F490648

General Info

Members Datasets Scaffolds Average Seq Length
1137 432 2274 255

Family's Representative Sequence

Representative Sequence 3300044672|Ga0466982_0000040|Ga0466982_0000040_35719_36549
Length 276
Sequence VTKRPEEIALLAASGRLLADVFAHLDRLDLVGMSTLQVNDLVESFIVDGLGARPASKGQYGYAYALNASRNDVVCHGVPSAADVLRSGDIVNFDITLEKHGYIADSSKTYLVGEVDPAARRLVQVTYEAMWKGIEAVRPGARLGDVGHAIERHARRNGYSIVREYCGHGIGREMHEEPQVLHWGKPGTGLMLREGMVFTIEPMLNQGRPAVRTESDGWTVVTRDGRLSAQFEHTVAVTRHGARVLTLRADEKPRSPLTRPQARRASPHDARARHGS

Samples

Sample ID Description Type Environment
1 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
165 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
280 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
281 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
282 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
298 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
299 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
300 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
301 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
302 2511231006 Pseudomonas sp. GM17 Isolate Nodule
303 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
304 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
305 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
306 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
307 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
308 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
309 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
310 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
311 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
312 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
313 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
314 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
315 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
316 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
317 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
318 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
319 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
320 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
321 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
322 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
323 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
324 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
325 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
326 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
327 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
328 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
329 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
330 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
331 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
332 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
333 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
334 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
335 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
336 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
337 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
338 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
339 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
340 2643221556 Massilia sp. Root1485 Isolate Unclassified
341 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
342 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
343 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
344 2643221638 Duganella sp. Root336D2 Isolate Unclassified
345 2643221684 Massilia sp. Root133 Isolate Unclassified
346 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
347 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
348 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
349 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
350 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
351 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
352 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
353 2738541297 Duganella sp. GV083 Isolate Unclassified
354 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
355 2738541357 Duganella sp. GV053 Isolate Unclassified
356 2738543003 Duganella sp. GV066 Isolate Unclassified
357 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
358 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
359 2738543026 Duganella sp. GV089 Isolate Unclassified
360 2738543029 Duganella sp. GV039 Isolate Unclassified
361 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
362 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
363 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
364 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
365 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
366 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
367 2821131069 Duganella sp. 1224 Isolate Unclassified
368 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
369 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
370 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
371 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
372 2842711865 Duganella sp. R-73148 Isolate Unclassified
373 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
374 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
375 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
376 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
377 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
378 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
379 2855730933 Achromobacter sp. HZ28 Isolate Nodule
380 2855767633 Achromobacter sp. HZ34 Isolate Nodule
381 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
382 2857553236 Duganella sp. R-74557 Isolate Unclassified
383 2857558681 Duganella sp. R-74565 Isolate Unclassified
384 2857564685 Duganella sp. R-74599 Isolate Unclassified
385 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
386 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
387 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
388 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
389 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
390 2904424332 Duganella sp. 1411 Isolate Rhizosphere
391 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
392 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
393 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
394 2919476304 Duganella sp. 3397 Isolate Unclassified
395 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
396 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
397 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
398 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
399 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
400 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
401 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
402 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
403 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
404 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
405 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
406 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
407 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
408 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
409 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
410 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
411 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
412 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
413 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
414 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
415 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
416 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
417 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
418 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
419 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
420 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
421 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
422 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
423 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
424 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
425 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
426 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
427 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
428 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
429 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
430 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
431 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
432 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.1
Metatranscriptomes 1.93
Isolates 11.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0.79
Rhizoplane 4.93
Rhizosphere 74.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466982_0000040 3300044672 Bacteria 41234
2 JGI24741J21665_1000149 3300001915 Bacteria 19701
3 JGI24740J21852_10003968 3300001979 Bacteria 6425
4 JGI25156J39149_1011038 3300002705 Bacteria 2073
5 JGI25162J39368_1000004 3300002737 Bacteria 441040
6 JGI25162J39368_1003457 3300002737 Bacteria 4545
7 JGI25154J39366_1000359 3300002738 Bacteria 25837
8 JGI25163J39215_1000047 3300002771 Bacteria 53654
9 JGI25164J39214_1000031 3300002772 Bacteria 144582
10 JGI25159J45721_1000757 3300002987 Bacteria 14011
11 JGI25165J46597_1000011 3300003214 Bacteria 441040
12 rootL2_10031707 3300003322 Bacteria 6903
13 Ga0055538_1000123 3300003751 Bacteria 58939
14 Ga0055538_1004657 3300003751 Bacteria 1523
15 Ga0055539_1000073 3300003752 Bacteria 131094
16 Ga0055539_1000167 3300003752 Bacteria 58939
17 Ga0055533_1000171 3300003756 Bacteria 58939
18 Ga0055533_1005112 3300003756 Bacteria 2187
19 Ga0055533_1005878 3300003756 Bacteria 1903
20 Ga0055532_1000090 3300003758 Bacteria 104391
21 Ga0055532_1000159 3300003758 Bacteria 59066
22 Ga0055525_1000232 3300003759 Bacteria 58939
23 Ga0055525_1000383 3300003759 Bacteria 28771
24 Ga0055527_1000479 3300003760 Bacteria 14726
25 Ga0055535_1000085 3300003761 Bacteria 104391
26 Ga0055535_1006235 3300003761 Bacteria 2455
27 Ga0055529_1000134 3300003763 Bacteria 104391
28 Ga0055526_1000007 3300003771 Bacteria 321998
29 Ga0055526_1000116 3300003771 Bacteria 70518
30 Ga0055536_1000014 3300003781 Bacteria 240624
31 Ga0055536_1000820 3300003781 Bacteria 20498
32 Ga0055530_10000126 3300003791 Bacteria 66675
33 Ga0055530_10000182 3300003791 Bacteria 56371
34 Ga0055530_10000529 3300003791 Bacteria 33175
35 Ga0055540_1000566 3300003792 Bacteria 27221
36 Ga0055531_10000165 3300003794 Bacteria 74768
37 Ga0055531_10001146 3300003794 Bacteria 20498
38 Ga0055541_1000112 3300003841 Bacteria 58923
39 Ga0055541_1009305 3300003841 Bacteria 1525
40 Ga0058692_1000002 3300003856 Bacteria 508401
41 Ga0055543_1002524 3300004625 Bacteria 5985
42 Ga0065165_1000005 3300005262 Bacteria 370361
43 Ga0065165_1000286 3300005262 Bacteria 85993
44 Ga0065714_10064654 3300005288 Bacteria 25523
45 Ga0065704_10071150 3300005289 Bacteria 12831
46 Ga0065704_10092201 3300005289 Bacteria 2668
47 Ga0065704_10135927 3300005289 Bacteria 1571
48 Ga0065712_10009916 3300005290 Bacteria 4202
49 Ga0070658_10583537 3300005327 Bacteria 968
50 Ga0070670_100000087 3300005331 Bacteria 88228
51 Ga0070670_100001916 3300005331 Bacteria 17030
52 Ga0070660_100511446 3300005339 Bacteria 999
53 Ga0070661_100000141 3300005344 Bacteria 58825
54 Ga0070661_100004776 3300005344 Bacteria 9328
55 Ga0070669_100009854 3300005353 Bacteria 6806
56 Ga0070663_100000034 3300005455 Bacteria 68516
57 Ga0070662_100005950 3300005457 Bacteria 7824
58 Ga0070662_100203365 3300005457 Bacteria 1572
59 Ga0068867_100283963 3300005459 Bacteria 1358
60 Ga0068853_100077825 3300005539 Bacteria 2898
61 Ga0070665_100000335 3300005548 Bacteria 71847
62 Ga0070664_100000044 3300005564 Bacteria 74926
63 Ga0070664_100000057 3300005564 Bacteria 68516
64 Ga0070664_100051154 3300005564 Bacteria 3498
65 Ga0068854_100000937 3300005578 Bacteria 17545
66 Ga0068856_100004528 3300005614 Bacteria 13821
67 Ga0068852_100115207 3300005616 Bacteria 2450
68 Ga0068851_10000752 3300005834 Bacteria 13928
69 Ga0068851_10215765 3300005834 Bacteria 1076
70 Ga0075363_100130804 3300006048 Bacteria 1407
71 Ga0075364_10012986 3300006051 Bacteria 5111
72 Ga0075364_10034882 3300006051 Bacteria 3249
73 Ga0079104_1006764 3300006946 Bacteria 4263
74 Ga0099826_10000013 3300006948 Bacteria 265459
75 Ga0105251_10003715 3300009011 Bacteria 10936
76 Ga0105251_10005101 3300009011 Bacteria 8693
77 Ga0105251_10013329 3300009011 Bacteria 4603
78 Ga0105251_10039117 3300009011 Bacteria 2319
79 Ga0105251_10055154 3300009011 Bacteria 1885
80 Ga0105244_10000014 3300009036 Bacteria 257018
81 Ga0105244_10000134 3300009036 Bacteria 75961
82 Ga0105244_10002934 3300009036 Bacteria 12584
83 Ga0105244_10015891 3300009036 Bacteria 4305
84 Ga0105244_10050756 3300009036 Bacteria 2115
85 Ga0105244_10206415 3300009036 Bacteria 925
86 Ga0105250_10000661 3300009092 Bacteria 21815
87 Ga0105250_10021366 3300009092 Bacteria 2613
88 Ga0105240_10031977 3300009093 Bacteria 6815
89 Ga0105240_10042292 3300009093 Bacteria 5807
90 Ga0105243_10007675 3300009148 Bacteria 8287
91 Ga0105243_10014001 3300009148 Bacteria 6069
92 Ga0105243_10062782 3300009148 Bacteria 2975
93 Ga0105241_10071225 3300009174 Bacteria 2698
94 Ga0105242_10000661 3300009176 Bacteria 26974
95 Ga0105237_10000116 3300009545 Bacteria 111312
96 Ga0105237_10053888 3300009545 Bacteria 4032
97 Ga0105237_10181195 3300009545 Bacteria 2107
98 Ga0105237_10359267 3300009545 Bacteria 1461
99 Ga0105238_10217878 3300009551 Bacteria 1885
100 Ga0105246_10001733 3300011119 Bacteria 13031
101 Ga0105246_10011605 3300011119 Bacteria 5469
102 Ga0157373_10006159 3300013100 Bacteria 8970
103 Ga0157373_10009246 3300013100 Bacteria 7287
104 Ga0157373_10011962 3300013100 Bacteria 6376
105 Ga0157373_10025897 3300013100 Bacteria 4238
106 Ga0157371_10000323 3300013102 Bacteria 61980
107 Ga0157371_10004329 3300013102 Bacteria 12448
108 Ga0157370_10000038 3300013104 Bacteria 135182
109 Ga0157370_10018703 3300013104 Bacteria 6967
110 Ga0157370_10024498 3300013104 Bacteria 5977
111 Ga0157369_10003855 3300013105 Bacteria 17824
112 Ga0157369_10007043 3300013105 Bacteria 12966
113 Ga0157369_10007727 3300013105 Bacteria 12368
114 Ga0157369_10034990 3300013105 Bacteria 5508
115 Ga0157369_10037652 3300013105 Bacteria 5295
116 Ga0163162_10085005 3300013306 Bacteria 3240
117 Ga0157372_10000776 3300013307 Bacteria 34547
118 Ga0157372_10323738 3300013307 Bacteria 1795
119 Ga0157372_10604177 3300013307 Bacteria 1278
120 Ga0157375_10003691 3300013308 Bacteria 13289
121 Ga0157375_10007576 3300013308 Bacteria 9492
122 Ga0157375_10121243 3300013308 Bacteria 2724
123 Ga0182008_10000261 3300014497 Bacteria 41195
124 Ga0182008_10001346 3300014497 Bacteria 16710
125 Ga0182008_10003524 3300014497 Bacteria 9413
126 Ga0157379_10186755 3300014968 Bacteria 1873
127 Ga0157376_10082633 3300014969 Bacteria 2761
128 Ga0182006_1000206 3300015261 Bacteria 59352
129 Ga0182006_1002616 3300015261 Bacteria 9730
130 Ga0182006_1004672 3300015261 Bacteria 6706
131 Ga0182007_10003019 3300015262 Bacteria 8131
132 Ga0163161_10007916 3300017792 Bacteria 7357
133 Ga0163161_10008504 3300017792 Bacteria 7108
134 Ga0163161_10011745 3300017792 Bacteria 6073
135 Ga0163161_10013050 3300017792 Bacteria 5774
136 Ga0163161_10015040 3300017792 Bacteria 5393
137 Ga0197907_11440316 3300020069 Bacteria 1510
138 Ga0206356_10624618 3300020070 Bacteria 1284
139 Ga0206351_10978011 3300020077 Bacteria 1397
140 Ga0206351_10989253 3300020077 Bacteria 1347
141 Ga0206350_11491042 3300020080 Bacteria 1763
142 Ga0154015_1552384 3300020610 Bacteria 22900
143 Ga0224712_10002754 3300022467 Bacteria 4421
144 Ga0209435_100840 3300025206 Bacteria 4828
145 Ga0209760_100032 3300025207 Bacteria 138015
146 Ga0209784_100006 3300025224 Bacteria 930704
147 Ga0209784_100058 3300025224 Bacteria 167327
148 Ga0209566_100002 3300025225 Bacteria 2614868
149 Ga0209566_100045 3300025225 Bacteria 258557
150 Ga0209674_100096 3300025226 Bacteria 167418
151 Ga0209674_100097 3300025226 Bacteria 167285
152 Ga0209674_100403 3300025226 Bacteria 21586
153 Ga0209672_100208 3300025228 Bacteria 46403
154 Ga0209147_100018 3300025229 Bacteria 515719
155 Ga0209147_100056 3300025229 Bacteria 258557
156 Ga0209563_100007 3300025230 Bacteria 1579402
157 Ga0209563_100041 3300025230 Bacteria 407467
158 Ga0209563_100064 3300025230 Bacteria 258557
159 Ga0207427_100003 3300025231 Bacteria 1035004
160 Ga0209437_100002 3300025233 Bacteria 1574801
161 Ga0209437_101405 3300025233 Bacteria 6017
162 Ga0209258_100028 3300025242 Bacteria 515719
163 Ga0209258_100243 3300025242 Bacteria 100317
164 Ga0209646_1000007 3300025246 Bacteria 670994
165 Ga0209646_1000207 3300025246 Bacteria 67740
166 Ga0209677_100007 3300025253 Bacteria 1021332
167 Ga0209677_100053 3300025253 Bacteria 167537
168 Ga0209148_1000640 3300025254 Bacteria 30511
169 Ga0209759_1002850 3300025256 Bacteria 7288
170 Ga0209759_1013956 3300025256 Bacteria 2148
171 Ga0209233_1000004 3300025261 Bacteria 1574798
172 Ga0209455_1000107 3300025272 Bacteria 195136
173 Ga0209130_1000254 3300025284 Bacteria 67210
174 Ga0209676_1000003 3300025292 Bacteria 1454178
175 Ga0209676_1001558 3300025292 Bacteria 20540
176 Ga0209564_1000010 3300025295 Bacteria 885399
177 Ga0209564_1000202 3300025295 Bacteria 136555
178 Ga0209564_1001636 3300025295 Bacteria 21656
179 Ga0209050_1000004 3300025298 Bacteria 1600040
180 Ga0209050_1000010 3300025298 Bacteria 980454
181 Ga0209050_1000069 3300025298 Bacteria 297615
182 Ga0209050_1015681 3300025298 Bacteria 3161
183 Ga0209256_1000921 3300025299 Bacteria 35969
184 Ga0209051_1000006 3300025303 Bacteria 1015785
185 Ga0209257_1000027 3300025304 Bacteria 703541
186 Ga0209257_1001484 3300025304 Bacteria 27531
187 Ga0207656_10000394 3300025321 Bacteria 14693
188 Ga0207696_1000041 3300025711 Bacteria 311695
189 Ga0207655_1000002 3300025728 Bacteria 1148694
190 Ga0207655_1000022 3300025728 Bacteria 483933
191 Ga0207655_1000063 3300025728 Bacteria 257028
192 Ga0207655_1000191 3300025728 Bacteria 108382
193 Ga0207655_1002838 3300025728 Bacteria 13411
194 Ga0207655_1014974 3300025728 Bacteria 4342
195 Ga0207655_1037820 3300025728 Bacteria 2119
196 Ga0207655_1111208 3300025728 Bacteria 925
197 Ga0207713_1000004 3300025735 Bacteria 702781
198 Ga0207713_1000682 3300025735 Bacteria 31836
199 Ga0207713_1008675 3300025735 Bacteria 5811
200 Ga0207713_1042527 3300025735 Bacteria 1885
201 Ga0207713_1064545 3300025735 Bacteria 1377
202 Ga0207705_10127390 3300025909 Bacteria 1893
203 Ga0207695_10002492 3300025913 Bacteria 27113
204 Ga0207671_10000166 3300025914 Bacteria 102694
205 Ga0207660_10563602 3300025917 Bacteria 927
206 Ga0207657_10007356 3300025919 Bacteria 11298
207 Ga0207649_10000056 3300025920 Bacteria 102891
208 Ga0207649_10000111 3300025920 Bacteria 68568
209 Ga0207650_10000418 3300025925 Bacteria 37720
210 Ga0207650_10005379 3300025925 Bacteria 8730
211 Ga0207690_10045688 3300025932 Bacteria 2895
212 Ga0207706_10003731 3300025933 Bacteria 14529
213 Ga0207709_10000982 3300025935 Bacteria 21301
214 Ga0207709_10004470 3300025935 Bacteria 8074
215 Ga0207709_10021519 3300025935 Bacteria 3651
216 Ga0207679_10000036 3300025945 Bacteria 133834
217 Ga0207679_10000105 3300025945 Bacteria 68561
218 Ga0207679_10138463 3300025945 Bacteria 1964
219 Ga0207640_10000154 3300025981 Bacteria 49637
220 Ga0207678_10000106 3300026067 Bacteria 68474
221 Ga0207702_10000135 3300026078 Bacteria 88092
222 Ga0207648_10137021 3300026089 Bacteria 2156
223 Ga0207674_10002847 3300026116 Bacteria 21514
224 Ga0207698_10091909 3300026142 Bacteria 2486
225 Ga0209281_1000379 3300027111 Bacteria 70495
226 Ga0209281_1004003 3300027111 Bacteria 4567
227 Ga0209371_1000004 3300027312 Bacteria 1098197
228 Ga0209282_1000043 3300027666 Bacteria 119260
229 Ga0268266_10000335 3300028379 Bacteria 73645
230 Ga0268266_10126077 3300028379 Bacteria 2285
231 Ga0265338_10001178 3300028800 Bacteria 43156
232 Ga0268256_1000005 3300030500 Bacteria 1082342
233 Ga0307511_10061742 3300030521 Bacteria 2852
234 Ga0265340_10079217 3300031247 Bacteria 1549
235 Ga0307509_10097343 3300031507 Bacteria 2991
236 Ga0307408_100000028 3300031548 Bacteria 233440
237 Ga0307408_100000074 3300031548 Bacteria 111955
238 Ga0307405_10001861 3300031731 Bacteria 9057
239 Ga0307405_10064245 3300031731 Bacteria 2332
240 Ga0307518_10013348 3300031838 Bacteria 5874
241 Ga0307406_10068905 3300031901 Bacteria 2311
242 Ga0307412_10001662 3300031911 Bacteria 12283
243 Ga0307412_10016685 3300031911 Bacteria 4379
244 Ga0307414_10098460 3300032004 Bacteria 2194
245 Ga0307414_10273285 3300032004 Bacteria 1416
246 Ga0307414_10499323 3300032004 Bacteria 1076
247 Ga0395899_0078640 3300037312 Bacteria 2404
248 Ga0395899_0085802 3300037312 Bacteria 2287
249 Ga0395899_0104362 3300037312 Bacteria 2043
250 Ga0395899_0112424 3300037312 Bacteria 1956
251 Ga0395900_0000162 3300037418 Bacteria 109616
252 Ga0395900_0005262 3300037418 Bacteria 13569
253 Ga0395900_0007334 3300037418 Bacteria 11410
254 Ga0395900_0009391 3300037418 Bacteria 10027
255 Ga0395900_0041333 3300037418 Bacteria 4753
256 Ga0395900_0107327 3300037418 Bacteria 2868
257 Ga0395900_0148447 3300037418 Bacteria 2396
258 Ga0395900_0177587 3300037418 Bacteria 2165
259 Ga0395900_0259394 3300037418 Bacteria 1736
260 Ga0395900_0334831 3300037418 Bacteria 1490
261 Ga0395900_0354717 3300037418 Bacteria 1439
262 Ga0395900_0378589 3300037418 Bacteria 1384
263 Ga0395898_0002086 3300037466 Bacteria 24861
264 Ga0395898_0023727 3300037466 Bacteria 6192
265 Ga0395898_0046474 3300037466 Bacteria 4264
266 Ga0395898_0050881 3300037466 Bacteria 4053
267 Ga0395898_0134242 3300037466 Bacteria 2370
268 Ga0395898_0279590 3300037466 Bacteria 1592
269 Ga0395905_0032388 3300037471 Bacteria 4916
270 Ga0395905_0039045 3300037471 Bacteria 4454
271 Ga0395905_0066292 3300037471 Bacteria 3381
272 Ga0395905_0300853 3300037471 Bacteria 1491
273 Ga0395905_0528993 3300037471 Bacteria 1079
274 Ga0395901_0000009 3300038443 Bacteria 479396
275 Ga0395901_0000042 3300038443 Bacteria 201819
276 Ga0395901_0000091 3300038443 Bacteria 123334
277 Ga0395901_0023936 3300038443 Bacteria 6264
278 Ga0395901_0061038 3300038443 Bacteria 3923
279 Ga0395901_0123431 3300038443 Bacteria 2721
280 Ga0395901_0168631 3300038443 Bacteria 2297
281 Ga0395901_0283097 3300038443 Bacteria 1722
282 Ga0395901_0525495 3300038443 Bacteria 1202
283 Ga0439436_0000095 3300041404 Bacteria 20869
284 Ga0439438_000160 3300041405 Bacteria 30706
285 Ga0439438_000190 3300041405 Bacteria 27711
286 Ga0439438_000503 3300041405 Bacteria 17737
287 Ga0439466_0000574 3300041411 Bacteria 13819
288 Ga0439466_0008236 3300041411 Bacteria 3930
289 Ga0439466_0032146 3300041411 Bacteria 1791
290 Ga0439448_0069504 3300042005 Bacteria 1172
291 Ga0439432_005030 3300042006 Bacteria 4780
292 Ga0439432_006082 3300042006 Bacteria 4324
293 Ga0439432_021723 3300042006 Bacteria 2125
294 Ga0450906_012235 3300042145 Bacteria 1592
295 Ga0439464_0000813 3300042439 Bacteria 6861
296 Ga0439464_0005146 3300042439 Bacteria 3368
297 Ga0439464_0018199 3300042439 Bacteria 1910
298 Ga0466972_0002472 3300044658 Bacteria 9144
299 Ga0466972_0003769 3300044658 Bacteria 7542
300 Ga0466972_0054889 3300044658 Bacteria 1917
301 Ga0466965_0001680 3300044683 Bacteria 9081
302 Ga0466966_0031469 3300044684 Bacteria 3440
303 Ga0466966_0270642 3300044684 Bacteria 1022
304 Ga0466961_0142054 3300044693 Bacteria 1502
305 Ga0466971_0137107 3300044719 Bacteria 1138
306 Ga0466968_0006840 3300044735 Bacteria 4315
307 Ga0466970_0007069 3300044765 Bacteria 5614
308 Ga0466970_0099987 3300044765 Bacteria 1579
309 Ga0466958_0108722 3300045836 Bacteria 1730
310 Ga0466967_0746344 3300045976 Bacteria 971
311 Ga0495617_000002 3300046452 Bacteria 710121
312 Ga0495617_000020 3300046452 Bacteria 230257
313 Ga0495617_000443 3300046452 Bacteria 22346
314 Ga0495617_002156 3300046452 Bacteria 8073
315 Ga0495627_000005 3300046453 Bacteria 630805
316 Ga0495627_000058 3300046453 Bacteria 143802
317 Ga0495627_000207 3300046453 Bacteria 63763
318 Ga0495627_001366 3300046453 Bacteria 14571
319 Ga0495627_027126 3300046453 Bacteria 1840
320 Ga0495627_033386 3300046453 Bacteria 1614
321 Ga0495603_0028731 3300046455 Bacteria 3355
322 Ga0495603_0038059 3300046455 Bacteria 2885
323 Ga0495603_0040631 3300046455 Bacteria 2783
324 Ga0495590_0000025 3300046457 Bacteria 165221
325 Ga0495590_0013996 3300046457 Bacteria 2938
326 Ga0495590_0038493 3300046457 Bacteria 1668
327 Ga0495591_000081 3300046458 Bacteria 107738
328 Ga0495591_000246 3300046458 Bacteria 52198
329 Ga0495591_002486 3300046458 Bacteria 10221
330 Ga0495591_012754 3300046458 Bacteria 3111
331 Ga0495591_016756 3300046458 Bacteria 2538
332 Ga0495629_0080053 3300046459 Bacteria 2281
333 Ga0495638_0007776 3300046460 Bacteria 7656
334 Ga0495638_0011767 3300046460 Bacteria 6024
335 Ga0495638_0029677 3300046460 Bacteria 3526
336 Ga0495638_0061000 3300046460 Bacteria 2331
337 Ga0495638_0070430 3300046460 Bacteria 2141
338 Ga0495638_0192279 3300046460 Bacteria 1157
339 Ga0495653_0000082 3300046463 Bacteria 80285
340 Ga0495653_0015657 3300046463 Bacteria 6181
341 Ga0495653_0019749 3300046463 Bacteria 5463
342 Ga0495653_0033932 3300046463 Bacteria 4039
343 Ga0495653_0049210 3300046463 Bacteria 3248
344 Ga0495650_0000001 3300046471 Bacteria 1085492
345 Ga0495650_0000085 3300046471 Bacteria 235655
346 Ga0495650_0000462 3300046471 Bacteria 63149
347 Ga0495650_0001171 3300046471 Bacteria 28029
348 Ga0495650_0001182 3300046471 Bacteria 27749
349 Ga0495650_0053169 3300046471 Bacteria 1660
350 Ga0495582_0111521 3300046473 Bacteria 1536
351 Ga0495605_0000018 3300046474 Bacteria 270187
352 Ga0495605_0000051 3300046474 Bacteria 163067
353 Ga0495605_0000293 3300046474 Bacteria 55067
354 Ga0495605_0011697 3300046474 Bacteria 4884
355 Ga0495605_0019095 3300046474 Bacteria 3667
356 Ga0495605_0027590 3300046474 Bacteria 2941
357 Ga0495605_0029040 3300046474 Bacteria 2850
358 Ga0495605_0035726 3300046474 Bacteria 2510
359 Ga0495605_0057595 3300046474 Bacteria 1869
360 Ga0495605_0063262 3300046474 Bacteria 1765
361 Ga0495605_0108008 3300046474 Bacteria 1272
362 Ga0495605_0109559 3300046474 Bacteria 1261
363 Ga0495584_0000003 3300046491 Bacteria 323768
364 Ga0495584_0000058 3300046491 Bacteria 81148
365 Ga0495584_0000070 3300046491 Bacteria 73237
366 Ga0495584_0029859 3300046491 Bacteria 2762
367 Ga0495584_0062431 3300046491 Bacteria 1873
368 Ga0495584_0079441 3300046491 Bacteria 1650
369 Ga0495584_0083705 3300046491 Bacteria 1606
370 Ga0495584_0116125 3300046491 Bacteria 1355
371 Ga0495585_0000183 3300046492 Bacteria 66586
372 Ga0495585_0000424 3300046492 Bacteria 40738
373 Ga0495585_0000814 3300046492 Bacteria 27169
374 Ga0495585_0005398 3300046492 Bacteria 8061
375 Ga0495585_0006004 3300046492 Bacteria 7599
376 Ga0495585_0010489 3300046492 Bacteria 5510
377 Ga0495585_0017021 3300046492 Bacteria 4207
378 Ga0495585_0017297 3300046492 Bacteria 4168
379 Ga0495585_0030772 3300046492 Bacteria 3051
380 Ga0495585_0043023 3300046492 Bacteria 2527
381 Ga0495585_0043787 3300046492 Bacteria 2502
382 Ga0495585_0050006 3300046492 Bacteria 2319
383 Ga0495585_0088414 3300046492 Bacteria 1671
384 Ga0495585_0093826 3300046492 Bacteria 1613
385 Ga0495594_0000828 3300046499 Bacteria 15980
386 Ga0495594_0002110 3300046499 Bacteria 10356
387 Ga0495594_0054489 3300046499 Bacteria 2204
388 Ga0495594_0242772 3300046499 Bacteria 1026
389 Ga0495596_0000017 3300046500 Bacteria 114761
390 Ga0495596_0000366 3300046500 Bacteria 29053
391 Ga0495596_0000486 3300046500 Bacteria 25196
392 Ga0495596_0000884 3300046500 Bacteria 18072
393 Ga0495596_0000958 3300046500 Bacteria 17231
394 Ga0495596_0002814 3300046500 Bacteria 9109
395 Ga0495596_0002923 3300046500 Bacteria 8877
396 Ga0495596_0010139 3300046500 Bacteria 4117
397 Ga0495596_0010912 3300046500 Bacteria 3937
398 Ga0495596_0011652 3300046500 Bacteria 3784
399 Ga0495596_0012793 3300046500 Bacteria 3579
400 Ga0495596_0014942 3300046500 Bacteria 3262
401 Ga0495596_0016439 3300046500 Bacteria 3073
402 Ga0495596_0020852 3300046500 Bacteria 2679
403 Ga0495596_0024894 3300046500 Bacteria 2421
404 Ga0495596_0087490 3300046500 Bacteria 1209
405 Ga0495607_0000485 3300046501 Bacteria 39753
406 Ga0495607_0001440 3300046501 Bacteria 21201
407 Ga0495607_0001650 3300046501 Bacteria 19320
408 Ga0495607_0004773 3300046501 Bacteria 9907
409 Ga0495607_0004924 3300046501 Bacteria 9709
410 Ga0495607_0006308 3300046501 Bacteria 8357
411 Ga0495607_0009224 3300046501 Bacteria 6702
412 Ga0495607_0015090 3300046501 Bacteria 5016
413 Ga0495607_0019636 3300046501 Bacteria 4288
414 Ga0495607_0063452 3300046501 Bacteria 2090
415 Ga0495583_0000010 3300046506 Bacteria 353523
416 Ga0495583_0000051 3300046506 Bacteria 212400
417 Ga0495583_0000382 3300046506 Bacteria 68388
418 Ga0495583_0001685 3300046506 Bacteria 21387
419 Ga0495583_0003156 3300046506 Bacteria 12993
420 Ga0495583_0004240 3300046506 Bacteria 10401
421 Ga0495583_0005962 3300046506 Bacteria 8086
422 Ga0495583_0006526 3300046506 Bacteria 7609
423 Ga0495583_0021928 3300046506 Bacteria 3273
424 Ga0495583_0030949 3300046506 Bacteria 2600
425 Ga0495583_0036045 3300046506 Bacteria 2356
426 Ga0495583_0039818 3300046506 Bacteria 2211
427 Ga0495583_0055621 3300046506 Bacteria 1787
428 Ga0495583_0098912 3300046506 Bacteria 1247
429 Ga0495606_0000101 3300046507 Bacteria 146752
430 Ga0495606_0000161 3300046507 Bacteria 117607
431 Ga0495606_0000409 3300046507 Bacteria 72543
432 Ga0495606_0001868 3300046507 Bacteria 26409
433 Ga0495606_0003416 3300046507 Bacteria 16866
434 Ga0495606_0010811 3300046507 Bacteria 7521
435 Ga0495606_0017655 3300046507 Bacteria 5384
436 Ga0495606_0027466 3300046507 Bacteria 4035
437 Ga0495606_0089737 3300046507 Bacteria 1893
438 Ga0495610_0000014 3300046512 Bacteria 444708
439 Ga0495610_0000020 3300046512 Bacteria 344007
440 Ga0495610_0000229 3300046512 Bacteria 59730
441 Ga0495610_0000293 3300046512 Bacteria 52547
442 Ga0495610_0001226 3300046512 Bacteria 23065
443 Ga0495610_0019426 3300046512 Bacteria 3802
444 Ga0495610_0024547 3300046512 Bacteria 3250
445 Ga0495610_0069845 3300046512 Bacteria 1642
446 Ga0495616_0000207 3300046513 Bacteria 48768
447 Ga0495616_0000446 3300046513 Bacteria 31542
448 Ga0495616_0000492 3300046513 Bacteria 30078
449 Ga0495616_0000493 3300046513 Bacteria 30071
450 Ga0495616_0002335 3300046513 Bacteria 12668
451 Ga0495616_0008047 3300046513 Bacteria 6279
452 Ga0495616_0008671 3300046513 Bacteria 5999
453 Ga0495616_0011794 3300046513 Bacteria 4987
454 Ga0495616_0017240 3300046513 Bacteria 3984
455 Ga0495616_0019015 3300046513 Bacteria 3755
456 Ga0495616_0020945 3300046513 Bacteria 3550
457 Ga0495616_0025138 3300046513 Bacteria 3185
458 Ga0495616_0029934 3300046513 Bacteria 2867
459 Ga0495616_0034155 3300046513 Bacteria 2643
460 Ga0495616_0034287 3300046513 Bacteria 2637
461 Ga0495616_0073500 3300046513 Bacteria 1649
462 Ga0495616_0115044 3300046513 Bacteria 1246
463 Ga0495616_0172039 3300046513 Bacteria 968
464 Ga0495620_0004244 3300046515 Bacteria 8100
465 Ga0495620_0005093 3300046515 Bacteria 7359
466 Ga0495620_0034269 3300046515 Bacteria 2296
467 Ga0495620_0053036 3300046515 Bacteria 1719
468 Ga0495630_0034925 3300046517 Bacteria 3756
469 Ga0495631_0000791 3300046518 Bacteria 20226
470 Ga0495631_0002616 3300046518 Bacteria 10050
471 Ga0495631_0003789 3300046518 Bacteria 8228
472 Ga0495631_0004387 3300046518 Bacteria 7517
473 Ga0495631_0005725 3300046518 Bacteria 6482
474 Ga0495631_0016205 3300046518 Bacteria 3559
475 Ga0495631_0016490 3300046518 Bacteria 3520
476 Ga0495631_0025827 3300046518 Bacteria 2701
477 Ga0495631_0040161 3300046518 Bacteria 2074
478 Ga0495631_0044611 3300046518 Bacteria 1953
479 Ga0495631_0052258 3300046518 Bacteria 1784
480 Ga0495631_0054674 3300046518 Bacteria 1740
481 Ga0495631_0084225 3300046518 Bacteria 1370
482 Ga0495631_0106122 3300046518 Bacteria 1208
483 Ga0495631_0127202 3300046518 Bacteria 1095
484 Ga0495631_0160438 3300046518 Bacteria 965
485 Ga0495632_0000048 3300046519 Bacteria 137883
486 Ga0495632_0000065 3300046519 Bacteria 116086
487 Ga0495632_0000129 3300046519 Bacteria 77134
488 Ga0495632_0000296 3300046519 Bacteria 48157
489 Ga0495632_0000445 3300046519 Bacteria 39318
490 Ga0495632_0002241 3300046519 Bacteria 14914
491 Ga0495632_0013411 3300046519 Bacteria 4678
492 Ga0495632_0013468 3300046519 Bacteria 4667
493 Ga0495632_0014339 3300046519 Bacteria 4487
494 Ga0495632_0018245 3300046519 Bacteria 3854
495 Ga0495632_0023960 3300046519 Bacteria 3250
496 Ga0495632_0025629 3300046519 Bacteria 3117
497 Ga0495637_0000019 3300046520 Bacteria 185953
498 Ga0495637_0000293 3300046520 Bacteria 38928
499 Ga0495637_0003878 3300046520 Bacteria 7849
500 Ga0495637_0015401 3300046520 Bacteria 3585
501 Ga0495637_0023477 3300046520 Bacteria 2802
502 Ga0495637_0025683 3300046520 Bacteria 2652
503 Ga0495637_0031841 3300046520 Bacteria 2329
504 Ga0495637_0046503 3300046520 Bacteria 1835
505 Ga0495637_0047426 3300046520 Bacteria 1813
506 Ga0495643_0000030 3300046522 Bacteria 260229
507 Ga0495643_0000081 3300046522 Bacteria 160004
508 Ga0495643_0000234 3300046522 Bacteria 84022
509 Ga0495643_0000259 3300046522 Bacteria 77609
510 Ga0495643_0000391 3300046522 Bacteria 57750
511 Ga0495643_0003298 3300046522 Bacteria 11926
512 Ga0495643_0005676 3300046522 Bacteria 8363
513 Ga0495643_0038465 3300046522 Bacteria 2620
514 Ga0495643_0039291 3300046522 Bacteria 2589
515 Ga0495643_0045127 3300046522 Bacteria 2393
516 Ga0495643_0110145 3300046522 Bacteria 1401
517 Ga0495643_0114352 3300046522 Bacteria 1369
518 Ga0495643_0135447 3300046522 Bacteria 1233
519 Ga0495644_0005954 3300046523 Bacteria 4753
520 Ga0495644_0013952 3300046523 Bacteria 3080
521 Ga0495644_0022314 3300046523 Bacteria 2412
522 Ga0495644_0026508 3300046523 Bacteria 2198
523 Ga0495644_0039788 3300046523 Bacteria 1772
524 Ga0495644_0082294 3300046523 Bacteria 1213
525 Ga0495648_0000030 3300046524 Bacteria 216178
526 Ga0495648_0001105 3300046524 Bacteria 27423
527 Ga0495648_0002123 3300046524 Bacteria 18676
528 Ga0495648_0002372 3300046524 Bacteria 17491
529 Ga0495648_0003335 3300046524 Bacteria 14162
530 Ga0495648_0006165 3300046524 Bacteria 9831
531 Ga0495648_0016682 3300046524 Bacteria 5286
532 Ga0495648_0020755 3300046524 Bacteria 4570
533 Ga0495648_0024723 3300046524 Bacteria 4081
534 Ga0495663_0000003 3300046525 Bacteria 362694
535 Ga0495663_0017735 3300046525 Bacteria 2022
536 Ga0495663_0056308 3300046525 Bacteria 1228
537 Ga0495663_0077534 3300046525 Bacteria 1066
538 Ga0495666_0001974 3300046526 Bacteria 10124
539 Ga0495666_0071989 3300046526 Bacteria 1642
540 Ga0495666_0120197 3300046526 Bacteria 1231
541 Ga0495642_0000085 3300046528 Bacteria 54372
542 Ga0495642_0000285 3300046528 Bacteria 28471
543 Ga0495642_0002484 3300046528 Bacteria 7496
544 Ga0495642_0004658 3300046528 Bacteria 5312
545 Ga0495642_0032156 3300046528 Bacteria 2104
546 Ga0495642_0055346 3300046528 Bacteria 1637
547 Ga0495642_0064434 3300046528 Bacteria 1524
548 Ga0495642_0092782 3300046528 Bacteria 1279
549 Ga0495652_0033951 3300046529 Bacteria 4449
550 Ga0495654_0000014 3300046530 Bacteria 312126
551 Ga0495654_0002221 3300046530 Bacteria 12587
552 Ga0495654_0032258 3300046530 Bacteria 2656
553 Ga0495654_0041475 3300046530 Bacteria 2289
554 Ga0495654_0053621 3300046530 Bacteria 1959
555 Ga0495654_0054451 3300046530 Bacteria 1940
556 Ga0495665_0000967 3300046531 Bacteria 15211
557 Ga0495665_0002029 3300046531 Bacteria 10962
558 Ga0495665_0230130 3300046531 Bacteria 957
559 Ga0495586_0005932 3300046535 Bacteria 6538
560 Ga0495586_0348831 3300046535 Bacteria 850
561 Ga0495587_0012506 3300046536 Bacteria 5338
562 Ga0495587_0047406 3300046536 Bacteria 2548
563 Ga0495609_0000019 3300046538 Bacteria 297777
564 Ga0495609_0000298 3300046538 Bacteria 45867
565 Ga0495609_0000447 3300046538 Bacteria 33815
566 Ga0495609_0001963 3300046538 Bacteria 13048
567 Ga0495609_0002362 3300046538 Bacteria 11646
568 Ga0495609_0004683 3300046538 Bacteria 7409
569 Ga0495609_0005513 3300046538 Bacteria 6618
570 Ga0495609_0011763 3300046538 Bacteria 4161
571 Ga0495609_0017035 3300046538 Bacteria 3380
572 Ga0495609_0039371 3300046538 Bacteria 2128
573 Ga0495609_0071947 3300046538 Bacteria 1519
574 Ga0495597_0000020 3300046542 Bacteria 161793
575 Ga0495597_0000226 3300046542 Bacteria 51108
576 Ga0495597_0000378 3300046542 Bacteria 38615
577 Ga0495597_0000771 3300046542 Bacteria 25342
578 Ga0495597_0010567 3300046542 Bacteria 4504
579 Ga0495597_0027187 3300046542 Bacteria 2624
580 Ga0495597_0049366 3300046542 Bacteria 1859
581 Ga0495597_0059891 3300046542 Bacteria 1661
582 Ga0495597_0079802 3300046542 Bacteria 1401
583 Ga0495622_0000002 3300046557 Bacteria 321742
584 Ga0495622_0001564 3300046557 Bacteria 11352
585 Ga0495622_0020979 3300046557 Bacteria 3042
586 Ga0495622_0038190 3300046557 Bacteria 2236
587 Ga0495622_0055342 3300046557 Bacteria 1840
588 Ga0495622_0115500 3300046557 Bacteria 1227
589 Ga0495633_0000215 3300046558 Bacteria 72445
590 Ga0495633_0002968 3300046558 Bacteria 11604
591 Ga0495633_0003511 3300046558 Bacteria 10400
592 Ga0495633_0006036 3300046558 Bacteria 7265
593 Ga0495633_0009986 3300046558 Bacteria 5208
594 Ga0495633_0030221 3300046558 Bacteria 2633
595 Ga0495633_0033386 3300046558 Bacteria 2481
596 Ga0495633_0044780 3300046558 Bacteria 2097
597 Ga0495633_0051377 3300046558 Bacteria 1942
598 Ga0495633_0091548 3300046558 Bacteria 1414
599 Ga0495633_0102959 3300046558 Bacteria 1325
600 Ga0495633_0143858 3300046558 Bacteria 1102
601 Ga0495656_0009349 3300046615 Bacteria 3523
602 Ga0495656_0009453 3300046615 Bacteria 3505
603 Ga0495656_0012450 3300046615 Bacteria 3139
604 Ga0495656_0127214 3300046615 Bacteria 1209
605 Ga0495656_0129691 3300046615 Bacteria 1199
606 Ga0495668_0000066 3300046616 Bacteria 178533
607 Ga0495668_0000579 3300046616 Bacteria 44604
608 Ga0495668_0000712 3300046616 Bacteria 40090
609 Ga0495668_0000941 3300046616 Bacteria 32463
610 Ga0495668_0006113 3300046616 Bacteria 7971
611 Ga0495668_0008725 3300046616 Bacteria 6294
612 Ga0495668_0014985 3300046616 Bacteria 4536
613 Ga0495668_0018432 3300046616 Bacteria 4033
614 Ga0495668_0025349 3300046616 Bacteria 3370
615 Ga0495668_0026700 3300046616 Bacteria 3275
616 Ga0495668_0028787 3300046616 Bacteria 3140
617 Ga0495634_0110452 3300046642 Bacteria 1768
618 Ga0495611_0000195 3300046648 Bacteria 42925
619 Ga0495611_0000773 3300046648 Bacteria 17861
620 Ga0495611_0005640 3300046648 Bacteria 5337
621 Ga0495611_0012256 3300046648 Bacteria 3645
622 Ga0495611_0013207 3300046648 Bacteria 3514
623 Ga0495611_0021422 3300046648 Bacteria 2792
624 Ga0495625_0000931 3300046660 Bacteria 39360
625 Ga0495625_0003303 3300046660 Bacteria 16271
626 Ga0495625_0006597 3300046660 Bacteria 10306
627 Ga0495625_0007223 3300046660 Bacteria 9722
628 Ga0495625_0008059 3300046660 Bacteria 9034
629 Ga0495625_0009200 3300046660 Bacteria 8297
630 Ga0495625_0009398 3300046660 Bacteria 8184
631 Ga0495625_0016910 3300046660 Bacteria 5725
632 Ga0495625_0042605 3300046660 Bacteria 3297
633 Ga0495625_0045391 3300046660 Bacteria 3177
634 Ga0495625_0053402 3300046660 Bacteria 2890
635 Ga0495625_0070958 3300046660 Bacteria 2445
636 Ga0495625_0079450 3300046660 Bacteria 2287
637 Ga0495625_0262301 3300046660 Bacteria 1118
638 Ga0495635_0080820 3300046663 Bacteria 2224
639 Ga0495661_0000012 3300046665 Bacteria 276804
640 Ga0495661_0001056 3300046665 Bacteria 24401
641 Ga0495661_0001625 3300046665 Bacteria 18404
642 Ga0495661_0001753 3300046665 Bacteria 17440
643 Ga0495661_0002244 3300046665 Bacteria 14973
644 Ga0495661_0002879 3300046665 Bacteria 13017
645 Ga0495661_0003589 3300046665 Bacteria 11417
646 Ga0495661_0005577 3300046665 Bacteria 8923
647 Ga0495661_0019699 3300046665 Bacteria 4416
648 Ga0495661_0025401 3300046665 Bacteria 3825
649 Ga0495661_0025719 3300046665 Bacteria 3799
650 Ga0495661_0025738 3300046665 Bacteria 3797
651 Ga0495661_0029391 3300046665 Bacteria 3508
652 Ga0495661_0032133 3300046665 Bacteria 3321
653 Ga0495661_0036722 3300046665 Bacteria 3064
654 Ga0495661_0042148 3300046665 Bacteria 2816
655 Ga0495661_0054609 3300046665 Bacteria 2397
656 Ga0495661_0062250 3300046665 Bacteria 2211
657 Ga0495661_0064810 3300046665 Bacteria 2154
658 Ga0495661_0070399 3300046665 Bacteria 2047
659 Ga0495661_0087318 3300046665 Bacteria 1783
660 Ga0495661_0134895 3300046665 Bacteria 1348
661 Ga0495661_0138143 3300046665 Bacteria 1328
662 Ga0495661_0186158 3300046665 Bacteria 1097
663 Ga0495661_0208321 3300046665 Bacteria 1019
664 Ga0495588_0000050 3300046674 Bacteria 335314
665 Ga0495588_0004204 3300046674 Bacteria 6348
666 Ga0495588_0005098 3300046674 Bacteria 5838
667 Ga0495588_0014664 3300046674 Bacteria 3757
668 Ga0495588_0039624 3300046674 Bacteria 2401
669 Ga0495623_0011819 3300046679 Bacteria 5656
670 Ga0495646_0249751 3300046680 Bacteria 951
671 Ga0495669_0000177 3300046684 Bacteria 40130
672 Ga0495669_0001901 3300046684 Bacteria 8561
673 Ga0495669_0002014 3300046684 Bacteria 8331
674 Ga0495669_0004319 3300046684 Bacteria 5865
675 Ga0495669_0004923 3300046684 Bacteria 5543
676 Ga0495669_0006645 3300046684 Bacteria 4837
677 Ga0495669_0017491 3300046684 Bacteria 3077
678 Ga0495669_0025856 3300046684 Bacteria 2563
679 Ga0495669_0136775 3300046684 Bacteria 1155
680 Ga0495613_0021419 3300046689 Bacteria 4819
681 Ga0495613_0127856 3300046689 Bacteria 1821
682 Ga0495624_0012500 3300046690 Bacteria 5799
683 Ga0495670_0000099 3300046691 Bacteria 37893
684 Ga0495670_0000845 3300046691 Bacteria 14804
685 Ga0495670_0002249 3300046691 Bacteria 9520
686 Ga0495670_0004826 3300046691 Bacteria 6621
687 Ga0495670_0014837 3300046691 Bacteria 3835
688 Ga0495670_0015496 3300046691 Bacteria 3745
689 Ga0495670_0015603 3300046691 Bacteria 3732
690 Ga0495670_0073028 3300046691 Bacteria 1738
691 Ga0495670_0124261 3300046691 Bacteria 1342
692 Ga0495670_0155901 3300046691 Bacteria 1198
693 Ga0495671_0000005 3300046692 Bacteria 509397
694 Ga0495671_0000043 3300046692 Bacteria 163036
695 Ga0495671_0000965 3300046692 Bacteria 20129
696 Ga0495671_0001044 3300046692 Bacteria 19266
697 Ga0495671_0002730 3300046692 Bacteria 11054
698 Ga0495671_0003679 3300046692 Bacteria 9336
699 Ga0495671_0009092 3300046692 Bacteria 5567
700 Ga0495671_0013778 3300046692 Bacteria 4366
701 Ga0495671_0020586 3300046692 Bacteria 3475
702 Ga0495671_0027738 3300046692 Bacteria 2921
703 Ga0495671_0055345 3300046692 Bacteria 1965
704 Ga0495649_0000277 3300046694 Bacteria 45216
705 Ga0495649_0000925 3300046694 Bacteria 23262
706 Ga0495649_0001478 3300046694 Bacteria 17648
707 Ga0495649_0002415 3300046694 Bacteria 13178
708 Ga0495649_0007497 3300046694 Bacteria 6640
709 Ga0495649_0009530 3300046694 Bacteria 5761
710 Ga0495649_0013410 3300046694 Bacteria 4728
711 Ga0495649_0021575 3300046694 Bacteria 3608
712 Ga0495649_0024486 3300046694 Bacteria 3365
713 Ga0495649_0033919 3300046694 Bacteria 2809
714 Ga0495649_0037742 3300046694 Bacteria 2651
715 Ga0495649_0123923 3300046694 Bacteria 1365
716 Ga0495589_0000007 3300046794 Bacteria 276444
717 Ga0495589_0000145 3300046794 Bacteria 65639
718 Ga0495589_0002088 3300046794 Bacteria 11298
719 Ga0495589_0008988 3300046794 Bacteria 5198
720 Ga0495589_0017726 3300046794 Bacteria 3654
721 Ga0495589_0022401 3300046794 Bacteria 3223
722 Ga0495589_0038226 3300046794 Bacteria 2403
723 Ga0495589_0047301 3300046794 Bacteria 2132
724 Ga0495589_0052226 3300046794 Bacteria 2020
725 Ga0495589_0059031 3300046794 Bacteria 1886
726 Ga0495589_0062732 3300046794 Bacteria 1823
727 Ga0495589_0103003 3300046794 Bacteria 1380
728 Ga0495589_0126147 3300046794 Bacteria 1231
729 Ga0495660_0000100 3300046810 Bacteria 92354
730 Ga0495660_0000779 3300046810 Bacteria 23870
731 Ga0495660_0002034 3300046810 Bacteria 13147
732 Ga0495660_0002236 3300046810 Bacteria 12458
733 Ga0495660_0004798 3300046810 Bacteria 8157
734 Ga0495660_0006085 3300046810 Bacteria 7165
735 Ga0495660_0007481 3300046810 Bacteria 6413
736 Ga0495660_0011314 3300046810 Bacteria 5181
737 Ga0495660_0011889 3300046810 Bacteria 5050
738 Ga0495660_0013655 3300046810 Bacteria 4709
739 Ga0495660_0015327 3300046810 Bacteria 4428
740 Ga0495660_0059833 3300046810 Bacteria 2048
741 Ga0495660_0114702 3300046810 Bacteria 1370
742 Ga0495581_0013823 3300047315 Bacteria 4678
743 Ga0495581_0069182 3300047315 Bacteria 2041
744 Ga0495604_0017012 3300047317 Bacteria 5815
745 Ga0495604_0062481 3300047317 Bacteria 2844
746 Ga0495604_0323950 3300047317 Bacteria 1029
747 Ga0495636_0010960 3300047318 Bacteria 3589
748 Ga0495672_0000041 3300047320 Bacteria 267545
749 Ga0495672_0000188 3300047320 Bacteria 89538
750 Ga0495672_0000226 3300047320 Bacteria 80307
751 Ga0495672_0000272 3300047320 Bacteria 71551
752 Ga0495672_0007001 3300047320 Bacteria 8570
753 Ga0495672_0011006 3300047320 Bacteria 6410
754 Ga0495672_0020577 3300047320 Bacteria 4318
755 Ga0495672_0072364 3300047320 Bacteria 1947
756 Ga0495672_0077174 3300047320 Bacteria 1868
757 Ga0495672_0197651 3300047320 Bacteria 1007
758 Ga0495676_0000037 3300047321 Bacteria 115856
759 Ga0495676_0043115 3300047321 Bacteria 3696
760 Ga0495676_0127562 3300047321 Bacteria 1841
761 Ga0495680_0005077 3300047322 Bacteria 12424
762 Ga0495680_0021570 3300047322 Bacteria 5390
763 Ga0495683_0000763 3300047323 Bacteria 23208
764 Ga0495683_0001975 3300047323 Bacteria 12798
765 Ga0495683_0009910 3300047323 Bacteria 5060
766 Ga0495683_0011455 3300047323 Bacteria 4667
767 Ga0495683_0023237 3300047323 Bacteria 3188
768 Ga0495683_0051917 3300047323 Bacteria 2048
769 Ga0495683_0075001 3300047323 Bacteria 1657
770 Ga0495683_0115975 3300047323 Bacteria 1275
771 Ga0495683_0156977 3300047323 Bacteria 1054
772 Ga0495687_000003 3300047443 Bacteria 859509
773 Ga0495687_000016 3300047443 Bacteria 359237
774 Ga0495687_000028 3300047443 Bacteria 293356
775 Ga0495687_000417 3300047443 Bacteria 52512
776 Ga0495687_001550 3300047443 Bacteria 20895
777 Ga0495687_046170 3300047443 Bacteria 1882
778 Ga0495675_0101663 3300047444 Bacteria 1798
779 Ga0495677_0000005 3300047445 Bacteria 243336
780 Ga0495677_0000210 3300047445 Bacteria 26828
781 Ga0495677_0000722 3300047445 Bacteria 13347
782 Ga0495677_0002621 3300047445 Bacteria 7038
783 Ga0495677_0003870 3300047445 Bacteria 5785
784 Ga0495677_0005985 3300047445 Bacteria 4604
785 Ga0495677_0011091 3300047445 Bacteria 3299
786 Ga0495677_0017220 3300047445 Bacteria 2620
787 Ga0495677_0020456 3300047445 Bacteria 2399
788 Ga0495677_0125269 3300047445 Bacteria 981
789 Ga0495677_0211802 3300047445 Bacteria 754
790 Ga0495679_002173 3300047446 Bacteria 10289
791 Ga0495679_005976 3300047446 Bacteria 5320
792 Ga0495679_008263 3300047446 Bacteria 4247
793 Ga0495679_022179 3300047446 Bacteria 2177
794 Ga0495679_041848 3300047446 Bacteria 1416
795 Ga0495685_005235 3300047447 Bacteria 4223
796 Ga0495685_019404 3300047447 Bacteria 2336
797 Ga0495685_039044 3300047447 Bacteria 1625
798 Ga0495673_0000008 3300047469 Bacteria 752462
799 Ga0495673_0000012 3300047469 Bacteria 656908
800 Ga0495673_0000702 3300047469 Bacteria 32531
801 Ga0495673_0068437 3300047469 Bacteria 1500
802 Ga0495673_0092700 3300047469 Bacteria 1232
803 Ga0495681_0000123 3300047470 Bacteria 68069
804 Ga0495681_0003758 3300047470 Bacteria 10527
805 Ga0495681_0004627 3300047470 Bacteria 9339
806 Ga0495681_0005829 3300047470 Bacteria 8182
807 Ga0495681_0007875 3300047470 Bacteria 6737
808 Ga0495681_0008039 3300047470 Bacteria 6650
809 Ga0495681_0027026 3300047470 Bacteria 2976
810 Ga0495681_0081491 3300047470 Bacteria 1443
811 Ga0495681_0099096 3300047470 Bacteria 1276
812 Ga0495681_0104627 3300047470 Bacteria 1233
813 Ga0495681_0201059 3300047470 Bacteria 808
814 Ga0495686_0000054 3300047472 Bacteria 259400
815 Ga0495686_0000732 3300047472 Bacteria 43872
816 Ga0495686_0003051 3300047472 Bacteria 14839
817 Ga0495686_0003612 3300047472 Bacteria 13268
818 Ga0495686_0012570 3300047472 Bacteria 5918
819 Ga0495686_0019149 3300047472 Bacteria 4578
820 Ga0495686_0039828 3300047472 Bacteria 2999
821 Ga0495686_0041746 3300047472 Bacteria 2919
822 Ga0495686_0066042 3300047472 Bacteria 2236
823 Ga0495686_0233483 3300047472 Bacteria 1040
824 Ga0495593_0004899 3300047673 Bacteria 7939
825 Ga0495593_0014834 3300047673 Bacteria 4427
826 Ga0495593_0068663 3300047673 Bacteria 1844
827 Ga0495614_0008021 3300048089 Bacteria 4693
828 Ga0495614_0010244 3300048089 Bacteria 4134
829 Ga0495626_0000004 3300048091 Bacteria 356599
830 Ga0495626_0000322 3300048091 Bacteria 50407
831 Ga0495626_0003241 3300048091 Bacteria 10532
832 Ga0495626_0003747 3300048091 Bacteria 9576
833 Ga0495626_0004117 3300048091 Bacteria 9034
834 Ga0495626_0004329 3300048091 Bacteria 8751
835 Ga0495626_0006298 3300048091 Bacteria 6769
836 Ga0495626_0006531 3300048091 Bacteria 6624
837 Ga0495626_0014964 3300048091 Bacteria 3980
838 Ga0495626_0016531 3300048091 Bacteria 3744
839 Ga0495626_0025116 3300048091 Bacteria 2916
840 Ga0495626_0025984 3300048091 Bacteria 2858
841 Ga0495626_0026914 3300048091 Bacteria 2798
842 Ga0495626_0041785 3300048091 Bacteria 2156
843 Ga0495626_0057082 3300048091 Bacteria 1786
844 Ga0495626_0065753 3300048091 Bacteria 1640
845 Ga0496100_0059302 3300048903 Bacteria 2514
846 Ga0496101_0020477 3300048904 Bacteria 4530
847 Ga0496101_0112071 3300048904 Bacteria 2055
848 Ga0496102_0000931 3300048905 Bacteria 27579
849 Ga0496102_0011417 3300048905 Bacteria 7657
850 Ga0496102_0030581 3300048905 Bacteria 4820
851 Ga0496102_0122227 3300048905 Bacteria 2432
852 Ga0496102_0174486 3300048905 Bacteria 2024
853 Ga0496102_0196686 3300048905 Bacteria 1900
854 Ga0496103_0007939 3300048906 Bacteria 6308
855 Ga0496103_0346197 3300048906 Bacteria 956
856 Ga0496106_0012244 3300048909 Bacteria 6332
857 Ga0496107_0017128 3300048910 Bacteria 5096
858 Ga0496107_0049247 3300048910 Bacteria 3036
859 Ga0496109_0115634 3300048912 Bacteria 2496
860 Ga0496109_0229130 3300048912 Bacteria 1748
861 Ga0496109_0231317 3300048912 Bacteria 1739
862 Ga0496109_0439711 3300048912 Bacteria 1232
863 Ga0496110_0001119 3300048913 Bacteria 18923
864 Ga0496111_0060901 3300048914 Bacteria 2736
865 Ga0496113_0007519 3300048916 Bacteria 7021
866 Ga0496113_0353646 3300048916 Bacteria 1179
867 Ga0496114_0075065 3300048917 Bacteria 2847
868 Ga0496115_0101784 3300048918 Bacteria 2356
869 Ga0496116_0000382 3300048919 Bacteria 65862
870 Ga0496116_0015565 3300048919 Bacteria 6007
871 Ga0496117_0000100 3300048920 Bacteria 194307
872 Ga0496117_0000645 3300048920 Bacteria 56167
873 Ga0496117_0001645 3300048920 Bacteria 31400
874 Ga0496117_0003157 3300048920 Bacteria 19622
875 Ga0496117_0010742 3300048920 Bacteria 8277
876 Ga0496117_0035465 3300048920 Bacteria 3743
877 Ga0496117_0130556 3300048920 Bacteria 1523
878 Ga0496118_0000338 3300048921 Bacteria 80086
879 Ga0496118_0002116 3300048921 Bacteria 27830
880 Ga0496118_0004775 3300048921 Bacteria 15842
881 Ga0496118_0008860 3300048921 Bacteria 10291
882 Ga0496118_0038351 3300048921 Bacteria 3842
883 Ga0496119_0006814 3300048922 Bacteria 10473
884 Ga0496119_0037252 3300048922 Bacteria 3162
885 Ga0496120_0004314 3300048923 Bacteria 12040
886 Ga0496120_0014380 3300048923 Bacteria 5277
887 Ga0496121_0000589 3300048924 Bacteria 68077
888 Ga0496121_0026317 3300048924 Bacteria 5486
889 Ga0496121_0040615 3300048924 Bacteria 4078
890 Ga0496121_0059199 3300048924 Bacteria 3160
891 Ga0496121_0070409 3300048924 Bacteria 2817
892 Ga0496121_0147814 3300048924 Bacteria 1734
893 Ga0496121_0258550 3300048924 Bacteria 1203
894 Ga0496122_0000210 3300048925 Bacteria 130178
895 Ga0496122_0000808 3300048925 Bacteria 60057
896 Ga0496122_0005126 3300048925 Bacteria 15811
897 Ga0496122_0009079 3300048925 Bacteria 10545
898 Ga0496122_0019722 3300048925 Bacteria 6144
899 Ga0496122_0034402 3300048925 Bacteria 4146
900 Ga0496122_0055038 3300048925 Bacteria 2981
901 Ga0496122_0106936 3300048925 Bacteria 1850
902 Ga0496122_0168599 3300048925 Bacteria 1323
903 Ga0496123_0000591 3300048926 Bacteria 61801
904 Ga0496123_0000597 3300048926 Bacteria 61302
905 Ga0496123_0001320 3300048926 Bacteria 35029
906 Ga0496123_0003625 3300048926 Bacteria 17092
907 Ga0496123_0005021 3300048926 Bacteria 13544
908 Ga0496123_0023774 3300048926 Bacteria 4681
909 Ga0496123_0066312 3300048926 Bacteria 2287
910 Ga0496123_0085817 3300048926 Bacteria 1891
911 Ga0496123_0128076 3300048926 Bacteria 1413
912 Ga0496123_0143417 3300048926 Bacteria 1301
913 Ga0496123_0161496 3300048926 Bacteria 1194
914 Ga0496124_0000056 3300048927 Bacteria 250907
915 Ga0496124_0000425 3300048927 Bacteria 75572
916 Ga0496124_0001066 3300048927 Bacteria 43350
917 Ga0496124_0004210 3300048927 Bacteria 16937
918 Ga0496124_0010799 3300048927 Bacteria 9202
919 Ga0496124_0022742 3300048927 Bacteria 5740
920 Ga0496124_0023861 3300048927 Bacteria 5572
921 Ga0496124_0035413 3300048927 Bacteria 4368
922 Ga0496124_0037634 3300048927 Bacteria 4206
923 Ga0496124_0054728 3300048927 Bacteria 3376
924 Ga0496124_0069987 3300048927 Bacteria 2911
925 Ga0496124_0114901 3300048927 Bacteria 2161
926 Ga0496124_0129593 3300048927 Bacteria 2005
927 Ga0496124_0324435 3300048927 Bacteria 1101
928 Ga0496125_0000245 3300048928 Bacteria 111310
929 Ga0496125_0000789 3300048928 Bacteria 51669
930 Ga0496125_0003880 3300048928 Bacteria 17674
931 Ga0496125_0004750 3300048928 Bacteria 15481
932 Ga0496125_0023862 3300048928 Bacteria 5637
933 Ga0496125_0042739 3300048928 Bacteria 3855
934 Ga0496125_0077384 3300048928 Bacteria 2564
935 Ga0496125_0078919 3300048928 Bacteria 2527
936 Ga0496125_0145313 3300048928 Bacteria 1640
937 Ga0496125_0222157 3300048928 Bacteria 1216
938 Ga0496125_0350107 3300048928 Bacteria 883
939 Ga0496126_0022618 3300048929 Bacteria 6110
940 Ga0496126_0101114 3300048929 Bacteria 2522
941 Ga0496126_0125425 3300048929 Bacteria 2222
942 Ga0496126_0406116 3300048929 Bacteria 1104
943 Ga0495678_000006 3300049459 Bacteria 463690
944 Ga0495678_000130 3300049459 Bacteria 88909
945 Ga0495678_000233 3300049459 Bacteria 63499
946 Ga0495678_001703 3300049459 Bacteria 16504
947 Ga0495678_001985 3300049459 Bacteria 14727
948 Ga0495678_002123 3300049459 Bacteria 14081
949 Ga0495678_018410 3300049459 Bacteria 3141
950 Ga0495678_020704 3300049459 Bacteria 2906
951 Ga0495682_0000107 3300049460 Bacteria 73486
952 Ga0495682_0001172 3300049460 Bacteria 14944
953 Ga0495682_0011704 3300049460 Bacteria 3371
954 Ga0495682_0030101 3300049460 Bacteria 2009
955 Ga0495682_0068963 3300049460 Bacteria 1273
956 Ga0495682_0085817 3300049460 Bacteria 1131
957 Ga0501032_0189417 3300049569 Bacteria 1345
958 Ga0501034_0166710 3300049571 Bacteria 2171
959 Ga0501034_0191130 3300049571 Bacteria 2009
960 Ga0501034_0339289 3300049571 Bacteria 1433
961 Ga0501034_0505333 3300049571 Bacteria 1122
962 Ga0501047_0235227 3300049581 Bacteria 1684
963 Ga0501227_005034 3300049665 Bacteria 2838
964 Ga0501249_004483 3300049679 Bacteria 2836
965 Ga0501269_000016 3300049766 Bacteria 58863
966 Ga0501269_001654 3300049766 Bacteria 2850
967 Ga0501035_0018733 3300049822 Bacteria 6376
968 Ga0501035_0148309 3300049822 Bacteria 2037
969 Ga0501044_0177987 3300049823 Bacteria 2095
970 Ga0501044_0389883 3300049823 Bacteria 1307
971 nmdc:mga03n38_225856_c1 3300050490 Bacteria 979
972 nmdc:mga00v17_23_c1 3300050491 Bacteria 43132
973 nmdc:mga00v17_33669_c1 3300050491 Bacteria 3037
974 nmdc:mga00v17_62366_c1 3300050491 Bacteria 2293
975 Ga0500643_000362 3300053087 Bacteria 35932
976 Ga0500641_0072413 3300053096 Bacteria 1452
977 Ga0500555_000370 3300053103 Bacteria 19042
978 Ga0500618_000088 3300053125 Bacteria 74892
979 Ga0500618_000519 3300053125 Bacteria 24282
980 Ga0500618_009889 3300053125 Bacteria 2585
981 Ga0500559_0004652 3300053136 Bacteria 6469
982 Ga0500564_178817 3300053138 Bacteria 886
983 Ga0500568_0023303 3300053139 Bacteria 2634
984 Ga0500604_0014012 3300053151 Bacteria 2179
985 Ga0500627_0008381 3300053158 Bacteria 3668
986 Ga0500634_0000386 3300053161 Bacteria 14126
987 Ga0587084_000853 3300059477 Bacteria 2651
988 Ga0587066_001081 3300059490 Bacteria 2609
989 Ga0587070_001403 3300059491 Bacteria 2477
990 Ga0587077_003339 3300059493 Bacteria 2008
991 Ga0587085_005580 3300059506 Bacteria 1488
992 Ga0587090_004877 3300059510 Bacteria 1653
993 Ga0587091_002339 3300059511 Bacteria 2231
994 Ga0587101_001671 3300059623 Bacteria 1965
995 Ga0587109_008309 3300059624 Bacteria 1598
996 Ga0587117_004643 3300059627 Bacteria 1442
997 Ga0587062_002637 3300059639 Bacteria 1732
998 Ga0587067_003478 3300059640 Bacteria 1971
999 Ga0587076_001114 3300059645 Bacteria 2622
1000 Ga0587100_000181 3300059648 Bacteria 2598
1001 Ga0587111_0008704 3300060346 Bacteria 1691
1002 2501081278 2501025502 Bacteria 9641094
1003 2501412208 2501025504 Bacteria 8008976
1004 2511094266 2510917013 Bacteria 9951648
1005 2511101645 2510917014 Bacteria 8296963
1006 2511127402 2510917021 Bacteria 5705459
1007 2511265866 2511231006 Bacteria 6794709
1008 2511386320 2511231026 Bacteria 5225445
1009 2512329148 2512047018 Bacteria 6663241
1010 2512641806 2512564014 Bacteria 4639632
1011 2516020977 2515154189 Bacteria 9629850
1012 2547501460 2547132130 Bacteria 4660562
1013 2555670074 2554235341 Bacteria 6867980
1014 2583792341 2582580891 Bacteria 6800976
1015 2597858049 2597489887 Bacteria 6666321
1016 2597863717 2597489888 Bacteria 6179543
1017 2599352892 2599185160 Bacteria 6844013
1018 2599359237 2599185161 Bacteria 6960462
1019 2599365242 2599185162 Bacteria 6957254
1020 2599371931 2599185163 Bacteria 6995158
1021 2599378000 2599185164 Bacteria 6841688
1022 2599384623 2599185165 Bacteria 6843250
1023 2599390789 2599185166 Bacteria 6959206
1024 2599401838 2599185167 Bacteria 6353609
1025 2599402974 2599185168 Bacteria 6997636
1026 2599448427 2599185178 Bacteria 5365746
1027 2599453971 2599185179 Bacteria 6611171
1028 2599459726 2599185181 Bacteria 6844519
1029 2599465935 2599185182 Bacteria 6883168
1030 2599485082 2599185185 Bacteria 6652270
1031 2599488747 2599185186 Bacteria 6831633
1032 2599509180 2599185189 Bacteria 5862825
1033 2599515545 2599185190 Bacteria 6285678
1034 2599521350 2599185191 Bacteria 6297582
1035 2599802695 2599185257 Bacteria 6492581
1036 2599881171 2599185288 Bacteria 6666191
1037 2599894924 2599185290 Bacteria 6289611
1038 2599949544 2599185303 Bacteria 6512725
1039 2600212333 2599185356 Bacteria 6843884
1040 2600366655 2600254931 Bacteria 6734225
1041 2600446158 2600254954 Bacteria 5100516
1042 2601690471 2600255296 Bacteria 5784754
1043 2601772501 2600255313 Bacteria 6842543
1044 2602008040 2600255389 Bacteria 5275336
1045 2643800573 2643221556 Bacteria 7251154
1046 2643869799 2643221571 Bacteria 6228673
1047 2643949730 2643221588 Bacteria 3692460
1048 2644133894 2643221623 Bacteria 5239945
1049 2644214045 2643221638 Bacteria 6579467
1050 2644470690 2643221684 Bacteria 7145183
1051 2644621043 2643221713 Bacteria 6554480
1052 2671095531 2667528171 Bacteria 6900659
1053 2671769684 2671180172 Bacteria 6495783
1054 2677901038 2675903420 Bacteria 6247433
1055 2691331382 2690315857 Bacteria 4396207
1056 2723248999 2721755607 Bacteria 5841722
1057 2738810409 2738541294 Bacteria 6925949
1058 2738826346 2738541297 Bacteria 6549566
1059 2738897769 2738541309 Bacteria 6926455
1060 2739150143 2738541357 Bacteria 6549408
1061 2739192062 2738543003 Bacteria 6549560
1062 2739288474 2738543020 Bacteria 5718238
1063 2739293786 2738543021 Bacteria 5718241
1064 2739318539 2738543026 Bacteria 6549408
1065 2739336780 2738543029 Bacteria 6549249
1066 2743737515 2740892503 Bacteria 6855563
1067 2758640644 2758568016 Bacteria 5645291
1068 2808978416 2808606385 Bacteria 6711065
1069 2808994057 2808606388 Bacteria 6706662
1070 2809143300 2808606418 Bacteria 6724496
1071 2819700992 2818991464 Bacteria 6907494
1072 2821134854 2821131069 Bacteria 6108407
1073 2821444546 2821443989 Bacteria 7658172
1074 2823421295 2823421272 Bacteria 5372474
1075 2834030082 2834028612 Bacteria 6354979
1076 2834643344 2834641062 Bacteria 5559922
1077 2842715698 2842711865 Bacteria 7155354
1078 2842831616 2842826826 Bacteria 5974129
1079 2842840132 2842837860 Bacteria 6066181
1080 2842858020 2842854478 Bacteria 6143501
1081 2844670692 2844665904 Bacteria 6817974
1082 2852617558 2852612431 Bacteria 6885235
1083 2852672323 2852667396 Bacteria 6885555
1084 2855732292 2855730933 Bacteria 7047938
1085 2855769000 2855767633 Bacteria 7049357
1086 2857358052 2857357740 Bacteria 9937880
1087 2857553374 2857553236 Bacteria 6166726
1088 2857563351 2857558681 Bacteria 6617694
1089 2857569760 2857564685 Bacteria 6290584
1090 2882809192 2882806704 Bacteria 3007728
1091 2883089071 2883087390 Bacteria 9532701
1092 2895501889 2895498888 Bacteria 5283788
1093 2895517554 2895511927 Bacteria 6802080
1094 2895526189 2895525241 Bacteria 3388457
1095 2904428222 2904424332 Bacteria 7633521
1096 2917073897 2917070673 Bacteria 6868303
1097 2919046776 2919046199 Bacteria 5567169
1098 2919136880 2919134579 Bacteria 4480386
1099 2919479716 2919476304 Bacteria 5888696
1100 2919502916 2919501602 Bacteria 5286340
1101 2919534945 2919534386 Bacteria 4577686
1102 2923156556 2923153595 Bacteria 6870622
1103 2926064589 2926063275 Bacteria 5285848
1104 2929192820 2929189879 Bacteria 5930554
1105 2931394224 2931390751 Bacteria 6273349
1106 2935357048 2935353572 Unclassified 6955622
1107 2939608774 2939607340 Bacteria 4719256
1108 2939636014 2939631187 Bacteria 6118131
1109 2945933753 2945928738 Bacteria 6053221
1110 2945963935 2945961074 Bacteria 7342064
1111 2946010172 2946006987 Bacteria 6705746
1112 2946031158 2946027586 Bacteria 6049274
1113 2947237556 2947233263 Bacteria 6439278
1114 2984289518 2984286254 Bacteria 6702062
1115 2987607663 2987605356 Bacteria 4187822
1116 2990710726 2990703756 Bacteria 7715990
1117 3007254912 3007252601 Bacteria 4559114
1118 3007316287 3007315729 Bacteria 5076637
1119 3007395940 3007395558 Bacteria 6755444
1120 637320439 637000220 Bacteria 7074893
1121 8003402591 8003400568 Bacteria 5535898
1122 8015690750 8015687852 Bacteria 6613826
1123 8019773250 8019769354 Bacteria 6924660
1124 8047677569 8047673197 Bacteria 7395230
1125 8054286389 8054285046 Bacteria 6919322
1126 8054348165 8054347763 Bacteria 5901107
1127 8054359281 8054357960 Bacteria 2867777
1128 8054505932 8054503363 Bacteria 6101651
1129 8055100099 8055097453 Bacteria 4865496
1130 8055773887 8055770955 Bacteria 6827675
1131 8055820576 8055817908 Bacteria 6609162
1132 8056134978 8056131705 Bacteria 6107031
1133 8056146549 8056143049 Bacteria 6307666
1134 8056154544 8056148874 Bacteria 6479865
1135 8056166363 8056161164 Bacteria 6106669
1136 8057309339 8057304971 Bacteria 4649742
1137 8057800578 8057798959 Bacteria 6713499
1138 Ga0466982_0000040
1139 JGI24741J21665_1000149
1140 JGI24740J21852_10003968
1141 JGI25156J39149_1011038
1142 JGI25162J39368_1000004
1143 JGI25162J39368_1003457
1144 JGI25154J39366_1000359
1145 JGI25163J39215_1000047
1146 JGI25164J39214_1000031
1147 JGI25159J45721_1000757
1148 JGI25165J46597_1000011
1149 rootL2_10031707
1150 Ga0055538_1000123
1151 Ga0055538_1004657
1152 Ga0055539_1000073
1153 Ga0055539_1000167
1154 Ga0055533_1000171
1155 Ga0055533_1005112
1156 Ga0055533_1005878
1157 Ga0055532_1000090
1158 Ga0055532_1000159
1159 Ga0055525_1000232
1160 Ga0055525_1000383
1161 Ga0055527_1000479
1162 Ga0055535_1000085
1163 Ga0055535_1006235
1164 Ga0055529_1000134
1165 Ga0055526_1000007
1166 Ga0055526_1000116
1167 Ga0055536_1000014
1168 Ga0055536_1000820
1169 Ga0055530_10000126
1170 Ga0055530_10000182
1171 Ga0055530_10000529
1172 Ga0055540_1000566
1173 Ga0055531_10000165
1174 Ga0055531_10001146
1175 Ga0055541_1000112
1176 Ga0055541_1009305
1177 Ga0058692_1000002
1178 Ga0055543_1002524
1179 Ga0065165_1000005
1180 Ga0065165_1000286
1181 Ga0065714_10064654
1182 Ga0065704_10071150
1183 Ga0065704_10092201
1184 Ga0065704_10135927
1185 Ga0065712_10009916
1186 Ga0070658_10583537
1187 Ga0070670_100000087
1188 Ga0070670_100001916
1189 Ga0070660_100511446
1190 Ga0070661_100000141
1191 Ga0070661_100004776
1192 Ga0070669_100009854
1193 Ga0070663_100000034
1194 Ga0070662_100005950
1195 Ga0070662_100203365
1196 Ga0068867_100283963
1197 Ga0068853_100077825
1198 Ga0070665_100000335
1199 Ga0070664_100000044
1200 Ga0070664_100000057
1201 Ga0070664_100051154
1202 Ga0068854_100000937
1203 Ga0068856_100004528
1204 Ga0068852_100115207
1205 Ga0068851_10000752
1206 Ga0068851_10215765
1207 Ga0075363_100130804
1208 Ga0075364_10012986
1209 Ga0075364_10034882
1210 Ga0079104_1006764
1211 Ga0099826_10000013
1212 Ga0105251_10003715
1213 Ga0105251_10005101
1214 Ga0105251_10013329
1215 Ga0105251_10039117
1216 Ga0105251_10055154
1217 Ga0105244_10000014
1218 Ga0105244_10000134
1219 Ga0105244_10002934
1220 Ga0105244_10015891
1221 Ga0105244_10050756
1222 Ga0105244_10206415
1223 Ga0105250_10000661
1224 Ga0105250_10021366
1225 Ga0105240_10031977
1226 Ga0105240_10042292
1227 Ga0105243_10007675
1228 Ga0105243_10014001
1229 Ga0105243_10062782
1230 Ga0105241_10071225
1231 Ga0105242_10000661
1232 Ga0105237_10000116
1233 Ga0105237_10053888
1234 Ga0105237_10181195
1235 Ga0105237_10359267
1236 Ga0105238_10217878
1237 Ga0105246_10001733
1238 Ga0105246_10011605
1239 Ga0157373_10006159
1240 Ga0157373_10009246
1241 Ga0157373_10011962
1242 Ga0157373_10025897
1243 Ga0157371_10000323
1244 Ga0157371_10004329
1245 Ga0157370_10000038
1246 Ga0157370_10018703
1247 Ga0157370_10024498
1248 Ga0157369_10003855
1249 Ga0157369_10007043
1250 Ga0157369_10007727
1251 Ga0157369_10034990
1252 Ga0157369_10037652
1253 Ga0163162_10085005
1254 Ga0157372_10000776
1255 Ga0157372_10323738
1256 Ga0157372_10604177
1257 Ga0157375_10003691
1258 Ga0157375_10007576
1259 Ga0157375_10121243
1260 Ga0182008_10000261
1261 Ga0182008_10001346
1262 Ga0182008_10003524
1263 Ga0157379_10186755
1264 Ga0157376_10082633
1265 Ga0182006_1000206
1266 Ga0182006_1002616
1267 Ga0182006_1004672
1268 Ga0182007_10003019
1269 Ga0163161_10007916
1270 Ga0163161_10008504
1271 Ga0163161_10011745
1272 Ga0163161_10013050
1273 Ga0163161_10015040
1274 Ga0197907_11440316
1275 Ga0206356_10624618
1276 Ga0206351_10978011
1277 Ga0206351_10989253
1278 Ga0206350_11491042
1279 Ga0154015_1552384
1280 Ga0224712_10002754
1281 Ga0209435_100840
1282 Ga0209760_100032
1283 Ga0209784_100006
1284 Ga0209784_100058
1285 Ga0209566_100002
1286 Ga0209566_100045
1287 Ga0209674_100096
1288 Ga0209674_100097
1289 Ga0209674_100403
1290 Ga0209672_100208
1291 Ga0209147_100018
1292 Ga0209147_100056
1293 Ga0209563_100007
1294 Ga0209563_100041
1295 Ga0209563_100064
1296 Ga0207427_100003
1297 Ga0209437_100002
1298 Ga0209437_101405
1299 Ga0209258_100028
1300 Ga0209258_100243
1301 Ga0209646_1000007
1302 Ga0209646_1000207
1303 Ga0209677_100007
1304 Ga0209677_100053
1305 Ga0209148_1000640
1306 Ga0209759_1002850
1307 Ga0209759_1013956
1308 Ga0209233_1000004
1309 Ga0209455_1000107
1310 Ga0209130_1000254
1311 Ga0209676_1000003
1312 Ga0209676_1001558
1313 Ga0209564_1000010
1314 Ga0209564_1000202
1315 Ga0209564_1001636
1316 Ga0209050_1000004
1317 Ga0209050_1000010
1318 Ga0209050_1000069
1319 Ga0209050_1015681
1320 Ga0209256_1000921
1321 Ga0209051_1000006
1322 Ga0209257_1000027
1323 Ga0209257_1001484
1324 Ga0207656_10000394
1325 Ga0207696_1000041
1326 Ga0207655_1000002
1327 Ga0207655_1000022
1328 Ga0207655_1000063
1329 Ga0207655_1000191
1330 Ga0207655_1002838
1331 Ga0207655_1014974
1332 Ga0207655_1037820
1333 Ga0207655_1111208
1334 Ga0207713_1000004
1335 Ga0207713_1000682
1336 Ga0207713_1008675
1337 Ga0207713_1042527
1338 Ga0207713_1064545
1339 Ga0207705_10127390
1340 Ga0207695_10002492
1341 Ga0207671_10000166
1342 Ga0207660_10563602
1343 Ga0207657_10007356
1344 Ga0207649_10000056
1345 Ga0207649_10000111
1346 Ga0207650_10000418
1347 Ga0207650_10005379
1348 Ga0207690_10045688
1349 Ga0207706_10003731
1350 Ga0207709_10000982
1351 Ga0207709_10004470
1352 Ga0207709_10021519
1353 Ga0207679_10000036
1354 Ga0207679_10000105
1355 Ga0207679_10138463
1356 Ga0207640_10000154
1357 Ga0207678_10000106
1358 Ga0207702_10000135
1359 Ga0207648_10137021
1360 Ga0207674_10002847
1361 Ga0207698_10091909
1362 Ga0209281_1000379
1363 Ga0209281_1004003
1364 Ga0209371_1000004
1365 Ga0209282_1000043
1366 Ga0268266_10000335
1367 Ga0268266_10126077
1368 Ga0265338_10001178
1369 Ga0268256_1000005
1370 Ga0307511_10061742
1371 Ga0265340_10079217
1372 Ga0307509_10097343
1373 Ga0307408_100000028
1374 Ga0307408_100000074
1375 Ga0307405_10001861
1376 Ga0307405_10064245
1377 Ga0307518_10013348
1378 Ga0307406_10068905
1379 Ga0307412_10001662
1380 Ga0307412_10016685
1381 Ga0307414_10098460
1382 Ga0307414_10273285
1383 Ga0307414_10499323
1384 Ga0395899_0078640
1385 Ga0395899_0085802
1386 Ga0395899_0104362
1387 Ga0395899_0112424
1388 Ga0395900_0000162
1389 Ga0395900_0005262
1390 Ga0395900_0007334
1391 Ga0395900_0009391
1392 Ga0395900_0041333
1393 Ga0395900_0107327
1394 Ga0395900_0148447
1395 Ga0395900_0177587
1396 Ga0395900_0259394
1397 Ga0395900_0334831
1398 Ga0395900_0354717
1399 Ga0395900_0378589
1400 Ga0395898_0002086
1401 Ga0395898_0023727
1402 Ga0395898_0046474
1403 Ga0395898_0050881
1404 Ga0395898_0134242
1405 Ga0395898_0279590
1406 Ga0395905_0032388
1407 Ga0395905_0039045
1408 Ga0395905_0066292
1409 Ga0395905_0300853
1410 Ga0395905_0528993
1411 Ga0395901_0000009
1412 Ga0395901_0000042
1413 Ga0395901_0000091
1414 Ga0395901_0023936
1415 Ga0395901_0061038
1416 Ga0395901_0123431
1417 Ga0395901_0168631
1418 Ga0395901_0283097
1419 Ga0395901_0525495
1420 Ga0439436_0000095
1421 Ga0439438_000160
1422 Ga0439438_000190
1423 Ga0439438_000503
1424 Ga0439466_0000574
1425 Ga0439466_0008236
1426 Ga0439466_0032146
1427 Ga0439448_0069504
1428 Ga0439432_005030
1429 Ga0439432_006082
1430 Ga0439432_021723
1431 Ga0450906_012235
1432 Ga0439464_0000813
1433 Ga0439464_0005146
1434 Ga0439464_0018199
1435 Ga0466972_0002472
1436 Ga0466972_0003769
1437 Ga0466972_0054889
1438 Ga0466965_0001680
1439 Ga0466966_0031469
1440 Ga0466966_0270642
1441 Ga0466961_0142054
1442 Ga0466971_0137107
1443 Ga0466968_0006840
1444 Ga0466970_0007069
1445 Ga0466970_0099987
1446 Ga0466958_0108722
1447 Ga0466967_0746344
1448 Ga0495617_000002
1449 Ga0495617_000020
1450 Ga0495617_000443
1451 Ga0495617_002156
1452 Ga0495627_000005
1453 Ga0495627_000058
1454 Ga0495627_000207
1455 Ga0495627_001366
1456 Ga0495627_027126
1457 Ga0495627_033386
1458 Ga0495603_0028731
1459 Ga0495603_0038059
1460 Ga0495603_0040631
1461 Ga0495590_0000025
1462 Ga0495590_0013996
1463 Ga0495590_0038493
1464 Ga0495591_000081
1465 Ga0495591_000246
1466 Ga0495591_002486
1467 Ga0495591_012754
1468 Ga0495591_016756
1469 Ga0495629_0080053
1470 Ga0495638_0007776
1471 Ga0495638_0011767
1472 Ga0495638_0029677
1473 Ga0495638_0061000
1474 Ga0495638_0070430
1475 Ga0495638_0192279
1476 Ga0495653_0000082
1477 Ga0495653_0015657
1478 Ga0495653_0019749
1479 Ga0495653_0033932
1480 Ga0495653_0049210
1481 Ga0495650_0000001
1482 Ga0495650_0000085
1483 Ga0495650_0000462
1484 Ga0495650_0001171
1485 Ga0495650_0001182
1486 Ga0495650_0053169
1487 Ga0495582_0111521
1488 Ga0495605_0000018
1489 Ga0495605_0000051
1490 Ga0495605_0000293
1491 Ga0495605_0011697
1492 Ga0495605_0019095
1493 Ga0495605_0027590
1494 Ga0495605_0029040
1495 Ga0495605_0035726
1496 Ga0495605_0057595
1497 Ga0495605_0063262
1498 Ga0495605_0108008
1499 Ga0495605_0109559
1500 Ga0495584_0000003
1501 Ga0495584_0000058
1502 Ga0495584_0000070
1503 Ga0495584_0029859
1504 Ga0495584_0062431
1505 Ga0495584_0079441
1506 Ga0495584_0083705
1507 Ga0495584_0116125
1508 Ga0495585_0000183
1509 Ga0495585_0000424
1510 Ga0495585_0000814
1511 Ga0495585_0005398
1512 Ga0495585_0006004
1513 Ga0495585_0010489
1514 Ga0495585_0017021
1515 Ga0495585_0017297
1516 Ga0495585_0030772
1517 Ga0495585_0043023
1518 Ga0495585_0043787
1519 Ga0495585_0050006
1520 Ga0495585_0088414
1521 Ga0495585_0093826
1522 Ga0495594_0000828
1523 Ga0495594_0002110
1524 Ga0495594_0054489
1525 Ga0495594_0242772
1526 Ga0495596_0000017
1527 Ga0495596_0000366
1528 Ga0495596_0000486
1529 Ga0495596_0000884
1530 Ga0495596_0000958
1531 Ga0495596_0002814
1532 Ga0495596_0002923
1533 Ga0495596_0010139
1534 Ga0495596_0010912
1535 Ga0495596_0011652
1536 Ga0495596_0012793
1537 Ga0495596_0014942
1538 Ga0495596_0016439
1539 Ga0495596_0020852
1540 Ga0495596_0024894
1541 Ga0495596_0087490
1542 Ga0495607_0000485
1543 Ga0495607_0001440
1544 Ga0495607_0001650
1545 Ga0495607_0004773
1546 Ga0495607_0004924
1547 Ga0495607_0006308
1548 Ga0495607_0009224
1549 Ga0495607_0015090
1550 Ga0495607_0019636
1551 Ga0495607_0063452
1552 Ga0495583_0000010
1553 Ga0495583_0000051
1554 Ga0495583_0000382
1555 Ga0495583_0001685
1556 Ga0495583_0003156
1557 Ga0495583_0004240
1558 Ga0495583_0005962
1559 Ga0495583_0006526
1560 Ga0495583_0021928
1561 Ga0495583_0030949
1562 Ga0495583_0036045
1563 Ga0495583_0039818
1564 Ga0495583_0055621
1565 Ga0495583_0098912
1566 Ga0495606_0000101
1567 Ga0495606_0000161
1568 Ga0495606_0000409
1569 Ga0495606_0001868
1570 Ga0495606_0003416
1571 Ga0495606_0010811
1572 Ga0495606_0017655
1573 Ga0495606_0027466
1574 Ga0495606_0089737
1575 Ga0495610_0000014
1576 Ga0495610_0000020
1577 Ga0495610_0000229
1578 Ga0495610_0000293
1579 Ga0495610_0001226
1580 Ga0495610_0019426
1581 Ga0495610_0024547
1582 Ga0495610_0069845
1583 Ga0495616_0000207
1584 Ga0495616_0000446
1585 Ga0495616_0000492
1586 Ga0495616_0000493
1587 Ga0495616_0002335
1588 Ga0495616_0008047
1589 Ga0495616_0008671
1590 Ga0495616_0011794
1591 Ga0495616_0017240
1592 Ga0495616_0019015
1593 Ga0495616_0020945
1594 Ga0495616_0025138
1595 Ga0495616_0029934
1596 Ga0495616_0034155
1597 Ga0495616_0034287
1598 Ga0495616_0073500
1599 Ga0495616_0115044
1600 Ga0495616_0172039
1601 Ga0495620_0004244
1602 Ga0495620_0005093
1603 Ga0495620_0034269
1604 Ga0495620_0053036
1605 Ga0495630_0034925
1606 Ga0495631_0000791
1607 Ga0495631_0002616
1608 Ga0495631_0003789
1609 Ga0495631_0004387
1610 Ga0495631_0005725
1611 Ga0495631_0016205
1612 Ga0495631_0016490
1613 Ga0495631_0025827
1614 Ga0495631_0040161
1615 Ga0495631_0044611
1616 Ga0495631_0052258
1617 Ga0495631_0054674
1618 Ga0495631_0084225
1619 Ga0495631_0106122
1620 Ga0495631_0127202
1621 Ga0495631_0160438
1622 Ga0495632_0000048
1623 Ga0495632_0000065
1624 Ga0495632_0000129
1625 Ga0495632_0000296
1626 Ga0495632_0000445
1627 Ga0495632_0002241
1628 Ga0495632_0013411
1629 Ga0495632_0013468
1630 Ga0495632_0014339
1631 Ga0495632_0018245
1632 Ga0495632_0023960
1633 Ga0495632_0025629
1634 Ga0495637_0000019
1635 Ga0495637_0000293
1636 Ga0495637_0003878
1637 Ga0495637_0015401
1638 Ga0495637_0023477
1639 Ga0495637_0025683
1640 Ga0495637_0031841
1641 Ga0495637_0046503
1642 Ga0495637_0047426
1643 Ga0495643_0000030
1644 Ga0495643_0000081
1645 Ga0495643_0000234
1646 Ga0495643_0000259
1647 Ga0495643_0000391
1648 Ga0495643_0003298
1649 Ga0495643_0005676
1650 Ga0495643_0038465
1651 Ga0495643_0039291
1652 Ga0495643_0045127
1653 Ga0495643_0110145
1654 Ga0495643_0114352
1655 Ga0495643_0135447
1656 Ga0495644_0005954
1657 Ga0495644_0013952
1658 Ga0495644_0022314
1659 Ga0495644_0026508
1660 Ga0495644_0039788
1661 Ga0495644_0082294
1662 Ga0495648_0000030
1663 Ga0495648_0001105
1664 Ga0495648_0002123
1665 Ga0495648_0002372
1666 Ga0495648_0003335
1667 Ga0495648_0006165
1668 Ga0495648_0016682
1669 Ga0495648_0020755
1670 Ga0495648_0024723
1671 Ga0495663_0000003
1672 Ga0495663_0017735
1673 Ga0495663_0056308
1674 Ga0495663_0077534
1675 Ga0495666_0001974
1676 Ga0495666_0071989
1677 Ga0495666_0120197
1678 Ga0495642_0000085
1679 Ga0495642_0000285
1680 Ga0495642_0002484
1681 Ga0495642_0004658
1682 Ga0495642_0032156
1683 Ga0495642_0055346
1684 Ga0495642_0064434
1685 Ga0495642_0092782
1686 Ga0495652_0033951
1687 Ga0495654_0000014
1688 Ga0495654_0002221
1689 Ga0495654_0032258
1690 Ga0495654_0041475
1691 Ga0495654_0053621
1692 Ga0495654_0054451
1693 Ga0495665_0000967
1694 Ga0495665_0002029
1695 Ga0495665_0230130
1696 Ga0495586_0005932
1697 Ga0495586_0348831
1698 Ga0495587_0012506
1699 Ga0495587_0047406
1700 Ga0495609_0000019
1701 Ga0495609_0000298
1702 Ga0495609_0000447
1703 Ga0495609_0001963
1704 Ga0495609_0002362
1705 Ga0495609_0004683
1706 Ga0495609_0005513
1707 Ga0495609_0011763
1708 Ga0495609_0017035
1709 Ga0495609_0039371
1710 Ga0495609_0071947
1711 Ga0495597_0000020
1712 Ga0495597_0000226
1713 Ga0495597_0000378
1714 Ga0495597_0000771
1715 Ga0495597_0010567
1716 Ga0495597_0027187
1717 Ga0495597_0049366
1718 Ga0495597_0059891
1719 Ga0495597_0079802
1720 Ga0495622_0000002
1721 Ga0495622_0001564
1722 Ga0495622_0020979
1723 Ga0495622_0038190
1724 Ga0495622_0055342
1725 Ga0495622_0115500
1726 Ga0495633_0000215
1727 Ga0495633_0002968
1728 Ga0495633_0003511
1729 Ga0495633_0006036
1730 Ga0495633_0009986
1731 Ga0495633_0030221
1732 Ga0495633_0033386
1733 Ga0495633_0044780
1734 Ga0495633_0051377
1735 Ga0495633_0091548
1736 Ga0495633_0102959
1737 Ga0495633_0143858
1738 Ga0495656_0009349
1739 Ga0495656_0009453
1740 Ga0495656_0012450
1741 Ga0495656_0127214
1742 Ga0495656_0129691
1743 Ga0495668_0000066
1744 Ga0495668_0000579
1745 Ga0495668_0000712
1746 Ga0495668_0000941
1747 Ga0495668_0006113
1748 Ga0495668_0008725
1749 Ga0495668_0014985
1750 Ga0495668_0018432
1751 Ga0495668_0025349
1752 Ga0495668_0026700
1753 Ga0495668_0028787
1754 Ga0495634_0110452
1755 Ga0495611_0000195
1756 Ga0495611_0000773
1757 Ga0495611_0005640
1758 Ga0495611_0012256
1759 Ga0495611_0013207
1760 Ga0495611_0021422
1761 Ga0495625_0000931
1762 Ga0495625_0003303
1763 Ga0495625_0006597
1764 Ga0495625_0007223
1765 Ga0495625_0008059
1766 Ga0495625_0009200
1767 Ga0495625_0009398
1768 Ga0495625_0016910
1769 Ga0495625_0042605
1770 Ga0495625_0045391
1771 Ga0495625_0053402
1772 Ga0495625_0070958
1773 Ga0495625_0079450
1774 Ga0495625_0262301
1775 Ga0495635_0080820
1776 Ga0495661_0000012
1777 Ga0495661_0001056
1778 Ga0495661_0001625
1779 Ga0495661_0001753
1780 Ga0495661_0002244
1781 Ga0495661_0002879
1782 Ga0495661_0003589
1783 Ga0495661_0005577
1784 Ga0495661_0019699
1785 Ga0495661_0025401
1786 Ga0495661_0025719
1787 Ga0495661_0025738
1788 Ga0495661_0029391
1789 Ga0495661_0032133
1790 Ga0495661_0036722
1791 Ga0495661_0042148
1792 Ga0495661_0054609
1793 Ga0495661_0062250
1794 Ga0495661_0064810
1795 Ga0495661_0070399
1796 Ga0495661_0087318
1797 Ga0495661_0134895
1798 Ga0495661_0138143
1799 Ga0495661_0186158
1800 Ga0495661_0208321
1801 Ga0495588_0000050
1802 Ga0495588_0004204
1803 Ga0495588_0005098
1804 Ga0495588_0014664
1805 Ga0495588_0039624
1806 Ga0495623_0011819
1807 Ga0495646_0249751
1808 Ga0495669_0000177
1809 Ga0495669_0001901
1810 Ga0495669_0002014
1811 Ga0495669_0004319
1812 Ga0495669_0004923
1813 Ga0495669_0006645
1814 Ga0495669_0017491
1815 Ga0495669_0025856
1816 Ga0495669_0136775
1817 Ga0495613_0021419
1818 Ga0495613_0127856
1819 Ga0495624_0012500
1820 Ga0495670_0000099
1821 Ga0495670_0000845
1822 Ga0495670_0002249
1823 Ga0495670_0004826
1824 Ga0495670_0014837
1825 Ga0495670_0015496
1826 Ga0495670_0015603
1827 Ga0495670_0073028
1828 Ga0495670_0124261
1829 Ga0495670_0155901
1830 Ga0495671_0000005
1831 Ga0495671_0000043
1832 Ga0495671_0000965
1833 Ga0495671_0001044
1834 Ga0495671_0002730
1835 Ga0495671_0003679
1836 Ga0495671_0009092
1837 Ga0495671_0013778
1838 Ga0495671_0020586
1839 Ga0495671_0027738
1840 Ga0495671_0055345
1841 Ga0495649_0000277
1842 Ga0495649_0000925
1843 Ga0495649_0001478
1844 Ga0495649_0002415
1845 Ga0495649_0007497
1846 Ga0495649_0009530
1847 Ga0495649_0013410
1848 Ga0495649_0021575
1849 Ga0495649_0024486
1850 Ga0495649_0033919
1851 Ga0495649_0037742
1852 Ga0495649_0123923
1853 Ga0495589_0000007
1854 Ga0495589_0000145
1855 Ga0495589_0002088
1856 Ga0495589_0008988
1857 Ga0495589_0017726
1858 Ga0495589_0022401
1859 Ga0495589_0038226
1860 Ga0495589_0047301
1861 Ga0495589_0052226
1862 Ga0495589_0059031
1863 Ga0495589_0062732
1864 Ga0495589_0103003
1865 Ga0495589_0126147
1866 Ga0495660_0000100
1867 Ga0495660_0000779
1868 Ga0495660_0002034
1869 Ga0495660_0002236
1870 Ga0495660_0004798
1871 Ga0495660_0006085
1872 Ga0495660_0007481
1873 Ga0495660_0011314
1874 Ga0495660_0011889
1875 Ga0495660_0013655
1876 Ga0495660_0015327
1877 Ga0495660_0059833
1878 Ga0495660_0114702
1879 Ga0495581_0013823
1880 Ga0495581_0069182
1881 Ga0495604_0017012
1882 Ga0495604_0062481
1883 Ga0495604_0323950
1884 Ga0495636_0010960
1885 Ga0495672_0000041
1886 Ga0495672_0000188
1887 Ga0495672_0000226
1888 Ga0495672_0000272
1889 Ga0495672_0007001
1890 Ga0495672_0011006
1891 Ga0495672_0020577
1892 Ga0495672_0072364
1893 Ga0495672_0077174
1894 Ga0495672_0197651
1895 Ga0495676_0000037
1896 Ga0495676_0043115
1897 Ga0495676_0127562
1898 Ga0495680_0005077
1899 Ga0495680_0021570
1900 Ga0495683_0000763
1901 Ga0495683_0001975
1902 Ga0495683_0009910
1903 Ga0495683_0011455
1904 Ga0495683_0023237
1905 Ga0495683_0051917
1906 Ga0495683_0075001
1907 Ga0495683_0115975
1908 Ga0495683_0156977
1909 Ga0495687_000003
1910 Ga0495687_000016
1911 Ga0495687_000028
1912 Ga0495687_000417
1913 Ga0495687_001550
1914 Ga0495687_046170
1915 Ga0495675_0101663
1916 Ga0495677_0000005
1917 Ga0495677_0000210
1918 Ga0495677_0000722
1919 Ga0495677_0002621
1920 Ga0495677_0003870
1921 Ga0495677_0005985
1922 Ga0495677_0011091
1923 Ga0495677_0017220
1924 Ga0495677_0020456
1925 Ga0495677_0125269
1926 Ga0495677_0211802
1927 Ga0495679_002173
1928 Ga0495679_005976
1929 Ga0495679_008263
1930 Ga0495679_022179
1931 Ga0495679_041848
1932 Ga0495685_005235
1933 Ga0495685_019404
1934 Ga0495685_039044
1935 Ga0495673_0000008
1936 Ga0495673_0000012
1937 Ga0495673_0000702
1938 Ga0495673_0068437
1939 Ga0495673_0092700
1940 Ga0495681_0000123
1941 Ga0495681_0003758
1942 Ga0495681_0004627
1943 Ga0495681_0005829
1944 Ga0495681_0007875
1945 Ga0495681_0008039
1946 Ga0495681_0027026
1947 Ga0495681_0081491
1948 Ga0495681_0099096
1949 Ga0495681_0104627
1950 Ga0495681_0201059
1951 Ga0495686_0000054
1952 Ga0495686_0000732
1953 Ga0495686_0003051
1954 Ga0495686_0003612
1955 Ga0495686_0012570
1956 Ga0495686_0019149
1957 Ga0495686_0039828
1958 Ga0495686_0041746
1959 Ga0495686_0066042
1960 Ga0495686_0233483
1961 Ga0495593_0004899
1962 Ga0495593_0014834
1963 Ga0495593_0068663
1964 Ga0495614_0008021
1965 Ga0495614_0010244
1966 Ga0495626_0000004
1967 Ga0495626_0000322
1968 Ga0495626_0003241
1969 Ga0495626_0003747
1970 Ga0495626_0004117
1971 Ga0495626_0004329
1972 Ga0495626_0006298
1973 Ga0495626_0006531
1974 Ga0495626_0014964
1975 Ga0495626_0016531
1976 Ga0495626_0025116
1977 Ga0495626_0025984
1978 Ga0495626_0026914
1979 Ga0495626_0041785
1980 Ga0495626_0057082
1981 Ga0495626_0065753
1982 Ga0496100_0059302
1983 Ga0496101_0020477
1984 Ga0496101_0112071
1985 Ga0496102_0000931
1986 Ga0496102_0011417
1987 Ga0496102_0030581
1988 Ga0496102_0122227
1989 Ga0496102_0174486
1990 Ga0496102_0196686
1991 Ga0496103_0007939
1992 Ga0496103_0346197
1993 Ga0496106_0012244
1994 Ga0496107_0017128
1995 Ga0496107_0049247
1996 Ga0496109_0115634
1997 Ga0496109_0229130
1998 Ga0496109_0231317
1999 Ga0496109_0439711
2000 Ga0496110_0001119
2001 Ga0496111_0060901
2002 Ga0496113_0007519
2003 Ga0496113_0353646
2004 Ga0496114_0075065
2005 Ga0496115_0101784
2006 Ga0496116_0000382
2007 Ga0496116_0015565
2008 Ga0496117_0000100
2009 Ga0496117_0000645
2010 Ga0496117_0001645
2011 Ga0496117_0003157
2012 Ga0496117_0010742
2013 Ga0496117_0035465
2014 Ga0496117_0130556
2015 Ga0496118_0000338
2016 Ga0496118_0002116
2017 Ga0496118_0004775
2018 Ga0496118_0008860
2019 Ga0496118_0038351
2020 Ga0496119_0006814
2021 Ga0496119_0037252
2022 Ga0496120_0004314
2023 Ga0496120_0014380
2024 Ga0496121_0000589
2025 Ga0496121_0026317
2026 Ga0496121_0040615
2027 Ga0496121_0059199
2028 Ga0496121_0070409
2029 Ga0496121_0147814
2030 Ga0496121_0258550
2031 Ga0496122_0000210
2032 Ga0496122_0000808
2033 Ga0496122_0005126
2034 Ga0496122_0009079
2035 Ga0496122_0019722
2036 Ga0496122_0034402
2037 Ga0496122_0055038
2038 Ga0496122_0106936
2039 Ga0496122_0168599
2040 Ga0496123_0000591
2041 Ga0496123_0000597
2042 Ga0496123_0001320
2043 Ga0496123_0003625
2044 Ga0496123_0005021
2045 Ga0496123_0023774
2046 Ga0496123_0066312
2047 Ga0496123_0085817
2048 Ga0496123_0128076
2049 Ga0496123_0143417
2050 Ga0496123_0161496
2051 Ga0496124_0000056
2052 Ga0496124_0000425
2053 Ga0496124_0001066
2054 Ga0496124_0004210
2055 Ga0496124_0010799
2056 Ga0496124_0022742
2057 Ga0496124_0023861
2058 Ga0496124_0035413
2059 Ga0496124_0037634
2060 Ga0496124_0054728
2061 Ga0496124_0069987
2062 Ga0496124_0114901
2063 Ga0496124_0129593
2064 Ga0496124_0324435
2065 Ga0496125_0000245
2066 Ga0496125_0000789
2067 Ga0496125_0003880
2068 Ga0496125_0004750
2069 Ga0496125_0023862
2070 Ga0496125_0042739
2071 Ga0496125_0077384
2072 Ga0496125_0078919
2073 Ga0496125_0145313
2074 Ga0496125_0222157
2075 Ga0496125_0350107
2076 Ga0496126_0022618
2077 Ga0496126_0101114
2078 Ga0496126_0125425
2079 Ga0496126_0406116
2080 Ga0495678_000006
2081 Ga0495678_000130
2082 Ga0495678_000233
2083 Ga0495678_001703
2084 Ga0495678_001985
2085 Ga0495678_002123
2086 Ga0495678_018410
2087 Ga0495678_020704
2088 Ga0495682_0000107
2089 Ga0495682_0001172
2090 Ga0495682_0011704
2091 Ga0495682_0030101
2092 Ga0495682_0068963
2093 Ga0495682_0085817
2094 Ga0501032_0189417
2095 Ga0501034_0166710
2096 Ga0501034_0191130
2097 Ga0501034_0339289
2098 Ga0501034_0505333
2099 Ga0501047_0235227
2100 Ga0501227_005034
2101 Ga0501249_004483
2102 Ga0501269_000016
2103 Ga0501269_001654
2104 Ga0501035_0018733
2105 Ga0501035_0148309
2106 Ga0501044_0177987
2107 Ga0501044_0389883
2108 nmdc:mga03n38_225856_c1
2109 nmdc:mga00v17_23_c1
2110 nmdc:mga00v17_33669_c1
2111 nmdc:mga00v17_62366_c1
2112 Ga0500643_000362
2113 Ga0500641_0072413
2114 Ga0500555_000370
2115 Ga0500618_000088
2116 Ga0500618_000519
2117 Ga0500618_009889
2118 Ga0500559_0004652
2119 Ga0500564_178817
2120 Ga0500568_0023303
2121 Ga0500604_0014012
2122 Ga0500627_0008381
2123 Ga0500634_0000386
2124 Ga0587084_000853
2125 Ga0587066_001081
2126 Ga0587070_001403
2127 Ga0587077_003339
2128 Ga0587085_005580
2129 Ga0587090_004877
2130 Ga0587091_002339
2131 Ga0587101_001671
2132 Ga0587109_008309
2133 Ga0587117_004643
2134 Ga0587062_002637
2135 Ga0587067_003478
2136 Ga0587076_001114
2137 Ga0587100_000181
2138 Ga0587111_0008704
2139 2501081278
2140 2501412208
2141 2511094266
2142 2511101645
2143 2511127402
2144 2511265866
2145 2511386320
2146 2512329148
2147 2512641806
2148 2516020977
2149 2547501460
2150 2555670074
2151 2583792341
2152 2597858049
2153 2597863717
2154 2599352892
2155 2599359237
2156 2599365242
2157 2599371931
2158 2599378000
2159 2599384623
2160 2599390789
2161 2599401838
2162 2599402974
2163 2599448427
2164 2599453971
2165 2599459726
2166 2599465935
2167 2599485082
2168 2599488747
2169 2599509180
2170 2599515545
2171 2599521350
2172 2599802695
2173 2599881171
2174 2599894924
2175 2599949544
2176 2600212333
2177 2600366655
2178 2600446158
2179 2601690471
2180 2601772501
2181 2602008040
2182 2643800573
2183 2643869799
2184 2643949730
2185 2644133894
2186 2644214045
2187 2644470690
2188 2644621043
2189 2671095531
2190 2671769684
2191 2677901038
2192 2691331382
2193 2723248999
2194 2738810409
2195 2738826346
2196 2738897769
2197 2739150143
2198 2739192062
2199 2739288474
2200 2739293786
2201 2739318539
2202 2739336780
2203 2743737515
2204 2758640644
2205 2808978416
2206 2808994057
2207 2809143300
2208 2819700992
2209 2821134854
2210 2821444546
2211 2823421295
2212 2834030082
2213 2834643344
2214 2842715698
2215 2842831616
2216 2842840132
2217 2842858020
2218 2844670692
2219 2852617558
2220 2852672323
2221 2855732292
2222 2855769000
2223 2857358052
2224 2857553374
2225 2857563351
2226 2857569760
2227 2882809192
2228 2883089071
2229 2895501889
2230 2895517554
2231 2895526189
2232 2904428222
2233 2917073897
2234 2919046776
2235 2919136880
2236 2919479716
2237 2919502916
2238 2919534945
2239 2923156556
2240 2926064589
2241 2929192820
2242 2931394224
2243 2935357048
2244 2939608774
2245 2939636014
2246 2945933753
2247 2945963935
2248 2946010172
2249 2946031158
2250 2947237556
2251 2984289518
2252 2987607663
2253 2990710726
2254 3007254912
2255 3007316287
2256 3007395940
2257 637320439
2258 8003402591
2259 8015690750
2260 8019773250
2261 8047677569
2262 8054286389
2263 8054348165
2264 8054359281
2265 8054505932
2266 8055100099
2267 8055773887
2268 8055820576
2269 8056134978
2270 8056146549
2271 8056154544
2272 8056166363
2273 8057309339
2274 8057800578

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

9

239

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9856 1 252
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9816 1 247
4fuk-assembly1.cif.gz_A aminopeptidase from trypanosoma brucei 0.9764 7 253
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9755 1 246
4a6v-assembly1.cif.gz_A x-ray structures of oxazole hydroxamate ecmetap-mn complexes 0.9751 1 252
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9914 1 252 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9784 46 247 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9773 1 247 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9755 1 246 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9738 2 247 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A2M8P659-F1-model_v4 Type I methionyl aminopeptidase 1.002 116 233 GO:0005829
GO:0006508
GO:0070006
AF-A0A3B9AWZ8-F1-model_v4 deleted 0.9997 69 251
AF-A0A4Q6F1R4-F1-model_v4 deleted 0.9983 34 247
AF-A0A6G8DHF1-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9982 1 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A3C0LYD4-F1-model_v4 deleted 0.9978 108 202

Map