F490648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1137 | 432 | 2274 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300044672|Ga0466982_0000040|Ga0466982_0000040_35719_36549 |
| Length | 276 |
| Sequence | VTKRPEEIALLAASGRLLADVFAHLDRLDLVGMSTLQVNDLVESFIVDGLGARPASKGQYGYAYALNASRNDVVCHGVPSAADVLRSGDIVNFDITLEKHGYIADSSKTYLVGEVDPAARRLVQVTYEAMWKGIEAVRPGARLGDVGHAIERHARRNGYSIVREYCGHGIGREMHEEPQVLHWGKPGTGLMLREGMVFTIEPMLNQGRPAVRTESDGWTVVTRDGRLSAQFEHTVAVTRHGARVLTLRADEKPRSPLTRPQARRASPHDARARHGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 50 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 132 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 146 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 147 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 148 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 149 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 150 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 151 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 277 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 279 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 280 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 282 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 298 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 299 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 300 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 301 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 302 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 303 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 304 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 305 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 306 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 307 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 308 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 309 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 310 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 311 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 312 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 313 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 314 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 315 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 316 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 317 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 318 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 319 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 320 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 321 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 322 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 323 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 324 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 325 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 326 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 327 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 328 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 329 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 330 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 331 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 332 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 333 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 334 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 335 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 336 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 337 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 338 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 339 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 340 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 341 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 342 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 343 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 344 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 345 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 346 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 347 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 348 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 349 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 350 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 351 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 352 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 353 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 354 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 355 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 356 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 357 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 358 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 359 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 360 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 361 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 362 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 363 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 364 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 365 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 366 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 367 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 368 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 369 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 370 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 371 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 372 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 373 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 374 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 375 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 376 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 377 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 378 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 379 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 380 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 381 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 382 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 383 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 384 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 385 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 386 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 387 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 388 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 389 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 390 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 391 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 392 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 393 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 394 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 395 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 396 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 397 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 398 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 399 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 400 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 401 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 402 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 403 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 404 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 405 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 406 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 407 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 408 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 409 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 410 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 411 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 412 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 413 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 414 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 415 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 416 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 417 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 418 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 419 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 420 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 421 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 422 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
| 423 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 424 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 425 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 426 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 427 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 428 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 429 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 430 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 431 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 432 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.1 |
| Metatranscriptomes | 1.93 |
| Isolates | 11.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.18 |
| Nodule | 0.79 |
| Rhizoplane | 4.93 |
| Rhizosphere | 74.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466982_0000040 | 3300044672 | Bacteria | 41234 |
| 2 | JGI24741J21665_1000149 | 3300001915 | Bacteria | 19701 |
| 3 | JGI24740J21852_10003968 | 3300001979 | Bacteria | 6425 |
| 4 | JGI25156J39149_1011038 | 3300002705 | Bacteria | 2073 |
| 5 | JGI25162J39368_1000004 | 3300002737 | Bacteria | 441040 |
| 6 | JGI25162J39368_1003457 | 3300002737 | Bacteria | 4545 |
| 7 | JGI25154J39366_1000359 | 3300002738 | Bacteria | 25837 |
| 8 | JGI25163J39215_1000047 | 3300002771 | Bacteria | 53654 |
| 9 | JGI25164J39214_1000031 | 3300002772 | Bacteria | 144582 |
| 10 | JGI25159J45721_1000757 | 3300002987 | Bacteria | 14011 |
| 11 | JGI25165J46597_1000011 | 3300003214 | Bacteria | 441040 |
| 12 | rootL2_10031707 | 3300003322 | Bacteria | 6903 |
| 13 | Ga0055538_1000123 | 3300003751 | Bacteria | 58939 |
| 14 | Ga0055538_1004657 | 3300003751 | Bacteria | 1523 |
| 15 | Ga0055539_1000073 | 3300003752 | Bacteria | 131094 |
| 16 | Ga0055539_1000167 | 3300003752 | Bacteria | 58939 |
| 17 | Ga0055533_1000171 | 3300003756 | Bacteria | 58939 |
| 18 | Ga0055533_1005112 | 3300003756 | Bacteria | 2187 |
| 19 | Ga0055533_1005878 | 3300003756 | Bacteria | 1903 |
| 20 | Ga0055532_1000090 | 3300003758 | Bacteria | 104391 |
| 21 | Ga0055532_1000159 | 3300003758 | Bacteria | 59066 |
| 22 | Ga0055525_1000232 | 3300003759 | Bacteria | 58939 |
| 23 | Ga0055525_1000383 | 3300003759 | Bacteria | 28771 |
| 24 | Ga0055527_1000479 | 3300003760 | Bacteria | 14726 |
| 25 | Ga0055535_1000085 | 3300003761 | Bacteria | 104391 |
| 26 | Ga0055535_1006235 | 3300003761 | Bacteria | 2455 |
| 27 | Ga0055529_1000134 | 3300003763 | Bacteria | 104391 |
| 28 | Ga0055526_1000007 | 3300003771 | Bacteria | 321998 |
| 29 | Ga0055526_1000116 | 3300003771 | Bacteria | 70518 |
| 30 | Ga0055536_1000014 | 3300003781 | Bacteria | 240624 |
| 31 | Ga0055536_1000820 | 3300003781 | Bacteria | 20498 |
| 32 | Ga0055530_10000126 | 3300003791 | Bacteria | 66675 |
| 33 | Ga0055530_10000182 | 3300003791 | Bacteria | 56371 |
| 34 | Ga0055530_10000529 | 3300003791 | Bacteria | 33175 |
| 35 | Ga0055540_1000566 | 3300003792 | Bacteria | 27221 |
| 36 | Ga0055531_10000165 | 3300003794 | Bacteria | 74768 |
| 37 | Ga0055531_10001146 | 3300003794 | Bacteria | 20498 |
| 38 | Ga0055541_1000112 | 3300003841 | Bacteria | 58923 |
| 39 | Ga0055541_1009305 | 3300003841 | Bacteria | 1525 |
| 40 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 41 | Ga0055543_1002524 | 3300004625 | Bacteria | 5985 |
| 42 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 43 | Ga0065165_1000286 | 3300005262 | Bacteria | 85993 |
| 44 | Ga0065714_10064654 | 3300005288 | Bacteria | 25523 |
| 45 | Ga0065704_10071150 | 3300005289 | Bacteria | 12831 |
| 46 | Ga0065704_10092201 | 3300005289 | Bacteria | 2668 |
| 47 | Ga0065704_10135927 | 3300005289 | Bacteria | 1571 |
| 48 | Ga0065712_10009916 | 3300005290 | Bacteria | 4202 |
| 49 | Ga0070658_10583537 | 3300005327 | Bacteria | 968 |
| 50 | Ga0070670_100000087 | 3300005331 | Bacteria | 88228 |
| 51 | Ga0070670_100001916 | 3300005331 | Bacteria | 17030 |
| 52 | Ga0070660_100511446 | 3300005339 | Bacteria | 999 |
| 53 | Ga0070661_100000141 | 3300005344 | Bacteria | 58825 |
| 54 | Ga0070661_100004776 | 3300005344 | Bacteria | 9328 |
| 55 | Ga0070669_100009854 | 3300005353 | Bacteria | 6806 |
| 56 | Ga0070663_100000034 | 3300005455 | Bacteria | 68516 |
| 57 | Ga0070662_100005950 | 3300005457 | Bacteria | 7824 |
| 58 | Ga0070662_100203365 | 3300005457 | Bacteria | 1572 |
| 59 | Ga0068867_100283963 | 3300005459 | Bacteria | 1358 |
| 60 | Ga0068853_100077825 | 3300005539 | Bacteria | 2898 |
| 61 | Ga0070665_100000335 | 3300005548 | Bacteria | 71847 |
| 62 | Ga0070664_100000044 | 3300005564 | Bacteria | 74926 |
| 63 | Ga0070664_100000057 | 3300005564 | Bacteria | 68516 |
| 64 | Ga0070664_100051154 | 3300005564 | Bacteria | 3498 |
| 65 | Ga0068854_100000937 | 3300005578 | Bacteria | 17545 |
| 66 | Ga0068856_100004528 | 3300005614 | Bacteria | 13821 |
| 67 | Ga0068852_100115207 | 3300005616 | Bacteria | 2450 |
| 68 | Ga0068851_10000752 | 3300005834 | Bacteria | 13928 |
| 69 | Ga0068851_10215765 | 3300005834 | Bacteria | 1076 |
| 70 | Ga0075363_100130804 | 3300006048 | Bacteria | 1407 |
| 71 | Ga0075364_10012986 | 3300006051 | Bacteria | 5111 |
| 72 | Ga0075364_10034882 | 3300006051 | Bacteria | 3249 |
| 73 | Ga0079104_1006764 | 3300006946 | Bacteria | 4263 |
| 74 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 75 | Ga0105251_10003715 | 3300009011 | Bacteria | 10936 |
| 76 | Ga0105251_10005101 | 3300009011 | Bacteria | 8693 |
| 77 | Ga0105251_10013329 | 3300009011 | Bacteria | 4603 |
| 78 | Ga0105251_10039117 | 3300009011 | Bacteria | 2319 |
| 79 | Ga0105251_10055154 | 3300009011 | Bacteria | 1885 |
| 80 | Ga0105244_10000014 | 3300009036 | Bacteria | 257018 |
| 81 | Ga0105244_10000134 | 3300009036 | Bacteria | 75961 |
| 82 | Ga0105244_10002934 | 3300009036 | Bacteria | 12584 |
| 83 | Ga0105244_10015891 | 3300009036 | Bacteria | 4305 |
| 84 | Ga0105244_10050756 | 3300009036 | Bacteria | 2115 |
| 85 | Ga0105244_10206415 | 3300009036 | Bacteria | 925 |
| 86 | Ga0105250_10000661 | 3300009092 | Bacteria | 21815 |
| 87 | Ga0105250_10021366 | 3300009092 | Bacteria | 2613 |
| 88 | Ga0105240_10031977 | 3300009093 | Bacteria | 6815 |
| 89 | Ga0105240_10042292 | 3300009093 | Bacteria | 5807 |
| 90 | Ga0105243_10007675 | 3300009148 | Bacteria | 8287 |
| 91 | Ga0105243_10014001 | 3300009148 | Bacteria | 6069 |
| 92 | Ga0105243_10062782 | 3300009148 | Bacteria | 2975 |
| 93 | Ga0105241_10071225 | 3300009174 | Bacteria | 2698 |
| 94 | Ga0105242_10000661 | 3300009176 | Bacteria | 26974 |
| 95 | Ga0105237_10000116 | 3300009545 | Bacteria | 111312 |
| 96 | Ga0105237_10053888 | 3300009545 | Bacteria | 4032 |
| 97 | Ga0105237_10181195 | 3300009545 | Bacteria | 2107 |
| 98 | Ga0105237_10359267 | 3300009545 | Bacteria | 1461 |
| 99 | Ga0105238_10217878 | 3300009551 | Bacteria | 1885 |
| 100 | Ga0105246_10001733 | 3300011119 | Bacteria | 13031 |
| 101 | Ga0105246_10011605 | 3300011119 | Bacteria | 5469 |
| 102 | Ga0157373_10006159 | 3300013100 | Bacteria | 8970 |
| 103 | Ga0157373_10009246 | 3300013100 | Bacteria | 7287 |
| 104 | Ga0157373_10011962 | 3300013100 | Bacteria | 6376 |
| 105 | Ga0157373_10025897 | 3300013100 | Bacteria | 4238 |
| 106 | Ga0157371_10000323 | 3300013102 | Bacteria | 61980 |
| 107 | Ga0157371_10004329 | 3300013102 | Bacteria | 12448 |
| 108 | Ga0157370_10000038 | 3300013104 | Bacteria | 135182 |
| 109 | Ga0157370_10018703 | 3300013104 | Bacteria | 6967 |
| 110 | Ga0157370_10024498 | 3300013104 | Bacteria | 5977 |
| 111 | Ga0157369_10003855 | 3300013105 | Bacteria | 17824 |
| 112 | Ga0157369_10007043 | 3300013105 | Bacteria | 12966 |
| 113 | Ga0157369_10007727 | 3300013105 | Bacteria | 12368 |
| 114 | Ga0157369_10034990 | 3300013105 | Bacteria | 5508 |
| 115 | Ga0157369_10037652 | 3300013105 | Bacteria | 5295 |
| 116 | Ga0163162_10085005 | 3300013306 | Bacteria | 3240 |
| 117 | Ga0157372_10000776 | 3300013307 | Bacteria | 34547 |
| 118 | Ga0157372_10323738 | 3300013307 | Bacteria | 1795 |
| 119 | Ga0157372_10604177 | 3300013307 | Bacteria | 1278 |
| 120 | Ga0157375_10003691 | 3300013308 | Bacteria | 13289 |
| 121 | Ga0157375_10007576 | 3300013308 | Bacteria | 9492 |
| 122 | Ga0157375_10121243 | 3300013308 | Bacteria | 2724 |
| 123 | Ga0182008_10000261 | 3300014497 | Bacteria | 41195 |
| 124 | Ga0182008_10001346 | 3300014497 | Bacteria | 16710 |
| 125 | Ga0182008_10003524 | 3300014497 | Bacteria | 9413 |
| 126 | Ga0157379_10186755 | 3300014968 | Bacteria | 1873 |
| 127 | Ga0157376_10082633 | 3300014969 | Bacteria | 2761 |
| 128 | Ga0182006_1000206 | 3300015261 | Bacteria | 59352 |
| 129 | Ga0182006_1002616 | 3300015261 | Bacteria | 9730 |
| 130 | Ga0182006_1004672 | 3300015261 | Bacteria | 6706 |
| 131 | Ga0182007_10003019 | 3300015262 | Bacteria | 8131 |
| 132 | Ga0163161_10007916 | 3300017792 | Bacteria | 7357 |
| 133 | Ga0163161_10008504 | 3300017792 | Bacteria | 7108 |
| 134 | Ga0163161_10011745 | 3300017792 | Bacteria | 6073 |
| 135 | Ga0163161_10013050 | 3300017792 | Bacteria | 5774 |
| 136 | Ga0163161_10015040 | 3300017792 | Bacteria | 5393 |
| 137 | Ga0197907_11440316 | 3300020069 | Bacteria | 1510 |
| 138 | Ga0206356_10624618 | 3300020070 | Bacteria | 1284 |
| 139 | Ga0206351_10978011 | 3300020077 | Bacteria | 1397 |
| 140 | Ga0206351_10989253 | 3300020077 | Bacteria | 1347 |
| 141 | Ga0206350_11491042 | 3300020080 | Bacteria | 1763 |
| 142 | Ga0154015_1552384 | 3300020610 | Bacteria | 22900 |
| 143 | Ga0224712_10002754 | 3300022467 | Bacteria | 4421 |
| 144 | Ga0209435_100840 | 3300025206 | Bacteria | 4828 |
| 145 | Ga0209760_100032 | 3300025207 | Bacteria | 138015 |
| 146 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 147 | Ga0209784_100058 | 3300025224 | Bacteria | 167327 |
| 148 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 149 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 150 | Ga0209674_100096 | 3300025226 | Bacteria | 167418 |
| 151 | Ga0209674_100097 | 3300025226 | Bacteria | 167285 |
| 152 | Ga0209674_100403 | 3300025226 | Bacteria | 21586 |
| 153 | Ga0209672_100208 | 3300025228 | Bacteria | 46403 |
| 154 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 155 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 156 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 157 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 158 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 159 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 160 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 161 | Ga0209437_101405 | 3300025233 | Bacteria | 6017 |
| 162 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 163 | Ga0209258_100243 | 3300025242 | Bacteria | 100317 |
| 164 | Ga0209646_1000007 | 3300025246 | Bacteria | 670994 |
| 165 | Ga0209646_1000207 | 3300025246 | Bacteria | 67740 |
| 166 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 167 | Ga0209677_100053 | 3300025253 | Bacteria | 167537 |
| 168 | Ga0209148_1000640 | 3300025254 | Bacteria | 30511 |
| 169 | Ga0209759_1002850 | 3300025256 | Bacteria | 7288 |
| 170 | Ga0209759_1013956 | 3300025256 | Bacteria | 2148 |
| 171 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 172 | Ga0209455_1000107 | 3300025272 | Bacteria | 195136 |
| 173 | Ga0209130_1000254 | 3300025284 | Bacteria | 67210 |
| 174 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 175 | Ga0209676_1001558 | 3300025292 | Bacteria | 20540 |
| 176 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 177 | Ga0209564_1000202 | 3300025295 | Bacteria | 136555 |
| 178 | Ga0209564_1001636 | 3300025295 | Bacteria | 21656 |
| 179 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 180 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 181 | Ga0209050_1000069 | 3300025298 | Bacteria | 297615 |
| 182 | Ga0209050_1015681 | 3300025298 | Bacteria | 3161 |
| 183 | Ga0209256_1000921 | 3300025299 | Bacteria | 35969 |
| 184 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 185 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 186 | Ga0209257_1001484 | 3300025304 | Bacteria | 27531 |
| 187 | Ga0207656_10000394 | 3300025321 | Bacteria | 14693 |
| 188 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 189 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 190 | Ga0207655_1000022 | 3300025728 | Bacteria | 483933 |
| 191 | Ga0207655_1000063 | 3300025728 | Bacteria | 257028 |
| 192 | Ga0207655_1000191 | 3300025728 | Bacteria | 108382 |
| 193 | Ga0207655_1002838 | 3300025728 | Bacteria | 13411 |
| 194 | Ga0207655_1014974 | 3300025728 | Bacteria | 4342 |
| 195 | Ga0207655_1037820 | 3300025728 | Bacteria | 2119 |
| 196 | Ga0207655_1111208 | 3300025728 | Bacteria | 925 |
| 197 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 198 | Ga0207713_1000682 | 3300025735 | Bacteria | 31836 |
| 199 | Ga0207713_1008675 | 3300025735 | Bacteria | 5811 |
| 200 | Ga0207713_1042527 | 3300025735 | Bacteria | 1885 |
| 201 | Ga0207713_1064545 | 3300025735 | Bacteria | 1377 |
| 202 | Ga0207705_10127390 | 3300025909 | Bacteria | 1893 |
| 203 | Ga0207695_10002492 | 3300025913 | Bacteria | 27113 |
| 204 | Ga0207671_10000166 | 3300025914 | Bacteria | 102694 |
| 205 | Ga0207660_10563602 | 3300025917 | Bacteria | 927 |
| 206 | Ga0207657_10007356 | 3300025919 | Bacteria | 11298 |
| 207 | Ga0207649_10000056 | 3300025920 | Bacteria | 102891 |
| 208 | Ga0207649_10000111 | 3300025920 | Bacteria | 68568 |
| 209 | Ga0207650_10000418 | 3300025925 | Bacteria | 37720 |
| 210 | Ga0207650_10005379 | 3300025925 | Bacteria | 8730 |
| 211 | Ga0207690_10045688 | 3300025932 | Bacteria | 2895 |
| 212 | Ga0207706_10003731 | 3300025933 | Bacteria | 14529 |
| 213 | Ga0207709_10000982 | 3300025935 | Bacteria | 21301 |
| 214 | Ga0207709_10004470 | 3300025935 | Bacteria | 8074 |
| 215 | Ga0207709_10021519 | 3300025935 | Bacteria | 3651 |
| 216 | Ga0207679_10000036 | 3300025945 | Bacteria | 133834 |
| 217 | Ga0207679_10000105 | 3300025945 | Bacteria | 68561 |
| 218 | Ga0207679_10138463 | 3300025945 | Bacteria | 1964 |
| 219 | Ga0207640_10000154 | 3300025981 | Bacteria | 49637 |
| 220 | Ga0207678_10000106 | 3300026067 | Bacteria | 68474 |
| 221 | Ga0207702_10000135 | 3300026078 | Bacteria | 88092 |
| 222 | Ga0207648_10137021 | 3300026089 | Bacteria | 2156 |
| 223 | Ga0207674_10002847 | 3300026116 | Bacteria | 21514 |
| 224 | Ga0207698_10091909 | 3300026142 | Bacteria | 2486 |
| 225 | Ga0209281_1000379 | 3300027111 | Bacteria | 70495 |
| 226 | Ga0209281_1004003 | 3300027111 | Bacteria | 4567 |
| 227 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 228 | Ga0209282_1000043 | 3300027666 | Bacteria | 119260 |
| 229 | Ga0268266_10000335 | 3300028379 | Bacteria | 73645 |
| 230 | Ga0268266_10126077 | 3300028379 | Bacteria | 2285 |
| 231 | Ga0265338_10001178 | 3300028800 | Bacteria | 43156 |
| 232 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 233 | Ga0307511_10061742 | 3300030521 | Bacteria | 2852 |
| 234 | Ga0265340_10079217 | 3300031247 | Bacteria | 1549 |
| 235 | Ga0307509_10097343 | 3300031507 | Bacteria | 2991 |
| 236 | Ga0307408_100000028 | 3300031548 | Bacteria | 233440 |
| 237 | Ga0307408_100000074 | 3300031548 | Bacteria | 111955 |
| 238 | Ga0307405_10001861 | 3300031731 | Bacteria | 9057 |
| 239 | Ga0307405_10064245 | 3300031731 | Bacteria | 2332 |
| 240 | Ga0307518_10013348 | 3300031838 | Bacteria | 5874 |
| 241 | Ga0307406_10068905 | 3300031901 | Bacteria | 2311 |
| 242 | Ga0307412_10001662 | 3300031911 | Bacteria | 12283 |
| 243 | Ga0307412_10016685 | 3300031911 | Bacteria | 4379 |
| 244 | Ga0307414_10098460 | 3300032004 | Bacteria | 2194 |
| 245 | Ga0307414_10273285 | 3300032004 | Bacteria | 1416 |
| 246 | Ga0307414_10499323 | 3300032004 | Bacteria | 1076 |
| 247 | Ga0395899_0078640 | 3300037312 | Bacteria | 2404 |
| 248 | Ga0395899_0085802 | 3300037312 | Bacteria | 2287 |
| 249 | Ga0395899_0104362 | 3300037312 | Bacteria | 2043 |
| 250 | Ga0395899_0112424 | 3300037312 | Bacteria | 1956 |
| 251 | Ga0395900_0000162 | 3300037418 | Bacteria | 109616 |
| 252 | Ga0395900_0005262 | 3300037418 | Bacteria | 13569 |
| 253 | Ga0395900_0007334 | 3300037418 | Bacteria | 11410 |
| 254 | Ga0395900_0009391 | 3300037418 | Bacteria | 10027 |
| 255 | Ga0395900_0041333 | 3300037418 | Bacteria | 4753 |
| 256 | Ga0395900_0107327 | 3300037418 | Bacteria | 2868 |
| 257 | Ga0395900_0148447 | 3300037418 | Bacteria | 2396 |
| 258 | Ga0395900_0177587 | 3300037418 | Bacteria | 2165 |
| 259 | Ga0395900_0259394 | 3300037418 | Bacteria | 1736 |
| 260 | Ga0395900_0334831 | 3300037418 | Bacteria | 1490 |
| 261 | Ga0395900_0354717 | 3300037418 | Bacteria | 1439 |
| 262 | Ga0395900_0378589 | 3300037418 | Bacteria | 1384 |
| 263 | Ga0395898_0002086 | 3300037466 | Bacteria | 24861 |
| 264 | Ga0395898_0023727 | 3300037466 | Bacteria | 6192 |
| 265 | Ga0395898_0046474 | 3300037466 | Bacteria | 4264 |
| 266 | Ga0395898_0050881 | 3300037466 | Bacteria | 4053 |
| 267 | Ga0395898_0134242 | 3300037466 | Bacteria | 2370 |
| 268 | Ga0395898_0279590 | 3300037466 | Bacteria | 1592 |
| 269 | Ga0395905_0032388 | 3300037471 | Bacteria | 4916 |
| 270 | Ga0395905_0039045 | 3300037471 | Bacteria | 4454 |
| 271 | Ga0395905_0066292 | 3300037471 | Bacteria | 3381 |
| 272 | Ga0395905_0300853 | 3300037471 | Bacteria | 1491 |
| 273 | Ga0395905_0528993 | 3300037471 | Bacteria | 1079 |
| 274 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 275 | Ga0395901_0000042 | 3300038443 | Bacteria | 201819 |
| 276 | Ga0395901_0000091 | 3300038443 | Bacteria | 123334 |
| 277 | Ga0395901_0023936 | 3300038443 | Bacteria | 6264 |
| 278 | Ga0395901_0061038 | 3300038443 | Bacteria | 3923 |
| 279 | Ga0395901_0123431 | 3300038443 | Bacteria | 2721 |
| 280 | Ga0395901_0168631 | 3300038443 | Bacteria | 2297 |
| 281 | Ga0395901_0283097 | 3300038443 | Bacteria | 1722 |
| 282 | Ga0395901_0525495 | 3300038443 | Bacteria | 1202 |
| 283 | Ga0439436_0000095 | 3300041404 | Bacteria | 20869 |
| 284 | Ga0439438_000160 | 3300041405 | Bacteria | 30706 |
| 285 | Ga0439438_000190 | 3300041405 | Bacteria | 27711 |
| 286 | Ga0439438_000503 | 3300041405 | Bacteria | 17737 |
| 287 | Ga0439466_0000574 | 3300041411 | Bacteria | 13819 |
| 288 | Ga0439466_0008236 | 3300041411 | Bacteria | 3930 |
| 289 | Ga0439466_0032146 | 3300041411 | Bacteria | 1791 |
| 290 | Ga0439448_0069504 | 3300042005 | Bacteria | 1172 |
| 291 | Ga0439432_005030 | 3300042006 | Bacteria | 4780 |
| 292 | Ga0439432_006082 | 3300042006 | Bacteria | 4324 |
| 293 | Ga0439432_021723 | 3300042006 | Bacteria | 2125 |
| 294 | Ga0450906_012235 | 3300042145 | Bacteria | 1592 |
| 295 | Ga0439464_0000813 | 3300042439 | Bacteria | 6861 |
| 296 | Ga0439464_0005146 | 3300042439 | Bacteria | 3368 |
| 297 | Ga0439464_0018199 | 3300042439 | Bacteria | 1910 |
| 298 | Ga0466972_0002472 | 3300044658 | Bacteria | 9144 |
| 299 | Ga0466972_0003769 | 3300044658 | Bacteria | 7542 |
| 300 | Ga0466972_0054889 | 3300044658 | Bacteria | 1917 |
| 301 | Ga0466965_0001680 | 3300044683 | Bacteria | 9081 |
| 302 | Ga0466966_0031469 | 3300044684 | Bacteria | 3440 |
| 303 | Ga0466966_0270642 | 3300044684 | Bacteria | 1022 |
| 304 | Ga0466961_0142054 | 3300044693 | Bacteria | 1502 |
| 305 | Ga0466971_0137107 | 3300044719 | Bacteria | 1138 |
| 306 | Ga0466968_0006840 | 3300044735 | Bacteria | 4315 |
| 307 | Ga0466970_0007069 | 3300044765 | Bacteria | 5614 |
| 308 | Ga0466970_0099987 | 3300044765 | Bacteria | 1579 |
| 309 | Ga0466958_0108722 | 3300045836 | Bacteria | 1730 |
| 310 | Ga0466967_0746344 | 3300045976 | Bacteria | 971 |
| 311 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 312 | Ga0495617_000020 | 3300046452 | Bacteria | 230257 |
| 313 | Ga0495617_000443 | 3300046452 | Bacteria | 22346 |
| 314 | Ga0495617_002156 | 3300046452 | Bacteria | 8073 |
| 315 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 316 | Ga0495627_000058 | 3300046453 | Bacteria | 143802 |
| 317 | Ga0495627_000207 | 3300046453 | Bacteria | 63763 |
| 318 | Ga0495627_001366 | 3300046453 | Bacteria | 14571 |
| 319 | Ga0495627_027126 | 3300046453 | Bacteria | 1840 |
| 320 | Ga0495627_033386 | 3300046453 | Bacteria | 1614 |
| 321 | Ga0495603_0028731 | 3300046455 | Bacteria | 3355 |
| 322 | Ga0495603_0038059 | 3300046455 | Bacteria | 2885 |
| 323 | Ga0495603_0040631 | 3300046455 | Bacteria | 2783 |
| 324 | Ga0495590_0000025 | 3300046457 | Bacteria | 165221 |
| 325 | Ga0495590_0013996 | 3300046457 | Bacteria | 2938 |
| 326 | Ga0495590_0038493 | 3300046457 | Bacteria | 1668 |
| 327 | Ga0495591_000081 | 3300046458 | Bacteria | 107738 |
| 328 | Ga0495591_000246 | 3300046458 | Bacteria | 52198 |
| 329 | Ga0495591_002486 | 3300046458 | Bacteria | 10221 |
| 330 | Ga0495591_012754 | 3300046458 | Bacteria | 3111 |
| 331 | Ga0495591_016756 | 3300046458 | Bacteria | 2538 |
| 332 | Ga0495629_0080053 | 3300046459 | Bacteria | 2281 |
| 333 | Ga0495638_0007776 | 3300046460 | Bacteria | 7656 |
| 334 | Ga0495638_0011767 | 3300046460 | Bacteria | 6024 |
| 335 | Ga0495638_0029677 | 3300046460 | Bacteria | 3526 |
| 336 | Ga0495638_0061000 | 3300046460 | Bacteria | 2331 |
| 337 | Ga0495638_0070430 | 3300046460 | Bacteria | 2141 |
| 338 | Ga0495638_0192279 | 3300046460 | Bacteria | 1157 |
| 339 | Ga0495653_0000082 | 3300046463 | Bacteria | 80285 |
| 340 | Ga0495653_0015657 | 3300046463 | Bacteria | 6181 |
| 341 | Ga0495653_0019749 | 3300046463 | Bacteria | 5463 |
| 342 | Ga0495653_0033932 | 3300046463 | Bacteria | 4039 |
| 343 | Ga0495653_0049210 | 3300046463 | Bacteria | 3248 |
| 344 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 345 | Ga0495650_0000085 | 3300046471 | Bacteria | 235655 |
| 346 | Ga0495650_0000462 | 3300046471 | Bacteria | 63149 |
| 347 | Ga0495650_0001171 | 3300046471 | Bacteria | 28029 |
| 348 | Ga0495650_0001182 | 3300046471 | Bacteria | 27749 |
| 349 | Ga0495650_0053169 | 3300046471 | Bacteria | 1660 |
| 350 | Ga0495582_0111521 | 3300046473 | Bacteria | 1536 |
| 351 | Ga0495605_0000018 | 3300046474 | Bacteria | 270187 |
| 352 | Ga0495605_0000051 | 3300046474 | Bacteria | 163067 |
| 353 | Ga0495605_0000293 | 3300046474 | Bacteria | 55067 |
| 354 | Ga0495605_0011697 | 3300046474 | Bacteria | 4884 |
| 355 | Ga0495605_0019095 | 3300046474 | Bacteria | 3667 |
| 356 | Ga0495605_0027590 | 3300046474 | Bacteria | 2941 |
| 357 | Ga0495605_0029040 | 3300046474 | Bacteria | 2850 |
| 358 | Ga0495605_0035726 | 3300046474 | Bacteria | 2510 |
| 359 | Ga0495605_0057595 | 3300046474 | Bacteria | 1869 |
| 360 | Ga0495605_0063262 | 3300046474 | Bacteria | 1765 |
| 361 | Ga0495605_0108008 | 3300046474 | Bacteria | 1272 |
| 362 | Ga0495605_0109559 | 3300046474 | Bacteria | 1261 |
| 363 | Ga0495584_0000003 | 3300046491 | Bacteria | 323768 |
| 364 | Ga0495584_0000058 | 3300046491 | Bacteria | 81148 |
| 365 | Ga0495584_0000070 | 3300046491 | Bacteria | 73237 |
| 366 | Ga0495584_0029859 | 3300046491 | Bacteria | 2762 |
| 367 | Ga0495584_0062431 | 3300046491 | Bacteria | 1873 |
| 368 | Ga0495584_0079441 | 3300046491 | Bacteria | 1650 |
| 369 | Ga0495584_0083705 | 3300046491 | Bacteria | 1606 |
| 370 | Ga0495584_0116125 | 3300046491 | Bacteria | 1355 |
| 371 | Ga0495585_0000183 | 3300046492 | Bacteria | 66586 |
| 372 | Ga0495585_0000424 | 3300046492 | Bacteria | 40738 |
| 373 | Ga0495585_0000814 | 3300046492 | Bacteria | 27169 |
| 374 | Ga0495585_0005398 | 3300046492 | Bacteria | 8061 |
| 375 | Ga0495585_0006004 | 3300046492 | Bacteria | 7599 |
| 376 | Ga0495585_0010489 | 3300046492 | Bacteria | 5510 |
| 377 | Ga0495585_0017021 | 3300046492 | Bacteria | 4207 |
| 378 | Ga0495585_0017297 | 3300046492 | Bacteria | 4168 |
| 379 | Ga0495585_0030772 | 3300046492 | Bacteria | 3051 |
| 380 | Ga0495585_0043023 | 3300046492 | Bacteria | 2527 |
| 381 | Ga0495585_0043787 | 3300046492 | Bacteria | 2502 |
| 382 | Ga0495585_0050006 | 3300046492 | Bacteria | 2319 |
| 383 | Ga0495585_0088414 | 3300046492 | Bacteria | 1671 |
| 384 | Ga0495585_0093826 | 3300046492 | Bacteria | 1613 |
| 385 | Ga0495594_0000828 | 3300046499 | Bacteria | 15980 |
| 386 | Ga0495594_0002110 | 3300046499 | Bacteria | 10356 |
| 387 | Ga0495594_0054489 | 3300046499 | Bacteria | 2204 |
| 388 | Ga0495594_0242772 | 3300046499 | Bacteria | 1026 |
| 389 | Ga0495596_0000017 | 3300046500 | Bacteria | 114761 |
| 390 | Ga0495596_0000366 | 3300046500 | Bacteria | 29053 |
| 391 | Ga0495596_0000486 | 3300046500 | Bacteria | 25196 |
| 392 | Ga0495596_0000884 | 3300046500 | Bacteria | 18072 |
| 393 | Ga0495596_0000958 | 3300046500 | Bacteria | 17231 |
| 394 | Ga0495596_0002814 | 3300046500 | Bacteria | 9109 |
| 395 | Ga0495596_0002923 | 3300046500 | Bacteria | 8877 |
| 396 | Ga0495596_0010139 | 3300046500 | Bacteria | 4117 |
| 397 | Ga0495596_0010912 | 3300046500 | Bacteria | 3937 |
| 398 | Ga0495596_0011652 | 3300046500 | Bacteria | 3784 |
| 399 | Ga0495596_0012793 | 3300046500 | Bacteria | 3579 |
| 400 | Ga0495596_0014942 | 3300046500 | Bacteria | 3262 |
| 401 | Ga0495596_0016439 | 3300046500 | Bacteria | 3073 |
| 402 | Ga0495596_0020852 | 3300046500 | Bacteria | 2679 |
| 403 | Ga0495596_0024894 | 3300046500 | Bacteria | 2421 |
| 404 | Ga0495596_0087490 | 3300046500 | Bacteria | 1209 |
| 405 | Ga0495607_0000485 | 3300046501 | Bacteria | 39753 |
| 406 | Ga0495607_0001440 | 3300046501 | Bacteria | 21201 |
| 407 | Ga0495607_0001650 | 3300046501 | Bacteria | 19320 |
| 408 | Ga0495607_0004773 | 3300046501 | Bacteria | 9907 |
| 409 | Ga0495607_0004924 | 3300046501 | Bacteria | 9709 |
| 410 | Ga0495607_0006308 | 3300046501 | Bacteria | 8357 |
| 411 | Ga0495607_0009224 | 3300046501 | Bacteria | 6702 |
| 412 | Ga0495607_0015090 | 3300046501 | Bacteria | 5016 |
| 413 | Ga0495607_0019636 | 3300046501 | Bacteria | 4288 |
| 414 | Ga0495607_0063452 | 3300046501 | Bacteria | 2090 |
| 415 | Ga0495583_0000010 | 3300046506 | Bacteria | 353523 |
| 416 | Ga0495583_0000051 | 3300046506 | Bacteria | 212400 |
| 417 | Ga0495583_0000382 | 3300046506 | Bacteria | 68388 |
| 418 | Ga0495583_0001685 | 3300046506 | Bacteria | 21387 |
| 419 | Ga0495583_0003156 | 3300046506 | Bacteria | 12993 |
| 420 | Ga0495583_0004240 | 3300046506 | Bacteria | 10401 |
| 421 | Ga0495583_0005962 | 3300046506 | Bacteria | 8086 |
| 422 | Ga0495583_0006526 | 3300046506 | Bacteria | 7609 |
| 423 | Ga0495583_0021928 | 3300046506 | Bacteria | 3273 |
| 424 | Ga0495583_0030949 | 3300046506 | Bacteria | 2600 |
| 425 | Ga0495583_0036045 | 3300046506 | Bacteria | 2356 |
| 426 | Ga0495583_0039818 | 3300046506 | Bacteria | 2211 |
| 427 | Ga0495583_0055621 | 3300046506 | Bacteria | 1787 |
| 428 | Ga0495583_0098912 | 3300046506 | Bacteria | 1247 |
| 429 | Ga0495606_0000101 | 3300046507 | Bacteria | 146752 |
| 430 | Ga0495606_0000161 | 3300046507 | Bacteria | 117607 |
| 431 | Ga0495606_0000409 | 3300046507 | Bacteria | 72543 |
| 432 | Ga0495606_0001868 | 3300046507 | Bacteria | 26409 |
| 433 | Ga0495606_0003416 | 3300046507 | Bacteria | 16866 |
| 434 | Ga0495606_0010811 | 3300046507 | Bacteria | 7521 |
| 435 | Ga0495606_0017655 | 3300046507 | Bacteria | 5384 |
| 436 | Ga0495606_0027466 | 3300046507 | Bacteria | 4035 |
| 437 | Ga0495606_0089737 | 3300046507 | Bacteria | 1893 |
| 438 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 439 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 440 | Ga0495610_0000229 | 3300046512 | Bacteria | 59730 |
| 441 | Ga0495610_0000293 | 3300046512 | Bacteria | 52547 |
| 442 | Ga0495610_0001226 | 3300046512 | Bacteria | 23065 |
| 443 | Ga0495610_0019426 | 3300046512 | Bacteria | 3802 |
| 444 | Ga0495610_0024547 | 3300046512 | Bacteria | 3250 |
| 445 | Ga0495610_0069845 | 3300046512 | Bacteria | 1642 |
| 446 | Ga0495616_0000207 | 3300046513 | Bacteria | 48768 |
| 447 | Ga0495616_0000446 | 3300046513 | Bacteria | 31542 |
| 448 | Ga0495616_0000492 | 3300046513 | Bacteria | 30078 |
| 449 | Ga0495616_0000493 | 3300046513 | Bacteria | 30071 |
| 450 | Ga0495616_0002335 | 3300046513 | Bacteria | 12668 |
| 451 | Ga0495616_0008047 | 3300046513 | Bacteria | 6279 |
| 452 | Ga0495616_0008671 | 3300046513 | Bacteria | 5999 |
| 453 | Ga0495616_0011794 | 3300046513 | Bacteria | 4987 |
| 454 | Ga0495616_0017240 | 3300046513 | Bacteria | 3984 |
| 455 | Ga0495616_0019015 | 3300046513 | Bacteria | 3755 |
| 456 | Ga0495616_0020945 | 3300046513 | Bacteria | 3550 |
| 457 | Ga0495616_0025138 | 3300046513 | Bacteria | 3185 |
| 458 | Ga0495616_0029934 | 3300046513 | Bacteria | 2867 |
| 459 | Ga0495616_0034155 | 3300046513 | Bacteria | 2643 |
| 460 | Ga0495616_0034287 | 3300046513 | Bacteria | 2637 |
| 461 | Ga0495616_0073500 | 3300046513 | Bacteria | 1649 |
| 462 | Ga0495616_0115044 | 3300046513 | Bacteria | 1246 |
| 463 | Ga0495616_0172039 | 3300046513 | Bacteria | 968 |
| 464 | Ga0495620_0004244 | 3300046515 | Bacteria | 8100 |
| 465 | Ga0495620_0005093 | 3300046515 | Bacteria | 7359 |
| 466 | Ga0495620_0034269 | 3300046515 | Bacteria | 2296 |
| 467 | Ga0495620_0053036 | 3300046515 | Bacteria | 1719 |
| 468 | Ga0495630_0034925 | 3300046517 | Bacteria | 3756 |
| 469 | Ga0495631_0000791 | 3300046518 | Bacteria | 20226 |
| 470 | Ga0495631_0002616 | 3300046518 | Bacteria | 10050 |
| 471 | Ga0495631_0003789 | 3300046518 | Bacteria | 8228 |
| 472 | Ga0495631_0004387 | 3300046518 | Bacteria | 7517 |
| 473 | Ga0495631_0005725 | 3300046518 | Bacteria | 6482 |
| 474 | Ga0495631_0016205 | 3300046518 | Bacteria | 3559 |
| 475 | Ga0495631_0016490 | 3300046518 | Bacteria | 3520 |
| 476 | Ga0495631_0025827 | 3300046518 | Bacteria | 2701 |
| 477 | Ga0495631_0040161 | 3300046518 | Bacteria | 2074 |
| 478 | Ga0495631_0044611 | 3300046518 | Bacteria | 1953 |
| 479 | Ga0495631_0052258 | 3300046518 | Bacteria | 1784 |
| 480 | Ga0495631_0054674 | 3300046518 | Bacteria | 1740 |
| 481 | Ga0495631_0084225 | 3300046518 | Bacteria | 1370 |
| 482 | Ga0495631_0106122 | 3300046518 | Bacteria | 1208 |
| 483 | Ga0495631_0127202 | 3300046518 | Bacteria | 1095 |
| 484 | Ga0495631_0160438 | 3300046518 | Bacteria | 965 |
| 485 | Ga0495632_0000048 | 3300046519 | Bacteria | 137883 |
| 486 | Ga0495632_0000065 | 3300046519 | Bacteria | 116086 |
| 487 | Ga0495632_0000129 | 3300046519 | Bacteria | 77134 |
| 488 | Ga0495632_0000296 | 3300046519 | Bacteria | 48157 |
| 489 | Ga0495632_0000445 | 3300046519 | Bacteria | 39318 |
| 490 | Ga0495632_0002241 | 3300046519 | Bacteria | 14914 |
| 491 | Ga0495632_0013411 | 3300046519 | Bacteria | 4678 |
| 492 | Ga0495632_0013468 | 3300046519 | Bacteria | 4667 |
| 493 | Ga0495632_0014339 | 3300046519 | Bacteria | 4487 |
| 494 | Ga0495632_0018245 | 3300046519 | Bacteria | 3854 |
| 495 | Ga0495632_0023960 | 3300046519 | Bacteria | 3250 |
| 496 | Ga0495632_0025629 | 3300046519 | Bacteria | 3117 |
| 497 | Ga0495637_0000019 | 3300046520 | Bacteria | 185953 |
| 498 | Ga0495637_0000293 | 3300046520 | Bacteria | 38928 |
| 499 | Ga0495637_0003878 | 3300046520 | Bacteria | 7849 |
| 500 | Ga0495637_0015401 | 3300046520 | Bacteria | 3585 |
| 501 | Ga0495637_0023477 | 3300046520 | Bacteria | 2802 |
| 502 | Ga0495637_0025683 | 3300046520 | Bacteria | 2652 |
| 503 | Ga0495637_0031841 | 3300046520 | Bacteria | 2329 |
| 504 | Ga0495637_0046503 | 3300046520 | Bacteria | 1835 |
| 505 | Ga0495637_0047426 | 3300046520 | Bacteria | 1813 |
| 506 | Ga0495643_0000030 | 3300046522 | Bacteria | 260229 |
| 507 | Ga0495643_0000081 | 3300046522 | Bacteria | 160004 |
| 508 | Ga0495643_0000234 | 3300046522 | Bacteria | 84022 |
| 509 | Ga0495643_0000259 | 3300046522 | Bacteria | 77609 |
| 510 | Ga0495643_0000391 | 3300046522 | Bacteria | 57750 |
| 511 | Ga0495643_0003298 | 3300046522 | Bacteria | 11926 |
| 512 | Ga0495643_0005676 | 3300046522 | Bacteria | 8363 |
| 513 | Ga0495643_0038465 | 3300046522 | Bacteria | 2620 |
| 514 | Ga0495643_0039291 | 3300046522 | Bacteria | 2589 |
| 515 | Ga0495643_0045127 | 3300046522 | Bacteria | 2393 |
| 516 | Ga0495643_0110145 | 3300046522 | Bacteria | 1401 |
| 517 | Ga0495643_0114352 | 3300046522 | Bacteria | 1369 |
| 518 | Ga0495643_0135447 | 3300046522 | Bacteria | 1233 |
| 519 | Ga0495644_0005954 | 3300046523 | Bacteria | 4753 |
| 520 | Ga0495644_0013952 | 3300046523 | Bacteria | 3080 |
| 521 | Ga0495644_0022314 | 3300046523 | Bacteria | 2412 |
| 522 | Ga0495644_0026508 | 3300046523 | Bacteria | 2198 |
| 523 | Ga0495644_0039788 | 3300046523 | Bacteria | 1772 |
| 524 | Ga0495644_0082294 | 3300046523 | Bacteria | 1213 |
| 525 | Ga0495648_0000030 | 3300046524 | Bacteria | 216178 |
| 526 | Ga0495648_0001105 | 3300046524 | Bacteria | 27423 |
| 527 | Ga0495648_0002123 | 3300046524 | Bacteria | 18676 |
| 528 | Ga0495648_0002372 | 3300046524 | Bacteria | 17491 |
| 529 | Ga0495648_0003335 | 3300046524 | Bacteria | 14162 |
| 530 | Ga0495648_0006165 | 3300046524 | Bacteria | 9831 |
| 531 | Ga0495648_0016682 | 3300046524 | Bacteria | 5286 |
| 532 | Ga0495648_0020755 | 3300046524 | Bacteria | 4570 |
| 533 | Ga0495648_0024723 | 3300046524 | Bacteria | 4081 |
| 534 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 535 | Ga0495663_0017735 | 3300046525 | Bacteria | 2022 |
| 536 | Ga0495663_0056308 | 3300046525 | Bacteria | 1228 |
| 537 | Ga0495663_0077534 | 3300046525 | Bacteria | 1066 |
| 538 | Ga0495666_0001974 | 3300046526 | Bacteria | 10124 |
| 539 | Ga0495666_0071989 | 3300046526 | Bacteria | 1642 |
| 540 | Ga0495666_0120197 | 3300046526 | Bacteria | 1231 |
| 541 | Ga0495642_0000085 | 3300046528 | Bacteria | 54372 |
| 542 | Ga0495642_0000285 | 3300046528 | Bacteria | 28471 |
| 543 | Ga0495642_0002484 | 3300046528 | Bacteria | 7496 |
| 544 | Ga0495642_0004658 | 3300046528 | Bacteria | 5312 |
| 545 | Ga0495642_0032156 | 3300046528 | Bacteria | 2104 |
| 546 | Ga0495642_0055346 | 3300046528 | Bacteria | 1637 |
| 547 | Ga0495642_0064434 | 3300046528 | Bacteria | 1524 |
| 548 | Ga0495642_0092782 | 3300046528 | Bacteria | 1279 |
| 549 | Ga0495652_0033951 | 3300046529 | Bacteria | 4449 |
| 550 | Ga0495654_0000014 | 3300046530 | Bacteria | 312126 |
| 551 | Ga0495654_0002221 | 3300046530 | Bacteria | 12587 |
| 552 | Ga0495654_0032258 | 3300046530 | Bacteria | 2656 |
| 553 | Ga0495654_0041475 | 3300046530 | Bacteria | 2289 |
| 554 | Ga0495654_0053621 | 3300046530 | Bacteria | 1959 |
| 555 | Ga0495654_0054451 | 3300046530 | Bacteria | 1940 |
| 556 | Ga0495665_0000967 | 3300046531 | Bacteria | 15211 |
| 557 | Ga0495665_0002029 | 3300046531 | Bacteria | 10962 |
| 558 | Ga0495665_0230130 | 3300046531 | Bacteria | 957 |
| 559 | Ga0495586_0005932 | 3300046535 | Bacteria | 6538 |
| 560 | Ga0495586_0348831 | 3300046535 | Bacteria | 850 |
| 561 | Ga0495587_0012506 | 3300046536 | Bacteria | 5338 |
| 562 | Ga0495587_0047406 | 3300046536 | Bacteria | 2548 |
| 563 | Ga0495609_0000019 | 3300046538 | Bacteria | 297777 |
| 564 | Ga0495609_0000298 | 3300046538 | Bacteria | 45867 |
| 565 | Ga0495609_0000447 | 3300046538 | Bacteria | 33815 |
| 566 | Ga0495609_0001963 | 3300046538 | Bacteria | 13048 |
| 567 | Ga0495609_0002362 | 3300046538 | Bacteria | 11646 |
| 568 | Ga0495609_0004683 | 3300046538 | Bacteria | 7409 |
| 569 | Ga0495609_0005513 | 3300046538 | Bacteria | 6618 |
| 570 | Ga0495609_0011763 | 3300046538 | Bacteria | 4161 |
| 571 | Ga0495609_0017035 | 3300046538 | Bacteria | 3380 |
| 572 | Ga0495609_0039371 | 3300046538 | Bacteria | 2128 |
| 573 | Ga0495609_0071947 | 3300046538 | Bacteria | 1519 |
| 574 | Ga0495597_0000020 | 3300046542 | Bacteria | 161793 |
| 575 | Ga0495597_0000226 | 3300046542 | Bacteria | 51108 |
| 576 | Ga0495597_0000378 | 3300046542 | Bacteria | 38615 |
| 577 | Ga0495597_0000771 | 3300046542 | Bacteria | 25342 |
| 578 | Ga0495597_0010567 | 3300046542 | Bacteria | 4504 |
| 579 | Ga0495597_0027187 | 3300046542 | Bacteria | 2624 |
| 580 | Ga0495597_0049366 | 3300046542 | Bacteria | 1859 |
| 581 | Ga0495597_0059891 | 3300046542 | Bacteria | 1661 |
| 582 | Ga0495597_0079802 | 3300046542 | Bacteria | 1401 |
| 583 | Ga0495622_0000002 | 3300046557 | Bacteria | 321742 |
| 584 | Ga0495622_0001564 | 3300046557 | Bacteria | 11352 |
| 585 | Ga0495622_0020979 | 3300046557 | Bacteria | 3042 |
| 586 | Ga0495622_0038190 | 3300046557 | Bacteria | 2236 |
| 587 | Ga0495622_0055342 | 3300046557 | Bacteria | 1840 |
| 588 | Ga0495622_0115500 | 3300046557 | Bacteria | 1227 |
| 589 | Ga0495633_0000215 | 3300046558 | Bacteria | 72445 |
| 590 | Ga0495633_0002968 | 3300046558 | Bacteria | 11604 |
| 591 | Ga0495633_0003511 | 3300046558 | Bacteria | 10400 |
| 592 | Ga0495633_0006036 | 3300046558 | Bacteria | 7265 |
| 593 | Ga0495633_0009986 | 3300046558 | Bacteria | 5208 |
| 594 | Ga0495633_0030221 | 3300046558 | Bacteria | 2633 |
| 595 | Ga0495633_0033386 | 3300046558 | Bacteria | 2481 |
| 596 | Ga0495633_0044780 | 3300046558 | Bacteria | 2097 |
| 597 | Ga0495633_0051377 | 3300046558 | Bacteria | 1942 |
| 598 | Ga0495633_0091548 | 3300046558 | Bacteria | 1414 |
| 599 | Ga0495633_0102959 | 3300046558 | Bacteria | 1325 |
| 600 | Ga0495633_0143858 | 3300046558 | Bacteria | 1102 |
| 601 | Ga0495656_0009349 | 3300046615 | Bacteria | 3523 |
| 602 | Ga0495656_0009453 | 3300046615 | Bacteria | 3505 |
| 603 | Ga0495656_0012450 | 3300046615 | Bacteria | 3139 |
| 604 | Ga0495656_0127214 | 3300046615 | Bacteria | 1209 |
| 605 | Ga0495656_0129691 | 3300046615 | Bacteria | 1199 |
| 606 | Ga0495668_0000066 | 3300046616 | Bacteria | 178533 |
| 607 | Ga0495668_0000579 | 3300046616 | Bacteria | 44604 |
| 608 | Ga0495668_0000712 | 3300046616 | Bacteria | 40090 |
| 609 | Ga0495668_0000941 | 3300046616 | Bacteria | 32463 |
| 610 | Ga0495668_0006113 | 3300046616 | Bacteria | 7971 |
| 611 | Ga0495668_0008725 | 3300046616 | Bacteria | 6294 |
| 612 | Ga0495668_0014985 | 3300046616 | Bacteria | 4536 |
| 613 | Ga0495668_0018432 | 3300046616 | Bacteria | 4033 |
| 614 | Ga0495668_0025349 | 3300046616 | Bacteria | 3370 |
| 615 | Ga0495668_0026700 | 3300046616 | Bacteria | 3275 |
| 616 | Ga0495668_0028787 | 3300046616 | Bacteria | 3140 |
| 617 | Ga0495634_0110452 | 3300046642 | Bacteria | 1768 |
| 618 | Ga0495611_0000195 | 3300046648 | Bacteria | 42925 |
| 619 | Ga0495611_0000773 | 3300046648 | Bacteria | 17861 |
| 620 | Ga0495611_0005640 | 3300046648 | Bacteria | 5337 |
| 621 | Ga0495611_0012256 | 3300046648 | Bacteria | 3645 |
| 622 | Ga0495611_0013207 | 3300046648 | Bacteria | 3514 |
| 623 | Ga0495611_0021422 | 3300046648 | Bacteria | 2792 |
| 624 | Ga0495625_0000931 | 3300046660 | Bacteria | 39360 |
| 625 | Ga0495625_0003303 | 3300046660 | Bacteria | 16271 |
| 626 | Ga0495625_0006597 | 3300046660 | Bacteria | 10306 |
| 627 | Ga0495625_0007223 | 3300046660 | Bacteria | 9722 |
| 628 | Ga0495625_0008059 | 3300046660 | Bacteria | 9034 |
| 629 | Ga0495625_0009200 | 3300046660 | Bacteria | 8297 |
| 630 | Ga0495625_0009398 | 3300046660 | Bacteria | 8184 |
| 631 | Ga0495625_0016910 | 3300046660 | Bacteria | 5725 |
| 632 | Ga0495625_0042605 | 3300046660 | Bacteria | 3297 |
| 633 | Ga0495625_0045391 | 3300046660 | Bacteria | 3177 |
| 634 | Ga0495625_0053402 | 3300046660 | Bacteria | 2890 |
| 635 | Ga0495625_0070958 | 3300046660 | Bacteria | 2445 |
| 636 | Ga0495625_0079450 | 3300046660 | Bacteria | 2287 |
| 637 | Ga0495625_0262301 | 3300046660 | Bacteria | 1118 |
| 638 | Ga0495635_0080820 | 3300046663 | Bacteria | 2224 |
| 639 | Ga0495661_0000012 | 3300046665 | Bacteria | 276804 |
| 640 | Ga0495661_0001056 | 3300046665 | Bacteria | 24401 |
| 641 | Ga0495661_0001625 | 3300046665 | Bacteria | 18404 |
| 642 | Ga0495661_0001753 | 3300046665 | Bacteria | 17440 |
| 643 | Ga0495661_0002244 | 3300046665 | Bacteria | 14973 |
| 644 | Ga0495661_0002879 | 3300046665 | Bacteria | 13017 |
| 645 | Ga0495661_0003589 | 3300046665 | Bacteria | 11417 |
| 646 | Ga0495661_0005577 | 3300046665 | Bacteria | 8923 |
| 647 | Ga0495661_0019699 | 3300046665 | Bacteria | 4416 |
| 648 | Ga0495661_0025401 | 3300046665 | Bacteria | 3825 |
| 649 | Ga0495661_0025719 | 3300046665 | Bacteria | 3799 |
| 650 | Ga0495661_0025738 | 3300046665 | Bacteria | 3797 |
| 651 | Ga0495661_0029391 | 3300046665 | Bacteria | 3508 |
| 652 | Ga0495661_0032133 | 3300046665 | Bacteria | 3321 |
| 653 | Ga0495661_0036722 | 3300046665 | Bacteria | 3064 |
| 654 | Ga0495661_0042148 | 3300046665 | Bacteria | 2816 |
| 655 | Ga0495661_0054609 | 3300046665 | Bacteria | 2397 |
| 656 | Ga0495661_0062250 | 3300046665 | Bacteria | 2211 |
| 657 | Ga0495661_0064810 | 3300046665 | Bacteria | 2154 |
| 658 | Ga0495661_0070399 | 3300046665 | Bacteria | 2047 |
| 659 | Ga0495661_0087318 | 3300046665 | Bacteria | 1783 |
| 660 | Ga0495661_0134895 | 3300046665 | Bacteria | 1348 |
| 661 | Ga0495661_0138143 | 3300046665 | Bacteria | 1328 |
| 662 | Ga0495661_0186158 | 3300046665 | Bacteria | 1097 |
| 663 | Ga0495661_0208321 | 3300046665 | Bacteria | 1019 |
| 664 | Ga0495588_0000050 | 3300046674 | Bacteria | 335314 |
| 665 | Ga0495588_0004204 | 3300046674 | Bacteria | 6348 |
| 666 | Ga0495588_0005098 | 3300046674 | Bacteria | 5838 |
| 667 | Ga0495588_0014664 | 3300046674 | Bacteria | 3757 |
| 668 | Ga0495588_0039624 | 3300046674 | Bacteria | 2401 |
| 669 | Ga0495623_0011819 | 3300046679 | Bacteria | 5656 |
| 670 | Ga0495646_0249751 | 3300046680 | Bacteria | 951 |
| 671 | Ga0495669_0000177 | 3300046684 | Bacteria | 40130 |
| 672 | Ga0495669_0001901 | 3300046684 | Bacteria | 8561 |
| 673 | Ga0495669_0002014 | 3300046684 | Bacteria | 8331 |
| 674 | Ga0495669_0004319 | 3300046684 | Bacteria | 5865 |
| 675 | Ga0495669_0004923 | 3300046684 | Bacteria | 5543 |
| 676 | Ga0495669_0006645 | 3300046684 | Bacteria | 4837 |
| 677 | Ga0495669_0017491 | 3300046684 | Bacteria | 3077 |
| 678 | Ga0495669_0025856 | 3300046684 | Bacteria | 2563 |
| 679 | Ga0495669_0136775 | 3300046684 | Bacteria | 1155 |
| 680 | Ga0495613_0021419 | 3300046689 | Bacteria | 4819 |
| 681 | Ga0495613_0127856 | 3300046689 | Bacteria | 1821 |
| 682 | Ga0495624_0012500 | 3300046690 | Bacteria | 5799 |
| 683 | Ga0495670_0000099 | 3300046691 | Bacteria | 37893 |
| 684 | Ga0495670_0000845 | 3300046691 | Bacteria | 14804 |
| 685 | Ga0495670_0002249 | 3300046691 | Bacteria | 9520 |
| 686 | Ga0495670_0004826 | 3300046691 | Bacteria | 6621 |
| 687 | Ga0495670_0014837 | 3300046691 | Bacteria | 3835 |
| 688 | Ga0495670_0015496 | 3300046691 | Bacteria | 3745 |
| 689 | Ga0495670_0015603 | 3300046691 | Bacteria | 3732 |
| 690 | Ga0495670_0073028 | 3300046691 | Bacteria | 1738 |
| 691 | Ga0495670_0124261 | 3300046691 | Bacteria | 1342 |
| 692 | Ga0495670_0155901 | 3300046691 | Bacteria | 1198 |
| 693 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 694 | Ga0495671_0000043 | 3300046692 | Bacteria | 163036 |
| 695 | Ga0495671_0000965 | 3300046692 | Bacteria | 20129 |
| 696 | Ga0495671_0001044 | 3300046692 | Bacteria | 19266 |
| 697 | Ga0495671_0002730 | 3300046692 | Bacteria | 11054 |
| 698 | Ga0495671_0003679 | 3300046692 | Bacteria | 9336 |
| 699 | Ga0495671_0009092 | 3300046692 | Bacteria | 5567 |
| 700 | Ga0495671_0013778 | 3300046692 | Bacteria | 4366 |
| 701 | Ga0495671_0020586 | 3300046692 | Bacteria | 3475 |
| 702 | Ga0495671_0027738 | 3300046692 | Bacteria | 2921 |
| 703 | Ga0495671_0055345 | 3300046692 | Bacteria | 1965 |
| 704 | Ga0495649_0000277 | 3300046694 | Bacteria | 45216 |
| 705 | Ga0495649_0000925 | 3300046694 | Bacteria | 23262 |
| 706 | Ga0495649_0001478 | 3300046694 | Bacteria | 17648 |
| 707 | Ga0495649_0002415 | 3300046694 | Bacteria | 13178 |
| 708 | Ga0495649_0007497 | 3300046694 | Bacteria | 6640 |
| 709 | Ga0495649_0009530 | 3300046694 | Bacteria | 5761 |
| 710 | Ga0495649_0013410 | 3300046694 | Bacteria | 4728 |
| 711 | Ga0495649_0021575 | 3300046694 | Bacteria | 3608 |
| 712 | Ga0495649_0024486 | 3300046694 | Bacteria | 3365 |
| 713 | Ga0495649_0033919 | 3300046694 | Bacteria | 2809 |
| 714 | Ga0495649_0037742 | 3300046694 | Bacteria | 2651 |
| 715 | Ga0495649_0123923 | 3300046694 | Bacteria | 1365 |
| 716 | Ga0495589_0000007 | 3300046794 | Bacteria | 276444 |
| 717 | Ga0495589_0000145 | 3300046794 | Bacteria | 65639 |
| 718 | Ga0495589_0002088 | 3300046794 | Bacteria | 11298 |
| 719 | Ga0495589_0008988 | 3300046794 | Bacteria | 5198 |
| 720 | Ga0495589_0017726 | 3300046794 | Bacteria | 3654 |
| 721 | Ga0495589_0022401 | 3300046794 | Bacteria | 3223 |
| 722 | Ga0495589_0038226 | 3300046794 | Bacteria | 2403 |
| 723 | Ga0495589_0047301 | 3300046794 | Bacteria | 2132 |
| 724 | Ga0495589_0052226 | 3300046794 | Bacteria | 2020 |
| 725 | Ga0495589_0059031 | 3300046794 | Bacteria | 1886 |
| 726 | Ga0495589_0062732 | 3300046794 | Bacteria | 1823 |
| 727 | Ga0495589_0103003 | 3300046794 | Bacteria | 1380 |
| 728 | Ga0495589_0126147 | 3300046794 | Bacteria | 1231 |
| 729 | Ga0495660_0000100 | 3300046810 | Bacteria | 92354 |
| 730 | Ga0495660_0000779 | 3300046810 | Bacteria | 23870 |
| 731 | Ga0495660_0002034 | 3300046810 | Bacteria | 13147 |
| 732 | Ga0495660_0002236 | 3300046810 | Bacteria | 12458 |
| 733 | Ga0495660_0004798 | 3300046810 | Bacteria | 8157 |
| 734 | Ga0495660_0006085 | 3300046810 | Bacteria | 7165 |
| 735 | Ga0495660_0007481 | 3300046810 | Bacteria | 6413 |
| 736 | Ga0495660_0011314 | 3300046810 | Bacteria | 5181 |
| 737 | Ga0495660_0011889 | 3300046810 | Bacteria | 5050 |
| 738 | Ga0495660_0013655 | 3300046810 | Bacteria | 4709 |
| 739 | Ga0495660_0015327 | 3300046810 | Bacteria | 4428 |
| 740 | Ga0495660_0059833 | 3300046810 | Bacteria | 2048 |
| 741 | Ga0495660_0114702 | 3300046810 | Bacteria | 1370 |
| 742 | Ga0495581_0013823 | 3300047315 | Bacteria | 4678 |
| 743 | Ga0495581_0069182 | 3300047315 | Bacteria | 2041 |
| 744 | Ga0495604_0017012 | 3300047317 | Bacteria | 5815 |
| 745 | Ga0495604_0062481 | 3300047317 | Bacteria | 2844 |
| 746 | Ga0495604_0323950 | 3300047317 | Bacteria | 1029 |
| 747 | Ga0495636_0010960 | 3300047318 | Bacteria | 3589 |
| 748 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 749 | Ga0495672_0000188 | 3300047320 | Bacteria | 89538 |
| 750 | Ga0495672_0000226 | 3300047320 | Bacteria | 80307 |
| 751 | Ga0495672_0000272 | 3300047320 | Bacteria | 71551 |
| 752 | Ga0495672_0007001 | 3300047320 | Bacteria | 8570 |
| 753 | Ga0495672_0011006 | 3300047320 | Bacteria | 6410 |
| 754 | Ga0495672_0020577 | 3300047320 | Bacteria | 4318 |
| 755 | Ga0495672_0072364 | 3300047320 | Bacteria | 1947 |
| 756 | Ga0495672_0077174 | 3300047320 | Bacteria | 1868 |
| 757 | Ga0495672_0197651 | 3300047320 | Bacteria | 1007 |
| 758 | Ga0495676_0000037 | 3300047321 | Bacteria | 115856 |
| 759 | Ga0495676_0043115 | 3300047321 | Bacteria | 3696 |
| 760 | Ga0495676_0127562 | 3300047321 | Bacteria | 1841 |
| 761 | Ga0495680_0005077 | 3300047322 | Bacteria | 12424 |
| 762 | Ga0495680_0021570 | 3300047322 | Bacteria | 5390 |
| 763 | Ga0495683_0000763 | 3300047323 | Bacteria | 23208 |
| 764 | Ga0495683_0001975 | 3300047323 | Bacteria | 12798 |
| 765 | Ga0495683_0009910 | 3300047323 | Bacteria | 5060 |
| 766 | Ga0495683_0011455 | 3300047323 | Bacteria | 4667 |
| 767 | Ga0495683_0023237 | 3300047323 | Bacteria | 3188 |
| 768 | Ga0495683_0051917 | 3300047323 | Bacteria | 2048 |
| 769 | Ga0495683_0075001 | 3300047323 | Bacteria | 1657 |
| 770 | Ga0495683_0115975 | 3300047323 | Bacteria | 1275 |
| 771 | Ga0495683_0156977 | 3300047323 | Bacteria | 1054 |
| 772 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 773 | Ga0495687_000016 | 3300047443 | Bacteria | 359237 |
| 774 | Ga0495687_000028 | 3300047443 | Bacteria | 293356 |
| 775 | Ga0495687_000417 | 3300047443 | Bacteria | 52512 |
| 776 | Ga0495687_001550 | 3300047443 | Bacteria | 20895 |
| 777 | Ga0495687_046170 | 3300047443 | Bacteria | 1882 |
| 778 | Ga0495675_0101663 | 3300047444 | Bacteria | 1798 |
| 779 | Ga0495677_0000005 | 3300047445 | Bacteria | 243336 |
| 780 | Ga0495677_0000210 | 3300047445 | Bacteria | 26828 |
| 781 | Ga0495677_0000722 | 3300047445 | Bacteria | 13347 |
| 782 | Ga0495677_0002621 | 3300047445 | Bacteria | 7038 |
| 783 | Ga0495677_0003870 | 3300047445 | Bacteria | 5785 |
| 784 | Ga0495677_0005985 | 3300047445 | Bacteria | 4604 |
| 785 | Ga0495677_0011091 | 3300047445 | Bacteria | 3299 |
| 786 | Ga0495677_0017220 | 3300047445 | Bacteria | 2620 |
| 787 | Ga0495677_0020456 | 3300047445 | Bacteria | 2399 |
| 788 | Ga0495677_0125269 | 3300047445 | Bacteria | 981 |
| 789 | Ga0495677_0211802 | 3300047445 | Bacteria | 754 |
| 790 | Ga0495679_002173 | 3300047446 | Bacteria | 10289 |
| 791 | Ga0495679_005976 | 3300047446 | Bacteria | 5320 |
| 792 | Ga0495679_008263 | 3300047446 | Bacteria | 4247 |
| 793 | Ga0495679_022179 | 3300047446 | Bacteria | 2177 |
| 794 | Ga0495679_041848 | 3300047446 | Bacteria | 1416 |
| 795 | Ga0495685_005235 | 3300047447 | Bacteria | 4223 |
| 796 | Ga0495685_019404 | 3300047447 | Bacteria | 2336 |
| 797 | Ga0495685_039044 | 3300047447 | Bacteria | 1625 |
| 798 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 799 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 800 | Ga0495673_0000702 | 3300047469 | Bacteria | 32531 |
| 801 | Ga0495673_0068437 | 3300047469 | Bacteria | 1500 |
| 802 | Ga0495673_0092700 | 3300047469 | Bacteria | 1232 |
| 803 | Ga0495681_0000123 | 3300047470 | Bacteria | 68069 |
| 804 | Ga0495681_0003758 | 3300047470 | Bacteria | 10527 |
| 805 | Ga0495681_0004627 | 3300047470 | Bacteria | 9339 |
| 806 | Ga0495681_0005829 | 3300047470 | Bacteria | 8182 |
| 807 | Ga0495681_0007875 | 3300047470 | Bacteria | 6737 |
| 808 | Ga0495681_0008039 | 3300047470 | Bacteria | 6650 |
| 809 | Ga0495681_0027026 | 3300047470 | Bacteria | 2976 |
| 810 | Ga0495681_0081491 | 3300047470 | Bacteria | 1443 |
| 811 | Ga0495681_0099096 | 3300047470 | Bacteria | 1276 |
| 812 | Ga0495681_0104627 | 3300047470 | Bacteria | 1233 |
| 813 | Ga0495681_0201059 | 3300047470 | Bacteria | 808 |
| 814 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 815 | Ga0495686_0000732 | 3300047472 | Bacteria | 43872 |
| 816 | Ga0495686_0003051 | 3300047472 | Bacteria | 14839 |
| 817 | Ga0495686_0003612 | 3300047472 | Bacteria | 13268 |
| 818 | Ga0495686_0012570 | 3300047472 | Bacteria | 5918 |
| 819 | Ga0495686_0019149 | 3300047472 | Bacteria | 4578 |
| 820 | Ga0495686_0039828 | 3300047472 | Bacteria | 2999 |
| 821 | Ga0495686_0041746 | 3300047472 | Bacteria | 2919 |
| 822 | Ga0495686_0066042 | 3300047472 | Bacteria | 2236 |
| 823 | Ga0495686_0233483 | 3300047472 | Bacteria | 1040 |
| 824 | Ga0495593_0004899 | 3300047673 | Bacteria | 7939 |
| 825 | Ga0495593_0014834 | 3300047673 | Bacteria | 4427 |
| 826 | Ga0495593_0068663 | 3300047673 | Bacteria | 1844 |
| 827 | Ga0495614_0008021 | 3300048089 | Bacteria | 4693 |
| 828 | Ga0495614_0010244 | 3300048089 | Bacteria | 4134 |
| 829 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 830 | Ga0495626_0000322 | 3300048091 | Bacteria | 50407 |
| 831 | Ga0495626_0003241 | 3300048091 | Bacteria | 10532 |
| 832 | Ga0495626_0003747 | 3300048091 | Bacteria | 9576 |
| 833 | Ga0495626_0004117 | 3300048091 | Bacteria | 9034 |
| 834 | Ga0495626_0004329 | 3300048091 | Bacteria | 8751 |
| 835 | Ga0495626_0006298 | 3300048091 | Bacteria | 6769 |
| 836 | Ga0495626_0006531 | 3300048091 | Bacteria | 6624 |
| 837 | Ga0495626_0014964 | 3300048091 | Bacteria | 3980 |
| 838 | Ga0495626_0016531 | 3300048091 | Bacteria | 3744 |
| 839 | Ga0495626_0025116 | 3300048091 | Bacteria | 2916 |
| 840 | Ga0495626_0025984 | 3300048091 | Bacteria | 2858 |
| 841 | Ga0495626_0026914 | 3300048091 | Bacteria | 2798 |
| 842 | Ga0495626_0041785 | 3300048091 | Bacteria | 2156 |
| 843 | Ga0495626_0057082 | 3300048091 | Bacteria | 1786 |
| 844 | Ga0495626_0065753 | 3300048091 | Bacteria | 1640 |
| 845 | Ga0496100_0059302 | 3300048903 | Bacteria | 2514 |
| 846 | Ga0496101_0020477 | 3300048904 | Bacteria | 4530 |
| 847 | Ga0496101_0112071 | 3300048904 | Bacteria | 2055 |
| 848 | Ga0496102_0000931 | 3300048905 | Bacteria | 27579 |
| 849 | Ga0496102_0011417 | 3300048905 | Bacteria | 7657 |
| 850 | Ga0496102_0030581 | 3300048905 | Bacteria | 4820 |
| 851 | Ga0496102_0122227 | 3300048905 | Bacteria | 2432 |
| 852 | Ga0496102_0174486 | 3300048905 | Bacteria | 2024 |
| 853 | Ga0496102_0196686 | 3300048905 | Bacteria | 1900 |
| 854 | Ga0496103_0007939 | 3300048906 | Bacteria | 6308 |
| 855 | Ga0496103_0346197 | 3300048906 | Bacteria | 956 |
| 856 | Ga0496106_0012244 | 3300048909 | Bacteria | 6332 |
| 857 | Ga0496107_0017128 | 3300048910 | Bacteria | 5096 |
| 858 | Ga0496107_0049247 | 3300048910 | Bacteria | 3036 |
| 859 | Ga0496109_0115634 | 3300048912 | Bacteria | 2496 |
| 860 | Ga0496109_0229130 | 3300048912 | Bacteria | 1748 |
| 861 | Ga0496109_0231317 | 3300048912 | Bacteria | 1739 |
| 862 | Ga0496109_0439711 | 3300048912 | Bacteria | 1232 |
| 863 | Ga0496110_0001119 | 3300048913 | Bacteria | 18923 |
| 864 | Ga0496111_0060901 | 3300048914 | Bacteria | 2736 |
| 865 | Ga0496113_0007519 | 3300048916 | Bacteria | 7021 |
| 866 | Ga0496113_0353646 | 3300048916 | Bacteria | 1179 |
| 867 | Ga0496114_0075065 | 3300048917 | Bacteria | 2847 |
| 868 | Ga0496115_0101784 | 3300048918 | Bacteria | 2356 |
| 869 | Ga0496116_0000382 | 3300048919 | Bacteria | 65862 |
| 870 | Ga0496116_0015565 | 3300048919 | Bacteria | 6007 |
| 871 | Ga0496117_0000100 | 3300048920 | Bacteria | 194307 |
| 872 | Ga0496117_0000645 | 3300048920 | Bacteria | 56167 |
| 873 | Ga0496117_0001645 | 3300048920 | Bacteria | 31400 |
| 874 | Ga0496117_0003157 | 3300048920 | Bacteria | 19622 |
| 875 | Ga0496117_0010742 | 3300048920 | Bacteria | 8277 |
| 876 | Ga0496117_0035465 | 3300048920 | Bacteria | 3743 |
| 877 | Ga0496117_0130556 | 3300048920 | Bacteria | 1523 |
| 878 | Ga0496118_0000338 | 3300048921 | Bacteria | 80086 |
| 879 | Ga0496118_0002116 | 3300048921 | Bacteria | 27830 |
| 880 | Ga0496118_0004775 | 3300048921 | Bacteria | 15842 |
| 881 | Ga0496118_0008860 | 3300048921 | Bacteria | 10291 |
| 882 | Ga0496118_0038351 | 3300048921 | Bacteria | 3842 |
| 883 | Ga0496119_0006814 | 3300048922 | Bacteria | 10473 |
| 884 | Ga0496119_0037252 | 3300048922 | Bacteria | 3162 |
| 885 | Ga0496120_0004314 | 3300048923 | Bacteria | 12040 |
| 886 | Ga0496120_0014380 | 3300048923 | Bacteria | 5277 |
| 887 | Ga0496121_0000589 | 3300048924 | Bacteria | 68077 |
| 888 | Ga0496121_0026317 | 3300048924 | Bacteria | 5486 |
| 889 | Ga0496121_0040615 | 3300048924 | Bacteria | 4078 |
| 890 | Ga0496121_0059199 | 3300048924 | Bacteria | 3160 |
| 891 | Ga0496121_0070409 | 3300048924 | Bacteria | 2817 |
| 892 | Ga0496121_0147814 | 3300048924 | Bacteria | 1734 |
| 893 | Ga0496121_0258550 | 3300048924 | Bacteria | 1203 |
| 894 | Ga0496122_0000210 | 3300048925 | Bacteria | 130178 |
| 895 | Ga0496122_0000808 | 3300048925 | Bacteria | 60057 |
| 896 | Ga0496122_0005126 | 3300048925 | Bacteria | 15811 |
| 897 | Ga0496122_0009079 | 3300048925 | Bacteria | 10545 |
| 898 | Ga0496122_0019722 | 3300048925 | Bacteria | 6144 |
| 899 | Ga0496122_0034402 | 3300048925 | Bacteria | 4146 |
| 900 | Ga0496122_0055038 | 3300048925 | Bacteria | 2981 |
| 901 | Ga0496122_0106936 | 3300048925 | Bacteria | 1850 |
| 902 | Ga0496122_0168599 | 3300048925 | Bacteria | 1323 |
| 903 | Ga0496123_0000591 | 3300048926 | Bacteria | 61801 |
| 904 | Ga0496123_0000597 | 3300048926 | Bacteria | 61302 |
| 905 | Ga0496123_0001320 | 3300048926 | Bacteria | 35029 |
| 906 | Ga0496123_0003625 | 3300048926 | Bacteria | 17092 |
| 907 | Ga0496123_0005021 | 3300048926 | Bacteria | 13544 |
| 908 | Ga0496123_0023774 | 3300048926 | Bacteria | 4681 |
| 909 | Ga0496123_0066312 | 3300048926 | Bacteria | 2287 |
| 910 | Ga0496123_0085817 | 3300048926 | Bacteria | 1891 |
| 911 | Ga0496123_0128076 | 3300048926 | Bacteria | 1413 |
| 912 | Ga0496123_0143417 | 3300048926 | Bacteria | 1301 |
| 913 | Ga0496123_0161496 | 3300048926 | Bacteria | 1194 |
| 914 | Ga0496124_0000056 | 3300048927 | Bacteria | 250907 |
| 915 | Ga0496124_0000425 | 3300048927 | Bacteria | 75572 |
| 916 | Ga0496124_0001066 | 3300048927 | Bacteria | 43350 |
| 917 | Ga0496124_0004210 | 3300048927 | Bacteria | 16937 |
| 918 | Ga0496124_0010799 | 3300048927 | Bacteria | 9202 |
| 919 | Ga0496124_0022742 | 3300048927 | Bacteria | 5740 |
| 920 | Ga0496124_0023861 | 3300048927 | Bacteria | 5572 |
| 921 | Ga0496124_0035413 | 3300048927 | Bacteria | 4368 |
| 922 | Ga0496124_0037634 | 3300048927 | Bacteria | 4206 |
| 923 | Ga0496124_0054728 | 3300048927 | Bacteria | 3376 |
| 924 | Ga0496124_0069987 | 3300048927 | Bacteria | 2911 |
| 925 | Ga0496124_0114901 | 3300048927 | Bacteria | 2161 |
| 926 | Ga0496124_0129593 | 3300048927 | Bacteria | 2005 |
| 927 | Ga0496124_0324435 | 3300048927 | Bacteria | 1101 |
| 928 | Ga0496125_0000245 | 3300048928 | Bacteria | 111310 |
| 929 | Ga0496125_0000789 | 3300048928 | Bacteria | 51669 |
| 930 | Ga0496125_0003880 | 3300048928 | Bacteria | 17674 |
| 931 | Ga0496125_0004750 | 3300048928 | Bacteria | 15481 |
| 932 | Ga0496125_0023862 | 3300048928 | Bacteria | 5637 |
| 933 | Ga0496125_0042739 | 3300048928 | Bacteria | 3855 |
| 934 | Ga0496125_0077384 | 3300048928 | Bacteria | 2564 |
| 935 | Ga0496125_0078919 | 3300048928 | Bacteria | 2527 |
| 936 | Ga0496125_0145313 | 3300048928 | Bacteria | 1640 |
| 937 | Ga0496125_0222157 | 3300048928 | Bacteria | 1216 |
| 938 | Ga0496125_0350107 | 3300048928 | Bacteria | 883 |
| 939 | Ga0496126_0022618 | 3300048929 | Bacteria | 6110 |
| 940 | Ga0496126_0101114 | 3300048929 | Bacteria | 2522 |
| 941 | Ga0496126_0125425 | 3300048929 | Bacteria | 2222 |
| 942 | Ga0496126_0406116 | 3300048929 | Bacteria | 1104 |
| 943 | Ga0495678_000006 | 3300049459 | Bacteria | 463690 |
| 944 | Ga0495678_000130 | 3300049459 | Bacteria | 88909 |
| 945 | Ga0495678_000233 | 3300049459 | Bacteria | 63499 |
| 946 | Ga0495678_001703 | 3300049459 | Bacteria | 16504 |
| 947 | Ga0495678_001985 | 3300049459 | Bacteria | 14727 |
| 948 | Ga0495678_002123 | 3300049459 | Bacteria | 14081 |
| 949 | Ga0495678_018410 | 3300049459 | Bacteria | 3141 |
| 950 | Ga0495678_020704 | 3300049459 | Bacteria | 2906 |
| 951 | Ga0495682_0000107 | 3300049460 | Bacteria | 73486 |
| 952 | Ga0495682_0001172 | 3300049460 | Bacteria | 14944 |
| 953 | Ga0495682_0011704 | 3300049460 | Bacteria | 3371 |
| 954 | Ga0495682_0030101 | 3300049460 | Bacteria | 2009 |
| 955 | Ga0495682_0068963 | 3300049460 | Bacteria | 1273 |
| 956 | Ga0495682_0085817 | 3300049460 | Bacteria | 1131 |
| 957 | Ga0501032_0189417 | 3300049569 | Bacteria | 1345 |
| 958 | Ga0501034_0166710 | 3300049571 | Bacteria | 2171 |
| 959 | Ga0501034_0191130 | 3300049571 | Bacteria | 2009 |
| 960 | Ga0501034_0339289 | 3300049571 | Bacteria | 1433 |
| 961 | Ga0501034_0505333 | 3300049571 | Bacteria | 1122 |
| 962 | Ga0501047_0235227 | 3300049581 | Bacteria | 1684 |
| 963 | Ga0501227_005034 | 3300049665 | Bacteria | 2838 |
| 964 | Ga0501249_004483 | 3300049679 | Bacteria | 2836 |
| 965 | Ga0501269_000016 | 3300049766 | Bacteria | 58863 |
| 966 | Ga0501269_001654 | 3300049766 | Bacteria | 2850 |
| 967 | Ga0501035_0018733 | 3300049822 | Bacteria | 6376 |
| 968 | Ga0501035_0148309 | 3300049822 | Bacteria | 2037 |
| 969 | Ga0501044_0177987 | 3300049823 | Bacteria | 2095 |
| 970 | Ga0501044_0389883 | 3300049823 | Bacteria | 1307 |
| 971 | nmdc:mga03n38_225856_c1 | 3300050490 | Bacteria | 979 |
| 972 | nmdc:mga00v17_23_c1 | 3300050491 | Bacteria | 43132 |
| 973 | nmdc:mga00v17_33669_c1 | 3300050491 | Bacteria | 3037 |
| 974 | nmdc:mga00v17_62366_c1 | 3300050491 | Bacteria | 2293 |
| 975 | Ga0500643_000362 | 3300053087 | Bacteria | 35932 |
| 976 | Ga0500641_0072413 | 3300053096 | Bacteria | 1452 |
| 977 | Ga0500555_000370 | 3300053103 | Bacteria | 19042 |
| 978 | Ga0500618_000088 | 3300053125 | Bacteria | 74892 |
| 979 | Ga0500618_000519 | 3300053125 | Bacteria | 24282 |
| 980 | Ga0500618_009889 | 3300053125 | Bacteria | 2585 |
| 981 | Ga0500559_0004652 | 3300053136 | Bacteria | 6469 |
| 982 | Ga0500564_178817 | 3300053138 | Bacteria | 886 |
| 983 | Ga0500568_0023303 | 3300053139 | Bacteria | 2634 |
| 984 | Ga0500604_0014012 | 3300053151 | Bacteria | 2179 |
| 985 | Ga0500627_0008381 | 3300053158 | Bacteria | 3668 |
| 986 | Ga0500634_0000386 | 3300053161 | Bacteria | 14126 |
| 987 | Ga0587084_000853 | 3300059477 | Bacteria | 2651 |
| 988 | Ga0587066_001081 | 3300059490 | Bacteria | 2609 |
| 989 | Ga0587070_001403 | 3300059491 | Bacteria | 2477 |
| 990 | Ga0587077_003339 | 3300059493 | Bacteria | 2008 |
| 991 | Ga0587085_005580 | 3300059506 | Bacteria | 1488 |
| 992 | Ga0587090_004877 | 3300059510 | Bacteria | 1653 |
| 993 | Ga0587091_002339 | 3300059511 | Bacteria | 2231 |
| 994 | Ga0587101_001671 | 3300059623 | Bacteria | 1965 |
| 995 | Ga0587109_008309 | 3300059624 | Bacteria | 1598 |
| 996 | Ga0587117_004643 | 3300059627 | Bacteria | 1442 |
| 997 | Ga0587062_002637 | 3300059639 | Bacteria | 1732 |
| 998 | Ga0587067_003478 | 3300059640 | Bacteria | 1971 |
| 999 | Ga0587076_001114 | 3300059645 | Bacteria | 2622 |
| 1000 | Ga0587100_000181 | 3300059648 | Bacteria | 2598 |
| 1001 | Ga0587111_0008704 | 3300060346 | Bacteria | 1691 |
| 1002 | 2501081278 | 2501025502 | Bacteria | 9641094 |
| 1003 | 2501412208 | 2501025504 | Bacteria | 8008976 |
| 1004 | 2511094266 | 2510917013 | Bacteria | 9951648 |
| 1005 | 2511101645 | 2510917014 | Bacteria | 8296963 |
| 1006 | 2511127402 | 2510917021 | Bacteria | 5705459 |
| 1007 | 2511265866 | 2511231006 | Bacteria | 6794709 |
| 1008 | 2511386320 | 2511231026 | Bacteria | 5225445 |
| 1009 | 2512329148 | 2512047018 | Bacteria | 6663241 |
| 1010 | 2512641806 | 2512564014 | Bacteria | 4639632 |
| 1011 | 2516020977 | 2515154189 | Bacteria | 9629850 |
| 1012 | 2547501460 | 2547132130 | Bacteria | 4660562 |
| 1013 | 2555670074 | 2554235341 | Bacteria | 6867980 |
| 1014 | 2583792341 | 2582580891 | Bacteria | 6800976 |
| 1015 | 2597858049 | 2597489887 | Bacteria | 6666321 |
| 1016 | 2597863717 | 2597489888 | Bacteria | 6179543 |
| 1017 | 2599352892 | 2599185160 | Bacteria | 6844013 |
| 1018 | 2599359237 | 2599185161 | Bacteria | 6960462 |
| 1019 | 2599365242 | 2599185162 | Bacteria | 6957254 |
| 1020 | 2599371931 | 2599185163 | Bacteria | 6995158 |
| 1021 | 2599378000 | 2599185164 | Bacteria | 6841688 |
| 1022 | 2599384623 | 2599185165 | Bacteria | 6843250 |
| 1023 | 2599390789 | 2599185166 | Bacteria | 6959206 |
| 1024 | 2599401838 | 2599185167 | Bacteria | 6353609 |
| 1025 | 2599402974 | 2599185168 | Bacteria | 6997636 |
| 1026 | 2599448427 | 2599185178 | Bacteria | 5365746 |
| 1027 | 2599453971 | 2599185179 | Bacteria | 6611171 |
| 1028 | 2599459726 | 2599185181 | Bacteria | 6844519 |
| 1029 | 2599465935 | 2599185182 | Bacteria | 6883168 |
| 1030 | 2599485082 | 2599185185 | Bacteria | 6652270 |
| 1031 | 2599488747 | 2599185186 | Bacteria | 6831633 |
| 1032 | 2599509180 | 2599185189 | Bacteria | 5862825 |
| 1033 | 2599515545 | 2599185190 | Bacteria | 6285678 |
| 1034 | 2599521350 | 2599185191 | Bacteria | 6297582 |
| 1035 | 2599802695 | 2599185257 | Bacteria | 6492581 |
| 1036 | 2599881171 | 2599185288 | Bacteria | 6666191 |
| 1037 | 2599894924 | 2599185290 | Bacteria | 6289611 |
| 1038 | 2599949544 | 2599185303 | Bacteria | 6512725 |
| 1039 | 2600212333 | 2599185356 | Bacteria | 6843884 |
| 1040 | 2600366655 | 2600254931 | Bacteria | 6734225 |
| 1041 | 2600446158 | 2600254954 | Bacteria | 5100516 |
| 1042 | 2601690471 | 2600255296 | Bacteria | 5784754 |
| 1043 | 2601772501 | 2600255313 | Bacteria | 6842543 |
| 1044 | 2602008040 | 2600255389 | Bacteria | 5275336 |
| 1045 | 2643800573 | 2643221556 | Bacteria | 7251154 |
| 1046 | 2643869799 | 2643221571 | Bacteria | 6228673 |
| 1047 | 2643949730 | 2643221588 | Bacteria | 3692460 |
| 1048 | 2644133894 | 2643221623 | Bacteria | 5239945 |
| 1049 | 2644214045 | 2643221638 | Bacteria | 6579467 |
| 1050 | 2644470690 | 2643221684 | Bacteria | 7145183 |
| 1051 | 2644621043 | 2643221713 | Bacteria | 6554480 |
| 1052 | 2671095531 | 2667528171 | Bacteria | 6900659 |
| 1053 | 2671769684 | 2671180172 | Bacteria | 6495783 |
| 1054 | 2677901038 | 2675903420 | Bacteria | 6247433 |
| 1055 | 2691331382 | 2690315857 | Bacteria | 4396207 |
| 1056 | 2723248999 | 2721755607 | Bacteria | 5841722 |
| 1057 | 2738810409 | 2738541294 | Bacteria | 6925949 |
| 1058 | 2738826346 | 2738541297 | Bacteria | 6549566 |
| 1059 | 2738897769 | 2738541309 | Bacteria | 6926455 |
| 1060 | 2739150143 | 2738541357 | Bacteria | 6549408 |
| 1061 | 2739192062 | 2738543003 | Bacteria | 6549560 |
| 1062 | 2739288474 | 2738543020 | Bacteria | 5718238 |
| 1063 | 2739293786 | 2738543021 | Bacteria | 5718241 |
| 1064 | 2739318539 | 2738543026 | Bacteria | 6549408 |
| 1065 | 2739336780 | 2738543029 | Bacteria | 6549249 |
| 1066 | 2743737515 | 2740892503 | Bacteria | 6855563 |
| 1067 | 2758640644 | 2758568016 | Bacteria | 5645291 |
| 1068 | 2808978416 | 2808606385 | Bacteria | 6711065 |
| 1069 | 2808994057 | 2808606388 | Bacteria | 6706662 |
| 1070 | 2809143300 | 2808606418 | Bacteria | 6724496 |
| 1071 | 2819700992 | 2818991464 | Bacteria | 6907494 |
| 1072 | 2821134854 | 2821131069 | Bacteria | 6108407 |
| 1073 | 2821444546 | 2821443989 | Bacteria | 7658172 |
| 1074 | 2823421295 | 2823421272 | Bacteria | 5372474 |
| 1075 | 2834030082 | 2834028612 | Bacteria | 6354979 |
| 1076 | 2834643344 | 2834641062 | Bacteria | 5559922 |
| 1077 | 2842715698 | 2842711865 | Bacteria | 7155354 |
| 1078 | 2842831616 | 2842826826 | Bacteria | 5974129 |
| 1079 | 2842840132 | 2842837860 | Bacteria | 6066181 |
| 1080 | 2842858020 | 2842854478 | Bacteria | 6143501 |
| 1081 | 2844670692 | 2844665904 | Bacteria | 6817974 |
| 1082 | 2852617558 | 2852612431 | Bacteria | 6885235 |
| 1083 | 2852672323 | 2852667396 | Bacteria | 6885555 |
| 1084 | 2855732292 | 2855730933 | Bacteria | 7047938 |
| 1085 | 2855769000 | 2855767633 | Bacteria | 7049357 |
| 1086 | 2857358052 | 2857357740 | Bacteria | 9937880 |
| 1087 | 2857553374 | 2857553236 | Bacteria | 6166726 |
| 1088 | 2857563351 | 2857558681 | Bacteria | 6617694 |
| 1089 | 2857569760 | 2857564685 | Bacteria | 6290584 |
| 1090 | 2882809192 | 2882806704 | Bacteria | 3007728 |
| 1091 | 2883089071 | 2883087390 | Bacteria | 9532701 |
| 1092 | 2895501889 | 2895498888 | Bacteria | 5283788 |
| 1093 | 2895517554 | 2895511927 | Bacteria | 6802080 |
| 1094 | 2895526189 | 2895525241 | Bacteria | 3388457 |
| 1095 | 2904428222 | 2904424332 | Bacteria | 7633521 |
| 1096 | 2917073897 | 2917070673 | Bacteria | 6868303 |
| 1097 | 2919046776 | 2919046199 | Bacteria | 5567169 |
| 1098 | 2919136880 | 2919134579 | Bacteria | 4480386 |
| 1099 | 2919479716 | 2919476304 | Bacteria | 5888696 |
| 1100 | 2919502916 | 2919501602 | Bacteria | 5286340 |
| 1101 | 2919534945 | 2919534386 | Bacteria | 4577686 |
| 1102 | 2923156556 | 2923153595 | Bacteria | 6870622 |
| 1103 | 2926064589 | 2926063275 | Bacteria | 5285848 |
| 1104 | 2929192820 | 2929189879 | Bacteria | 5930554 |
| 1105 | 2931394224 | 2931390751 | Bacteria | 6273349 |
| 1106 | 2935357048 | 2935353572 | Unclassified | 6955622 |
| 1107 | 2939608774 | 2939607340 | Bacteria | 4719256 |
| 1108 | 2939636014 | 2939631187 | Bacteria | 6118131 |
| 1109 | 2945933753 | 2945928738 | Bacteria | 6053221 |
| 1110 | 2945963935 | 2945961074 | Bacteria | 7342064 |
| 1111 | 2946010172 | 2946006987 | Bacteria | 6705746 |
| 1112 | 2946031158 | 2946027586 | Bacteria | 6049274 |
| 1113 | 2947237556 | 2947233263 | Bacteria | 6439278 |
| 1114 | 2984289518 | 2984286254 | Bacteria | 6702062 |
| 1115 | 2987607663 | 2987605356 | Bacteria | 4187822 |
| 1116 | 2990710726 | 2990703756 | Bacteria | 7715990 |
| 1117 | 3007254912 | 3007252601 | Bacteria | 4559114 |
| 1118 | 3007316287 | 3007315729 | Bacteria | 5076637 |
| 1119 | 3007395940 | 3007395558 | Bacteria | 6755444 |
| 1120 | 637320439 | 637000220 | Bacteria | 7074893 |
| 1121 | 8003402591 | 8003400568 | Bacteria | 5535898 |
| 1122 | 8015690750 | 8015687852 | Bacteria | 6613826 |
| 1123 | 8019773250 | 8019769354 | Bacteria | 6924660 |
| 1124 | 8047677569 | 8047673197 | Bacteria | 7395230 |
| 1125 | 8054286389 | 8054285046 | Bacteria | 6919322 |
| 1126 | 8054348165 | 8054347763 | Bacteria | 5901107 |
| 1127 | 8054359281 | 8054357960 | Bacteria | 2867777 |
| 1128 | 8054505932 | 8054503363 | Bacteria | 6101651 |
| 1129 | 8055100099 | 8055097453 | Bacteria | 4865496 |
| 1130 | 8055773887 | 8055770955 | Bacteria | 6827675 |
| 1131 | 8055820576 | 8055817908 | Bacteria | 6609162 |
| 1132 | 8056134978 | 8056131705 | Bacteria | 6107031 |
| 1133 | 8056146549 | 8056143049 | Bacteria | 6307666 |
| 1134 | 8056154544 | 8056148874 | Bacteria | 6479865 |
| 1135 | 8056166363 | 8056161164 | Bacteria | 6106669 |
| 1136 | 8057309339 | 8057304971 | Bacteria | 4649742 |
| 1137 | 8057800578 | 8057798959 | Bacteria | 6713499 |
| 1138 | Ga0466982_0000040 | |||
| 1139 | JGI24741J21665_1000149 | |||
| 1140 | JGI24740J21852_10003968 | |||
| 1141 | JGI25156J39149_1011038 | |||
| 1142 | JGI25162J39368_1000004 | |||
| 1143 | JGI25162J39368_1003457 | |||
| 1144 | JGI25154J39366_1000359 | |||
| 1145 | JGI25163J39215_1000047 | |||
| 1146 | JGI25164J39214_1000031 | |||
| 1147 | JGI25159J45721_1000757 | |||
| 1148 | JGI25165J46597_1000011 | |||
| 1149 | rootL2_10031707 | |||
| 1150 | Ga0055538_1000123 | |||
| 1151 | Ga0055538_1004657 | |||
| 1152 | Ga0055539_1000073 | |||
| 1153 | Ga0055539_1000167 | |||
| 1154 | Ga0055533_1000171 | |||
| 1155 | Ga0055533_1005112 | |||
| 1156 | Ga0055533_1005878 | |||
| 1157 | Ga0055532_1000090 | |||
| 1158 | Ga0055532_1000159 | |||
| 1159 | Ga0055525_1000232 | |||
| 1160 | Ga0055525_1000383 | |||
| 1161 | Ga0055527_1000479 | |||
| 1162 | Ga0055535_1000085 | |||
| 1163 | Ga0055535_1006235 | |||
| 1164 | Ga0055529_1000134 | |||
| 1165 | Ga0055526_1000007 | |||
| 1166 | Ga0055526_1000116 | |||
| 1167 | Ga0055536_1000014 | |||
| 1168 | Ga0055536_1000820 | |||
| 1169 | Ga0055530_10000126 | |||
| 1170 | Ga0055530_10000182 | |||
| 1171 | Ga0055530_10000529 | |||
| 1172 | Ga0055540_1000566 | |||
| 1173 | Ga0055531_10000165 | |||
| 1174 | Ga0055531_10001146 | |||
| 1175 | Ga0055541_1000112 | |||
| 1176 | Ga0055541_1009305 | |||
| 1177 | Ga0058692_1000002 | |||
| 1178 | Ga0055543_1002524 | |||
| 1179 | Ga0065165_1000005 | |||
| 1180 | Ga0065165_1000286 | |||
| 1181 | Ga0065714_10064654 | |||
| 1182 | Ga0065704_10071150 | |||
| 1183 | Ga0065704_10092201 | |||
| 1184 | Ga0065704_10135927 | |||
| 1185 | Ga0065712_10009916 | |||
| 1186 | Ga0070658_10583537 | |||
| 1187 | Ga0070670_100000087 | |||
| 1188 | Ga0070670_100001916 | |||
| 1189 | Ga0070660_100511446 | |||
| 1190 | Ga0070661_100000141 | |||
| 1191 | Ga0070661_100004776 | |||
| 1192 | Ga0070669_100009854 | |||
| 1193 | Ga0070663_100000034 | |||
| 1194 | Ga0070662_100005950 | |||
| 1195 | Ga0070662_100203365 | |||
| 1196 | Ga0068867_100283963 | |||
| 1197 | Ga0068853_100077825 | |||
| 1198 | Ga0070665_100000335 | |||
| 1199 | Ga0070664_100000044 | |||
| 1200 | Ga0070664_100000057 | |||
| 1201 | Ga0070664_100051154 | |||
| 1202 | Ga0068854_100000937 | |||
| 1203 | Ga0068856_100004528 | |||
| 1204 | Ga0068852_100115207 | |||
| 1205 | Ga0068851_10000752 | |||
| 1206 | Ga0068851_10215765 | |||
| 1207 | Ga0075363_100130804 | |||
| 1208 | Ga0075364_10012986 | |||
| 1209 | Ga0075364_10034882 | |||
| 1210 | Ga0079104_1006764 | |||
| 1211 | Ga0099826_10000013 | |||
| 1212 | Ga0105251_10003715 | |||
| 1213 | Ga0105251_10005101 | |||
| 1214 | Ga0105251_10013329 | |||
| 1215 | Ga0105251_10039117 | |||
| 1216 | Ga0105251_10055154 | |||
| 1217 | Ga0105244_10000014 | |||
| 1218 | Ga0105244_10000134 | |||
| 1219 | Ga0105244_10002934 | |||
| 1220 | Ga0105244_10015891 | |||
| 1221 | Ga0105244_10050756 | |||
| 1222 | Ga0105244_10206415 | |||
| 1223 | Ga0105250_10000661 | |||
| 1224 | Ga0105250_10021366 | |||
| 1225 | Ga0105240_10031977 | |||
| 1226 | Ga0105240_10042292 | |||
| 1227 | Ga0105243_10007675 | |||
| 1228 | Ga0105243_10014001 | |||
| 1229 | Ga0105243_10062782 | |||
| 1230 | Ga0105241_10071225 | |||
| 1231 | Ga0105242_10000661 | |||
| 1232 | Ga0105237_10000116 | |||
| 1233 | Ga0105237_10053888 | |||
| 1234 | Ga0105237_10181195 | |||
| 1235 | Ga0105237_10359267 | |||
| 1236 | Ga0105238_10217878 | |||
| 1237 | Ga0105246_10001733 | |||
| 1238 | Ga0105246_10011605 | |||
| 1239 | Ga0157373_10006159 | |||
| 1240 | Ga0157373_10009246 | |||
| 1241 | Ga0157373_10011962 | |||
| 1242 | Ga0157373_10025897 | |||
| 1243 | Ga0157371_10000323 | |||
| 1244 | Ga0157371_10004329 | |||
| 1245 | Ga0157370_10000038 | |||
| 1246 | Ga0157370_10018703 | |||
| 1247 | Ga0157370_10024498 | |||
| 1248 | Ga0157369_10003855 | |||
| 1249 | Ga0157369_10007043 | |||
| 1250 | Ga0157369_10007727 | |||
| 1251 | Ga0157369_10034990 | |||
| 1252 | Ga0157369_10037652 | |||
| 1253 | Ga0163162_10085005 | |||
| 1254 | Ga0157372_10000776 | |||
| 1255 | Ga0157372_10323738 | |||
| 1256 | Ga0157372_10604177 | |||
| 1257 | Ga0157375_10003691 | |||
| 1258 | Ga0157375_10007576 | |||
| 1259 | Ga0157375_10121243 | |||
| 1260 | Ga0182008_10000261 | |||
| 1261 | Ga0182008_10001346 | |||
| 1262 | Ga0182008_10003524 | |||
| 1263 | Ga0157379_10186755 | |||
| 1264 | Ga0157376_10082633 | |||
| 1265 | Ga0182006_1000206 | |||
| 1266 | Ga0182006_1002616 | |||
| 1267 | Ga0182006_1004672 | |||
| 1268 | Ga0182007_10003019 | |||
| 1269 | Ga0163161_10007916 | |||
| 1270 | Ga0163161_10008504 | |||
| 1271 | Ga0163161_10011745 | |||
| 1272 | Ga0163161_10013050 | |||
| 1273 | Ga0163161_10015040 | |||
| 1274 | Ga0197907_11440316 | |||
| 1275 | Ga0206356_10624618 | |||
| 1276 | Ga0206351_10978011 | |||
| 1277 | Ga0206351_10989253 | |||
| 1278 | Ga0206350_11491042 | |||
| 1279 | Ga0154015_1552384 | |||
| 1280 | Ga0224712_10002754 | |||
| 1281 | Ga0209435_100840 | |||
| 1282 | Ga0209760_100032 | |||
| 1283 | Ga0209784_100006 | |||
| 1284 | Ga0209784_100058 | |||
| 1285 | Ga0209566_100002 | |||
| 1286 | Ga0209566_100045 | |||
| 1287 | Ga0209674_100096 | |||
| 1288 | Ga0209674_100097 | |||
| 1289 | Ga0209674_100403 | |||
| 1290 | Ga0209672_100208 | |||
| 1291 | Ga0209147_100018 | |||
| 1292 | Ga0209147_100056 | |||
| 1293 | Ga0209563_100007 | |||
| 1294 | Ga0209563_100041 | |||
| 1295 | Ga0209563_100064 | |||
| 1296 | Ga0207427_100003 | |||
| 1297 | Ga0209437_100002 | |||
| 1298 | Ga0209437_101405 | |||
| 1299 | Ga0209258_100028 | |||
| 1300 | Ga0209258_100243 | |||
| 1301 | Ga0209646_1000007 | |||
| 1302 | Ga0209646_1000207 | |||
| 1303 | Ga0209677_100007 | |||
| 1304 | Ga0209677_100053 | |||
| 1305 | Ga0209148_1000640 | |||
| 1306 | Ga0209759_1002850 | |||
| 1307 | Ga0209759_1013956 | |||
| 1308 | Ga0209233_1000004 | |||
| 1309 | Ga0209455_1000107 | |||
| 1310 | Ga0209130_1000254 | |||
| 1311 | Ga0209676_1000003 | |||
| 1312 | Ga0209676_1001558 | |||
| 1313 | Ga0209564_1000010 | |||
| 1314 | Ga0209564_1000202 | |||
| 1315 | Ga0209564_1001636 | |||
| 1316 | Ga0209050_1000004 | |||
| 1317 | Ga0209050_1000010 | |||
| 1318 | Ga0209050_1000069 | |||
| 1319 | Ga0209050_1015681 | |||
| 1320 | Ga0209256_1000921 | |||
| 1321 | Ga0209051_1000006 | |||
| 1322 | Ga0209257_1000027 | |||
| 1323 | Ga0209257_1001484 | |||
| 1324 | Ga0207656_10000394 | |||
| 1325 | Ga0207696_1000041 | |||
| 1326 | Ga0207655_1000002 | |||
| 1327 | Ga0207655_1000022 | |||
| 1328 | Ga0207655_1000063 | |||
| 1329 | Ga0207655_1000191 | |||
| 1330 | Ga0207655_1002838 | |||
| 1331 | Ga0207655_1014974 | |||
| 1332 | Ga0207655_1037820 | |||
| 1333 | Ga0207655_1111208 | |||
| 1334 | Ga0207713_1000004 | |||
| 1335 | Ga0207713_1000682 | |||
| 1336 | Ga0207713_1008675 | |||
| 1337 | Ga0207713_1042527 | |||
| 1338 | Ga0207713_1064545 | |||
| 1339 | Ga0207705_10127390 | |||
| 1340 | Ga0207695_10002492 | |||
| 1341 | Ga0207671_10000166 | |||
| 1342 | Ga0207660_10563602 | |||
| 1343 | Ga0207657_10007356 | |||
| 1344 | Ga0207649_10000056 | |||
| 1345 | Ga0207649_10000111 | |||
| 1346 | Ga0207650_10000418 | |||
| 1347 | Ga0207650_10005379 | |||
| 1348 | Ga0207690_10045688 | |||
| 1349 | Ga0207706_10003731 | |||
| 1350 | Ga0207709_10000982 | |||
| 1351 | Ga0207709_10004470 | |||
| 1352 | Ga0207709_10021519 | |||
| 1353 | Ga0207679_10000036 | |||
| 1354 | Ga0207679_10000105 | |||
| 1355 | Ga0207679_10138463 | |||
| 1356 | Ga0207640_10000154 | |||
| 1357 | Ga0207678_10000106 | |||
| 1358 | Ga0207702_10000135 | |||
| 1359 | Ga0207648_10137021 | |||
| 1360 | Ga0207674_10002847 | |||
| 1361 | Ga0207698_10091909 | |||
| 1362 | Ga0209281_1000379 | |||
| 1363 | Ga0209281_1004003 | |||
| 1364 | Ga0209371_1000004 | |||
| 1365 | Ga0209282_1000043 | |||
| 1366 | Ga0268266_10000335 | |||
| 1367 | Ga0268266_10126077 | |||
| 1368 | Ga0265338_10001178 | |||
| 1369 | Ga0268256_1000005 | |||
| 1370 | Ga0307511_10061742 | |||
| 1371 | Ga0265340_10079217 | |||
| 1372 | Ga0307509_10097343 | |||
| 1373 | Ga0307408_100000028 | |||
| 1374 | Ga0307408_100000074 | |||
| 1375 | Ga0307405_10001861 | |||
| 1376 | Ga0307405_10064245 | |||
| 1377 | Ga0307518_10013348 | |||
| 1378 | Ga0307406_10068905 | |||
| 1379 | Ga0307412_10001662 | |||
| 1380 | Ga0307412_10016685 | |||
| 1381 | Ga0307414_10098460 | |||
| 1382 | Ga0307414_10273285 | |||
| 1383 | Ga0307414_10499323 | |||
| 1384 | Ga0395899_0078640 | |||
| 1385 | Ga0395899_0085802 | |||
| 1386 | Ga0395899_0104362 | |||
| 1387 | Ga0395899_0112424 | |||
| 1388 | Ga0395900_0000162 | |||
| 1389 | Ga0395900_0005262 | |||
| 1390 | Ga0395900_0007334 | |||
| 1391 | Ga0395900_0009391 | |||
| 1392 | Ga0395900_0041333 | |||
| 1393 | Ga0395900_0107327 | |||
| 1394 | Ga0395900_0148447 | |||
| 1395 | Ga0395900_0177587 | |||
| 1396 | Ga0395900_0259394 | |||
| 1397 | Ga0395900_0334831 | |||
| 1398 | Ga0395900_0354717 | |||
| 1399 | Ga0395900_0378589 | |||
| 1400 | Ga0395898_0002086 | |||
| 1401 | Ga0395898_0023727 | |||
| 1402 | Ga0395898_0046474 | |||
| 1403 | Ga0395898_0050881 | |||
| 1404 | Ga0395898_0134242 | |||
| 1405 | Ga0395898_0279590 | |||
| 1406 | Ga0395905_0032388 | |||
| 1407 | Ga0395905_0039045 | |||
| 1408 | Ga0395905_0066292 | |||
| 1409 | Ga0395905_0300853 | |||
| 1410 | Ga0395905_0528993 | |||
| 1411 | Ga0395901_0000009 | |||
| 1412 | Ga0395901_0000042 | |||
| 1413 | Ga0395901_0000091 | |||
| 1414 | Ga0395901_0023936 | |||
| 1415 | Ga0395901_0061038 | |||
| 1416 | Ga0395901_0123431 | |||
| 1417 | Ga0395901_0168631 | |||
| 1418 | Ga0395901_0283097 | |||
| 1419 | Ga0395901_0525495 | |||
| 1420 | Ga0439436_0000095 | |||
| 1421 | Ga0439438_000160 | |||
| 1422 | Ga0439438_000190 | |||
| 1423 | Ga0439438_000503 | |||
| 1424 | Ga0439466_0000574 | |||
| 1425 | Ga0439466_0008236 | |||
| 1426 | Ga0439466_0032146 | |||
| 1427 | Ga0439448_0069504 | |||
| 1428 | Ga0439432_005030 | |||
| 1429 | Ga0439432_006082 | |||
| 1430 | Ga0439432_021723 | |||
| 1431 | Ga0450906_012235 | |||
| 1432 | Ga0439464_0000813 | |||
| 1433 | Ga0439464_0005146 | |||
| 1434 | Ga0439464_0018199 | |||
| 1435 | Ga0466972_0002472 | |||
| 1436 | Ga0466972_0003769 | |||
| 1437 | Ga0466972_0054889 | |||
| 1438 | Ga0466965_0001680 | |||
| 1439 | Ga0466966_0031469 | |||
| 1440 | Ga0466966_0270642 | |||
| 1441 | Ga0466961_0142054 | |||
| 1442 | Ga0466971_0137107 | |||
| 1443 | Ga0466968_0006840 | |||
| 1444 | Ga0466970_0007069 | |||
| 1445 | Ga0466970_0099987 | |||
| 1446 | Ga0466958_0108722 | |||
| 1447 | Ga0466967_0746344 | |||
| 1448 | Ga0495617_000002 | |||
| 1449 | Ga0495617_000020 | |||
| 1450 | Ga0495617_000443 | |||
| 1451 | Ga0495617_002156 | |||
| 1452 | Ga0495627_000005 | |||
| 1453 | Ga0495627_000058 | |||
| 1454 | Ga0495627_000207 | |||
| 1455 | Ga0495627_001366 | |||
| 1456 | Ga0495627_027126 | |||
| 1457 | Ga0495627_033386 | |||
| 1458 | Ga0495603_0028731 | |||
| 1459 | Ga0495603_0038059 | |||
| 1460 | Ga0495603_0040631 | |||
| 1461 | Ga0495590_0000025 | |||
| 1462 | Ga0495590_0013996 | |||
| 1463 | Ga0495590_0038493 | |||
| 1464 | Ga0495591_000081 | |||
| 1465 | Ga0495591_000246 | |||
| 1466 | Ga0495591_002486 | |||
| 1467 | Ga0495591_012754 | |||
| 1468 | Ga0495591_016756 | |||
| 1469 | Ga0495629_0080053 | |||
| 1470 | Ga0495638_0007776 | |||
| 1471 | Ga0495638_0011767 | |||
| 1472 | Ga0495638_0029677 | |||
| 1473 | Ga0495638_0061000 | |||
| 1474 | Ga0495638_0070430 | |||
| 1475 | Ga0495638_0192279 | |||
| 1476 | Ga0495653_0000082 | |||
| 1477 | Ga0495653_0015657 | |||
| 1478 | Ga0495653_0019749 | |||
| 1479 | Ga0495653_0033932 | |||
| 1480 | Ga0495653_0049210 | |||
| 1481 | Ga0495650_0000001 | |||
| 1482 | Ga0495650_0000085 | |||
| 1483 | Ga0495650_0000462 | |||
| 1484 | Ga0495650_0001171 | |||
| 1485 | Ga0495650_0001182 | |||
| 1486 | Ga0495650_0053169 | |||
| 1487 | Ga0495582_0111521 | |||
| 1488 | Ga0495605_0000018 | |||
| 1489 | Ga0495605_0000051 | |||
| 1490 | Ga0495605_0000293 | |||
| 1491 | Ga0495605_0011697 | |||
| 1492 | Ga0495605_0019095 | |||
| 1493 | Ga0495605_0027590 | |||
| 1494 | Ga0495605_0029040 | |||
| 1495 | Ga0495605_0035726 | |||
| 1496 | Ga0495605_0057595 | |||
| 1497 | Ga0495605_0063262 | |||
| 1498 | Ga0495605_0108008 | |||
| 1499 | Ga0495605_0109559 | |||
| 1500 | Ga0495584_0000003 | |||
| 1501 | Ga0495584_0000058 | |||
| 1502 | Ga0495584_0000070 | |||
| 1503 | Ga0495584_0029859 | |||
| 1504 | Ga0495584_0062431 | |||
| 1505 | Ga0495584_0079441 | |||
| 1506 | Ga0495584_0083705 | |||
| 1507 | Ga0495584_0116125 | |||
| 1508 | Ga0495585_0000183 | |||
| 1509 | Ga0495585_0000424 | |||
| 1510 | Ga0495585_0000814 | |||
| 1511 | Ga0495585_0005398 | |||
| 1512 | Ga0495585_0006004 | |||
| 1513 | Ga0495585_0010489 | |||
| 1514 | Ga0495585_0017021 | |||
| 1515 | Ga0495585_0017297 | |||
| 1516 | Ga0495585_0030772 | |||
| 1517 | Ga0495585_0043023 | |||
| 1518 | Ga0495585_0043787 | |||
| 1519 | Ga0495585_0050006 | |||
| 1520 | Ga0495585_0088414 | |||
| 1521 | Ga0495585_0093826 | |||
| 1522 | Ga0495594_0000828 | |||
| 1523 | Ga0495594_0002110 | |||
| 1524 | Ga0495594_0054489 | |||
| 1525 | Ga0495594_0242772 | |||
| 1526 | Ga0495596_0000017 | |||
| 1527 | Ga0495596_0000366 | |||
| 1528 | Ga0495596_0000486 | |||
| 1529 | Ga0495596_0000884 | |||
| 1530 | Ga0495596_0000958 | |||
| 1531 | Ga0495596_0002814 | |||
| 1532 | Ga0495596_0002923 | |||
| 1533 | Ga0495596_0010139 | |||
| 1534 | Ga0495596_0010912 | |||
| 1535 | Ga0495596_0011652 | |||
| 1536 | Ga0495596_0012793 | |||
| 1537 | Ga0495596_0014942 | |||
| 1538 | Ga0495596_0016439 | |||
| 1539 | Ga0495596_0020852 | |||
| 1540 | Ga0495596_0024894 | |||
| 1541 | Ga0495596_0087490 | |||
| 1542 | Ga0495607_0000485 | |||
| 1543 | Ga0495607_0001440 | |||
| 1544 | Ga0495607_0001650 | |||
| 1545 | Ga0495607_0004773 | |||
| 1546 | Ga0495607_0004924 | |||
| 1547 | Ga0495607_0006308 | |||
| 1548 | Ga0495607_0009224 | |||
| 1549 | Ga0495607_0015090 | |||
| 1550 | Ga0495607_0019636 | |||
| 1551 | Ga0495607_0063452 | |||
| 1552 | Ga0495583_0000010 | |||
| 1553 | Ga0495583_0000051 | |||
| 1554 | Ga0495583_0000382 | |||
| 1555 | Ga0495583_0001685 | |||
| 1556 | Ga0495583_0003156 | |||
| 1557 | Ga0495583_0004240 | |||
| 1558 | Ga0495583_0005962 | |||
| 1559 | Ga0495583_0006526 | |||
| 1560 | Ga0495583_0021928 | |||
| 1561 | Ga0495583_0030949 | |||
| 1562 | Ga0495583_0036045 | |||
| 1563 | Ga0495583_0039818 | |||
| 1564 | Ga0495583_0055621 | |||
| 1565 | Ga0495583_0098912 | |||
| 1566 | Ga0495606_0000101 | |||
| 1567 | Ga0495606_0000161 | |||
| 1568 | Ga0495606_0000409 | |||
| 1569 | Ga0495606_0001868 | |||
| 1570 | Ga0495606_0003416 | |||
| 1571 | Ga0495606_0010811 | |||
| 1572 | Ga0495606_0017655 | |||
| 1573 | Ga0495606_0027466 | |||
| 1574 | Ga0495606_0089737 | |||
| 1575 | Ga0495610_0000014 | |||
| 1576 | Ga0495610_0000020 | |||
| 1577 | Ga0495610_0000229 | |||
| 1578 | Ga0495610_0000293 | |||
| 1579 | Ga0495610_0001226 | |||
| 1580 | Ga0495610_0019426 | |||
| 1581 | Ga0495610_0024547 | |||
| 1582 | Ga0495610_0069845 | |||
| 1583 | Ga0495616_0000207 | |||
| 1584 | Ga0495616_0000446 | |||
| 1585 | Ga0495616_0000492 | |||
| 1586 | Ga0495616_0000493 | |||
| 1587 | Ga0495616_0002335 | |||
| 1588 | Ga0495616_0008047 | |||
| 1589 | Ga0495616_0008671 | |||
| 1590 | Ga0495616_0011794 | |||
| 1591 | Ga0495616_0017240 | |||
| 1592 | Ga0495616_0019015 | |||
| 1593 | Ga0495616_0020945 | |||
| 1594 | Ga0495616_0025138 | |||
| 1595 | Ga0495616_0029934 | |||
| 1596 | Ga0495616_0034155 | |||
| 1597 | Ga0495616_0034287 | |||
| 1598 | Ga0495616_0073500 | |||
| 1599 | Ga0495616_0115044 | |||
| 1600 | Ga0495616_0172039 | |||
| 1601 | Ga0495620_0004244 | |||
| 1602 | Ga0495620_0005093 | |||
| 1603 | Ga0495620_0034269 | |||
| 1604 | Ga0495620_0053036 | |||
| 1605 | Ga0495630_0034925 | |||
| 1606 | Ga0495631_0000791 | |||
| 1607 | Ga0495631_0002616 | |||
| 1608 | Ga0495631_0003789 | |||
| 1609 | Ga0495631_0004387 | |||
| 1610 | Ga0495631_0005725 | |||
| 1611 | Ga0495631_0016205 | |||
| 1612 | Ga0495631_0016490 | |||
| 1613 | Ga0495631_0025827 | |||
| 1614 | Ga0495631_0040161 | |||
| 1615 | Ga0495631_0044611 | |||
| 1616 | Ga0495631_0052258 | |||
| 1617 | Ga0495631_0054674 | |||
| 1618 | Ga0495631_0084225 | |||
| 1619 | Ga0495631_0106122 | |||
| 1620 | Ga0495631_0127202 | |||
| 1621 | Ga0495631_0160438 | |||
| 1622 | Ga0495632_0000048 | |||
| 1623 | Ga0495632_0000065 | |||
| 1624 | Ga0495632_0000129 | |||
| 1625 | Ga0495632_0000296 | |||
| 1626 | Ga0495632_0000445 | |||
| 1627 | Ga0495632_0002241 | |||
| 1628 | Ga0495632_0013411 | |||
| 1629 | Ga0495632_0013468 | |||
| 1630 | Ga0495632_0014339 | |||
| 1631 | Ga0495632_0018245 | |||
| 1632 | Ga0495632_0023960 | |||
| 1633 | Ga0495632_0025629 | |||
| 1634 | Ga0495637_0000019 | |||
| 1635 | Ga0495637_0000293 | |||
| 1636 | Ga0495637_0003878 | |||
| 1637 | Ga0495637_0015401 | |||
| 1638 | Ga0495637_0023477 | |||
| 1639 | Ga0495637_0025683 | |||
| 1640 | Ga0495637_0031841 | |||
| 1641 | Ga0495637_0046503 | |||
| 1642 | Ga0495637_0047426 | |||
| 1643 | Ga0495643_0000030 | |||
| 1644 | Ga0495643_0000081 | |||
| 1645 | Ga0495643_0000234 | |||
| 1646 | Ga0495643_0000259 | |||
| 1647 | Ga0495643_0000391 | |||
| 1648 | Ga0495643_0003298 | |||
| 1649 | Ga0495643_0005676 | |||
| 1650 | Ga0495643_0038465 | |||
| 1651 | Ga0495643_0039291 | |||
| 1652 | Ga0495643_0045127 | |||
| 1653 | Ga0495643_0110145 | |||
| 1654 | Ga0495643_0114352 | |||
| 1655 | Ga0495643_0135447 | |||
| 1656 | Ga0495644_0005954 | |||
| 1657 | Ga0495644_0013952 | |||
| 1658 | Ga0495644_0022314 | |||
| 1659 | Ga0495644_0026508 | |||
| 1660 | Ga0495644_0039788 | |||
| 1661 | Ga0495644_0082294 | |||
| 1662 | Ga0495648_0000030 | |||
| 1663 | Ga0495648_0001105 | |||
| 1664 | Ga0495648_0002123 | |||
| 1665 | Ga0495648_0002372 | |||
| 1666 | Ga0495648_0003335 | |||
| 1667 | Ga0495648_0006165 | |||
| 1668 | Ga0495648_0016682 | |||
| 1669 | Ga0495648_0020755 | |||
| 1670 | Ga0495648_0024723 | |||
| 1671 | Ga0495663_0000003 | |||
| 1672 | Ga0495663_0017735 | |||
| 1673 | Ga0495663_0056308 | |||
| 1674 | Ga0495663_0077534 | |||
| 1675 | Ga0495666_0001974 | |||
| 1676 | Ga0495666_0071989 | |||
| 1677 | Ga0495666_0120197 | |||
| 1678 | Ga0495642_0000085 | |||
| 1679 | Ga0495642_0000285 | |||
| 1680 | Ga0495642_0002484 | |||
| 1681 | Ga0495642_0004658 | |||
| 1682 | Ga0495642_0032156 | |||
| 1683 | Ga0495642_0055346 | |||
| 1684 | Ga0495642_0064434 | |||
| 1685 | Ga0495642_0092782 | |||
| 1686 | Ga0495652_0033951 | |||
| 1687 | Ga0495654_0000014 | |||
| 1688 | Ga0495654_0002221 | |||
| 1689 | Ga0495654_0032258 | |||
| 1690 | Ga0495654_0041475 | |||
| 1691 | Ga0495654_0053621 | |||
| 1692 | Ga0495654_0054451 | |||
| 1693 | Ga0495665_0000967 | |||
| 1694 | Ga0495665_0002029 | |||
| 1695 | Ga0495665_0230130 | |||
| 1696 | Ga0495586_0005932 | |||
| 1697 | Ga0495586_0348831 | |||
| 1698 | Ga0495587_0012506 | |||
| 1699 | Ga0495587_0047406 | |||
| 1700 | Ga0495609_0000019 | |||
| 1701 | Ga0495609_0000298 | |||
| 1702 | Ga0495609_0000447 | |||
| 1703 | Ga0495609_0001963 | |||
| 1704 | Ga0495609_0002362 | |||
| 1705 | Ga0495609_0004683 | |||
| 1706 | Ga0495609_0005513 | |||
| 1707 | Ga0495609_0011763 | |||
| 1708 | Ga0495609_0017035 | |||
| 1709 | Ga0495609_0039371 | |||
| 1710 | Ga0495609_0071947 | |||
| 1711 | Ga0495597_0000020 | |||
| 1712 | Ga0495597_0000226 | |||
| 1713 | Ga0495597_0000378 | |||
| 1714 | Ga0495597_0000771 | |||
| 1715 | Ga0495597_0010567 | |||
| 1716 | Ga0495597_0027187 | |||
| 1717 | Ga0495597_0049366 | |||
| 1718 | Ga0495597_0059891 | |||
| 1719 | Ga0495597_0079802 | |||
| 1720 | Ga0495622_0000002 | |||
| 1721 | Ga0495622_0001564 | |||
| 1722 | Ga0495622_0020979 | |||
| 1723 | Ga0495622_0038190 | |||
| 1724 | Ga0495622_0055342 | |||
| 1725 | Ga0495622_0115500 | |||
| 1726 | Ga0495633_0000215 | |||
| 1727 | Ga0495633_0002968 | |||
| 1728 | Ga0495633_0003511 | |||
| 1729 | Ga0495633_0006036 | |||
| 1730 | Ga0495633_0009986 | |||
| 1731 | Ga0495633_0030221 | |||
| 1732 | Ga0495633_0033386 | |||
| 1733 | Ga0495633_0044780 | |||
| 1734 | Ga0495633_0051377 | |||
| 1735 | Ga0495633_0091548 | |||
| 1736 | Ga0495633_0102959 | |||
| 1737 | Ga0495633_0143858 | |||
| 1738 | Ga0495656_0009349 | |||
| 1739 | Ga0495656_0009453 | |||
| 1740 | Ga0495656_0012450 | |||
| 1741 | Ga0495656_0127214 | |||
| 1742 | Ga0495656_0129691 | |||
| 1743 | Ga0495668_0000066 | |||
| 1744 | Ga0495668_0000579 | |||
| 1745 | Ga0495668_0000712 | |||
| 1746 | Ga0495668_0000941 | |||
| 1747 | Ga0495668_0006113 | |||
| 1748 | Ga0495668_0008725 | |||
| 1749 | Ga0495668_0014985 | |||
| 1750 | Ga0495668_0018432 | |||
| 1751 | Ga0495668_0025349 | |||
| 1752 | Ga0495668_0026700 | |||
| 1753 | Ga0495668_0028787 | |||
| 1754 | Ga0495634_0110452 | |||
| 1755 | Ga0495611_0000195 | |||
| 1756 | Ga0495611_0000773 | |||
| 1757 | Ga0495611_0005640 | |||
| 1758 | Ga0495611_0012256 | |||
| 1759 | Ga0495611_0013207 | |||
| 1760 | Ga0495611_0021422 | |||
| 1761 | Ga0495625_0000931 | |||
| 1762 | Ga0495625_0003303 | |||
| 1763 | Ga0495625_0006597 | |||
| 1764 | Ga0495625_0007223 | |||
| 1765 | Ga0495625_0008059 | |||
| 1766 | Ga0495625_0009200 | |||
| 1767 | Ga0495625_0009398 | |||
| 1768 | Ga0495625_0016910 | |||
| 1769 | Ga0495625_0042605 | |||
| 1770 | Ga0495625_0045391 | |||
| 1771 | Ga0495625_0053402 | |||
| 1772 | Ga0495625_0070958 | |||
| 1773 | Ga0495625_0079450 | |||
| 1774 | Ga0495625_0262301 | |||
| 1775 | Ga0495635_0080820 | |||
| 1776 | Ga0495661_0000012 | |||
| 1777 | Ga0495661_0001056 | |||
| 1778 | Ga0495661_0001625 | |||
| 1779 | Ga0495661_0001753 | |||
| 1780 | Ga0495661_0002244 | |||
| 1781 | Ga0495661_0002879 | |||
| 1782 | Ga0495661_0003589 | |||
| 1783 | Ga0495661_0005577 | |||
| 1784 | Ga0495661_0019699 | |||
| 1785 | Ga0495661_0025401 | |||
| 1786 | Ga0495661_0025719 | |||
| 1787 | Ga0495661_0025738 | |||
| 1788 | Ga0495661_0029391 | |||
| 1789 | Ga0495661_0032133 | |||
| 1790 | Ga0495661_0036722 | |||
| 1791 | Ga0495661_0042148 | |||
| 1792 | Ga0495661_0054609 | |||
| 1793 | Ga0495661_0062250 | |||
| 1794 | Ga0495661_0064810 | |||
| 1795 | Ga0495661_0070399 | |||
| 1796 | Ga0495661_0087318 | |||
| 1797 | Ga0495661_0134895 | |||
| 1798 | Ga0495661_0138143 | |||
| 1799 | Ga0495661_0186158 | |||
| 1800 | Ga0495661_0208321 | |||
| 1801 | Ga0495588_0000050 | |||
| 1802 | Ga0495588_0004204 | |||
| 1803 | Ga0495588_0005098 | |||
| 1804 | Ga0495588_0014664 | |||
| 1805 | Ga0495588_0039624 | |||
| 1806 | Ga0495623_0011819 | |||
| 1807 | Ga0495646_0249751 | |||
| 1808 | Ga0495669_0000177 | |||
| 1809 | Ga0495669_0001901 | |||
| 1810 | Ga0495669_0002014 | |||
| 1811 | Ga0495669_0004319 | |||
| 1812 | Ga0495669_0004923 | |||
| 1813 | Ga0495669_0006645 | |||
| 1814 | Ga0495669_0017491 | |||
| 1815 | Ga0495669_0025856 | |||
| 1816 | Ga0495669_0136775 | |||
| 1817 | Ga0495613_0021419 | |||
| 1818 | Ga0495613_0127856 | |||
| 1819 | Ga0495624_0012500 | |||
| 1820 | Ga0495670_0000099 | |||
| 1821 | Ga0495670_0000845 | |||
| 1822 | Ga0495670_0002249 | |||
| 1823 | Ga0495670_0004826 | |||
| 1824 | Ga0495670_0014837 | |||
| 1825 | Ga0495670_0015496 | |||
| 1826 | Ga0495670_0015603 | |||
| 1827 | Ga0495670_0073028 | |||
| 1828 | Ga0495670_0124261 | |||
| 1829 | Ga0495670_0155901 | |||
| 1830 | Ga0495671_0000005 | |||
| 1831 | Ga0495671_0000043 | |||
| 1832 | Ga0495671_0000965 | |||
| 1833 | Ga0495671_0001044 | |||
| 1834 | Ga0495671_0002730 | |||
| 1835 | Ga0495671_0003679 | |||
| 1836 | Ga0495671_0009092 | |||
| 1837 | Ga0495671_0013778 | |||
| 1838 | Ga0495671_0020586 | |||
| 1839 | Ga0495671_0027738 | |||
| 1840 | Ga0495671_0055345 | |||
| 1841 | Ga0495649_0000277 | |||
| 1842 | Ga0495649_0000925 | |||
| 1843 | Ga0495649_0001478 | |||
| 1844 | Ga0495649_0002415 | |||
| 1845 | Ga0495649_0007497 | |||
| 1846 | Ga0495649_0009530 | |||
| 1847 | Ga0495649_0013410 | |||
| 1848 | Ga0495649_0021575 | |||
| 1849 | Ga0495649_0024486 | |||
| 1850 | Ga0495649_0033919 | |||
| 1851 | Ga0495649_0037742 | |||
| 1852 | Ga0495649_0123923 | |||
| 1853 | Ga0495589_0000007 | |||
| 1854 | Ga0495589_0000145 | |||
| 1855 | Ga0495589_0002088 | |||
| 1856 | Ga0495589_0008988 | |||
| 1857 | Ga0495589_0017726 | |||
| 1858 | Ga0495589_0022401 | |||
| 1859 | Ga0495589_0038226 | |||
| 1860 | Ga0495589_0047301 | |||
| 1861 | Ga0495589_0052226 | |||
| 1862 | Ga0495589_0059031 | |||
| 1863 | Ga0495589_0062732 | |||
| 1864 | Ga0495589_0103003 | |||
| 1865 | Ga0495589_0126147 | |||
| 1866 | Ga0495660_0000100 | |||
| 1867 | Ga0495660_0000779 | |||
| 1868 | Ga0495660_0002034 | |||
| 1869 | Ga0495660_0002236 | |||
| 1870 | Ga0495660_0004798 | |||
| 1871 | Ga0495660_0006085 | |||
| 1872 | Ga0495660_0007481 | |||
| 1873 | Ga0495660_0011314 | |||
| 1874 | Ga0495660_0011889 | |||
| 1875 | Ga0495660_0013655 | |||
| 1876 | Ga0495660_0015327 | |||
| 1877 | Ga0495660_0059833 | |||
| 1878 | Ga0495660_0114702 | |||
| 1879 | Ga0495581_0013823 | |||
| 1880 | Ga0495581_0069182 | |||
| 1881 | Ga0495604_0017012 | |||
| 1882 | Ga0495604_0062481 | |||
| 1883 | Ga0495604_0323950 | |||
| 1884 | Ga0495636_0010960 | |||
| 1885 | Ga0495672_0000041 | |||
| 1886 | Ga0495672_0000188 | |||
| 1887 | Ga0495672_0000226 | |||
| 1888 | Ga0495672_0000272 | |||
| 1889 | Ga0495672_0007001 | |||
| 1890 | Ga0495672_0011006 | |||
| 1891 | Ga0495672_0020577 | |||
| 1892 | Ga0495672_0072364 | |||
| 1893 | Ga0495672_0077174 | |||
| 1894 | Ga0495672_0197651 | |||
| 1895 | Ga0495676_0000037 | |||
| 1896 | Ga0495676_0043115 | |||
| 1897 | Ga0495676_0127562 | |||
| 1898 | Ga0495680_0005077 | |||
| 1899 | Ga0495680_0021570 | |||
| 1900 | Ga0495683_0000763 | |||
| 1901 | Ga0495683_0001975 | |||
| 1902 | Ga0495683_0009910 | |||
| 1903 | Ga0495683_0011455 | |||
| 1904 | Ga0495683_0023237 | |||
| 1905 | Ga0495683_0051917 | |||
| 1906 | Ga0495683_0075001 | |||
| 1907 | Ga0495683_0115975 | |||
| 1908 | Ga0495683_0156977 | |||
| 1909 | Ga0495687_000003 | |||
| 1910 | Ga0495687_000016 | |||
| 1911 | Ga0495687_000028 | |||
| 1912 | Ga0495687_000417 | |||
| 1913 | Ga0495687_001550 | |||
| 1914 | Ga0495687_046170 | |||
| 1915 | Ga0495675_0101663 | |||
| 1916 | Ga0495677_0000005 | |||
| 1917 | Ga0495677_0000210 | |||
| 1918 | Ga0495677_0000722 | |||
| 1919 | Ga0495677_0002621 | |||
| 1920 | Ga0495677_0003870 | |||
| 1921 | Ga0495677_0005985 | |||
| 1922 | Ga0495677_0011091 | |||
| 1923 | Ga0495677_0017220 | |||
| 1924 | Ga0495677_0020456 | |||
| 1925 | Ga0495677_0125269 | |||
| 1926 | Ga0495677_0211802 | |||
| 1927 | Ga0495679_002173 | |||
| 1928 | Ga0495679_005976 | |||
| 1929 | Ga0495679_008263 | |||
| 1930 | Ga0495679_022179 | |||
| 1931 | Ga0495679_041848 | |||
| 1932 | Ga0495685_005235 | |||
| 1933 | Ga0495685_019404 | |||
| 1934 | Ga0495685_039044 | |||
| 1935 | Ga0495673_0000008 | |||
| 1936 | Ga0495673_0000012 | |||
| 1937 | Ga0495673_0000702 | |||
| 1938 | Ga0495673_0068437 | |||
| 1939 | Ga0495673_0092700 | |||
| 1940 | Ga0495681_0000123 | |||
| 1941 | Ga0495681_0003758 | |||
| 1942 | Ga0495681_0004627 | |||
| 1943 | Ga0495681_0005829 | |||
| 1944 | Ga0495681_0007875 | |||
| 1945 | Ga0495681_0008039 | |||
| 1946 | Ga0495681_0027026 | |||
| 1947 | Ga0495681_0081491 | |||
| 1948 | Ga0495681_0099096 | |||
| 1949 | Ga0495681_0104627 | |||
| 1950 | Ga0495681_0201059 | |||
| 1951 | Ga0495686_0000054 | |||
| 1952 | Ga0495686_0000732 | |||
| 1953 | Ga0495686_0003051 | |||
| 1954 | Ga0495686_0003612 | |||
| 1955 | Ga0495686_0012570 | |||
| 1956 | Ga0495686_0019149 | |||
| 1957 | Ga0495686_0039828 | |||
| 1958 | Ga0495686_0041746 | |||
| 1959 | Ga0495686_0066042 | |||
| 1960 | Ga0495686_0233483 | |||
| 1961 | Ga0495593_0004899 | |||
| 1962 | Ga0495593_0014834 | |||
| 1963 | Ga0495593_0068663 | |||
| 1964 | Ga0495614_0008021 | |||
| 1965 | Ga0495614_0010244 | |||
| 1966 | Ga0495626_0000004 | |||
| 1967 | Ga0495626_0000322 | |||
| 1968 | Ga0495626_0003241 | |||
| 1969 | Ga0495626_0003747 | |||
| 1970 | Ga0495626_0004117 | |||
| 1971 | Ga0495626_0004329 | |||
| 1972 | Ga0495626_0006298 | |||
| 1973 | Ga0495626_0006531 | |||
| 1974 | Ga0495626_0014964 | |||
| 1975 | Ga0495626_0016531 | |||
| 1976 | Ga0495626_0025116 | |||
| 1977 | Ga0495626_0025984 | |||
| 1978 | Ga0495626_0026914 | |||
| 1979 | Ga0495626_0041785 | |||
| 1980 | Ga0495626_0057082 | |||
| 1981 | Ga0495626_0065753 | |||
| 1982 | Ga0496100_0059302 | |||
| 1983 | Ga0496101_0020477 | |||
| 1984 | Ga0496101_0112071 | |||
| 1985 | Ga0496102_0000931 | |||
| 1986 | Ga0496102_0011417 | |||
| 1987 | Ga0496102_0030581 | |||
| 1988 | Ga0496102_0122227 | |||
| 1989 | Ga0496102_0174486 | |||
| 1990 | Ga0496102_0196686 | |||
| 1991 | Ga0496103_0007939 | |||
| 1992 | Ga0496103_0346197 | |||
| 1993 | Ga0496106_0012244 | |||
| 1994 | Ga0496107_0017128 | |||
| 1995 | Ga0496107_0049247 | |||
| 1996 | Ga0496109_0115634 | |||
| 1997 | Ga0496109_0229130 | |||
| 1998 | Ga0496109_0231317 | |||
| 1999 | Ga0496109_0439711 | |||
| 2000 | Ga0496110_0001119 | |||
| 2001 | Ga0496111_0060901 | |||
| 2002 | Ga0496113_0007519 | |||
| 2003 | Ga0496113_0353646 | |||
| 2004 | Ga0496114_0075065 | |||
| 2005 | Ga0496115_0101784 | |||
| 2006 | Ga0496116_0000382 | |||
| 2007 | Ga0496116_0015565 | |||
| 2008 | Ga0496117_0000100 | |||
| 2009 | Ga0496117_0000645 | |||
| 2010 | Ga0496117_0001645 | |||
| 2011 | Ga0496117_0003157 | |||
| 2012 | Ga0496117_0010742 | |||
| 2013 | Ga0496117_0035465 | |||
| 2014 | Ga0496117_0130556 | |||
| 2015 | Ga0496118_0000338 | |||
| 2016 | Ga0496118_0002116 | |||
| 2017 | Ga0496118_0004775 | |||
| 2018 | Ga0496118_0008860 | |||
| 2019 | Ga0496118_0038351 | |||
| 2020 | Ga0496119_0006814 | |||
| 2021 | Ga0496119_0037252 | |||
| 2022 | Ga0496120_0004314 | |||
| 2023 | Ga0496120_0014380 | |||
| 2024 | Ga0496121_0000589 | |||
| 2025 | Ga0496121_0026317 | |||
| 2026 | Ga0496121_0040615 | |||
| 2027 | Ga0496121_0059199 | |||
| 2028 | Ga0496121_0070409 | |||
| 2029 | Ga0496121_0147814 | |||
| 2030 | Ga0496121_0258550 | |||
| 2031 | Ga0496122_0000210 | |||
| 2032 | Ga0496122_0000808 | |||
| 2033 | Ga0496122_0005126 | |||
| 2034 | Ga0496122_0009079 | |||
| 2035 | Ga0496122_0019722 | |||
| 2036 | Ga0496122_0034402 | |||
| 2037 | Ga0496122_0055038 | |||
| 2038 | Ga0496122_0106936 | |||
| 2039 | Ga0496122_0168599 | |||
| 2040 | Ga0496123_0000591 | |||
| 2041 | Ga0496123_0000597 | |||
| 2042 | Ga0496123_0001320 | |||
| 2043 | Ga0496123_0003625 | |||
| 2044 | Ga0496123_0005021 | |||
| 2045 | Ga0496123_0023774 | |||
| 2046 | Ga0496123_0066312 | |||
| 2047 | Ga0496123_0085817 | |||
| 2048 | Ga0496123_0128076 | |||
| 2049 | Ga0496123_0143417 | |||
| 2050 | Ga0496123_0161496 | |||
| 2051 | Ga0496124_0000056 | |||
| 2052 | Ga0496124_0000425 | |||
| 2053 | Ga0496124_0001066 | |||
| 2054 | Ga0496124_0004210 | |||
| 2055 | Ga0496124_0010799 | |||
| 2056 | Ga0496124_0022742 | |||
| 2057 | Ga0496124_0023861 | |||
| 2058 | Ga0496124_0035413 | |||
| 2059 | Ga0496124_0037634 | |||
| 2060 | Ga0496124_0054728 | |||
| 2061 | Ga0496124_0069987 | |||
| 2062 | Ga0496124_0114901 | |||
| 2063 | Ga0496124_0129593 | |||
| 2064 | Ga0496124_0324435 | |||
| 2065 | Ga0496125_0000245 | |||
| 2066 | Ga0496125_0000789 | |||
| 2067 | Ga0496125_0003880 | |||
| 2068 | Ga0496125_0004750 | |||
| 2069 | Ga0496125_0023862 | |||
| 2070 | Ga0496125_0042739 | |||
| 2071 | Ga0496125_0077384 | |||
| 2072 | Ga0496125_0078919 | |||
| 2073 | Ga0496125_0145313 | |||
| 2074 | Ga0496125_0222157 | |||
| 2075 | Ga0496125_0350107 | |||
| 2076 | Ga0496126_0022618 | |||
| 2077 | Ga0496126_0101114 | |||
| 2078 | Ga0496126_0125425 | |||
| 2079 | Ga0496126_0406116 | |||
| 2080 | Ga0495678_000006 | |||
| 2081 | Ga0495678_000130 | |||
| 2082 | Ga0495678_000233 | |||
| 2083 | Ga0495678_001703 | |||
| 2084 | Ga0495678_001985 | |||
| 2085 | Ga0495678_002123 | |||
| 2086 | Ga0495678_018410 | |||
| 2087 | Ga0495678_020704 | |||
| 2088 | Ga0495682_0000107 | |||
| 2089 | Ga0495682_0001172 | |||
| 2090 | Ga0495682_0011704 | |||
| 2091 | Ga0495682_0030101 | |||
| 2092 | Ga0495682_0068963 | |||
| 2093 | Ga0495682_0085817 | |||
| 2094 | Ga0501032_0189417 | |||
| 2095 | Ga0501034_0166710 | |||
| 2096 | Ga0501034_0191130 | |||
| 2097 | Ga0501034_0339289 | |||
| 2098 | Ga0501034_0505333 | |||
| 2099 | Ga0501047_0235227 | |||
| 2100 | Ga0501227_005034 | |||
| 2101 | Ga0501249_004483 | |||
| 2102 | Ga0501269_000016 | |||
| 2103 | Ga0501269_001654 | |||
| 2104 | Ga0501035_0018733 | |||
| 2105 | Ga0501035_0148309 | |||
| 2106 | Ga0501044_0177987 | |||
| 2107 | Ga0501044_0389883 | |||
| 2108 | nmdc:mga03n38_225856_c1 | |||
| 2109 | nmdc:mga00v17_23_c1 | |||
| 2110 | nmdc:mga00v17_33669_c1 | |||
| 2111 | nmdc:mga00v17_62366_c1 | |||
| 2112 | Ga0500643_000362 | |||
| 2113 | Ga0500641_0072413 | |||
| 2114 | Ga0500555_000370 | |||
| 2115 | Ga0500618_000088 | |||
| 2116 | Ga0500618_000519 | |||
| 2117 | Ga0500618_009889 | |||
| 2118 | Ga0500559_0004652 | |||
| 2119 | Ga0500564_178817 | |||
| 2120 | Ga0500568_0023303 | |||
| 2121 | Ga0500604_0014012 | |||
| 2122 | Ga0500627_0008381 | |||
| 2123 | Ga0500634_0000386 | |||
| 2124 | Ga0587084_000853 | |||
| 2125 | Ga0587066_001081 | |||
| 2126 | Ga0587070_001403 | |||
| 2127 | Ga0587077_003339 | |||
| 2128 | Ga0587085_005580 | |||
| 2129 | Ga0587090_004877 | |||
| 2130 | Ga0587091_002339 | |||
| 2131 | Ga0587101_001671 | |||
| 2132 | Ga0587109_008309 | |||
| 2133 | Ga0587117_004643 | |||
| 2134 | Ga0587062_002637 | |||
| 2135 | Ga0587067_003478 | |||
| 2136 | Ga0587076_001114 | |||
| 2137 | Ga0587100_000181 | |||
| 2138 | Ga0587111_0008704 | |||
| 2139 | 2501081278 | |||
| 2140 | 2501412208 | |||
| 2141 | 2511094266 | |||
| 2142 | 2511101645 | |||
| 2143 | 2511127402 | |||
| 2144 | 2511265866 | |||
| 2145 | 2511386320 | |||
| 2146 | 2512329148 | |||
| 2147 | 2512641806 | |||
| 2148 | 2516020977 | |||
| 2149 | 2547501460 | |||
| 2150 | 2555670074 | |||
| 2151 | 2583792341 | |||
| 2152 | 2597858049 | |||
| 2153 | 2597863717 | |||
| 2154 | 2599352892 | |||
| 2155 | 2599359237 | |||
| 2156 | 2599365242 | |||
| 2157 | 2599371931 | |||
| 2158 | 2599378000 | |||
| 2159 | 2599384623 | |||
| 2160 | 2599390789 | |||
| 2161 | 2599401838 | |||
| 2162 | 2599402974 | |||
| 2163 | 2599448427 | |||
| 2164 | 2599453971 | |||
| 2165 | 2599459726 | |||
| 2166 | 2599465935 | |||
| 2167 | 2599485082 | |||
| 2168 | 2599488747 | |||
| 2169 | 2599509180 | |||
| 2170 | 2599515545 | |||
| 2171 | 2599521350 | |||
| 2172 | 2599802695 | |||
| 2173 | 2599881171 | |||
| 2174 | 2599894924 | |||
| 2175 | 2599949544 | |||
| 2176 | 2600212333 | |||
| 2177 | 2600366655 | |||
| 2178 | 2600446158 | |||
| 2179 | 2601690471 | |||
| 2180 | 2601772501 | |||
| 2181 | 2602008040 | |||
| 2182 | 2643800573 | |||
| 2183 | 2643869799 | |||
| 2184 | 2643949730 | |||
| 2185 | 2644133894 | |||
| 2186 | 2644214045 | |||
| 2187 | 2644470690 | |||
| 2188 | 2644621043 | |||
| 2189 | 2671095531 | |||
| 2190 | 2671769684 | |||
| 2191 | 2677901038 | |||
| 2192 | 2691331382 | |||
| 2193 | 2723248999 | |||
| 2194 | 2738810409 | |||
| 2195 | 2738826346 | |||
| 2196 | 2738897769 | |||
| 2197 | 2739150143 | |||
| 2198 | 2739192062 | |||
| 2199 | 2739288474 | |||
| 2200 | 2739293786 | |||
| 2201 | 2739318539 | |||
| 2202 | 2739336780 | |||
| 2203 | 2743737515 | |||
| 2204 | 2758640644 | |||
| 2205 | 2808978416 | |||
| 2206 | 2808994057 | |||
| 2207 | 2809143300 | |||
| 2208 | 2819700992 | |||
| 2209 | 2821134854 | |||
| 2210 | 2821444546 | |||
| 2211 | 2823421295 | |||
| 2212 | 2834030082 | |||
| 2213 | 2834643344 | |||
| 2214 | 2842715698 | |||
| 2215 | 2842831616 | |||
| 2216 | 2842840132 | |||
| 2217 | 2842858020 | |||
| 2218 | 2844670692 | |||
| 2219 | 2852617558 | |||
| 2220 | 2852672323 | |||
| 2221 | 2855732292 | |||
| 2222 | 2855769000 | |||
| 2223 | 2857358052 | |||
| 2224 | 2857553374 | |||
| 2225 | 2857563351 | |||
| 2226 | 2857569760 | |||
| 2227 | 2882809192 | |||
| 2228 | 2883089071 | |||
| 2229 | 2895501889 | |||
| 2230 | 2895517554 | |||
| 2231 | 2895526189 | |||
| 2232 | 2904428222 | |||
| 2233 | 2917073897 | |||
| 2234 | 2919046776 | |||
| 2235 | 2919136880 | |||
| 2236 | 2919479716 | |||
| 2237 | 2919502916 | |||
| 2238 | 2919534945 | |||
| 2239 | 2923156556 | |||
| 2240 | 2926064589 | |||
| 2241 | 2929192820 | |||
| 2242 | 2931394224 | |||
| 2243 | 2935357048 | |||
| 2244 | 2939608774 | |||
| 2245 | 2939636014 | |||
| 2246 | 2945933753 | |||
| 2247 | 2945963935 | |||
| 2248 | 2946010172 | |||
| 2249 | 2946031158 | |||
| 2250 | 2947237556 | |||
| 2251 | 2984289518 | |||
| 2252 | 2987607663 | |||
| 2253 | 2990710726 | |||
| 2254 | 3007254912 | |||
| 2255 | 3007316287 | |||
| 2256 | 3007395940 | |||
| 2257 | 637320439 | |||
| 2258 | 8003402591 | |||
| 2259 | 8015690750 | |||
| 2260 | 8019773250 | |||
| 2261 | 8047677569 | |||
| 2262 | 8054286389 | |||
| 2263 | 8054348165 | |||
| 2264 | 8054359281 | |||
| 2265 | 8054505932 | |||
| 2266 | 8055100099 | |||
| 2267 | 8055773887 | |||
| 2268 | 8055820576 | |||
| 2269 | 8056134978 | |||
| 2270 | 8056146549 | |||
| 2271 | 8056154544 | |||
| 2272 | 8056166363 | |||
| 2273 | 8057309339 | |||
| 2274 | 8057800578 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9856 | 1 | 252 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9816 | 1 | 247 |
| 4fuk-assembly1.cif.gz_A | aminopeptidase from trypanosoma brucei | 0.9764 | 7 | 253 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9755 | 1 | 246 |
| 4a6v-assembly1.cif.gz_A | x-ray structures of oxazole hydroxamate ecmetap-mn complexes | 0.9751 | 1 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9914 | 1 | 252 | 3.90.230.10 |
| af_I1J6Q1_1_201_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9784 | 46 | 247 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9773 | 1 | 247 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9755 | 1 | 246 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9738 | 2 | 247 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8P659-F1-model_v4 | Type I methionyl aminopeptidase | 1.002 | 116 | 233 |
GO:0005829
GO:0006508 GO:0070006 |
| AF-A0A3B9AWZ8-F1-model_v4 | deleted | 0.9997 | 69 | 251 |
|
| AF-A0A4Q6F1R4-F1-model_v4 | deleted | 0.9983 | 34 | 247 |
|
| AF-A0A6G8DHF1-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9982 | 1 | 251 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A3C0LYD4-F1-model_v4 | deleted | 0.9978 | 108 | 202 |
|