0025403 | 3300035088 | Bacteria | 1542 |
| 459 | Ga0373949_0000308 | 3300035090 | Bacteria | 17544 |
| 460 | Ga0373951_0000393 | 3300035091 | Bacteria | 12972 |
| 461 | Ga0373951_0039868 | 3300035091 | Bacteria | 1130 |
| 462 | Ga0373952_0000208 | 3300035092 | Bacteria | 9305 |
| 463 | Ga0373923_0001249 | 3300035111 | Bacteria | 7142 |
| 464 | Ga0373923_0040453 | 3300035111 | Bacteria | 1919 |
| 465 | Ga0373932_0000031 | 3300035112 | Bacteria | 38730 |
| 466 | Ga0373932_0016969 | 3300035112 | Bacteria | 1863 |
| 467 | Ga0373936_0001314 | 3300035113 | Bacteria | 9000 |
| 468 | Ga0373939_0000083 | 3300035114 | Bacteria | 30438 |
| 469 | Ga0373939_0016703 | 3300035114 | Bacteria | 1939 |
| 470 | Ga0373941_0000540 | 3300035115 | Bacteria | 7532 |
| 471 | Ga0373945_0002176 | 3300035116 | Bacteria | 6118 |
| 472 | Ga0373945_0026639 | 3300035116 | Bacteria | 2015 |
| 473 | Ga0373945_0069082 | 3300035116 | Bacteria | 1334 |
| 474 | Ga0373945_0112619 | 3300035116 | Bacteria | 1075 |
| 475 | Ga0373953_0008626 | 3300035117 | Bacteria | 3471 |
| 476 | Ga0373954_0000584 | 3300035118 | Bacteria | 13828 |
| 477 | Ga0373954_0028214 | 3300035118 | Bacteria | 2579 |
| 478 | Ga0373956_0034939 | 3300035119 | Bacteria | 2215 |
| 479 | Ga0373957_0036851 | 3300035120 | Bacteria | 1824 |
| 480 | Ga0373960_0000088 | 3300035121 | Bacteria | 13897 |
| 481 | Ga0373960_0002807 | 3300035121 | Bacteria | 3942 |
| 482 | Ga0373943_0001654 | 3300035170 | Bacteria | 10122 |
| 483 | Ga0373943_0043060 | 3300035170 | Bacteria | 2191 |
| 484 | Ga0373943_0072058 | 3300035170 | Bacteria | 1752 |
| 485 | Ga0373946_0000997 | 3300035171 | Bacteria | 9719 |
| 486 | Ga0373955_0000576 | 3300035172 | Bacteria | 15603 |
| 487 | Ga0373955_0003175 | 3300035172 | Bacteria | 7194 |
| 488 | Ga0373942_0013490 | 3300035207 | Bacteria | 1965 |
| 489 | Ga0373961_0000539 | 3300035241 | Bacteria | 14412 |
| 490 | Ga0373962_0000715 | 3300035242 | Bacteria | 7504 |
| 491 | Ga0373924_0000447 | 3300035410 | Bacteria | 12658 |
| 492 | Ga0373924_0003919 | 3300035410 | Bacteria | 5162 |
| 493 | Ga0373924_0026279 | 3300035410 | Bacteria | 2308 |
| 494 | Ga0373931_0001752 | 3300035691 | Bacteria | 9420 |
| 495 | Ga0373931_0075357 | 3300035691 | Bacteria | 1850 |
| 496 | Ga0373931_0094573 | 3300035691 | Bacteria | 1671 |
| 497 | Ga0373931_0124161 | 3300035691 | Bacteria | 1478 |
| 498 | Ga0373935_0000013 | 3300035692 | Bacteria | 78986 |
| 499 | Ga0373935_0002637 | 3300035692 | Bacteria | 10305 |
| 500 | Ga0373935_0071495 | 3300035692 | Bacteria | 2239 |
| 501 | Ga0373927_0000488 | 3300035695 | Bacteria | 30514 |
| 502 | Ga0373927_0010805 | 3300035695 | Bacteria | 6083 |
| 503 | Ga0373927_0039297 | 3300035695 | Bacteria | 3071 |
| 504 | Ga0373927_0129181 | 3300035695 | Bacteria | 1650 |
| 505 | Ga0373927_0252430 | 3300035695 | Bacteria | 1159 |
| 506 | Ga0373933_0002241 | 3300035724 | Bacteria | 11028 |
| 507 | Ga0373933_0005665 | 3300035724 | Bacteria | 6801 |
| 508 | Ga0373933_0038644 | 3300035724 | Bacteria | 2805 |
| 509 | Ga0373933_0139803 | 3300035724 | Bacteria | 1528 |
| 510 | Ga0373933_0190263 | 3300035724 | Bacteria | 1311 |
| 511 | Ga0373947_0000484 | 3300035725 | Bacteria | 22895 |
| 512 | Ga0373947_0000909 | 3300035725 | Bacteria | 17934 |
| 513 | Ga0373947_0007264 | 3300035725 | Bacteria | 6418 |
| 514 | Ga0373947_0012470 | 3300035725 | Bacteria | 4873 |
| 515 | Ga0373937_0000018 | 3300036401 | Bacteria | 144056 |
| 516 | Ga0373937_0016044 | 3300036401 | Bacteria | 6644 |
| 517 | Ga0373937_0024143 | 3300036401 | Bacteria | 5482 |
| 518 | Ga0373937_0048025 | 3300036401 | Bacteria | 3906 |
| 519 | Ga0373937_0096258 | 3300036401 | Bacteria | 2745 |
| 520 | Ga0373937_0538274 | 3300036401 | Bacteria | 1109 |
| 521 | Ga0372808_011833 | 3300036459 | Bacteria | 1235 |
| 522 | Ga0316582_0229937 | 3300036647 | Bacteria | 1269 |
| 523 | Ga0316584_0007968 | 3300036712 | Bacteria | 7271 |
| 524 | Ga0373925_0000896 | 3300037068 | Bacteria | 27189 |
| 525 | Ga0373925_0002872 | 3300037068 | Bacteria | 13599 |
| 526 | Ga0373925_0032887 | 3300037068 | Bacteria | 3820 |
| 527 | Ga0373925_0150187 | 3300037068 | Bacteria | 1829 |
| 528 | Ga0373925_0179012 | 3300037068 | Bacteria | 1677 |
| 529 | Ga0373925_0370014 | 3300037068 | Bacteria | 1166 |
| 530 | Ga0395900_0001158 | 3300037418 | Bacteria | 33053 |
| 531 | Ga0395900_0088154 | 3300037418 | Bacteria | 3190 |
| 532 | Ga0395900_0574378 | 3300037418 | Bacteria | 1070 |
| 533 | Ga0395898_0003218 | 3300037466 | Bacteria | 18368 |
| 534 | Ga0395898_0022642 | 3300037466 | Bacteria | 6362 |
| 535 | Ga0395898_0193403 | 3300037466 | Bacteria | 1944 |
| 536 | Ga0395905_0030699 | 3300037471 | Bacteria | 5061 |
| 537 | Ga0395905_0222138 | 3300037471 | Bacteria | 1768 |
| 538 | Ga0395905_0383062 | 3300037471 | Bacteria | 1300 |
| 539 | Ga0436364_0938988 | 3300037853 | Bacteria | 2231 |
| 540 | Ga0436364_1251487 | 3300037853 | Bacteria | 1511 |
| 541 | Ga0395901_0059296 | 3300038443 | Bacteria | 3982 |
| 542 | Ga0395901_0316902 | 3300038443 | Bacteria | 1614 |
| 543 | Ga0400486_16168 | 3300038742 | Bacteria | 3324 |
| 544 | Ga0242420_007407 | 3300038996 | Bacteria | 1760 |
| 545 | Ga0436365_0557891 | 3300039437 | Bacteria | 8640 |
| 546 | Ga0436365_1114261 | 3300039437 | Bacteria | 1827 |
| 547 | Ga0436365_1219888 | 3300039437 | Bacteria | 2971 |
| 548 | Ga0436365_1228844 | 3300039437 | Bacteria | 1709 |
| 549 | Ga0436360_0417248 | 3300039438 | Bacteria | 4104 |
| 550 | Ga0436360_1229051 | 3300039438 | Bacteria | 3570 |
| 551 | Ga0436361_0481193 | 3300039447 | Bacteria | 1376 |
| 552 | Ga0436361_0577046 | 3300039447 | Bacteria | 10213 |
| 553 | Ga0436363_0278638 | 3300039450 | Bacteria | 2653 |
| 554 | Ga0436362_0369849 | 3300039453 | Bacteria | 4404 |
| 555 | Ga0436362_0829767 | 3300039453 | Bacteria | 3505 |
| 556 | Ga0439453_0003758 | 3300041408 | Bacteria | 2207 |
| 557 | Ga0439465_0013932 | 3300041413 | Bacteria | 2504 |
| 558 | Ga0439465_0020626 | 3300041413 | Bacteria | 2066 |
| 559 | Ga0451797_1253850 | 3300041453 | Bacteria | 1400 |
| 560 | Ga0450908_024028 | 3300042184 | Bacteria | 1066 |
| 561 | Ga0439464_0069422 | 3300042439 | Bacteria | 1041 |
| 562 | Ga0451577_0072394 | 3300042876 | Bacteria | 3074 |
| 563 | Ga0451577_0237373 | 3300042876 | Bacteria | 1649 |
| 564 | Ga0466972_0000419 | 3300044658 | Bacteria | 22086 |
| 565 | Ga0453683_0096822 | 3300044673 | Bacteria | 1852 |
| 566 | Ga0466966_0001368 | 3300044684 | Bacteria | 15665 |
| 567 | Ga0466961_0000039 | 3300044693 | Bacteria | 79787 |
| 568 | Ga0466963_0066247 | 3300044694 | Bacteria | 2422 |
| 569 | Ga0466963_0166127 | 3300044694 | Bacteria | 1537 |
| 570 | Ga0466963_0191441 | 3300044694 | Bacteria | 1429 |
| 571 | Ga0466964_0055788 | 3300044706 | Bacteria | 1632 |
| 572 | Ga0453684_0114476 | 3300044712 | Bacteria | 3270 |
| 573 | Ga0453684_0270454 | 3300044712 | Bacteria | 1942 |
| 574 | Ga0466957_0180088 | 3300044842 | Bacteria | 1380 |
| 575 | Ga0466959_0000475 | 3300045049 | Bacteria | 23395 |
| 576 | Ga0466959_0208126 | 3300045049 | Bacteria | 1360 |
| 577 | Ga0451576_0012930 | 3300045051 | Bacteria | 9352 |
| 578 | Ga0466958_0121334 | 3300045836 | Bacteria | 1637 |
| 579 | Ga0466967_0022137 | 3300045976 | Bacteria | 5179 |
| 580 | Ga0466967_0115196 | 3300045976 | Bacteria | 2475 |
| 581 | Ga0466967_0450182 | 3300045976 | Bacteria | 1258 |
| 582 | Ga0495617_002893 | 3300046452 | Bacteria | 6607 |
| 583 | Ga0495592_0000055 | 3300046454 | Bacteria | 106223 |
| 584 | Ga0495592_0009800 | 3300046454 | Bacteria | 7210 |
| 585 | Ga0495592_0021019 | 3300046454 | Bacteria | 4963 |
| 586 | Ga0495603_0007773 | 3300046455 | Bacteria | 6460 |
| 587 | Ga0495603_0009558 | 3300046455 | Bacteria | 5860 |
| 588 | Ga0495603_0026454 | 3300046455 | Bacteria | 3504 |
| 589 | Ga0495603_0178961 | 3300046455 | Bacteria | 1227 |
| 590 | Ga0495629_0000483 | 3300046459 | Bacteria | 33389 |
| 591 | Ga0495629_0002536 | 3300046459 | Bacteria | 14008 |
| 592 | Ga0495629_0004445 | 3300046459 | Bacteria | 10509 |
| 593 | Ga0495629_0007768 | 3300046459 | Bacteria | 7893 |
| 594 | Ga0495629_0050362 | 3300046459 | Bacteria | 2917 |
| 595 | Ga0495629_0120987 | 3300046459 | Bacteria | 1824 |
| 596 | Ga0495638_0007368 | 3300046460 | Bacteria | 7897 |
| 597 | Ga0495638_0011405 | 3300046460 | Bacteria | 6124 |
| 598 | Ga0495638_0056814 | 3300046460 | Bacteria | 2428 |
| 599 | Ga0495638_0083467 | 3300046460 | Bacteria | 1935 |
| 600 | Ga0495651_0003462 | 3300046462 | Bacteria | 12098 |
| 601 | Ga0495651_0017612 | 3300046462 | Bacteria | 5529 |
| 602 | Ga0495653_0000003 | 3300046463 | Bacteria | 377892 |
| 603 | Ga0495653_0094190 | 3300046463 | Bacteria | 2183 |
| 604 | Ga0495650_0091876 | 3300046471 | Bacteria | 1153 |
| 605 | Ga0495580_0000574 | 3300046472 | Bacteria | 30931 |
| 606 | Ga0495580_0037871 | 3300046472 | Bacteria | 3458 |
| 607 | Ga0495580_0283537 | 3300046472 | Bacteria | 1130 |
| 608 | Ga0495580_0323402 | 3300046472 | Bacteria | 1048 |
| 609 | Ga0495582_0000221 | 3300046473 | Bacteria | 31591 |
| 610 | Ga0495582_0045875 | 3300046473 | Bacteria | 2407 |
| 611 | Ga0495582_0124651 | 3300046473 | Bacteria | 1453 |
| 612 | Ga0495605_0022132 | 3300046474 | Bacteria | 3361 |
| 613 | Ga0495639_0000308 | 3300046475 | Bacteria | 23799 |
| 614 | Ga0495639_0013560 | 3300046475 | Bacteria | 3522 |
| 615 | Ga0495639_0071795 | 3300046475 | Bacteria | 1600 |
| 616 | Ga0495662_0005681 | 3300046476 | Bacteria | 6235 |
| 617 | Ga0495662_0010612 | 3300046476 | Bacteria | 4506 |
| 618 | Ga0495662_0077205 | 3300046476 | Bacteria | 1618 |
| 619 | Ga0495662_0124665 | 3300046476 | Bacteria | 1265 |
| 620 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 621 | Ga0495664_0014767 | 3300046477 | Bacteria | 4432 |
| 622 | Ga0495594_0000259 | 3300046499 | Bacteria | 25796 |
| 623 | Ga0495606_0113683 | 3300046507 | Bacteria | 1629 |
| 624 | Ga0495608_0000012 | 3300046511 | Bacteria | 242758 |
| 625 | Ga0495608_0002889 | 3300046511 | Bacteria | 12309 |
| 626 | Ga0495618_0000012 | 3300046514 | Bacteria | 170881 |
| 627 | Ga0495618_0085758 | 3300046514 | Bacteria | 2013 |
| 628 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 629 | Ga0495628_0069061 | 3300046516 | Bacteria | 2756 |
| 630 | Ga0495630_0000188 | 3300046517 | Bacteria | 48229 |
| 631 | Ga0495630_0054668 | 3300046517 | Bacteria | 2991 |
| 632 | Ga0495630_0073613 | 3300046517 | Bacteria | 2573 |
| 633 | Ga0495630_0141134 | 3300046517 | Bacteria | 1832 |
| 634 | Ga0495631_0068255 | 3300046518 | Bacteria | 1538 |
| 635 | Ga0495631_0075272 | 3300046518 | Bacteria | 1457 |
| 636 | Ga0495632_0116247 | 3300046519 | Bacteria | 1253 |
| 637 | Ga0495632_0143070 | 3300046519 | Bacteria | 1108 |
| 638 | Ga0495643_0019473 | 3300046522 | Bacteria | 3926 |
| 639 | Ga0495643_0047580 | 3300046522 | Bacteria | 2322 |
| 640 | Ga0495648_0001181 | 3300046524 | Bacteria | 26354 |
| 641 | Ga0495648_0110024 | 3300046524 | Bacteria | 1501 |
| 642 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 643 | Ga0495652_0101714 | 3300046529 | Bacteria | 2329 |
| 644 | Ga0495652_0117450 | 3300046529 | Bacteria | 2128 |
| 645 | Ga0495665_0000153 | 3300046531 | Bacteria | 34092 |
| 646 | Ga0495665_0098793 | 3300046531 | Bacteria | 1532 |
| 647 | Ga0495640_0000022 | 3300046533 | Bacteria | 101825 |
| 648 | Ga0495640_0000198 | 3300046533 | Bacteria | 40193 |
| 649 | Ga0495640_0030412 | 3300046533 | Bacteria | 3866 |
| 650 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 651 | Ga0495587_0032568 | 3300046536 | Bacteria | 3150 |
| 652 | Ga0495587_0181383 | 3300046536 | Bacteria | 1194 |
| 653 | Ga0495609_0090080 | 3300046538 | Bacteria | 1334 |
| 654 | Ga0495621_0035088 | 3300046539 | Bacteria | 1735 |
| 655 | Ga0495597_0104745 | 3300046542 | Bacteria | 1190 |
| 656 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 657 | Ga0495645_0143142 | 3300046543 | Bacteria | 1666 |
| 658 | Ga0495622_0045301 | 3300046557 | Bacteria | 2044 |
| 659 | Ga0495622_0114108 | 3300046557 | Bacteria | 1236 |
| 660 | Ga0495633_0053559 | 3300046558 | Bacteria | 1899 |
| 661 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 662 | Ga0495667_0006893 | 3300046559 | Bacteria | 7715 |
| 663 | Ga0495667_0294717 | 3300046559 | Bacteria | 1028 |
| 664 | Ga0495656_0150828 | 3300046615 | Bacteria | 1122 |
| 665 | Ga0495656_0173365 | 3300046615 | Bacteria | 1056 |
| 666 | Ga0495656_0206282 | 3300046615 | Bacteria | 977 |
| 667 | Ga0495634_0000012 | 3300046642 | Bacteria | 131341 |
| 668 | Ga0495634_0012406 | 3300046642 | Bacteria | 6168 |
| 669 | Ga0495634_0012733 | 3300046642 | Bacteria | 6089 |
| 670 | Ga0495634_0148423 | 3300046642 | Bacteria | 1484 |
| 671 | Ga0495625_0101485 | 3300046660 | Bacteria | 1976 |
| 672 | Ga0495625_0110129 | 3300046660 | Bacteria | 1883 |
| 673 | Ga0495625_0184149 | 3300046660 | Bacteria | 1387 |
| 674 | Ga0495635_0000011 | 3300046663 | Bacteria | 240094 |
| 675 | Ga0495635_0001940 | 3300046663 | Bacteria | 14058 |
| 676 | Ga0495661_0009514 | 3300046665 | Bacteria | 6669 |
| 677 | Ga0495588_0008766 | 3300046674 | Bacteria | 4647 |
| 678 | Ga0495657_0000086 | 3300046675 | Bacteria | 81806 |
| 679 | Ga0495657_0102405 | 3300046675 | Bacteria | 1822 |
| 680 | Ga0495599_0000004 | 3300046678 | Bacteria | 316231 |
| 681 | Ga0495599_0005293 | 3300046678 | Bacteria | 7696 |
| 682 | Ga0495599_0160036 | 3300046678 | Bacteria | 1392 |
| 683 | Ga0495623_0000308 | 3300046679 | Bacteria | 31709 |
| 684 | Ga0495623_0088670 | 3300046679 | Bacteria | 1903 |
| 685 | Ga0495623_0123981 | 3300046679 | Bacteria | 1553 |
| 686 | Ga0495646_0000010 | 3300046680 | Bacteria | 195319 |
| 687 | Ga0495646_0015302 | 3300046680 | Bacteria | 4870 |
| 688 | Ga0495646_0133121 | 3300046680 | Bacteria | 1398 |
| 689 | Ga0495646_0136578 | 3300046680 | Bacteria | 1375 |
| 690 | Ga0495647_0100928 | 3300046681 | Bacteria | 1195 |
| 691 | Ga0495658_0027938 | 3300046683 | Bacteria | 3041 |
| 692 | Ga0495613_0000393 | 3300046689 | Bacteria | 37458 |
| 693 | Ga0495613_0047531 | 3300046689 | Bacteria | 3170 |
| 694 | Ga0495613_0068120 | 3300046689 | Bacteria | 2596 |
| 695 | Ga0495624_0000182 | 3300046690 | Bacteria | 46968 |
| 696 | Ga0495624_0016464 | 3300046690 | Bacteria | 4976 |
| 697 | Ga0495624_0173605 | 3300046690 | Bacteria | 1315 |
| 698 | Ga0495670_0001025 | 3300046691 | Bacteria | 13565 |
| 699 | Ga0495670_0184058 | 3300046691 | Bacteria | 1104 |
| 700 | Ga0495649_0018770 | 3300046694 | Bacteria | 3885 |
| 701 | Ga0495589_0055230 | 3300046794 | Bacteria | 1957 |
| 702 | Ga0495600_0000026 | 3300046809 | Bacteria | 91792 |
| 703 | Ga0495600_0005897 | 3300046809 | Bacteria | 7411 |
| 704 | Ga0495581_0003469 | 3300047315 | Bacteria | 9049 |
| 705 | Ga0495581_0057297 | 3300047315 | Bacteria | 2249 |
| 706 | Ga0495604_0000010 | 3300047317 | Bacteria | 312236 |
| 707 | Ga0495604_0149123 | 3300047317 | Bacteria | 1663 |
| 708 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 709 | Ga0495674_0018083 | 3300047319 | Bacteria | 6561 |
| 710 | Ga0495674_0018464 | 3300047319 | Bacteria | 6490 |
| 711 | Ga0495674_0038322 | 3300047319 | Bacteria | 4303 |
| 712 | Ga0495672_0003613 | 3300047320 | Bacteria | 13115 |
| 713 | Ga0495672_0037293 | 3300047320 | Bacteria | 2975 |
| 714 | Ga0495676_0055244 | 3300047321 | Bacteria | 3150 |
| 715 | Ga0495680_0002781 | 3300047322 | Bacteria | 17646 |
| 716 | Ga0495680_0021273 | 3300047322 | Bacteria | 5432 |
| 717 | Ga0495680_0082168 | 3300047322 | Bacteria | 2431 |
| 718 | Ga0495683_0045665 | 3300047323 | Bacteria | 2201 |
| 719 | Ga0495675_0000009 | 3300047444 | Bacteria | 154214 |
| 720 | Ga0495675_0005020 | 3300047444 | Bacteria | 8051 |
| 721 | Ga0495685_026257 | 3300047447 | Bacteria | 2004 |
| 722 | Ga0495673_0080248 | 3300047469 | Bacteria | 1353 |
| 723 | Ga0495684_0000005 | 3300047471 | Bacteria | 291932 |
| 724 | Ga0495684_0003481 | 3300047471 | Bacteria | 12321 |
| 725 | Ga0495684_0261469 | 3300047471 | Bacteria | 1255 |
| 726 | Ga0495686_0079166 | 3300047472 | Bacteria | 2010 |
| 727 | Ga0495686_0119455 | 3300047472 | Bacteria | 1573 |
| 728 | Ga0495686_0144702 | 3300047472 | Bacteria | 1400 |
| 729 | Ga0495593_0000477 | 3300047673 | Bacteria | 22563 |
| 730 | Ga0495593_0005153 | 3300047673 | Bacteria | 7723 |
| 731 | Ga0495593_0111404 | 3300047673 | Bacteria | 1397 |
| 732 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 733 | Ga0495602_0104383 | 3300048088 | Bacteria | 2319 |
| 734 | Ga0495614_0023408 | 3300048089 | Bacteria | 2665 |
| 735 | Ga0496100_0088875 | 3300048903 | Bacteria | 2104 |
| 736 | Ga0496100_0133001 | 3300048903 | Bacteria | 1754 |
| 737 | Ga0496100_0249260 | 3300048903 | Bacteria | 1313 |
| 738 | Ga0496101_0016561 | 3300048904 | Bacteria | 4984 |
| 739 | Ga0496101_0128103 | 3300048904 | Bacteria | 1925 |
| 740 | Ga0496101_0180121 | 3300048904 | Bacteria | 1627 |
| 741 | Ga0496101_0188481 | 3300048904 | Bacteria | 1591 |
| 742 | Ga0496102_0028619 | 3300048905 | Bacteria | 4979 |
| 743 | Ga0496102_0066565 | 3300048905 | Bacteria | 3302 |
| 744 | Ga0496102_0267163 | 3300048905 | Bacteria | 1613 |
| 745 | Ga0496102_0349366 | 3300048905 | Bacteria | 1392 |
| 746 | Ga0496103_0029860 | 3300048906 | Bacteria | 3315 |
| 747 | Ga0496104_0157097 | 3300048907 | Bacteria | 2182 |
| 748 | Ga0496104_0228073 | 3300048907 | Bacteria | 1775 |
| 749 | Ga0496104_0486245 | 3300048907 | Bacteria | 1146 |
| 750 | Ga0496105_0006604 | 3300048908 | Bacteria | 8933 |
| 751 | Ga0496105_0103876 | 3300048908 | Bacteria | 2347 |
| 752 | Ga0496105_0142335 | 3300048908 | Bacteria | 1974 |
| 753 | Ga0496105_0173247 | 3300048908 | Bacteria | 1768 |
| 754 | Ga0496105_0292765 | 3300048908 | Bacteria | 1310 |
| 755 | Ga0496106_0009365 | 3300048909 | Bacteria | 7240 |
| 756 | Ga0496106_0090143 | 3300048909 | Bacteria | 2366 |
| 757 | Ga0496106_0152744 | 3300048909 | Bacteria | 1822 |
| 758 | Ga0496106_0179341 | 3300048909 | Bacteria | 1681 |
| 759 | Ga0496106_0271478 | 3300048909 | Bacteria | 1358 |
| 760 | Ga0496107_0002191 | 3300048910 | Bacteria | 12555 |
| 761 | Ga0496107_0119448 | 3300048910 | Bacteria | 1941 |
| 762 | Ga0496108_0000708 | 3300048911 | Bacteria | 25879 |
| 763 | Ga0496109_0000492 | 3300048912 | Bacteria | 33814 |
| 764 | Ga0496109_0033027 | 3300048912 | Bacteria | 4655 |
| 765 | Ga0496109_0039372 | 3300048912 | Bacteria | 4278 |
| 766 | Ga0496109_0132396 | 3300048912 | Bacteria | 2328 |
| 767 | Ga0496109_0149211 | 3300048912 | Bacteria | 2189 |
| 768 | Ga0496109_0297644 | 3300048912 | Bacteria | 1521 |
| 769 | Ga0496110_0002285 | 3300048913 | Bacteria | 14319 |
| 770 | Ga0496110_0177921 | 3300048913 | Bacteria | 1931 |
| 771 | Ga0496110_0202220 | 3300048913 | Bacteria | 1805 |
| 772 | Ga0496110_0215067 | 3300048913 | Bacteria | 1748 |
| 773 | Ga0496110_0241769 | 3300048913 | Bacteria | 1642 |
| 774 | Ga0496110_0280193 | 3300048913 | Bacteria | 1518 |
| 775 | Ga0496110_0363651 | 3300048913 | Bacteria | 1318 |
| 776 | Ga0496110_0450493 | 3300048913 | Bacteria | 1173 |
| 777 | Ga0496110_0472088 | 3300048913 | Bacteria | 1143 |
| 778 | Ga0496111_0064774 | 3300048914 | Bacteria | 2652 |
| 779 | Ga0496111_0119912 | 3300048914 | Bacteria | 1943 |
| 780 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 781 | Ga0496112_0000640 | 3300048915 | Bacteria | 24288 |
| 782 | Ga0496112_0011710 | 3300048915 | Bacteria | 8026 |
| 783 | Ga0496112_0035404 | 3300048915 | Bacteria | 4863 |
| 784 | Ga0496112_0156639 | 3300048915 | Bacteria | 2245 |
| 785 | Ga0496112_0188649 | 3300048915 | Bacteria | 2024 |
| 786 | Ga0496112_0193334 | 3300048915 | Bacteria | 1996 |
| 787 | Ga0496112_0400913 | 3300048915 | Bacteria | 1311 |
| 788 | Ga0496113_0249710 | 3300048916 | Bacteria | 1416 |
| 789 | Ga0496113_0429421 | 3300048916 | Bacteria | 1061 |
| 790 | Ga0496114_0085873 | 3300048917 | Bacteria | 2666 |
| 791 | Ga0496114_0217568 | 3300048917 | Bacteria | 1676 |
| 792 | Ga0496115_0000809 | 3300048918 | Bacteria | 22963 |
| 793 | Ga0496115_0022927 | 3300048918 | Bacteria | 4841 |
| 794 | Ga0496115_0054692 | 3300048918 | Bacteria | 3206 |
| 795 | Ga0496115_0181113 | 3300048918 | Bacteria | 1742 |
| 796 | Ga0496115_0214884 | 3300048918 | Bacteria | 1588 |
| 797 | Ga0496115_0310632 | 3300048918 | Bacteria | 1291 |
| 798 | Ga0496116_0001285 | 3300048919 | Bacteria | 28897 |
| 799 | Ga0496116_0053261 | 3300048919 | Bacteria | 2674 |
| 800 | Ga0496117_0008638 | 3300048920 | Bacteria | 9641 |
| 801 | Ga0496117_0024531 | 3300048920 | Bacteria | 4766 |
| 802 | Ga0496117_0032896 | 3300048920 | Bacteria | 3932 |
| 803 | Ga0496117_0050664 | 3300048920 | Bacteria | 2943 |
| 804 | Ga0496117_0128533 | 3300048920 | Bacteria | 1541 |
| 805 | Ga0496118_0006900 | 3300048921 | Bacteria | 12291 |
| 806 | Ga0496118_0032426 | 3300048921 | Bacteria | 4304 |
| 807 | Ga0496118_0048585 | 3300048921 | Bacteria | 3275 |
| 808 | Ga0496118_0053291 | 3300048921 | Bacteria | 3077 |
| 809 | Ga0496118_0053638 | 3300048921 | Bacteria | 3062 |
| 810 | Ga0496118_0079978 | 3300048921 | Bacteria | 2303 |
| 811 | Ga0496118_0120214 | 3300048921 | Bacteria | 1715 |
| 812 | Ga0496119_0058548 | 3300048922 | Bacteria | 2321 |
| 813 | Ga0496120_0102879 | 3300048923 | Bacteria | 1506 |
| 814 | Ga0496121_0000657 | 3300048924 | Bacteria | 64819 |
| 815 | Ga0496121_0003593 | 3300048924 | Bacteria | 21892 |
| 816 | Ga0496121_0014000 | 3300048924 | Bacteria | 8565 |
| 817 | Ga0496121_0014712 | 3300048924 | Bacteria | 8272 |
| 818 | Ga0496121_0030767 | 3300048924 | Bacteria | 4924 |
| 819 | Ga0496121_0085561 | 3300048924 | Bacteria | 2481 |
| 820 | Ga0496121_0160023 | 3300048924 | Bacteria | 1648 |
| 821 | Ga0496121_0253611 | 3300048924 | Bacteria | 1219 |
| 822 | Ga0496122_0010073 | 3300048925 | Bacteria | 9816 |
| 823 | Ga0496123_0013538 | 3300048926 | Bacteria | 6832 |
| 824 | Ga0496123_0081760 | 3300048926 | Bacteria | 1961 |
| 825 | Ga0496123_0162447 | 3300048926 | Bacteria | 1189 |
| 826 | Ga0496124_0003765 | 3300048927 | Bacteria | 18242 |
| 827 | Ga0496124_0073925 | 3300048927 | Bacteria | 2819 |
| 828 | Ga0496124_0210217 | 3300048927 | Bacteria | 1473 |
| 829 | Ga0496125_0000060 | 3300048928 | Bacteria | 264143 |
| 830 | Ga0496125_0002052 | 3300048928 | Bacteria | 27206 |
| 831 | Ga0496125_0009244 | 3300048928 | Bacteria | 10178 |
| 832 | Ga0496125_0054576 | 3300048928 | Bacteria | 3264 |
| 833 | Ga0496125_0257962 | 3300048928 | Bacteria | 1095 |
| 834 | Ga0496126_0005780 | 3300048929 | Bacteria | 13985 |
| 835 | Ga0496126_0019689 | 3300048929 | Bacteria | 6641 |
| 836 | Ga0496126_0039266 | 3300048929 | Bacteria | 4393 |
| 837 | Ga0496126_0089065 | 3300048929 | Bacteria | 2717 |
| 838 | Ga0496126_0090864 | 3300048929 | Bacteria | 2686 |
| 839 | Ga0496126_0099502 | 3300048929 | Bacteria | 2546 |
| 840 | Ga0496126_0194638 | 3300048929 | Bacteria | 1715 |
| 841 | Ga0496126_0362609 | 3300048929 | Bacteria | 1183 |
| 842 | Ga0495682_0031778 | 3300049460 | Bacteria | 1951 |
| 843 | Ga0501031_0013588 | 3300049568 | Bacteria | 5305 |
| 844 | Ga0501032_0000224 | 3300049569 | Bacteria | 46893 |
| 845 | Ga0501032_0138800 | 3300049569 | Bacteria | 1601 |
| 846 | Ga0501033_0000095 | 3300049570 | Bacteria | 84522 |
| 847 | Ga0501033_0002865 | 3300049570 | Bacteria | 14457 |
| 848 | Ga0501033_0023602 | 3300049570 | Bacteria | 4639 |
| 849 | Ga0501034_0001937 | 3300049571 | Bacteria | 26207 |
| 850 | Ga0501034_0083651 | 3300049571 | Bacteria | 3193 |
| 851 | Ga0501034_0101445 | 3300049571 | Bacteria | 2871 |
| 852 | Ga0501034_0252743 | 3300049571 | Bacteria | 1707 |
| 853 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 854 | Ga0501036_0032365 | 3300049572 | Bacteria | 4418 |
| 855 | Ga0501036_0045888 | 3300049572 | Bacteria | 3700 |
| 856 | Ga0501037_0000159 | 3300049573 | Bacteria | 63178 |
| 857 | Ga0501037_0001255 | 3300049573 | Bacteria | 18688 |
| 858 | Ga0501037_0051617 | 3300049573 | Bacteria | 3007 |
| 859 | Ga0501038_0000028 | 3300049574 | Bacteria | 144481 |
| 860 | Ga0501038_0075917 | 3300049574 | Bacteria | 2840 |
| 861 | Ga0501038_0228141 | 3300049574 | Bacteria | 1483 |
| 862 | Ga0501038_0299425 | 3300049574 | Bacteria | 1262 |
| 863 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 864 | Ga0501039_0007262 | 3300049575 | Bacteria | 8440 |
| 865 | Ga0501039_0063159 | 3300049575 | Bacteria | 2869 |
| 866 | Ga0501039_0167739 | 3300049575 | Bacteria | 1726 |
| 867 | Ga0501040_0031332 | 3300049576 | Bacteria | 3593 |
| 868 | Ga0501041_0077092 | 3300049577 | Bacteria | 2051 |
| 869 | Ga0501042_0055621 | 3300049578 | Bacteria | 2824 |
| 870 | Ga0501042_0122758 | 3300049578 | Bacteria | 1870 |
| 871 | Ga0501043_0000127 | 3300049579 | Bacteria | 70587 |
| 872 | Ga0501043_0004021 | 3300049579 | Bacteria | 12023 |
| 873 | Ga0501043_0066534 | 3300049579 | Bacteria | 2830 |
| 874 | Ga0501043_0076681 | 3300049579 | Bacteria | 2626 |
| 875 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 876 | Ga0501046_0004507 | 3300049580 | Bacteria | 12624 |
| 877 | Ga0501046_0091031 | 3300049580 | Bacteria | 2346 |
| 878 | Ga0501047_0000077 | 3300049581 | Bacteria | 123480 |
| 879 | Ga0501047_0158155 | 3300049581 | Bacteria | 2138 |
| 880 | Ga0501048_0002484 | 3300049582 | Bacteria | 14086 |
| 881 | Ga0501048_0226392 | 3300049582 | Bacteria | 1327 |
| 882 | Ga0501067_0012929 | 3300049583 | Bacteria | 4620 |
| 883 | Ga0501067_0019283 | 3300049583 | Bacteria | 3774 |
| 884 | Ga0501068_0000392 | 3300049584 | Bacteria | 22164 |
| 885 | Ga0501068_0073311 | 3300049584 | Bacteria | 2091 |
| 886 | Ga0501069_0013965 | 3300049585 | Bacteria | 4289 |
| 887 | Ga0501071_0366733 | 3300049587 | Bacteria | 1097 |
| 888 | Ga0501072_0007925 | 3300049588 | Bacteria | 8065 |
| 889 | Ga0501072_0042318 | 3300049588 | Bacteria | 3578 |
| 890 | Ga0501072_0075277 | 3300049588 | Bacteria | 2670 |
| 891 | Ga0501072_0134005 | 3300049588 | Bacteria | 1975 |
| 892 | Ga0501073_0002575 | 3300049589 | Bacteria | 13564 |
| 893 | Ga0501073_0141583 | 3300049589 | Bacteria | 1666 |
| 894 | Ga0501074_0014705 | 3300049590 | Bacteria | 5692 |
| 895 | Ga0501074_0090568 | 3300049590 | Bacteria | 2190 |
| 896 | Ga0501074_0215102 | 3300049590 | Bacteria | 1369 |
| 897 | Ga0501077_0026999 | 3300049593 | Bacteria | 3646 |
| 898 | Ga0501077_0028401 | 3300049593 | Bacteria | 3555 |
| 899 | Ga0501077_0131094 | 3300049593 | Bacteria | 1589 |
| 900 | Ga0501079_0010982 | 3300049741 | Bacteria | 6901 |
| 901 | Ga0501079_0012378 | 3300049741 | Bacteria | 6511 |
| 902 | Ga0501079_0185177 | 3300049741 | Bacteria | 1625 |
| 903 | Ga0501080_0000035 | 3300049742 | Bacteria | 83220 |
| 904 | Ga0501080_0159720 | 3300049742 | Bacteria | 2082 |
| 905 | Ga0501081_0034327 | 3300049743 | Bacteria | 3451 |
| 906 | Ga0501083_0010008 | 3300049744 | Bacteria | 6690 |
| 907 | Ga0501083_0038877 | 3300049744 | Bacteria | 3233 |
| 908 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 909 | Ga0501035_0088462 | 3300049822 | Bacteria | 2729 |
| 910 | Ga0501044_0000184 | 3300049823 | Bacteria | 77805 |
| 911 | Ga0501044_0019527 | 3300049823 | Bacteria | 7247 |
| 912 | Ga0501044_0036695 | 3300049823 | Bacteria | 5126 |
| 913 | Ga0501044_0177561 | 3300049823 | Bacteria | 2098 |
| 914 | Ga0501044_0198697 | 3300049823 | Bacteria | 1964 |
| 915 | Ga0501044_0238411 | 3300049823 | Bacteria | 1763 |
| 916 | Ga0501045_0044622 | 3300049824 | Bacteria | 3229 |
| 917 | Ga0501045_0044659 | 3300049824 | Bacteria | 3228 |
| 918 | nmdc:mga03n38_112485_c1 | 3300050490 | Bacteria | 1328 |
| 919 | nmdc:mga03n38_38778_c1 | 3300050490 | Bacteria | 2062 |
| 920 | nmdc:mga03n38_4281_c1 | 3300050490 | Bacteria | 4702 |
| 921 | nmdc:mga00v17_120748_c1 | 3300050491 | Bacteria | 1668 |
| 922 | nmdc:mga00v17_268237_c1 | 3300050491 | Bacteria | 1108 |
| 923 | nmdc:mga00v17_38195_c1 | 3300050491 | Bacteria | 2870 |
| 924 | nmdc:mga00v17_48575_c1 | 3300050491 | Bacteria | 2572 |
| 925 | nmdc:mga0yw44_152498_c1 | 3300050492 | Bacteria | 1508 |
| 926 | nmdc:mga0yw44_19478_c1 | 3300050492 | Bacteria | 3744 |
| 927 | nmdc:mga0yw44_297428_c1 | 3300050492 | Bacteria | 1081 |
| 928 | nmdc:mga0yw44_29988_c1 | 3300050492 | Bacteria | 3147 |
| 929 | nmdc:mga06z11_32988_c1 | 3300050494 | Bacteria | 2529 |
| 930 | nmdc:mga06z11_88350_c1 | 3300050494 | Bacteria | 1678 |
| 931 | nmdc:mga06z11_89326_c1 | 3300050494 | Bacteria | 1670 |
| 932 | nmdc:mga07m45_10244_c1 | 3300050496 | Bacteria | 4890 |
| 933 | nmdc:mga07m45_179337_c1 | 3300050496 | Bacteria | 1232 |
| 934 | nmdc:mga07m45_71182_c1 | 3300050496 | Bacteria | 1979 |
| 935 | nmdc:mga05p37_758271_c1 | 3300050507 | Bacteria | 1068 |
| 936 | nmdc:mga08y16_436163_c1 | 3300050511 | Bacteria | 1338 |
| 937 | nmdc:mga08y16_7344_c1 | 3300050511 | Bacteria | 11563 |
| 938 | nmdc:mga0n895_30715_c1 | 3300050512 | Bacteria | 5137 |
| 939 | nmdc:mga0n895_70992_c1 | 3300050512 | Bacteria | 3452 |
| 940 | nmdc:mga0rr50_250823_c1 | 3300050513 | Bacteria | 1470 |
| 941 | nmdc:mga0rr50_58971_c1 | 3300050513 | Bacteria | 2879 |
| 942 | nmdc:mga0a205_30358_c1 | 3300050515 | Bacteria | 5175 |
| 943 | nmdc:mga0a205_31359_c1 | 3300050515 | Bacteria | 5093 |
| 944 | nmdc:mga0sz30_18356_c2 | 3300050516 | Bacteria | 2047 |
| 945 | nmdc:mga0sz30_7678_c1 | 3300050516 | Bacteria | 2678 |
| 946 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 947 | Ga0495601_0009067 | 3300053077 | Bacteria | 5875 |
| 948 | Ga0495601_0107109 | 3300053077 | Bacteria | 1808 |
| 949 | Ga0495601_0194603 | 3300053077 | Bacteria | 1325 |
| 950 | Ga0495601_0211776 | 3300053077 | Bacteria | 1266 |
| 951 | Ga0495601_0231253 | 3300053077 | Bacteria | 1208 |
| 952 | Ga0495612_0000007 | 3300053078 | Bacteria | 253300 |
| 953 | Ga0495612_0003765 | 3300053078 | Bacteria | 6306 |
| 954 | Ga0495612_0043763 | 3300053078 | Bacteria | 1830 |
| 955 | Ga0500635_0004031 | 3300053080 | Bacteria | 3748 |
| 956 | Ga0495595_0000183 | 3300053084 | Bacteria | 25168 |
| 957 | Ga0495595_0013588 | 3300053084 | Bacteria | 3441 |
| 958 | Ga0495619_0000009 | 3300053085 | Bacteria | 305595 |
| 959 | Ga0495619_0002660 | 3300053085 | Bacteria | 11686 |
| 960 | Ga0495619_0004943 | 3300053085 | Bacteria | 8466 |
| 961 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 962 | Ga0500644_0011143 | 3300053088 | Bacteria | 2451 |
| 963 | Ga0500646_0020369 | 3300053090 | Bacteria | 1762 |
| 964 | Ga0500583_0015980 | 3300053092 | Bacteria | 2985 |
| 965 | Ga0500651_0014968 | 3300053093 | Bacteria | 4754 |
| 966 | Ga0500651_0113888 | 3300053093 | Bacteria | 1648 |
| 967 | Ga0500566_0000049 | 3300053094 | Bacteria | 57920 |
| 968 | Ga0500566_0000483 | 3300053094 | Bacteria | 22212 |
| 969 | Ga0500566_0013269 | 3300053094 | Bacteria | 4852 |
| 970 | Ga0500566_0016932 | 3300053094 | Bacteria | 4280 |
| 971 | Ga0500640_016974 | 3300053095 | Bacteria | 3080 |
| 972 | Ga0500641_0073877 | 3300053096 | Bacteria | 1439 |
| 973 | Ga0500650_0000551 | 3300053098 | Bacteria | 9616 |
| 974 | Ga0500650_0061657 | 3300053098 | Bacteria | 1752 |
| 975 | Ga0500554_000388 | 3300053102 | Bacteria | 9498 |
| 976 | Ga0500554_021338 | 3300053102 | Bacteria | 1794 |
| 977 | Ga0500555_002067 | 3300053103 | Bacteria | 5901 |
| 978 | Ga0500555_007043 | 3300053103 | Bacteria | 3197 |
| 979 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 980 | Ga0500556_0002448 | 3300053104 | Bacteria | 5946 |
| 981 | Ga0500569_008989 | 3300053109 | Bacteria | 2306 |
| 982 | Ga0500572_000123 | 3300053111 | Bacteria | 26083 |
| 983 | Ga0500572_000651 | 3300053111 | Bacteria | 11498 |
| 984 | Ga0500593_010627 | 3300053117 | Bacteria | 3869 |
| 985 | Ga0500595_000418 | 3300053119 | Bacteria | 26871 |
| 986 | Ga0500595_000632 | 3300053119 | Bacteria | 21074 |
| 987 | Ga0500595_000646 | 3300053119 | Bacteria | 20947 |
| 988 | Ga0500595_003294 | 3300053119 | Bacteria | 7607 |
| 989 | Ga0500608_002577 | 3300053122 | Bacteria | 6630 |
| 990 | Ga0500614_002655 | 3300053123 | Bacteria | 3955 |
| 991 | Ga0500618_006438 | 3300053125 | Bacteria | 3448 |
| 992 | Ga0500642_0000016 | 3300053130 | Bacteria | 176560 |
| 993 | Ga0500642_0002422 | 3300053130 | Bacteria | 5471 |
| 994 | Ga0500642_0024781 | 3300053130 | Bacteria | 2428 |
| 995 | Ga0500658_0003908 | 3300053134 | Bacteria | 5601 |
| 996 | Ga0500658_0023685 | 3300053134 | Bacteria | 2346 |
| 997 | Ga0500658_0061348 | 3300053134 | Bacteria | 1564 |
| 998 | Ga0500559_0000184 | 3300053136 | Bacteria | 49756 |
| 999 | Ga0500559_0000654 | 3300053136 | Bacteria | 23267 |
| 1000 | Ga0500568_0007988 | 3300053139 | Bacteria | 5137 |
| 1001 | Ga0500568_0021010 | 3300053139 | Bacteria | 2815 |
| 1002 | Ga0500568_0030430 | 3300053139 | Bacteria | 2235 |
| 1003 | Ga0500585_102195 | 3300053144 | Bacteria | 1032 |
| 1004 | Ga0500588_0051072 | 3300053146 | Bacteria | 1289 |
| 1005 | Ga0500590_027963 | 3300053148 | Bacteria | 2926 |
| 1006 | Ga0500603_000031 | 3300053150 | Bacteria | 34081 |
| 1007 | Ga0500604_0060029 | 3300053151 | Bacteria | 1192 |
| 1008 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 1009 | Ga0500616_0000061 | 3300053153 | Bacteria | 249158 |
| 1010 | Ga0500616_0054379 | 3300053153 | Bacteria | 2097 |
| 1011 | Ga0500620_071161 | 3300053155 | Bacteria | 1196 |
| 1012 | Ga0500622_0000668 | 3300053156 | Bacteria | 30285 |
| 1013 | Ga0500622_0046928 | 3300053156 | Bacteria | 2231 |
| 1014 | Ga0500622_0068809 | 3300053156 | Bacteria | 1794 |
| 1015 | Ga0500627_0044108 | 3300053158 | Bacteria | 1925 |
| 1016 | Ga0500627_0071999 | 3300053158 | Bacteria | 1532 |
| 1017 | Ga0500630_000330 | 3300053159 | Bacteria | 19750 |
| 1018 | Ga0500634_0027470 | 3300053161 | Bacteria | 3101 |
| 1019 | Ga0500638_000100 | 3300053162 | Bacteria | 16087 |
| 1020 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 1021 | Ga0500639_117100 | 3300053163 | Bacteria | 1286 |
| 1022 | Ga0500636_0000014 | 3300053177 | Bacteria | 124740 |
| 1023 | Ga0500636_0004292 | 3300053177 | Bacteria | 8069 |
| 1024 | Ga0500636_0039319 | 3300053177 | Bacteria | 2797 |
| 1025 | Ga0500637_0000845 | 3300053178 | Bacteria | 12246 |
| 1026 | Ga0500637_0022675 | 3300053178 | Bacteria | 3425 |
| 1027 | Ga0500645_006589 | 3300053730 | Bacteria | 4124 |
| 1028 | Ga0500596_001238 | 3300053735 | Bacteria | 5167 |
| 1029 | Ga0500596_001798 | 3300053735 | Bacteria | 4308 |
| 1030 | Ga0500599_001747 | 3300053736 | Bacteria | 2542 |
| 1031 | Ga0500601_000055 | 3300053737 | Bacteria | 23778 |
| 1032 | Ga0501084_0013511 | 3300054114 | Bacteria | 6757 |
| 1033 | Ga0501084_0038572 | 3300054114 | Bacteria | 3993 |
| 1034 | Ga0501084_0400044 | 3300054114 | Bacteria | 1161 |
| 1035 | Ga0500661_002374 | 3300055283 | Bacteria | 3552 |
| 1036 | Ga0501082_0000053 | 3300060353 | Bacteria | 82895 |
| 1037 | Ga0501082_0254020 | 3300060353 | Bacteria | 1529 |
| 1038 | Ga0466962_0026287 | 3300061719 | Bacteria | 2795 |
| 1039 | Ga0530510_0007668 | 3300061734 | Bacteria | 7516 |
| 1040 | Ga0530510_0206531 | 3300061734 | Bacteria | 1459 |
| 1041 | 2508692033 | 2508501042 | Bacteria | 8719808 |
| 1042 | 2509151425 | 2508501128 | Bacteria | 8613869 |
| 1043 | 2513656988 | 2513237096 | Bacteria | 8722461 |
| 1044 | 2513696791 | 2513237101 | Bacteria | 7952346 |
| 1045 | 2513722142 | 2513237104 | Bacteria | 10034502 |
| 1046 | 2513855427 | 2513237137 | Bacteria | 9558895 |
| 1047 | 2513873227 | 2513237139 | Bacteria | 8737671 |
| 1048 | 2513889946 | 2513237141 | Bacteria | 8496279 |
| 1049 | 2513918728 | 2513237145 | Bacteria | 8979722 |
| 1050 | 2514015788 | 2513237161 | Bacteria | 8871253 |
| 1051 | 2517891976 | 2517572143 | Bacteria | 9484767 |
| 1052 | 2524470208 | 2524023210 | Bacteria | 9029266 |
| 1053 | 2524534040 | 2524023228 | Bacteria | 10118060 |
| 1054 | 2603856833 | 2602042107 | Bacteria | 6226103 |
| 1055 | 2671121985 | 2667528175 | Bacteria | 7532676 |
| 1056 | 2723846644 | 2721755755 | Bacteria | 8322773 |
| 1057 | 2728753092 | 2728368998 | Bacteria | 8720350 |
| 1058 | 2793068957 | 2791355197 | Bacteria | 8420563 |
| 1059 | 2793076596 | |||
| 1060 | 2805914783 | 2802429603 | Bacteria | 8777136 |
| 1061 | 2824610643 | 2824609381 | Bacteria | 8672835 |
| 1062 | 2824676423 | 2824671348 | Bacteria | 8369588 |
| 1063 | 2824687135 | 2824679649 | Bacteria | 8248951 |
| 1064 | 2824692828 | 2824687955 | Bacteria | 8360029 |
| 1065 | 2824700309 | 2824696289 | Bacteria | 8335049 |
| 1066 | 2824756572 | 2824753945 | Bacteria | 9787441 |
| 1067 | 2824766066 | 2824763712 | Bacteria | 9792355 |
| 1068 | 2824774513 | 2824773399 | Bacteria | 8360218 |
| 1069 | 2838123264 | 2838122688 | Bacteria | 8803140 |
| 1070 | 2841946556 | 2841941048 | Bacteria | 8688029 |
| 1071 | 2841954215 | 2841949485 | Bacteria | 8680857 |
| 1072 | 2841961081 | 2841957949 | Bacteria | 8652217 |
| 1073 | 2841969590 | 2841966195 | Bacteria | 8673214 |
| 1074 | 2841974526 | 2841974524 | Bacteria | 8931498 |
| 1075 | 2841983911 | 2841983080 | Bacteria | 8395090 |
| 1076 | 2847947018 | 2847939898 | Bacteria | 8606328 |
| 1077 | 2857515991 | 2857509624 | Bacteria | 7472071 |
| 1078 | 2857528310 | 2857524615 | Bacteria | 6615449 |
| 1079 | 2874605669 | 2874604998 | Bacteria | 7834745 |
| 1080 | 2876770378 | 2876761206 | Bacteria | 10111113 |
| 1081 | 2876814710 | 2876808645 | Bacteria | 8824342 |
| 1082 | 2879108472 | 2879099564 | Bacteria | 10442239 |
| 1083 | 2879115953 | 2879110137 | Bacteria | 8907982 |
| 1084 | 2885391267 | 2885383462 | Bacteria | 9473874 |
| 1085 | 2889041203 | 2889033259 | Bacteria | 9099371 |
| 1086 | 2903750186 | 2903748898 | Bacteria | 9972761 |
| 1087 | 2903776912 | 2903768456 | Bacteria | 9749579 |
| 1088 | 2904694966 | 2904690495 | Bacteria | 9412302 |
| 1089 | 2904704080 | |||
| 1090 | 2904715203 | 2904711408 | Bacteria | 9771557 |
| 1091 | 2906617096 | |||
| 1092 | 2906643203 | 2906635258 | Bacteria | 8601019 |
| 1093 | 2906662365 | 2906660503 | Bacteria | 8595048 |
| 1094 | 2908742243 | 2908739725 | Bacteria | 8628932 |
| 1095 | 2908759894 | 2908756301 | Bacteria | 8864324 |
| 1096 | 2919075738 | 2919073203 | Bacteria | 6531949 |
| 1097 | 2922365848 | 2922361189 | Bacteria | 7436256 |
| 1098 | 2922391393 | 2922386360 | Bacteria | 7017218 |
| 1099 | 2922394488 | 2922393267 | Bacteria | 8285685 |
| 1100 | 2922430748 | |||
| 1101 | 2932800821 | 2932794094 | Bacteria | 7915132 |
| 1102 | 2932809318 | 2932801729 | Bacteria | 7987968 |
| 1103 | 2932812901 | 2932809354 | Bacteria | 9135765 |
| 1104 | 2932819008 | 2932818245 | Bacteria | 9955613 |
| 1105 | 2935636442 | 2935630451 | Bacteria | 8169952 |
| 1106 | 2935650831 | 2935648319 | Bacteria | 8801166 |
| 1107 | 2935659012 | 2935656913 | Bacteria | 8965014 |
| 1108 | 2935768166 | 2935760218 | Bacteria | 9817913 |
| 1109 | 2935885895 | 2935883170 | Bacteria | 7964738 |
| 1110 | 2935960905 | 2935959822 | Bacteria | 7869783 |
| 1111 | 2936013427 | 2936011229 | Bacteria | 8801034 |
| 1112 | 2936022446 | 2936019824 | Bacteria | 8804134 |
| 1113 | 2936030892 | 2936028420 | Bacteria | 8965941 |
| 1114 | 2936048705 | 2936046547 | Bacteria | 8903709 |
| 1115 | 2936058919 | 2936055302 | Bacteria | 8785755 |
| 1116 | 2941509848 | 2941507105 | Bacteria | 8166816 |
| 1117 | 2941520908 | 2941515067 | Bacteria | 8166720 |
| 1118 | 2941525247 | 2941523033 | Bacteria | 8169134 |
| 1119 | 2941533293 | 2941531003 | Bacteria | 7653939 |
| 1120 | 2995393341 | 2995392953 | Bacteria | 4539380 |
| 1121 | 3005480655 | 3005474847 | Bacteria | 9259049 |
| 1122 | 3005484756 | 3005483717 | Bacteria | 7877331 |
| 1123 | 3005507501 | 3005506211 | Bacteria | 6943378 |
| 1124 | 3005715370 | 3005710791 | Bacteria | 7622528 |
| 1125 | 8006940115 | 8006933436 | Bacteria | 10410654 |
| 1126 | 8006971736 | 8006964411 | Bacteria | 8966052 |
| 1127 | 8006979897 | 8006973647 | Bacteria | 10679141 |
| 1128 | 8006987792 | 8006984368 | Bacteria | 9651211 |
| 1129 | 8007000789 | 8006994254 | Bacteria | 8309700 |
| 1130 | 8016626071 | 8016622563 | Bacteria | 7999408 |
| 1131 | 8016639849 | 8016630954 | Bacteria | 9217207 |
| 1132 | 8019553163 | 8019547302 | Bacteria | 7996444 |
| 1133 | 8019556090 | 8019555841 | Bacteria | 9642137 |
| 1134 | 8019569217 | 8019565922 | Bacteria | 9639779 |
| 1135 | 8056677017 | 8056673599 | Bacteria | 7871253 |
| 1136 | 8056689312 | 8056681323 | Bacteria | 8472857 |
| 1137 | 8056692166 | 8056689827 | Bacteria | 6712655 |
| 1138 | Ga0105249_10321575 | |||
| 1139 | SwRhRL2b_contig_3446018 | |||
| 1140 | 2214767425 | |||
| 1141 | ARcpr5oldR_c000015 | |||
| 1142 | ARcpr5yngRDRAFT_c000041 | |||
| 1143 | ARSoilOldRDRAFT_c000020 | |||
| 1144 | LJQas_1002377 | |||
| 1145 | ARCol0yngRDRAFT_1000465 | |||
| 1146 | JGI24741J21665_1001722 | |||
| 1147 | JGI24751J29686_10011876 | |||
| 1148 | JGI25406J46586_10000107 | |||
| 1149 | JGI25406J46586_10032899 | |||
| 1150 | JGI25153J46596_10003474 | |||
| 1151 | JGI25153J46596_10005518 | |||
| 1152 | JGI25404J52841_10000207 | |||
| 1153 | JGI25404J52841_10004473 | |||
| 1154 | JGI25404J52841_10005027 | |||
| 1155 | Ga0055543_1003572 | |||
| 1156 | Ga0065165_1000611 | |||
| 1157 | Ga0065165_1002289 | |||
| 1158 | Ga0065165_1015899 | |||
| 1159 | Ga0065704_10073457 | |||
| 1160 | Ga0065712_10068673 | |||
| 1161 | Ga0065715_10001423 | |||
| 1162 | Ga0065707_10107116 | |||
| 1163 | Ga0070658_10022153 | |||
| 1164 | Ga0070683_100003299 | |||
| 1165 | Ga0070683_100045550 | |||
| 1166 | Ga0070690_100056719 | |||
| 1167 | Ga0070690_100215155 | |||
| 1168 | Ga0068869_100000020 | |||
| 1169 | Ga0070666_10132804 | |||
| 1170 | Ga0070680_100037477 | |||
| 1171 | Ga0070680_100139630 | |||
| 1172 | Ga0070680_100181669 | |||
| 1173 | Ga0070682_100133537 | |||
| 1174 | Ga0068868_100017417 | |||
| 1175 | Ga0068868_100176754 | |||
| 1176 | Ga0070660_100029209 | |||
| 1177 | Ga0070689_100010928 | |||
| 1178 | Ga0070691_10117181 | |||
| 1179 | Ga0070661_100028424 | |||
| 1180 | Ga0070661_100102336 | |||
| 1181 | Ga0070668_100022422 | |||
| 1182 | Ga0070668_100062995 | |||
| 1183 | Ga0070668_100088766 | |||
| 1184 | Ga0070668_100201586 | |||
| 1185 | Ga0070669_100073632 | |||
| 1186 | Ga0070671_100063509 | |||
| 1187 | Ga0070671_100154893 | |||
| 1188 | Ga0070674_100064973 | |||
| 1189 | Ga0070674_100186794 | |||
| 1190 | Ga0070659_100005453 | |||
| 1191 | Ga0070659_100008448 | |||
| 1192 | Ga0070667_100185575 | |||
| 1193 | Ga0070667_100205680 | |||
| 1194 | Ga0070667_100307819 | |||
| 1195 | Ga0070709_10001024 | |||
| 1196 | Ga0070709_10004772 | |||
| 1197 | Ga0070714_100004819 | |||
| 1198 | Ga0070714_100048263 | |||
| 1199 | Ga0070713_100042563 | |||
| 1200 | Ga0070710_10001247 | |||
| 1201 | Ga0070710_10006126 | |||
| 1202 | Ga0070701_10046340 | |||
| 1203 | Ga0070711_100017928 | |||
| 1204 | Ga0070711_100136718 | |||
| 1205 | Ga0070705_100100101 | |||
| 1206 | Ga0070694_100044923 | |||
| 1207 | Ga0070708_100059799 | |||
| 1208 | Ga0070663_100037485 | |||
| 1209 | Ga0070663_100366628 | |||
| 1210 | Ga0070678_100157561 | |||
| 1211 | Ga0070662_100047028 | |||
| 1212 | Ga0070662_100051625 | |||
| 1213 | Ga0070681_10035094 | |||
| 1214 | Ga0070681_10236456 | |||
| 1215 | Ga0070681_10238950 | |||
| 1216 | Ga0068867_100025717 | |||
| 1217 | Ga0068867_100260518 | |||
| 1218 | Ga0070685_10032452 | |||
| 1219 | Ga0070706_100092084 | |||
| 1220 | Ga0070679_100161976 | |||
| 1221 | Ga0070679_100235841 | |||
| 1222 | Ga0070684_100000621 | |||
| 1223 | Ga0070684_100195103 | |||
| 1224 | Ga0070684_100232719 | |||
| 1225 | Ga0070697_100022711 | |||
| 1226 | Ga0068853_100014191 | |||
| 1227 | Ga0068853_100127434 | |||
| 1228 | Ga0070686_100017885 | |||
| 1229 | Ga0070695_100082202 | |||
| 1230 | Ga0070696_100010123 | |||
| 1231 | Ga0070693_100115959 | |||
| 1232 | Ga0070665_100040138 | |||
| 1233 | Ga0070665_100068317 | |||
| 1234 | Ga0070665_100068706 | |||
| 1235 | Ga0070704_100277718 | |||
| 1236 | Ga0068855_100010870 | |||
| 1237 | Ga0068855_100092380 | |||
| 1238 | Ga0068855_100134825 | |||
| 1239 | Ga0068855_100343359 | |||
| 1240 | Ga0068855_100356659 | |||
| 1241 | Ga0070664_100241143 | |||
| 1242 | Ga0070664_100286860 | |||
| 1243 | Ga0068857_100011094 | |||
| 1244 | Ga0068857_100025261 | |||
| 1245 | Ga0068857_100207844 | |||
| 1246 | Ga0068854_100004158 | |||
| 1247 | Ga0068854_100015658 | |||
| 1248 | Ga0068856_100000201 | |||
| 1249 | Ga0068856_100026854 | |||
| 1250 | Ga0068856_100539336 | |||
| 1251 | Ga0068852_100004502 | |||
| 1252 | Ga0068852_100004666 | |||
| 1253 | Ga0068852_100009858 | |||
| 1254 | Ga0068852_100065320 | |||
| 1255 | Ga0068852_100229610 | |||
| 1256 | Ga0068864_100018108 | |||
| 1257 | Ga0068864_100074094 | |||
| 1258 | Ga0068864_100078232 | |||
| 1259 | Ga0068851_10001869 | |||
| 1260 | Ga0068851_10006397 | |||
| 1261 | Ga0068870_10040471 | |||
| 1262 | Ga0068858_100048576 | |||
| 1263 | Ga0068858_100051923 | |||
| 1264 | Ga0068860_100029434 | |||
| 1265 | Ga0068860_100030255 | |||
| 1266 | Ga0068860_100129197 | |||
| 1267 | Ga0068862_100018125 | |||
| 1268 | Ga0068862_100064781 | |||
| 1269 | Ga0068862_100083946 | |||
| 1270 | Ga0081455_10002927 | |||
| 1271 | Ga0081455_10010701 | |||
| 1272 | Ga0081455_10013922 | |||
| 1273 | Ga0081455_10039117 | |||
| 1274 | Ga0081455_10092991 | |||
| 1275 | Ga0081455_10169820 | |||
| 1276 | Ga0081540_1000008 | |||
| 1277 | Ga0081540_1000659 | |||
| 1278 | Ga0081540_1001575 | |||
| 1279 | Ga0081540_1001596 | |||
| 1280 | Ga0081540_1003337 | |||
| 1281 | Ga0081540_1014191 | |||
| 1282 | Ga0081540_1014661 | |||
| 1283 | Ga0081540_1032543 | |||
| 1284 | Ga0081539_10000051 | |||
| 1285 | Ga0081539_10000148 | |||
| 1286 | Ga0081539_10086976 | |||
| 1287 | Ga0070717_10032172 | |||
| 1288 | Ga0070717_10089698 | |||
| 1289 | Ga0075365_10023373 | |||
| 1290 | Ga0075368_10012863 | |||
| 1291 | Ga0075363_100078014 | |||
| 1292 | Ga0075363_100105309 | |||
| 1293 | Ga0075363_100125596 | |||
| 1294 | Ga0075363_100126773 | |||
| 1295 | Ga0075364_10057755 | |||
| 1296 | Ga0075364_10264017 | |||
| 1297 | Ga0070716_100007305 | |||
| 1298 | Ga0070712_100004628 | |||
| 1299 | Ga0070712_100097574 | |||
| 1300 | Ga0075362_10003965 | |||
| 1301 | Ga0075362_10010494 | |||
| 1302 | Ga0075367_10008677 | |||
| 1303 | Ga0075367_10112605 | |||
| 1304 | Ga0075369_10061787 | |||
| 1305 | Ga0075366_10142860 | |||
| 1306 | Ga0075370_10011963 | |||
| 1307 | Ga0075370_10012956 | |||
| 1308 | Ga0075370_10059624 | |||
| 1309 | Ga0075370_10085697 | |||
| 1310 | Ga0075370_10094691 | |||
| 1311 | Ga0075433_10003333 | |||
| 1312 | Ga0075433_10023484 | |||
| 1313 | Ga0075434_100045275 | |||
| 1314 | Ga0075434_100082988 | |||
| 1315 | Ga0075436_100278959 | |||
| 1316 | Ga0099824_1013104 | |||
| 1317 | Ga0099822_1033064 | |||
| 1318 | Ga0099794_10006033 | |||
| 1319 | Ga0099795_10005799 | |||
| 1320 | Ga0105240_10005244 | |||
| 1321 | Ga0105240_10014218 | |||
| 1322 | Ga0105240_10048346 | |||
| 1323 | Ga0105240_10061655 | |||
| 1324 | Ga0105240_10081762 | |||
| 1325 | Ga0105240_10102288 | |||
| 1326 | Ga0105240_10127327 | |||
| 1327 | Ga0105240_10520992 | |||
| 1328 | Ga0111539_10000376 | |||
| 1329 | Ga0111539_10023241 | |||
| 1330 | Ga0111539_10581597 | |||
| 1331 | Ga0105245_10011901 | |||
| 1332 | Ga0105245_10020273 | |||
| 1333 | Ga0105245_10061032 | |||
| 1334 | Ga0105243_10207505 | |||
| 1335 | Ga0105243_10266271 | |||
| 1336 | Ga0105241_10007828 | |||
| 1337 | Ga0105241_10018738 | |||
| 1338 | Ga0105242_10041951 | |||
| 1339 | Ga0105242_10118777 | |||
| 1340 | Ga0105242_10389571 | |||
| 1341 | Ga0105248_10042505 | |||
| 1342 | Ga0105248_10048562 | |||
| 1343 | Ga0105248_10171182 | |||
| 1344 | Ga0105248_10427528 | |||
| 1345 | Ga0105237_10004443 | |||
| 1346 | Ga0105237_10011853 | |||
| 1347 | Ga0105237_10170559 | |||
| 1348 | Ga0105238_10004551 | |||
| 1349 | Ga0105238_10039775 | |||
| 1350 | Ga0105238_10089499 | |||
| 1351 | Ga0105238_10318380 | |||
| 1352 | Ga0105238_10405517 | |||
| 1353 | Ga0105249_10001094 | |||
| 1354 | Ga0105249_10207054 | |||
| 1355 | Ga0105249_10566795 | |||
| 1356 | Ga0099796_10005285 | |||
| 1357 | Ga0099796_10099022 | |||
| 1358 | Ga0105239_10006224 | |||
| 1359 | Ga0105239_10028197 | |||
| 1360 | Ga0105239_10042743 | |||
| 1361 | Ga0105239_10077607 | |||
| 1362 | Ga0105239_10097931 | |||
| 1363 | Ga0105239_10267557 | |||
| 1364 | Ga0105239_10303707 | |||
| 1365 | Ga0105239_10310274 | |||
| 1366 | Ga0105239_10356872 | |||
| 1367 | Ga0105246_10142767 | |||
| 1368 | Ga0105246_10198155 | |||
| 1369 | Ga0157320_1000194 | |||
| 1370 | Ga0157370_10066022 | |||
| 1371 | Ga0157369_10009427 | |||
| 1372 | Ga0157369_10065629 | |||
| 1373 | Ga0157369_10152124 | |||
| 1374 | Ga0157369_10265192 | |||
| 1375 | Ga0157374_10057322 | |||
| 1376 | Ga0157374_10138668 | |||
| 1377 | Ga0157378_10283257 | |||
| 1378 | Ga0163162_10106716 | |||
| 1379 | Ga0163162_10178263 | |||
| 1380 | Ga0163162_10332276 | |||
| 1381 | Ga0157375_10098565 | |||
| 1382 | Ga0157375_10465821 | |||
| 1383 | Ga0163163_10001343 | |||
| 1384 | Ga0163163_10073841 | |||
| 1385 | Ga0157379_10037468 | |||
| 1386 | Ga0157379_10150681 | |||
| 1387 | Ga0157379_10167111 | |||
| 1388 | Ga0157376_10124817 | |||
| 1389 | Ga0206356_11288174 | |||
| 1390 | Ga0206356_11820764 | |||
| 1391 | Ga0206353_11720299 | |||
| 1392 | Ga0213873_10027478 | |||
| 1393 | Ga0213872_10070500 | |||
| 1394 | Ga0213876_10000453 | |||
| 1395 | Ga0213876_10058218 | |||
| 1396 | Ga0213876_10071584 | |||
| 1397 | Ga0213876_10077509 | |||
| 1398 | Ga0213871_10005670 | |||
| 1399 | Ga0209677_100744 | |||
| 1400 | Ga0209564_1008307 | |||
| 1401 | Ga0209758_1000868 | |||
| 1402 | Ga0209758_1001178 | |||
| 1403 | Ga0209758_1003296 | |||
| 1404 | Ga0209758_1009363 | |||
| 1405 | Ga0209758_1033454 | |||
| 1406 | Ga0209256_1033883 | |||
| 1407 | Ga0207426_1000588 | |||
| 1408 | Ga0207697_10016615 | |||
| 1409 | Ga0207656_10002603 | |||
| 1410 | Ga0207656_10006908 | |||
| 1411 | Ga0207653_10016325 | |||
| 1412 | Ga0207682_10001712 | |||
| 1413 | Ga0207692_10061188 | |||
| 1414 | Ga0207710_10062685 | |||
| 1415 | Ga0207688_10043037 | |||
| 1416 | Ga0207688_10218819 | |||
| 1417 | Ga0207680_10069420 | |||
| 1418 | Ga0207699_10006427 | |||
| 1419 | Ga0207645_10061151 | |||
| 1420 | Ga0207645_10174624 | |||
| 1421 | Ga0207643_10104004 | |||
| 1422 | Ga0207705_10039609 | |||
| 1423 | Ga0207705_10208975 | |||
| 1424 | Ga0207654_10000163 | |||
| 1425 | Ga0207707_10002780 | |||
| 1426 | Ga0207707_10092302 | |||
| 1427 | Ga0207707_10110780 | |||
| 1428 | Ga0207707_10163103 | |||
| 1429 | Ga0207695_10000008 | |||
| 1430 | Ga0207695_10001114 | |||
| 1431 | Ga0207695_10035147 | |||
| 1432 | Ga0207671_10002506 | |||
| 1433 | Ga0207693_10007358 | |||
| 1434 | Ga0207693_10023667 | |||
| 1435 | Ga0207693_10126811 | |||
| 1436 | Ga0207693_10303744 | |||
| 1437 | Ga0207663_10002205 | |||
| 1438 | Ga0207663_10006649 | |||
| 1439 | Ga0207663_10007579 | |||
| 1440 | Ga0207660_10021591 | |||
| 1441 | Ga0207660_10282216 | |||
| 1442 | Ga0207657_10012978 | |||
| 1443 | Ga0207657_10268767 | |||
| 1444 | Ga0207649_10021186 | |||
| 1445 | Ga0207649_10142983 | |||
| 1446 | Ga0207652_10011048 | |||
| 1447 | Ga0207652_10062969 | |||
| 1448 | Ga0207652_10219372 | |||
| 1449 | Ga0207652_10507911 | |||
| 1450 | Ga0207694_10000050 | |||
| 1451 | Ga0207694_10011867 | |||
| 1452 | Ga0207659_10236931 | |||
| 1453 | Ga0207687_10025900 | |||
| 1454 | Ga0207687_10083883 | |||
| 1455 | Ga0207687_10146208 | |||
| 1456 | Ga0207687_10345014 | |||
| 1457 | Ga0207700_10053108 | |||
| 1458 | Ga0207664_10022494 | |||
| 1459 | Ga0207664_10126588 | |||
| 1460 | Ga0207644_10235831 | |||
| 1461 | Ga0207690_10003164 | |||
| 1462 | Ga0207706_10022632 | |||
| 1463 | Ga0207706_10047907 | |||
| 1464 | Ga0207706_10065472 | |||
| 1465 | Ga0207706_10183448 | |||
| 1466 | Ga0207686_10070889 | |||
| 1467 | Ga0207709_10008908 | |||
| 1468 | Ga0207670_10010357 | |||
| 1469 | Ga0207669_10000188 | |||
| 1470 | Ga0207669_10028328 | |||
| 1471 | Ga0207704_10090406 | |||
| 1472 | Ga0207665_10006821 | |||
| 1473 | Ga0207665_10008768 | |||
| 1474 | Ga0207665_10074551 | |||
| 1475 | Ga0207665_10137516 | |||
| 1476 | Ga0207691_10024979 | |||
| 1477 | Ga0207691_10060665 | |||
| 1478 | Ga0207711_10038548 | |||
| 1479 | Ga0207689_10021584 | |||
| 1480 | Ga0207661_10090076 | |||
| 1481 | Ga0207667_10021363 | |||
| 1482 | Ga0207667_10031627 | |||
| 1483 | Ga0207667_10033121 | |||
| 1484 | Ga0207667_10090534 | |||
| 1485 | Ga0207667_10242446 | |||
| 1486 | Ga0207667_10305912 | |||
| 1487 | Ga0207712_10056403 | |||
| 1488 | Ga0207712_10085897 | |||
| 1489 | Ga0207668_10058127 | |||
| 1490 | Ga0207668_10323755 | |||
| 1491 | Ga0207668_10354588 | |||
| 1492 | Ga0207640_10005819 | |||
| 1493 | Ga0207640_10072968 | |||
| 1494 | Ga0207640_10286772 | |||
| 1495 | Ga0207640_10446453 | |||
| 1496 | Ga0207658_10400496 | |||
| 1497 | Ga0207677_10062176 | |||
| 1498 | Ga0207677_10374372 | |||
| 1499 | Ga0207703_10000418 | |||
| 1500 | Ga0207703_10021608 | |||
| 1501 | Ga0207703_10195268 | |||
| 1502 | Ga0207703_10276590 | |||
| 1503 | Ga0207639_10021830 | |||
| 1504 | Ga0207639_10032453 | |||
| 1505 | Ga0207639_10182945 | |||
| 1506 | Ga0207678_10002589 | |||
| 1507 | Ga0207678_10010327 | |||
| 1508 | Ga0207678_10054616 | |||
| 1509 | Ga0207678_10105935 | |||
| 1510 | Ga0207678_10108825 | |||
| 1511 | Ga0207708_10080352 | |||
| 1512 | Ga0207702_10000002 | |||
| 1513 | Ga0207702_10003278 | |||
| 1514 | Ga0207702_10071150 | |||
| 1515 | Ga0207702_10118293 | |||
| 1516 | Ga0207641_10313841 | |||
| 1517 | Ga0207648_10006918 | |||
| 1518 | Ga0207648_10104489 | |||
| 1519 | Ga0207674_10002309 | |||
| 1520 | Ga0207674_10003185 | |||
| 1521 | Ga0207674_10023962 | |||
| 1522 | Ga0207674_10281647 | |||
| 1523 | Ga0207675_100043175 | |||
| 1524 | Ga0207683_10172965 | |||
| 1525 | Ga0207698_10005259 | |||
| 1526 | Ga0207698_10032001 | |||
| 1527 | Ga0209589_1000001 | |||
| 1528 | Ga0209489_100001 | |||
| 1529 | Ga0209700_100001 | |||
| 1530 | Ga0209995_1009205 | |||
| 1531 | Ga0209588_1006513 | |||
| 1532 | Ga0209966_1001288 | |||
| 1533 | Ga0209813_10008256 | |||
| 1534 | Ga0209974_10055118 | |||
| 1535 | Ga0207428_10000777 | |||
| 1536 | Ga0207428_10044934 | |||
| 1537 | Ga0207428_10069706 | |||
| 1538 | Ga0268266_10010402 | |||
| 1539 | Ga0268266_10014306 | |||
| 1540 | Ga0268266_10088365 | |||
| 1541 | Ga0268266_10239766 | |||
| 1542 | Ga0268265_10063302 | |||
| 1543 | Ga0268265_10073429 | |||
| 1544 | Ga0268265_10077006 | |||
| 1545 | Ga0268264_10134481 | |||
| 1546 | Ga0268264_10262584 | |||
| 1547 | Ga0268264_10353858 | |||
| 1548 | Ga0265326_10038791 | |||
| 1549 | Ga0265323_10002280 | |||
| 1550 | Ga0265336_10000093 | |||
| 1551 | Ga0307517_10000008 | |||
| 1552 | Ga0265338_10000078 | |||
| 1553 | Ga0265324_10002197 | |||
| 1554 | Ga0265332_10000391 | |||
| 1555 | Ga0265332_10019628 | |||
| 1556 | Ga0265332_10099969 | |||
| 1557 | Ga0265325_10005389 | |||
| 1558 | Ga0265325_10129919 | |||
| 1559 | Ga0265340_10000390 | |||
| 1560 | Ga0265339_10000861 | |||
| 1561 | Ga0265339_10002237 | |||
| 1562 | Ga0265331_10009051 | |||
| 1563 | Ga0265316_10198655 | |||
| 1564 | Ga0265316_10303191 | |||
| 1565 | Ga0307513_10177284 | |||
| 1566 | Ga0307509_10010585 | |||
| 1567 | Ga0307509_10307918 | |||
| 1568 | Ga0265313_10039367 | |||
| 1569 | Ga0265313_10066159 | |||
| 1570 | Ga0316575_10035097 | |||
| 1571 | Ga0316579_10100236 | |||
| 1572 | Ga0265314_10002400 | |||
| 1573 | Ga0265314_10160904 | |||
| 1574 | Ga0265342_10000069 | |||
| 1575 | Ga0265342_10005077 | |||
| 1576 | Ga0265342_10030151 | |||
| 1577 | Ga0265342_10100432 | |||
| 1578 | Ga0307516_10012122 | |||
| 1579 | Ga0307516_10082323 | |||
| 1580 | Ga0307411_10251467 | |||
| 1581 | Ga0316583_10017748 | |||
| 1582 | Ga0316593_10036170 | |||
| 1583 | Ga0307510_10003985 | |||
| 1584 | Ga0307510_10255048 | |||
| 1585 | Ga0315911_1000002 | |||
| 1586 | Ga0373930_0001167 | |||
| 1587 | Ga0373948_0000190 | |||
| 1588 | Ga0373950_0000342 | |||
| 1589 | Ga0373958_0000055 | |||
| 1590 | Ga0373928_0000361 | |||
| 1591 | Ga0373928_0018372 | |||
| 1592 | Ga0373928_0027697 | |||
| 1593 | Ga0373929_0000927 | |||
| 1594 | Ga0373940_0000594 | |||
| 1595 | Ga0373940_0025403 | |||
| 1596 | Ga0373949_0000308 | |||
| 1597 | Ga0373951_0000393 | |||
| 1598 | Ga0373951_0039868 | |||
| 1599 | Ga0373952_0000208 | |||
| 1600 | Ga0373923_0001249 | |||
| 1601 | Ga0373923_0040453 | |||
| 1602 | Ga0373932_0000031 | |||
| 1603 | Ga0373932_0016969 | |||
| 1604 | Ga0373936_0001314 | |||
| 1605 | Ga0373939_0000083 | |||
| 1606 | Ga0373939_0016703 | |||
| 1607 | Ga0373941_0000540 | |||
| 1608 | Ga0373945_0002176 | |||
| 1609 | Ga0373945_0026639 | |||
| 1610 | Ga0373945_0069082 | |||
| 1611 | Ga0373945_0112619 | |||
| 1612 | Ga0373953_0008626 | |||
| 1613 | Ga0373954_0000584 | |||
| 1614 | Ga0373954_0028214 | |||
| 1615 | Ga0373956_0034939 | |||
| 1616 | Ga0373957_0036851 | |||
| 1617 | Ga0373960_0000088 | |||
| 1618 | Ga0373960_0002807 | |||
| 1619 | Ga0373943_0001654 | |||
| 1620 | Ga0373943_0043060 | |||
| 1621 | Ga0373943_0072058 | |||
| 1622 | Ga0373946_0000997 | |||
| 1623 | Ga0373955_0000576 | |||
| 1624 | Ga0373955_0003175 | |||
| 1625 | Ga0373942_0013490 | |||
| 1626 | Ga0373961_0000539 | |||
| 1627 | Ga0373962_0000715 | |||
| 1628 | Ga0373924_0000447 | |||
| 1629 | Ga0373924_0003919 | |||
| 1630 | Ga0373924_0026279 | |||
| 1631 | Ga0373931_0001752 | |||
| 1632 | Ga0373931_0075357 | |||
| 1633 | Ga0373931_0094573 | |||
| 1634 | Ga0373931_0124161 | |||
| 1635 | Ga0373935_0000013 | |||
| 1636 | Ga0373935_0002637 | |||
| 1637 | Ga0373935_0071495 | |||
| 1638 | Ga0373927_0000488 | |||
| 1639 | Ga0373927_0010805 | |||
| 1640 | Ga0373927_0039297 | |||
| 1641 | Ga0373927_0129181 | |||
| 1642 | Ga0373927_0252430 | |||
| 1643 | Ga0373933_0002241 | |||
| 1644 | Ga0373933_0005665 | |||
| 1645 | Ga0373933_0038644 | |||
| 1646 | Ga0373933_0139803 | |||
| 1647 | Ga0373933_0190263 | |||
| 1648 | Ga0373947_0000484 | |||
| 1649 | Ga0373947_0000909 | |||
| 1650 | Ga0373947_0007264 | |||
| 1651 | Ga0373947_0012470 | |||
| 1652 | Ga0373937_0000018 | |||
| 1653 | Ga0373937_0016044 | |||
| 1654 | Ga0373937_0024143 | |||
| 1655 | Ga0373937_0048025 | |||
| 1656 | Ga0373937_0096258 | |||
| 1657 | Ga0373937_0538274 | |||
| 1658 | Ga0372808_011833 | |||
| 1659 | Ga0316582_0229937 | |||
| 1660 | Ga0316584_0007968 | |||
| 1661 | Ga0373925_0000896 | |||
| 1662 | Ga0373925_0002872 | |||
| 1663 | Ga0373925_0032887 | |||
| 1664 | Ga0373925_0150187 | |||
| 1665 | Ga0373925_0179012 | |||
| 1666 | Ga0373925_0370014 | |||
| 1667 | Ga0395900_0001158 | |||
| 1668 | Ga0395900_0088154 | |||
| 1669 | Ga0395900_0574378 | |||
| 1670 | Ga0395898_0003218 | |||
| 1671 | Ga0395898_0022642 | |||
| 1672 | Ga0395898_0193403 | |||
| 1673 | Ga0395905_0030699 | |||
| 1674 | Ga0395905_0222138 | |||
| 1675 | Ga0395905_0383062 | |||
| 1676 | Ga0436364_0938988 | |||
| 1677 | Ga0436364_1251487 | |||
| 1678 | Ga0395901_0059296 | |||
| 1679 | Ga0395901_0316902 | |||
| 1680 | Ga0400486_16168 | |||
| 1681 | Ga0242420_007407 | |||
| 1682 | Ga0436365_0557891 | |||
| 1683 | Ga0436365_1114261 | |||
| 1684 | Ga0436365_1219888 | |||
| 1685 | Ga0436365_1228844 | |||
| 1686 | Ga0436360_0417248 | |||
| 1687 | Ga0436360_1229051 | |||
| 1688 | Ga0436361_0481193 | |||
| 1689 | Ga0436361_0577046 | |||
| 1690 | Ga0436363_0278638 | |||
| 1691 | Ga0436362_0369849 | |||
| 1692 | Ga0436362_0829767 | |||
| 1693 | Ga0439453_0003758 | |||
| 1694 | Ga0439465_0013932 | |||
| 1695 | Ga0439465_0020626 | |||
| 1696 | Ga0451797_1253850 | |||
| 1697 | Ga0450908_024028 | |||
| 1698 | Ga0439464_0069422 | |||
| 1699 | Ga0451577_0072394 | |||
| 1700 | Ga0451577_0237373 | |||
| 1701 | Ga0466972_0000419 | |||
| 1702 | Ga0453683_0096822 | |||
| 1703 | Ga0466966_0001368 | |||
| 1704 | Ga0466961_0000039 | |||
| 1705 | Ga0466963_0066247 | |||
| 1706 | Ga0466963_0166127 | |||
| 1707 | Ga0466963_0191441 | |||
| 1708 | Ga0466964_0055788 | |||
| 1709 | Ga0453684_0114476 | |||
| 1710 | Ga0453684_0270454 | |||
| 1711 | Ga0466957_0180088 | |||
| 1712 | Ga0466959_0000475 | |||
| 1713 | Ga0466959_0208126 | |||
| 1714 | Ga0451576_0012930 | |||
| 1715 | Ga0466958_0121334 | |||
| 1716 | Ga0466967_0022137 | |||
| 1717 | Ga0466967_0115196 | |||
| 1718 | Ga0466967_0450182 | |||
| 1719 | Ga0495617_002893 | |||
| 1720 | Ga0495592_0000055 | |||
| 1721 | Ga0495592_0009800 | |||
| 1722 | Ga0495592_0021019 | |||
| 1723 | Ga0495603_0007773 | |||
| 1724 | Ga0495603_0009558 | |||
| 1725 | Ga0495603_0026454 | |||
| 1726 | Ga0495603_0178961 | |||
| 1727 | Ga0495629_0000483 | |||
| 1728 | Ga0495629_0002536 | |||
| 1729 | Ga0495629_0004445 | |||
| 1730 | Ga0495629_0007768 | |||
| 1731 | Ga0495629_0050362 | |||
| 1732 | Ga0495629_0120987 | |||
| 1733 | Ga0495638_0007368 | |||
| 1734 | Ga0495638_0011405 | |||
| 1735 | Ga0495638_0056814 | |||
| 1736 | Ga0495638_0083467 | |||
| 1737 | Ga0495651_0003462 | |||
| 1738 | Ga0495651_0017612 | |||
| 1739 | Ga0495653_0000003 | |||
| 1740 | Ga0495653_0094190 | |||
| 1741 | Ga0495650_0091876 | |||
| 1742 | Ga0495580_0000574 | |||
| 1743 | Ga0495580_0037871 | |||
| 1744 | Ga0495580_0283537 | |||
| 1745 | Ga0495580_0323402 | |||
| 1746 | Ga0495582_0000221 | |||
| 1747 | Ga0495582_0045875 | |||
| 1748 | Ga0495582_0124651 | |||
| 1749 | Ga0495605_0022132 | |||
| 1750 | Ga0495639_0000308 | |||
| 1751 | Ga0495639_0013560 | |||
| 1752 | Ga0495639_0071795 | |||
| 1753 | Ga0495662_0005681 | |||
| 1754 | Ga0495662_0010612 | |||
| 1755 | Ga0495662_0077205 | |||
| 1756 | Ga0495662_0124665 | |||
| 1757 | Ga0495664_0000001 | |||
| 1758 | Ga0495664_0014767 | |||
| 1759 | Ga0495594_0000259 | |||
| 1760 | Ga0495606_0113683 | |||
| 1761 | Ga0495608_0000012 | |||
| 1762 | Ga0495608_0002889 | |||
| 1763 | Ga0495618_0000012 | |||
| 1764 | Ga0495618_0085758 | |||
| 1765 | Ga0495628_0000003 | |||
| 1766 | Ga0495628_0069061 | |||
| 1767 | Ga0495630_0000188 | |||
| 1768 | Ga0495630_0054668 | |||
| 1769 | Ga0495630_0073613 | |||
| 1770 | Ga0495630_0141134 | |||
| 1771 | Ga0495631_0068255 | |||
| 1772 | Ga0495631_0075272 | |||
| 1773 | Ga0495632_0116247 | |||
| 1774 | Ga0495632_0143070 | |||
| 1775 | Ga0495643_0019473 | |||
| 1776 | Ga0495643_0047580 | |||
| 1777 | Ga0495648_0001181 | |||
| 1778 | Ga0495648_0110024 | |||
| 1779 | Ga0495652_0000001 | |||
| 1780 | Ga0495652_0101714 | |||
| 1781 | Ga0495652_0117450 | |||
| 1782 | Ga0495665_0000153 | |||
| 1783 | Ga0495665_0098793 | |||
| 1784 | Ga0495640_0000022 | |||
| 1785 | Ga0495640_0000198 | |||
| 1786 | Ga0495640_0030412 | |||
| 1787 | Ga0495587_0000003 | |||
| 1788 | Ga0495587_0032568 | |||
| 1789 | Ga0495587_0181383 | |||
| 1790 | Ga0495609_0090080 | |||
| 1791 | Ga0495621_0035088 | |||
| 1792 | Ga0495597_0104745 | |||
| 1793 | Ga0495645_0000004 | |||
| 1794 | Ga0495645_0143142 | |||
| 1795 | Ga0495622_0045301 | |||
| 1796 | Ga0495622_0114108 | |||
| 1797 | Ga0495633_0053559 | |||
| 1798 | Ga0495667_0000001 | |||
| 1799 | Ga0495667_0006893 | |||
| 1800 | Ga0495667_0294717 | |||
| 1801 | Ga0495656_0150828 | |||
| 1802 | Ga0495656_0173365 | |||
| 1803 | Ga0495656_0206282 | |||
| 1804 | Ga0495634_0000012 | |||
| 1805 | Ga0495634_0012406 | |||
| 1806 | Ga0495634_0012733 | |||
| 1807 | Ga0495634_0148423 | |||
| 1808 | Ga0495625_0101485 | |||
| 1809 | Ga0495625_0110129 | |||
| 1810 | Ga0495625_0184149 | |||
| 1811 | Ga0495635_0000011 | |||
| 1812 | Ga0495635_0001940 | |||
| 1813 | Ga0495661_0009514 | |||
| 1814 | Ga0495588_0008766 | |||
| 1815 | Ga0495657_0000086 | |||
| 1816 | Ga0495657_0102405 | |||
| 1817 | Ga0495599_0000004 | |||
| 1818 | Ga0495599_0005293 | |||
| 1819 | Ga0495599_0160036 | |||
| 1820 | Ga0495623_0000308 | |||
| 1821 | Ga0495623_0088670 | |||
| 1822 | Ga0495623_0123981 | |||
| 1823 | Ga0495646_0000010 | |||
| 1824 | Ga0495646_0015302 | |||
| 1825 | Ga0495646_0133121 | |||
| 1826 | Ga0495646_0136578 | |||
| 1827 | Ga0495647_0100928 | |||
| 1828 | Ga0495658_0027938 | |||
| 1829 | Ga0495613_0000393 | |||
| 1830 | Ga0495613_0047531 | |||
| 1831 | Ga0495613_0068120 | |||
| 1832 | Ga0495624_0000182 | |||
| 1833 | Ga0495624_0016464 | |||
| 1834 | Ga0495624_0173605 | |||
| 1835 | Ga0495670_0001025 | |||
| 1836 | Ga0495670_0184058 | |||
| 1837 | Ga0495649_0018770 | |||
| 1838 | Ga0495589_0055230 | |||
| 1839 | Ga0495600_0000026 | |||
| 1840 | Ga0495600_0005897 | |||
| 1841 | Ga0495581_0003469 | |||
| 1842 | Ga0495581_0057297 | |||
| 1843 | Ga0495604_0000010 | |||
| 1844 | Ga0495604_0149123 | |||
| 1845 | Ga0495674_0000001 | |||
| 1846 | Ga0495674_0018083 | |||
| 1847 | Ga0495674_0018464 | |||
| 1848 | Ga0495674_0038322 | |||
| 1849 | Ga0495672_0003613 | |||
| 1850 | Ga0495672_0037293 | |||
| 1851 | Ga0495676_0055244 | |||
| 1852 | Ga0495680_0002781 | |||
| 1853 | Ga0495680_0021273 | |||
| 1854 | Ga0495680_0082168 | |||
| 1855 | Ga0495683_0045665 | |||
| 1856 | Ga0495675_0000009 | |||
| 1857 | Ga0495675_0005020 | |||
| 1858 | Ga0495685_026257 | |||
| 1859 | Ga0495673_0080248 | |||
| 1860 | Ga0495684_0000005 | |||
| 1861 | Ga0495684_0003481 | |||
| 1862 | Ga0495684_0261469 | |||
| 1863 | Ga0495686_0079166 | |||
| 1864 | Ga0495686_0119455 | |||
| 1865 | Ga0495686_0144702 | |||
| 1866 | Ga0495593_0000477 | |||
| 1867 | Ga0495593_0005153 | |||
| 1868 | Ga0495593_0111404 | |||
| 1869 | Ga0495602_0000002 | |||
| 1870 | Ga0495602_0104383 | |||
| 1871 | Ga0495614_0023408 | |||
| 1872 | Ga0496100_0088875 | |||
| 1873 | Ga0496100_0133001 | |||
| 1874 | Ga0496100_0249260 | |||
| 1875 | Ga0496101_0016561 | |||
| 1876 | Ga0496101_0128103 | |||
| 1877 | Ga0496101_0180121 | |||
| 1878 | Ga0496101_0188481 | |||
| 1879 | Ga0496102_0028619 | |||
| 1880 | Ga0496102_0066565 | |||
| 1881 | Ga0496102_0267163 | |||
| 1882 | Ga0496102_0349366 | |||
| 1883 | Ga0496103_0029860 | |||
| 1884 | Ga0496104_0157097 | |||
| 1885 | Ga0496104_0228073 | |||
| 1886 | Ga0496104_0486245 | |||
| 1887 | Ga0496105_0006604 | |||
| 1888 | Ga0496105_0103876 | |||
| 1889 | Ga0496105_0142335 | |||
| 1890 | Ga0496105_0173247 | |||
| 1891 | Ga0496105_0292765 | |||
| 1892 | Ga0496106_0009365 | |||
| 1893 | Ga0496106_0090143 | |||
| 1894 | Ga0496106_0152744 | |||
| 1895 | Ga0496106_0179341 | |||
| 1896 | Ga0496106_0271478 | |||
| 1897 | Ga0496107_0002191 | |||
| 1898 | Ga0496107_0119448 | |||
| 1899 | Ga0496108_0000708 | |||
| 1900 | Ga0496109_0000492 | |||
| 1901 | Ga0496109_0033027 | |||
| 1902 | Ga0496109_0039372 | |||
| 1903 | Ga0496109_0132396 | |||
| 1904 | Ga0496109_0149211 | |||
| 1905 | Ga0496109_0297644 | |||
| 1906 | Ga0496110_0002285 | |||
| 1907 | Ga0496110_0177921 | |||
| 1908 | Ga0496110_0202220 | |||
| 1909 | Ga0496110_0215067 | |||
| 1910 | Ga0496110_0241769 | |||
| 1911 | Ga0496110_0280193 | |||
| 1912 | Ga0496110_0363651 | |||
| 1913 | Ga0496110_0450493 | |||
| 1914 | Ga0496110_0472088 | |||
| 1915 | Ga0496111_0064774 | |||
| 1916 | Ga0496111_0119912 | |||
| 1917 | Ga0496112_0000004 | |||
| 1918 | Ga0496112_0000640 | |||
| 1919 | Ga0496112_0011710 | |||
| 1920 | Ga0496112_0035404 | |||
| 1921 | Ga0496112_0156639 | |||
| 1922 | Ga0496112_0188649 | |||
| 1923 | Ga0496112_0193334 | |||
| 1924 | Ga0496112_0400913 | |||
| 1925 | Ga0496113_0249710 | |||
| 1926 | Ga0496113_0429421 | |||
| 1927 | Ga0496114_0085873 | |||
| 1928 | Ga0496114_0217568 | |||
| 1929 | Ga0496115_0000809 | |||
| 1930 | Ga0496115_0022927 | |||
| 1931 | Ga0496115_0054692 | |||
| 1932 | Ga0496115_0181113 | |||
| 1933 | Ga0496115_0214884 | |||
| 1934 | Ga0496115_0310632 | |||
| 1935 | Ga0496116_0001285 | |||
| 1936 | Ga0496116_0053261 | |||
| 1937 | Ga0496117_0008638 | |||
| 1938 | Ga0496117_0024531 | |||
| 1939 | Ga0496117_0032896 | |||
| 1940 | Ga0496117_0050664 | |||
| 1941 | Ga0496117_0128533 | |||
| 1942 | Ga0496118_0006900 | |||
| 1943 | Ga0496118_0032426 | |||
| 1944 | Ga0496118_0048585 | |||
| 1945 | Ga0496118_0053291 | |||
| 1946 | Ga0496118_0053638 | |||
| 1947 | Ga0496118_0079978 | |||
| 1948 | Ga0496118_0120214 | |||
| 1949 | Ga0496119_0058548 | |||
| 1950 | Ga0496120_0102879 | |||
| 1951 | Ga0496121_0000657 | |||
| 1952 | Ga0496121_0003593 | |||
| 1953 | Ga0496121_0014000 | |||
| 1954 | Ga0496121_0014712 | |||
| 1955 | Ga0496121_0030767 | |||
| 1956 | Ga0496121_0085561 | |||
| 1957 | Ga0496121_0160023 | |||
| 1958 | Ga0496121_0253611 | |||
| 1959 | Ga0496122_0010073 | |||
| 1960 | Ga0496123_0013538 | |||
| 1961 | Ga0496123_0081760 | |||
| 1962 | Ga0496123_0162447 | |||
| 1963 | Ga0496124_0003765 | |||
| 1964 | Ga0496124_0073925 | |||
| 1965 | Ga0496124_0210217 | |||
| 1966 | Ga0496125_0000060 | |||
| 1967 | Ga0496125_0002052 | |||
| 1968 | Ga0496125_0009244 | |||
| 1969 | Ga0496125_0054576 | |||
| 1970 | Ga0496125_0257962 | |||
| 1971 | Ga0496126_0005780 | |||
| 1972 | Ga0496126_0019689 | |||
| 1973 | Ga0496126_0039266 | |||
| 1974 | Ga0496126_0089065 | |||
| 1975 | Ga0496126_0090864 | |||
| 1976 | Ga0496126_0099502 | |||
| 1977 | Ga0496126_0194638 | |||
| 1978 | Ga0496126_0362609 | |||
| 1979 | Ga0495682_0031778 | |||
| 1980 | Ga0501031_0013588 | |||
| 1981 | Ga0501032_0000224 | |||
| 1982 | Ga0501032_0138800 | |||
| 1983 | Ga0501033_0000095 | |||
| 1984 | Ga0501033_0002865 | |||
| 1985 | Ga0501033_0023602 | |||
| 1986 | Ga0501034_0001937 | |||
| 1987 | Ga0501034_0083651 | |||
| 1988 | Ga0501034_0101445 | |||
| 1989 | Ga0501034_0252743 | |||
| 1990 | Ga0501036_0000007 | |||
| 1991 | Ga0501036_0032365 | |||
| 1992 | Ga0501036_0045888 | |||
| 1993 | Ga0501037_0000159 | |||
| 1994 | Ga0501037_0001255 | |||
| 1995 | Ga0501037_0051617 | |||
| 1996 | Ga0501038_0000028 | |||
| 1997 | Ga0501038_0075917 | |||
| 1998 | Ga0501038_0228141 | |||
| 1999 | Ga0501038_0299425 | |||
| 2000 | Ga0501039_0000005 | |||
| 2001 | Ga0501039_0007262 | |||
| 2002 | Ga0501039_0063159 | |||
| 2003 | Ga0501039_0167739 | |||
| 2004 | Ga0501040_0031332 | |||
| 2005 | Ga0501041_0077092 | |||
| 2006 | Ga0501042_0055621 | |||
| 2007 | Ga0501042_0122758 | |||
| 2008 | Ga0501043_0000127 | |||
| 2009 | Ga0501043_0004021 | |||
| 2010 | Ga0501043_0066534 | |||
| 2011 | Ga0501043_0076681 | |||
| 2012 | Ga0501046_0000032 | |||
| 2013 | Ga0501046_0004507 | |||
| 2014 | Ga0501046_0091031 | |||
| 2015 | Ga0501047_0000077 | |||
| 2016 | Ga0501047_0158155 | |||
| 2017 | Ga0501048_0002484 | |||
| 2018 | Ga0501048_0226392 | |||
| 2019 | Ga0501067_0012929 | |||
| 2020 | Ga0501067_0019283 | |||
| 2021 | Ga0501068_0000392 | |||
| 2022 | Ga0501068_0073311 | |||
| 2023 | Ga0501069_0013965 | |||
| 2024 | Ga0501071_0366733 | |||
| 2025 | Ga0501072_0007925 | |||
| 2026 | Ga0501072_0042318 | |||
| 2027 | Ga0501072_0075277 | |||
| 2028 | Ga0501072_0134005 | |||
| 2029 | Ga0501073_0002575 | |||
| 2030 | Ga0501073_0141583 | |||
| 2031 | Ga0501074_0014705 | |||
| 2032 | Ga0501074_0090568 | |||
| 2033 | Ga0501074_0215102 | |||
| 2034 | Ga0501077_0026999 | |||
| 2035 | Ga0501077_0028401 | |||
| 2036 | Ga0501077_0131094 | |||
| 2037 | Ga0501079_0010982 | |||
| 2038 | Ga0501079_0012378 | |||
| 2039 | Ga0501079_0185177 | |||
| 2040 | Ga0501080_0000035 | |||
| 2041 | Ga0501080_0159720 | |||
| 2042 | Ga0501081_0034327 | |||
| 2043 | Ga0501083_0010008 | |||
| 2044 | Ga0501083_0038877 | |||
| 2045 | Ga0501035_0000016 | |||
| 2046 | Ga0501035_0088462 | |||
| 2047 | Ga0501044_0000184 | |||
| 2048 | Ga0501044_0019527 | |||
| 2049 | Ga0501044_0036695 | |||
| 2050 | Ga0501044_0177561 | |||
| 2051 | Ga0501044_0198697 | |||
| 2052 | Ga0501044_0238411 | |||
| 2053 | Ga0501045_0044622 | |||
| 2054 | Ga0501045_0044659 | |||
| 2055 | nmdc:mga03n38_112485_c1 | |||
| 2056 | nmdc:mga03n38_38778_c1 | |||
| 2057 | nmdc:mga03n38_4281_c1 | |||
| 2058 | nmdc:mga00v17_120748_c1 | |||
| 2059 | nmdc:mga00v17_268237_c1 | |||
| 2060 | nmdc:mga00v17_38195_c1 | |||
| 2061 | nmdc:mga00v17_48575_c1 | |||
| 2062 | nmdc:mga0yw44_152498_c1 | |||
| 2063 | nmdc:mga0yw44_19478_c1 | |||
| 2064 | nmdc:mga0yw44_297428_c1 | |||
| 2065 | nmdc:mga0yw44_29988_c1 | |||
| 2066 | nmdc:mga06z11_32988_c1 | |||
| 2067 | nmdc:mga06z11_88350_c1 | |||
| 2068 | nmdc:mga06z11_89326_c1 | |||
| 2069 | nmdc:mga07m45_10244_c1 | |||
| 2070 | nmdc:mga07m45_179337_c1 | |||
| 2071 | nmdc:mga07m45_71182_c1 | |||
| 2072 | nmdc:mga05p37_758271_c1 | |||
| 2073 | nmdc:mga08y16_436163_c1 | |||
| 2074 | nmdc:mga08y16_7344_c1 | |||
| 2075 | nmdc:mga0n895_30715_c1 | |||
| 2076 | nmdc:mga0n895_70992_c1 | |||
| 2077 | nmdc:mga0rr50_250823_c1 | |||
| 2078 | nmdc:mga0rr50_58971_c1 | |||
| 2079 | nmdc:mga0a205_30358_c1 | |||
| 2080 | nmdc:mga0a205_31359_c1 | |||
| 2081 | nmdc:mga0sz30_18356_c2 | |||
| 2082 | nmdc:mga0sz30_7678_c1 | |||
| 2083 | Ga0495601_0000003 | |||
| 2084 | Ga0495601_0009067 | |||
| 2085 | Ga0495601_0107109 | |||
| 2086 | Ga0495601_0194603 | |||
| 2087 | Ga0495601_0211776 | |||
| 2088 | Ga0495601_0231253 | |||
| 2089 | Ga0495612_0000007 | |||
| 2090 | Ga0495612_0003765 | |||
| 2091 | Ga0495612_0043763 | |||
| 2092 | Ga0500635_0004031 | |||
| 2093 | Ga0495595_0000183 | |||
| 2094 | Ga0495595_0013588 | |||
| 2095 | Ga0495619_0000009 | |||
| 2096 | Ga0495619_0002660 | |||
| 2097 | Ga0495619_0004943 | |||
| 2098 | Ga0500643_000007 | |||
| 2099 | Ga0500644_0011143 | |||
| 2100 | Ga0500646_0020369 | |||
| 2101 | Ga0500583_0015980 | |||
| 2102 | Ga0500651_0014968 | |||
| 2103 | Ga0500651_0113888 | |||
| 2104 | Ga0500566_0000049 | |||
| 2105 | Ga0500566_0000483 | |||
| 2106 | Ga0500566_0013269 | |||
| 2107 | Ga0500566_0016932 | |||
| 2108 | Ga0500640_016974 | |||
| 2109 | Ga0500641_0073877 | |||
| 2110 | Ga0500650_0000551 | |||
| 2111 | Ga0500650_0061657 | |||
| 2112 | Ga0500554_000388 | |||
| 2113 | Ga0500554_021338 | |||
| 2114 | Ga0500555_002067 | |||
| 2115 | Ga0500555_007043 | |||
| 2116 | Ga0500556_0000002 | |||
| 2117 | Ga0500556_0002448 | |||
| 2118 | Ga0500569_008989 | |||
| 2119 | Ga0500572_000123 | |||
| 2120 | Ga0500572_000651 | |||
| 2121 | Ga0500593_010627 | |||
| 2122 | Ga0500595_000418 | |||
| 2123 | Ga0500595_000632 | |||
| 2124 | Ga0500595_000646 | |||
| 2125 | Ga0500595_003294 | |||
| 2126 | Ga0500608_002577 | |||
| 2127 | Ga0500614_002655 | |||
| 2128 | Ga0500618_006438 | |||
| 2129 | Ga0500642_0000016 | |||
| 2130 | Ga0500642_0002422 | |||
| 2131 | Ga0500642_0024781 | |||
| 2132 | Ga0500658_0003908 | |||
| 2133 | Ga0500658_0023685 | |||
| 2134 | Ga0500658_0061348 | |||
| 2135 | Ga0500559_0000184 | |||
| 2136 | Ga0500559_0000654 | |||
| 2137 | Ga0500568_0007988 | |||
| 2138 | Ga0500568_0021010 | |||
| 2139 | Ga0500568_0030430 | |||
| 2140 | Ga0500585_102195 | |||
| 2141 | Ga0500588_0051072 | |||
| 2142 | Ga0500590_027963 | |||
| 2143 | Ga0500603_000031 | |||
| 2144 | Ga0500604_0060029 | |||
| 2145 | Ga0500616_0000034 | |||
| 2146 | Ga0500616_0000061 | |||
| 2147 | Ga0500616_0054379 | |||
| 2148 | Ga0500620_071161 | |||
| 2149 | Ga0500622_0000668 | |||
| 2150 | Ga0500622_0046928 | |||
| 2151 | Ga0500622_0068809 | |||
| 2152 | Ga0500627_0044108 | |||
| 2153 | Ga0500627_0071999 | |||
| 2154 | Ga0500630_000330 | |||
| 2155 | Ga0500634_0027470 | |||
| 2156 | Ga0500638_000100 | |||
| 2157 | Ga0500639_000020 | |||
| 2158 | Ga0500639_117100 | |||
| 2159 | Ga0500636_0000014 | |||
| 2160 | Ga0500636_0004292 | |||
| 2161 | Ga0500636_0039319 | |||
| 2162 | Ga0500637_0000845 | |||
| 2163 | Ga0500637_0022675 | |||
| 2164 | Ga0500645_006589 | |||
| 2165 | Ga0500596_001238 | |||
| 2166 | Ga0500596_001798 | |||
| 2167 | Ga0500599_001747 | |||
| 2168 | Ga0500601_000055 | |||
| 2169 | Ga0501084_0013511 | |||
| 2170 | Ga0501084_0038572 | |||
| 2171 | Ga0501084_0400044 | |||
| 2172 | Ga0500661_002374 | |||
| 2173 | Ga0501082_0000053 | |||
| 2174 | Ga0501082_0254020 | |||
| 2175 | Ga0466962_0026287 | |||
| 2176 | Ga0530510_0007668 | |||
| 2177 | Ga0530510_0206531 | |||
| 2178 | 2508692033 | |||
| 2179 | 2509151425 | |||
| 2180 | 2513656988 | |||
| 2181 | 2513696791 | |||
| 2182 | 2513722142 | |||
| 2183 | 2513855427 | |||
| 2184 | 2513873227 | |||
| 2185 | 2513889946 | |||
| 2186 | 2513918728 | |||
| 2187 | 2514015788 | |||
| 2188 | 2517891976 | |||
| 2189 | 2524470208 | |||
| 2190 | 2524534040 | |||
| 2191 | 2603856833 | |||
| 2192 | 2671121985 | |||
| 2193 | 2723846644 | |||
| 2194 | 2728753092 | |||
| 2195 | 2793068957 | |||
| 2196 | 2793076596 | |||
| 2197 | 2805914783 | |||
| 2198 | 2824610643 | |||
| 2199 | 2824676423 | |||
| 2200 | 2824687135 | |||
| 2201 | 2824692828 | |||
| 2202 | 2824700309 | |||
| 2203 | 2824756572 | |||
| 2204 | 2824766066 | |||
| 2205 | 2824774513 | |||
| 2206 | 2838123264 | |||
| 2207 | 2841946556 | |||
| 2208 | 2841954215 | |||
| 2209 | 2841961081 | |||
| 2210 | 2841969590 | |||
| 2211 | 2841974526 | |||
| 2212 | 2841983911 | |||
| 2213 | 2847947018 | |||
| 2214 | 2857515991 | |||
| 2215 | 2857528310 | |||
| 2216 | 2874605669 | |||
| 2217 | 2876770378 | |||
| 2218 | 2876814710 | |||
| 2219 | 2879108472 | |||
| 2220 | 2879115953 | |||
| 2221 | 2885391267 | |||
| 2222 | 2889041203 | |||
| 2223 | 2903750186 | |||
| 2224 | 2903776912 | |||
| 2225 | 2904694966 | |||
| 2226 | 2904704080 | |||
| 2227 | 2904715203 | |||
| 2228 | 2906617096 | |||
| 2229 | 2906643203 | |||
| 2230 | 2906662365 | |||
| 2231 | 2908742243 | |||
| 2232 | 2908759894 | |||
| 2233 | 2919075738 | |||
| 2234 | 2922365848 | |||
| 2235 | 2922391393 | |||
| 2236 | 2922394488 | |||
| 2237 | 2922430748 | |||
| 2238 | 2932800821 | |||
| 2239 | 2932809318 | |||
| 2240 | 2932812901 | |||
| 2241 | 2932819008 | |||
| 2242 | 2935636442 | |||
| 2243 | 2935650831 | |||
| 2244 | 2935659012 | |||
| 2245 | 2935768166 | |||
| 2246 | 2935885895 | |||
| 2247 | 2935960905 | |||
| 2248 | 2936013427 | |||
| 2249 | 2936022446 | |||
| 2250 | 2936030892 | |||
| 2251 | 2936048705 | |||
| 2252 | 2936058919 | |||
| 2253 | 2941509848 | |||
| 2254 | 2941520908 | |||
| 2255 | 2941525247 | |||
| 2256 | 2941533293 | |||
| 2257 | 2995393341 | |||
| 2258 | 3005480655 | |||
| 2259 | 3005484756 | |||
| 2260 | 3005507501 | |||
| 2261 | 3005715370 | |||
| 2262 | 8006940115 | |||
| 2263 | 8006971736 | |||
| 2264 | 8006979897 | |||
| 2265 | 8006987792 | |||
| 2266 | 8007000789 | |||
| 2267 | 8016626071 | |||
| 2268 | 8016639849 | |||
| 2269 | 8019553163 | |||
| 2270 | 8019556090 | |||
| 2271 | 8019569217 | |||
| 2272 | 8056677017 | |||
| 2273 | 8056689312 | |||
| 2274 | 8056692166 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3b0u-assembly2.cif.gz_Y | trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment | 0.9562 | 1 | 308 |
| 3b0p-assembly1.cif.gz_A | trna-dihydrouridine synthase from thermus thermophilus | 0.9513 | 1 | 308 |
| 3b0u-assembly2.cif.gz_Y | trna-dihydrouridine synthase from thermus thermophilus in complex with trna fragment | 0.9203 | 1 | 308 |
| 3b0p-assembly1.cif.gz_A | trna-dihydrouridine synthase from thermus thermophilus | 0.8999 | 1 | 308 |
| 6ei9-assembly2.cif.gz_B | crystal structure of e. coli trna-dihydrouridine synthase b (dusb) | 0.7675 | 2 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b0uX01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9594 | 1 | 234 | 3.20.20.70 |
| af_Q8I2W5_196_470_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9512 | 1 | 233 | 3.20.20.70 |
| af_A0A1D6EEF2_139_379_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9469 | 1 | 225 | 3.20.20.70 |
| 3b0uX01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9212 | 1 | 234 | 3.20.20.70 |
| af_Q54ES7_56_285_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8916 | 1 | 226 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F7M5Y3-F1-model_v4 | tRNA-dihydrouridine(20/20a) synthase (EC 1.3.1.91) (U20-specific dihydrouridine synthase) (U20-specific Dus) (tRNA-dihydrouridine synthase A) | 0.9761 | 12 | 309 |
GO:0000049
GO:0010181 GO:0050660 GO:0102264 GO:0102266 |
| AF-A0A451BM42-F1-model_v4 | tRNA-dihydrouridine(20/20a) synthase (EC 1.3.1.91) (U20-specific dihydrouridine synthase) (U20-specific Dus) (tRNA-dihydrouridine synthase A) | 0.9759 | 5 | 308 |
GO:0000049
GO:0010181 GO:0050660 GO:0102264 GO:0102266 |
| AF-A0A657AG67-F1-model_v4 | tRNA dihydrouridine synthase DusA | 0.9756 | 16 | 312 |
GO:0000049
GO:0017150 GO:0050660 |
| AF-V4NXK6-F1-model_v4 | tRNA-dihydrouridine synthase (EC 1.3.1.-) | 0.9755 | 28 | 309 |
GO:0000049
GO:0017150 GO:0050660 |
| AF-A0A257KLM2-F1-model_v4 | tRNA-dihydrouridine(20/20a) synthase (EC 1.3.1.91) (U20-specific dihydrouridine synthase) (U20-specific Dus) (tRNA-dihydrouridine synthase A) | 0.9749 | 1 | 312 |
GO:0000049
GO:0010181 GO:0050660 GO:0102264 GO:0102266 |