F490650

General Info

Members Datasets Scaffolds Average Seq Length
1137 517 2274 129

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0502319|Ga0495686_0502319_130_588
Length 152
Sequence MRPMVLADDSRIPRWSAAGERTVSKEMKFLVVDDFSTMRRIIKNLLHDLGYANVTEADDGQTALPMLQAGAFDFLITDWNMPGMPGLDLLKAVRADARLKQMPVLMLTAESKREQIVEAAQAGVNGYVIKPFTAVTLKEKIDKILESRSAAK

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
232 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
246 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
247 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
257 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
278 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
279 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
283 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
284 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
285 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
286 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
287 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
288 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
289 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
290 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
291 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
292 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
293 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
294 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
295 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
296 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
297 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
301 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
302 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
303 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
304 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
305 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
306 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
307 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
308 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
309 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
310 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
311 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
312 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
313 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
314 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
315 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
316 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
317 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
320 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
321 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
322 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
323 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
324 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
325 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
328 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
329 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
330 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
331 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
332 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
335 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
339 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
348 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
353 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
361 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
362 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
363 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
377 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
378 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
379 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
380 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
381 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
382 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
383 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
384 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
385 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
386 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
387 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
388 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
414 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
415 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
416 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
417 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
436 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
437 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
438 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
439 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
440 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
445 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
452 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
453 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
454 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
455 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
456 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
457 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
458 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
459 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
460 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
461 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
462 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
463 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
464 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
465 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
466 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
469 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
474 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
475 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
476 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
477 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
478 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
479 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
480 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
481 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
482 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
483 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
484 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
485 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
486 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
487 2734482264 Dyella sp. AD052 Isolate Unclassified
488 2738543009 Luteibacter sp. OK325 Isolate Unclassified
489 2739367700 Dyella sp. YR388 Isolate Unclassified
490 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
491 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
492 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
493 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
494 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
495 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
496 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
497 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
498 2884411467 Dyella sp. AD56 Isolate Rhizosphere
499 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
500 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
501 2919085039 Luteibacter sp. 1214 Isolate Unclassified
502 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
503 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
504 2919404418 Luteibacter sp. 3190 Isolate Unclassified
505 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
506 2928963466 Dyella japonica 1073 Isolate Unclassified
507 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
508 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
509 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
510 2941471342 Luteibacter sp. 621 Isolate Unclassified
511 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
512 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
513 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
514 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
515 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
516 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
517 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.25
Metatranscriptomes 1.5
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0.18
Rhizoplane 3.96
Rhizosphere 75.2
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0502319 3300047472 Bacteria 638
2 SwRhRL2b_contig_1463020 2162886007 Bacteria 812
3 SwRhRL2b_contig_209150 2162886007 Bacteria 1352
4 JGI24736J21556_1037929 3300001904 Bacteria 742
5 JGI24741J21665_1058143 3300001915 Bacteria 570
6 JGI24740J21852_10035843 3300001979 Bacteria 1546
7 JGI24739J22299_10000150 3300001989 Bacteria 22469
8 JGI24737J22298_10023750 3300001990 Bacteria 1943
9 JGI24735J21928_10000631 3300002067 Bacteria 12412
10 JGI24735J21928_10017635 3300002067 Bacteria 2207
11 JGI24738J21930_10001714 3300002075 Bacteria 5999
12 JGI25162J39368_1000300 3300002737 Bacteria 45514
13 JGI25162J39368_1000946 3300002737 Bacteria 18630
14 JGI25162J39368_1012103 3300002737 Bacteria 1006
15 JGI25157J39369_1001759 3300002741 Bacteria 7101
16 JGI25164J39214_1000252 3300002772 Bacteria 40244
17 JGI25406J46586_10003849 3300003203 Bacteria 7016
18 JGI25165J46597_1000223 3300003214 Bacteria 79270
19 JGI25165J46597_1030433 3300003214 Bacteria 696
20 JGI25153J46596_10026551 3300003215 Bacteria 2047
21 JGI25153J46596_10105839 3300003215 Bacteria 653
22 rootH1_10089905 3300003316 Bacteria 2193
23 rootH1_10112669 3300003316 Bacteria 3090
24 rootH2_10014066 3300003320 Bacteria 23331
25 rootH1_10182598 3300003323 Bacteria 1171
26 Ga0006556J51387_1035474 3300003479 Bacteria 2165
27 Ga0006554J51385_1028847 3300003567 Bacteria 1512
28 Ga0006562J51391_1003360 3300003578 Bacteria 5610
29 Ga0006562J51391_1003840 3300003578 Bacteria 26103
30 Ga0055533_1000607 3300003756 Bacteria 12076
31 Ga0055532_1026080 3300003758 Bacteria 572
32 Ga0055535_1006302 3300003761 Bacteria 2428
33 Ga0055542_1000340 3300003762 Bacteria 49481
34 Ga0055542_1016246 3300003762 Bacteria 1177
35 Ga0055526_1000736 3300003771 Bacteria 24682
36 Ga0055537_1000425 3300003773 Bacteria 27504
37 Ga0055524_1017895 3300003775 Bacteria 2482
38 Ga0055536_1006267 3300003781 Bacteria 5605
39 Ga0055534_1000119 3300003784 Bacteria 58422
40 Ga0055528_1000547 3300003790 Bacteria 28685
41 Ga0058692_1000163 3300003856 Bacteria 41448
42 Ga0058692_1027508 3300003856 Bacteria 1106
43 Ga0055543_1020543 3300004625 Bacteria 1212
44 Ga0065165_1000260 3300005262 Bacteria 90953
45 Ga0065165_1003583 3300005262 Bacteria 10704
46 Ga0065714_10089252 3300005288 Bacteria 1964
47 Ga0065704_10030471 3300005289 Bacteria 795
48 Ga0065704_10072583 3300005289 Bacteria 8293
49 Ga0065704_10237498 3300005289 Bacteria 1025
50 Ga0065704_10415312 3300005289 Bacteria 737
51 Ga0065707_10082517 3300005295 Bacteria 14244
52 Ga0065707_10083290 3300005295 Bacteria 9631
53 Ga0065707_10093119 3300005295 Bacteria 3672
54 Ga0070658_10003217 3300005327 Bacteria 13484
55 Ga0070658_10638534 3300005327 Bacteria 923
56 Ga0070670_100099429 3300005331 Bacteria 2503
57 Ga0070670_100165225 3300005331 Bacteria 1919
58 Ga0070670_100229688 3300005331 Bacteria 1615
59 Ga0070670_100435538 3300005331 Bacteria 1160
60 Ga0070670_101757663 3300005331 Bacteria 571
61 Ga0068869_100374508 3300005334 Bacteria 1166
62 Ga0068869_100510835 3300005334 Bacteria 1004
63 Ga0070666_10000013 3300005335 Bacteria 230442
64 Ga0070666_10007912 3300005335 Bacteria 6569
65 Ga0070680_100189313 3300005336 Bacteria 1733
66 Ga0070682_100013761 3300005337 Bacteria 4664
67 Ga0070682_100057071 3300005337 Bacteria 2458
68 Ga0070682_101397978 3300005337 Bacteria 598
69 Ga0068868_100915436 3300005338 Bacteria 798
70 Ga0070660_100257689 3300005339 Bacteria 1424
71 Ga0070660_100489691 3300005339 Bacteria 1022
72 Ga0070660_100494335 3300005339 Bacteria 1017
73 Ga0070660_101318929 3300005339 Bacteria 613
74 Ga0070689_100006873 3300005340 Bacteria 7915
75 Ga0070687_100380990 3300005343 Bacteria 919
76 Ga0070661_100004461 3300005344 Bacteria 9651
77 Ga0070661_100006700 3300005344 Bacteria 7946
78 Ga0070661_100062054 3300005344 Bacteria 2744
79 Ga0070661_100200287 3300005344 Bacteria 1525
80 Ga0070661_100333074 3300005344 Bacteria 1187
81 Ga0070692_10021855 3300005345 Bacteria 3117
82 Ga0070692_10699869 3300005345 Bacteria 682
83 Ga0070668_100378822 3300005347 Bacteria 1204
84 Ga0070668_100501776 3300005347 Bacteria 1050
85 Ga0070669_100169271 3300005353 Bacteria 1702
86 Ga0070669_101148718 3300005353 Bacteria 670
87 Ga0070675_100070972 3300005354 Bacteria 2888
88 Ga0070674_100028233 3300005356 Bacteria 3684
89 Ga0070674_100065862 3300005356 Bacteria 2544
90 Ga0070674_100244034 3300005356 Bacteria 1408
91 Ga0070673_100048820 3300005364 Bacteria 3301
92 Ga0070673_100059450 3300005364 Bacteria 3026
93 Ga0070673_100077300 3300005364 Bacteria 2689
94 Ga0070688_100849866 3300005365 Bacteria 717
95 Ga0070659_100106170 3300005366 Bacteria 2264
96 Ga0070659_100217918 3300005366 Bacteria 1574
97 Ga0070659_101231326 3300005366 Bacteria 662
98 Ga0070667_100000057 3300005367 Bacteria 150501
99 Ga0070667_100075773 3300005367 Bacteria 2872
100 Ga0070667_100194136 3300005367 Bacteria 1799
101 Ga0070667_101289781 3300005367 Bacteria 684
102 Ga0070667_101804314 3300005367 Bacteria 576
103 Ga0070709_10702030 3300005434 Bacteria 787
104 Ga0070714_100000146 3300005435 Bacteria 56392
105 Ga0070714_100006932 3300005435 Bacteria 8786
106 Ga0070714_100288063 3300005435 Bacteria 1528
107 Ga0070713_100001113 3300005436 Bacteria 17144
108 Ga0070700_100023296 3300005441 Bacteria 3619
109 Ga0070700_100143433 3300005441 Bacteria 1626
110 Ga0070663_100038378 3300005455 Bacteria 3341
111 Ga0070663_100163342 3300005455 Bacteria 1716
112 Ga0070663_100625898 3300005455 Bacteria 908
113 Ga0070663_100874932 3300005455 Bacteria 775
114 Ga0070678_100064896 3300005456 Bacteria 2708
115 Ga0070678_100226253 3300005456 Bacteria 1557
116 Ga0070678_100847843 3300005456 Bacteria 832
117 Ga0070662_100178306 3300005457 Bacteria 1673
118 Ga0070681_10399486 3300005458 Bacteria 1286
119 Ga0068867_101797533 3300005459 Bacteria 576
120 Ga0068867_101909262 3300005459 Bacteria 560
121 Ga0070685_10149985 3300005466 Bacteria 1477
122 Ga0070685_10222577 3300005466 Bacteria 1237
123 Ga0070685_10716982 3300005466 Bacteria 731
124 Ga0070706_100704723 3300005467 Bacteria 936
125 Ga0070679_100080953 3300005530 Bacteria 3237
126 Ga0070679_100428919 3300005530 Bacteria 1267
127 Ga0070679_101050805 3300005530 Bacteria 759
128 Ga0068853_100238634 3300005539 Bacteria 1665
129 Ga0070672_100136347 3300005543 Bacteria 2021
130 Ga0070672_100457345 3300005543 Bacteria 1100
131 Ga0070672_100560767 3300005543 Bacteria 992
132 Ga0070686_100250432 3300005544 Bacteria 1293
133 Ga0070696_100037091 3300005546 Bacteria 3362
134 Ga0070693_100080572 3300005547 Bacteria 1940
135 Ga0070693_100086721 3300005547 Bacteria 1878
136 Ga0070693_100274424 3300005547 Bacteria 1127
137 Ga0070665_100001412 3300005548 Bacteria 28208
138 Ga0070665_100001746 3300005548 Bacteria 24877
139 Ga0070665_100292367 3300005548 Bacteria 1631
140 Ga0070665_100419655 3300005548 Bacteria 1347
141 Ga0070665_100430295 3300005548 Bacteria 1329
142 Ga0070665_101655100 3300005548 Bacteria 648
143 Ga0068855_100001054 3300005563 Bacteria 34227
144 Ga0068855_100376110 3300005563 Bacteria 1560
145 Ga0070664_100229471 3300005564 Bacteria 1664
146 Ga0070664_101076391 3300005564 Bacteria 757
147 Ga0068857_100005138 3300005577 Bacteria 11127
148 Ga0068857_100011506 3300005577 Bacteria 7697
149 Ga0068857_100022774 3300005577 Bacteria 5512
150 Ga0068857_100306723 3300005577 Bacteria 1464
151 Ga0068857_101431976 3300005577 Bacteria 672
152 Ga0068857_101837400 3300005577 Bacteria 593
153 Ga0068854_100003997 3300005578 Bacteria 9255
154 Ga0068854_100653134 3300005578 Bacteria 903
155 Ga0068856_100028243 3300005614 Bacteria 5477
156 Ga0068856_100053976 3300005614 Bacteria 3963
157 Ga0068856_100126517 3300005614 Bacteria 2559
158 Ga0068852_100013196 3300005616 Bacteria 6315
159 Ga0068859_100205251 3300005617 Bacteria 2056
160 Ga0068859_100284558 3300005617 Bacteria 1746
161 Ga0068859_100412515 3300005617 Bacteria 1447
162 Ga0068864_101227968 3300005618 Bacteria 749
163 Ga0068861_100034657 3300005719 Bacteria 3734
164 Ga0068861_100078674 3300005719 Bacteria 2576
165 Ga0068861_100085506 3300005719 Bacteria 2477
166 Ga0068851_10005923 3300005834 Bacteria 5564
167 Ga0068858_100149055 3300005842 Bacteria 2198
168 Ga0068858_100163681 3300005842 Bacteria 2095
169 Ga0068858_101353970 3300005842 Bacteria 701
170 Ga0068860_100176386 3300005843 Bacteria 2065
171 Ga0068860_100230530 3300005843 Bacteria 1800
172 Ga0068860_101181629 3300005843 Bacteria 785
173 Ga0068862_100020082 3300005844 Bacteria 5578
174 Ga0068862_100239329 3300005844 Bacteria 1650
175 Ga0068862_100622213 3300005844 Bacteria 1039
176 Ga0081455_10000010 3300005937 Bacteria 248212
177 Ga0081540_1145781 3300005983 Bacteria 943
178 Ga0081539_10000016 3300005985 Bacteria 381648
179 Ga0075368_10023721 3300006042 Bacteria 2346
180 Ga0075364_10213537 3300006051 Bacteria 1309
181 Ga0075364_10490766 3300006051 Bacteria 840
182 Ga0070715_10292571 3300006163 Bacteria 868
183 Ga0070712_100392953 3300006175 Bacteria 1144
184 Ga0075369_10047861 3300006186 Bacteria 1844
185 Ga0075369_10084874 3300006186 Bacteria 1408
186 Ga0075369_10596223 3300006186 Bacteria 529
187 Ga0097621_100121949 3300006237 Bacteria 2211
188 Ga0068871_100208812 3300006358 Bacteria 1688
189 Ga0068871_100256382 3300006358 Bacteria 1525
190 Ga0068871_100705072 3300006358 Bacteria 925
191 Ga0075430_100069862 3300006846 Bacteria 2945
192 Ga0075430_100938495 3300006846 Bacteria 713
193 Ga0075431_100703332 3300006847 Bacteria 988
194 Ga0068865_100071638 3300006881 Bacteria 2459
195 Ga0068865_100674932 3300006881 Bacteria 880
196 Ga0097620_100205242 3300006931 Bacteria 2056
197 Ga0097620_100284579 3300006931 Bacteria 1746
198 Ga0097620_100412514 3300006931 Bacteria 1447
199 Ga0099826_10137357 3300006948 Bacteria 1417
200 Ga0105251_10000221 3300009011 Bacteria 57628
201 Ga0105244_10000631 3300009036 Bacteria 31164
202 Ga0105244_10272752 3300009036 Bacteria 785
203 Ga0105250_10000024 3300009092 Bacteria 218115
204 Ga0105250_10000215 3300009092 Bacteria 47921
205 Ga0105250_10095106 3300009092 Bacteria 1214
206 Ga0105250_10532743 3300009092 Bacteria 537
207 Ga0105240_10030430 3300009093 Bacteria 7016
208 Ga0105240_10093277 3300009093 Bacteria 3675
209 Ga0105240_10965196 3300009093 Bacteria 913
210 Ga0111539_10042871 3300009094 Bacteria 5430
211 Ga0111539_10539972 3300009094 Bacteria 1358
212 Ga0111539_10996254 3300009094 Bacteria 974
213 Ga0111539_11484368 3300009094 Bacteria 786
214 Ga0105247_10003410 3300009101 Bacteria 10385
215 Ga0105247_10020959 3300009101 Bacteria 3932
216 Ga0105247_10253607 3300009101 Bacteria 1204
217 Ga0105247_10666955 3300009101 Bacteria 779
218 Ga0105243_10010344 3300009148 Bacteria 7085
219 Ga0105243_10112312 3300009148 Bacteria 2283
220 Ga0105243_10818900 3300009148 Bacteria 919
221 Ga0105243_12209427 3300009148 Bacteria 587
222 Ga0105241_10187185 3300009174 Bacteria 1721
223 Ga0105241_10264895 3300009174 Bacteria 1462
224 Ga0105241_11170702 3300009174 Bacteria 727
225 Ga0105242_10036858 3300009176 Bacteria 3926
226 Ga0105242_10114268 3300009176 Bacteria 2306
227 Ga0105242_10141056 3300009176 Bacteria 2091
228 Ga0105248_10003931 3300009177 Bacteria 16430
229 Ga0105248_10107075 3300009177 Bacteria 3152
230 Ga0105248_10465516 3300009177 Bacteria 1425
231 Ga0105237_10000214 3300009545 Bacteria 82061
232 Ga0105237_10175664 3300009545 Bacteria 2142
233 Ga0105237_10373889 3300009545 Bacteria 1430
234 Ga0105237_10857228 3300009545 Bacteria 915
235 Ga0105238_10000156 3300009551 Bacteria 74551
236 Ga0105238_10010620 3300009551 Bacteria 9247
237 Ga0105238_10020830 3300009551 Bacteria 6679
238 Ga0105238_10638038 3300009551 Bacteria 1075
239 Ga0105238_11089715 3300009551 Bacteria 821
240 Ga0105249_10107207 3300009553 Bacteria 2637
241 Ga0105249_10679418 3300009553 Bacteria 1089
242 Ga0105249_11892733 3300009553 Bacteria 669
243 Ga0105239_10001178 3300010375 Bacteria 35871
244 Ga0105239_10028091 3300010375 Bacteria 6190
245 Ga0105239_10255733 3300010375 Bacteria 1968
246 Ga0105239_10271937 3300010375 Bacteria 1906
247 Ga0105239_10398557 3300010375 Bacteria 1557
248 Ga0105239_11281428 3300010375 Bacteria 845
249 Ga0105239_12535621 3300010375 Bacteria 598
250 Ga0105246_10634710 3300011119 Bacteria 928
251 Ga0157314_1000371 3300012500 Bacteria 4552
252 Ga0157373_10001512 3300013100 Bacteria 17716
253 Ga0157373_10026725 3300013100 Bacteria 4166
254 Ga0157373_10058834 3300013100 Bacteria 2723
255 Ga0157373_10549224 3300013100 Bacteria 838
256 Ga0157371_10001716 3300013102 Bacteria 22279
257 Ga0157371_10008141 3300013102 Bacteria 8378
258 Ga0157371_10032903 3300013102 Bacteria 3729
259 Ga0157371_10953400 3300013102 Bacteria 653
260 Ga0157370_10005803 3300013104 Bacteria 13799
261 Ga0157370_10006411 3300013104 Bacteria 12978
262 Ga0157370_10032072 3300013104 Bacteria 5133
263 Ga0157370_10049486 3300013104 Bacteria 4022
264 Ga0157370_10064902 3300013104 Bacteria 3455
265 Ga0157370_10491485 3300013104 Bacteria 1127
266 Ga0157370_10864262 3300013104 Bacteria 822
267 Ga0157369_10000171 3300013105 Bacteria 91555
268 Ga0157369_10066964 3300013105 Bacteria 3863
269 Ga0157369_10080787 3300013105 Bacteria 3480
270 Ga0157369_10120876 3300013105 Bacteria 2779
271 Ga0157378_10163836 3300013297 Bacteria 2081
272 Ga0157378_11824012 3300013297 Bacteria 656
273 Ga0163162_10000802 3300013306 Bacteria 29244
274 Ga0163162_10110954 3300013306 Bacteria 2840
275 Ga0163162_10113764 3300013306 Bacteria 2805
276 Ga0163162_11215712 3300013306 Bacteria 855
277 Ga0157372_10011602 3300013307 Bacteria 9379
278 Ga0157372_10043795 3300013307 Bacteria 4958
279 Ga0157375_10017161 3300013308 Bacteria 6527
280 Ga0157375_10219459 3300013308 Bacteria 2060
281 Ga0157375_10232891 3300013308 Bacteria 2001
282 Ga0157375_12926111 3300013308 Bacteria 570
283 Ga0163163_10009793 3300014325 Bacteria 8586
284 Ga0163163_10029623 3300014325 Bacteria 5268
285 Ga0163163_10072238 3300014325 Bacteria 3440
286 Ga0163163_10134972 3300014325 Bacteria 2509
287 Ga0157380_10000876 3300014326 Bacteria 18902
288 Ga0157380_10022918 3300014326 Bacteria 4708
289 Ga0157380_10324149 3300014326 Bacteria 1429
290 Ga0157380_10559501 3300014326 Bacteria 1123
291 Ga0157380_11495009 3300014326 Bacteria 728
292 Ga0182008_10006102 3300014497 Bacteria 6774
293 Ga0182008_10014917 3300014497 Bacteria 4064
294 Ga0182008_10020730 3300014497 Bacteria 3381
295 Ga0182008_10026590 3300014497 Bacteria 2934
296 Ga0182008_10071606 3300014497 Bacteria 1705
297 Ga0157377_10338196 3300014745 Bacteria 1006
298 Ga0157379_10000013 3300014968 Bacteria 108546
299 Ga0157379_10026667 3300014968 Bacteria 5144
300 Ga0157379_10073175 3300014968 Bacteria 3067
301 Ga0157379_10321666 3300014968 Bacteria 1412
302 Ga0157376_10097335 3300014969 Bacteria 2563
303 Ga0157376_10161097 3300014969 Bacteria 2034
304 Ga0157376_10306356 3300014969 Bacteria 1505
305 Ga0157376_10671576 3300014969 Bacteria 1039
306 Ga0182006_1000148 3300015261 Bacteria 74813
307 Ga0182006_1000208 3300015261 Bacteria 58504
308 Ga0182006_1029363 3300015261 Bacteria 2228
309 Ga0182006_1029600 3300015261 Bacteria 2217
310 Ga0182006_1057426 3300015261 Bacteria 1480
311 Ga0182006_1077523 3300015261 Bacteria 1219
312 Ga0182006_1251148 3300015261 Bacteria 581
313 Ga0182007_10000139 3300015262 Bacteria 49865
314 Ga0182007_10013777 3300015262 Bacteria 3072
315 Ga0182007_10022629 3300015262 Bacteria 2217
316 Ga0182007_10107541 3300015262 Bacteria 926
317 Ga0182005_1000110 3300015265 Bacteria 58820
318 Ga0182005_1000121 3300015265 Bacteria 56978
319 Ga0182005_1002288 3300015265 Bacteria 7002
320 Ga0182005_1002799 3300015265 Bacteria 6083
321 Ga0182005_1007803 3300015265 Bacteria 3186
322 Ga0182005_1028029 3300015265 Bacteria 1536
323 Ga0183368_1002 3300015687 Bacteria 1865598
324 Ga0163161_10001733 3300017792 Bacteria 15977
325 Ga0163161_10225623 3300017792 Bacteria 1452
326 Ga0163161_10239475 3300017792 Bacteria 1411
327 Ga0163161_11015005 3300017792 Bacteria 709
328 Ga0206353_11114430 3300020082 Bacteria 931
329 Ga0206353_11437260 3300020082 Bacteria 2343
330 Ga0209674_100061 3300025226 Bacteria 280844
331 Ga0209674_102951 3300025226 Bacteria 3337
332 Ga0209672_101058 3300025228 Bacteria 11781
333 Ga0209147_116127 3300025229 Bacteria 734
334 Ga0207427_100169 3300025231 Bacteria 72582
335 Ga0207427_103201 3300025231 Bacteria 3607
336 Ga0209437_100076 3300025233 Bacteria 295194
337 Ga0209437_100244 3300025233 Bacteria 88556
338 Ga0209437_100723 3300025233 Bacteria 16832
339 Ga0209258_101900 3300025242 Bacteria 6213
340 Ga0209258_106393 3300025242 Bacteria 1853
341 Ga0207425_1029061 3300025245 Bacteria 1117
342 Ga0209026_1000148 3300025250 Bacteria 111280
343 Ga0209148_1000002 3300025254 Bacteria 2399500
344 Ga0209148_1002312 3300025254 Bacteria 6816
345 Ga0209759_1019783 3300025256 Bacteria 1585
346 Ga0209129_1001105 3300025258 Bacteria 15718
347 Ga0209129_1007410 3300025258 Bacteria 3276
348 Ga0209233_1000246 3300025261 Bacteria 88556
349 Ga0209233_1006488 3300025261 Bacteria 3764
350 Ga0209233_1024072 3300025261 Bacteria 1529
351 Ga0209565_1000063 3300025263 Bacteria 183711
352 Ga0209673_1000065 3300025273 Bacteria 252799
353 Ga0209130_1011604 3300025284 Bacteria 2351
354 Ga0209675_1000011 3300025291 Bacteria 520597
355 Ga0209676_1000011 3300025292 Bacteria 860463
356 Ga0209676_1000068 3300025292 Bacteria 314068
357 Ga0209564_1000190 3300025295 Bacteria 142675
358 Ga0209758_1000814 3300025297 Bacteria 43940
359 Ga0209758_1008736 3300025297 Bacteria 6471
360 Ga0209050_1000239 3300025298 Bacteria 119530
361 Ga0209050_1000351 3300025298 Bacteria 88847
362 Ga0209050_1009828 3300025298 Bacteria 4818
363 Ga0209256_1015294 3300025299 Bacteria 2693
364 Ga0209256_1016682 3300025299 Bacteria 2486
365 Ga0209051_1004518 3300025303 Bacteria 8536
366 Ga0209051_1031335 3300025303 Bacteria 2048
367 Ga0209257_1000014 3300025304 Bacteria 946850
368 Ga0209257_1031598 3300025304 Bacteria 1691
369 Ga0207697_10035285 3300025315 Bacteria 2047
370 Ga0207656_10002369 3300025321 Bacteria 6329
371 Ga0207696_1000175 3300025711 Bacteria 102142
372 Ga0207655_1000825 3300025728 Bacteria 33516
373 Ga0207655_1075839 3300025728 Bacteria 1232
374 Ga0207713_1000207 3300025735 Bacteria 79895
375 Ga0207713_1054666 3300025735 Bacteria 1563
376 Ga0207682_10271285 3300025893 Bacteria 792
377 Ga0207642_10068281 3300025899 Bacteria 1681
378 Ga0207710_10051039 3300025900 Bacteria 1857
379 Ga0207710_10053258 3300025900 Bacteria 1821
380 Ga0207710_10095540 3300025900 Bacteria 1396
381 Ga0207710_10715443 3300025900 Bacteria 525
382 Ga0207688_10392621 3300025901 Bacteria 860
383 Ga0207680_10000001 3300025903 Bacteria 1091453
384 Ga0207680_10003460 3300025903 Bacteria 7443
385 Ga0207647_10000008 3300025904 Bacteria 192602
386 Ga0207647_10044316 3300025904 Bacteria 2780
387 Ga0207647_10046875 3300025904 Bacteria 2691
388 Ga0207647_10089817 3300025904 Bacteria 1833
389 Ga0207645_10057374 3300025907 Bacteria 2486
390 Ga0207643_10012846 3300025908 Bacteria 4528
391 Ga0207705_10006425 3300025909 Bacteria 8707
392 Ga0207705_10014972 3300025909 Bacteria 5575
393 Ga0207705_10152410 3300025909 Bacteria 1733
394 Ga0207705_10800636 3300025909 Bacteria 731
395 Ga0207684_10652573 3300025910 Bacteria 896
396 Ga0207654_10163013 3300025911 Bacteria 1442
397 Ga0207654_10280440 3300025911 Bacteria 1127
398 Ga0207695_10000649 3300025913 Bacteria 69041
399 Ga0207695_10001088 3300025913 Bacteria 47382
400 Ga0207695_10023313 3300025913 Bacteria 6998
401 Ga0207695_10209007 3300025913 Bacteria 1863
402 Ga0207695_11281751 3300025913 Bacteria 613
403 Ga0207671_10000057 3300025914 Bacteria 183729
404 Ga0207671_10267106 3300025914 Bacteria 1347
405 Ga0207671_10617782 3300025914 Bacteria 864
406 Ga0207693_10372193 3300025915 Bacteria 1117
407 Ga0207693_10416300 3300025915 Bacteria 1050
408 Ga0207660_10052332 3300025917 Bacteria 2907
409 Ga0207657_10148460 3300025919 Bacteria 1911
410 Ga0207649_10058303 3300025920 Bacteria 2417
411 Ga0207649_10060771 3300025920 Bacteria 2376
412 Ga0207649_10120319 3300025920 Bacteria 1769
413 Ga0207649_10236695 3300025920 Bacteria 1309
414 Ga0207652_10059872 3300025921 Bacteria 3284
415 Ga0207681_10468819 3300025923 Bacteria 1027
416 Ga0207694_10004515 3300025924 Bacteria 10861
417 Ga0207694_10022206 3300025924 Bacteria 4812
418 Ga0207694_10059595 3300025924 Bacteria 2969
419 Ga0207694_10075025 3300025924 Bacteria 2647
420 Ga0207694_10199276 3300025924 Bacteria 1628
421 Ga0207694_10884626 3300025924 Bacteria 755
422 Ga0207694_11573659 3300025924 Bacteria 554
423 Ga0207650_10534435 3300025925 Bacteria 982
424 Ga0207650_11361878 3300025925 Bacteria 604
425 Ga0207700_10014272 3300025928 Bacteria 5199
426 Ga0207664_10000055 3300025929 Bacteria 126338
427 Ga0207664_10004122 3300025929 Bacteria 9808
428 Ga0207664_10069386 3300025929 Bacteria 2834
429 Ga0207644_10261561 3300025931 Bacteria 1384
430 Ga0207690_10001361 3300025932 Bacteria 15345
431 Ga0207690_10001362 3300025932 Bacteria 15342
432 Ga0207690_10003572 3300025932 Bacteria 9258
433 Ga0207690_10068701 3300025932 Bacteria 2435
434 Ga0207690_10839607 3300025932 Bacteria 760
435 Ga0207706_10014408 3300025933 Bacteria 7166
436 Ga0207706_10103926 3300025933 Bacteria 2499
437 Ga0207686_10232595 3300025934 Bacteria 1337
438 Ga0207686_10550055 3300025934 Bacteria 902
439 Ga0207709_10004255 3300025935 Bacteria 8295
440 Ga0207709_10229869 3300025935 Bacteria 1343
441 Ga0207709_10282532 3300025935 Bacteria 1226
442 Ga0207670_10014029 3300025936 Bacteria 4744
443 Ga0207669_10068407 3300025937 Bacteria 2218
444 Ga0207669_10356045 3300025937 Bacteria 1132
445 Ga0207704_10915225 3300025938 Bacteria 738
446 Ga0207704_11553706 3300025938 Bacteria 568
447 Ga0207691_10011441 3300025940 Bacteria 8515
448 Ga0207691_10024666 3300025940 Bacteria 5656
449 Ga0207691_10928658 3300025940 Bacteria 728
450 Ga0207711_10570753 3300025941 Bacteria 1055
451 Ga0207689_10020699 3300025942 Bacteria 5530
452 Ga0207689_10399551 3300025942 Bacteria 1145
453 Ga0207689_10794431 3300025942 Bacteria 799
454 Ga0207679_10905917 3300025945 Bacteria 807
455 Ga0207667_10000139 3300025949 Bacteria 109949
456 Ga0207667_10000648 3300025949 Bacteria 45080
457 Ga0207667_10001898 3300025949 Bacteria 26237
458 Ga0207667_10016414 3300025949 Bacteria 8371
459 Ga0207667_10164369 3300025949 Bacteria 2282
460 Ga0207651_10015251 3300025960 Bacteria 4461
461 Ga0207651_10093158 3300025960 Bacteria 2211
462 Ga0207712_10073126 3300025961 Bacteria 2471
463 Ga0207668_10172312 3300025972 Bacteria 1698
464 Ga0207668_11072008 3300025972 Bacteria 722
465 Ga0207640_10000951 3300025981 Bacteria 16139
466 Ga0207658_10000200 3300025986 Bacteria 62618
467 Ga0207658_10550884 3300025986 Bacteria 1032
468 Ga0207658_12006093 3300025986 Bacteria 526
469 Ga0207677_10590266 3300026023 Bacteria 974
470 Ga0207677_11975924 3300026023 Bacteria 542
471 Ga0207703_10146213 3300026035 Bacteria 2056
472 Ga0207703_10201486 3300026035 Bacteria 1769
473 Ga0207703_10864739 3300026035 Bacteria 865
474 Ga0207639_10007199 3300026041 Bacteria 7580
475 Ga0207678_10072431 3300026067 Bacteria 2952
476 Ga0207678_10072715 3300026067 Bacteria 2946
477 Ga0207678_10155063 3300026067 Bacteria 1955
478 Ga0207678_10191115 3300026067 Bacteria 1749
479 Ga0207678_10307148 3300026067 Bacteria 1364
480 Ga0207708_10085178 3300026075 Bacteria 2431
481 Ga0207708_10327873 3300026075 Bacteria 1251
482 Ga0207708_10346001 3300026075 Bacteria 1219
483 Ga0207702_10039255 3300026078 Bacteria 3966
484 Ga0207702_11324195 3300026078 Bacteria 714
485 Ga0207641_10302219 3300026088 Bacteria 1512
486 Ga0207648_10439400 3300026089 Bacteria 1187
487 Ga0207676_10447539 3300026095 Bacteria 1217
488 Ga0207674_10010056 3300026116 Bacteria 10762
489 Ga0207674_10032391 3300026116 Bacteria 5484
490 Ga0207674_10044436 3300026116 Bacteria 4575
491 Ga0207674_10249235 3300026116 Bacteria 1723
492 Ga0207674_10375570 3300026116 Bacteria 1374
493 Ga0207674_11242900 3300026116 Bacteria 714
494 Ga0207675_100015832 3300026118 Bacteria 7032
495 Ga0207675_100048721 3300026118 Bacteria 3954
496 Ga0207675_100113706 3300026118 Bacteria 2556
497 Ga0207675_100118476 3300026118 Bacteria 2504
498 Ga0207683_10074989 3300026121 Bacteria 2994
499 Ga0207683_10179063 3300026121 Bacteria 1922
500 Ga0207683_10263700 3300026121 Bacteria 1573
501 Ga0207683_10750134 3300026121 Bacteria 906
502 Ga0207698_10002739 3300026142 Bacteria 10506
503 Ga0209371_1000023 3300027312 Bacteria 519553
504 Ga0209371_1003982 3300027312 Bacteria 6740
505 Ga0209813_10080637 3300027866 Bacteria 1075
506 Ga0268266_10000059 3300028379 Bacteria 269485
507 Ga0268266_10016021 3300028379 Bacteria 6410
508 Ga0268266_10258051 3300028379 Bacteria 1614
509 Ga0268266_10948346 3300028379 Bacteria 832
510 Ga0268265_10064342 3300028380 Bacteria 2825
511 Ga0268265_10202749 3300028380 Bacteria 1722
512 Ga0268265_10557300 3300028380 Bacteria 1089
513 Ga0268264_10024459 3300028381 Bacteria 4931
514 Ga0268264_10228683 3300028381 Bacteria 1716
515 Ga0307517_10313025 3300028786 Bacteria 873
516 Ga0307515_10101086 3300028794 Bacteria 3484
517 Ga0307515_10145245 3300028794 Bacteria 2517
518 Ga0268256_1000023 3300030500 Bacteria 519631
519 Ga0268256_1001500 3300030500 Bacteria 13823
520 Ga0307511_10389700 3300030521 Bacteria 578
521 Ga0316181_1273336 3300030744 Bacteria 882
522 Ga0265770_1060794 3300030878 Bacteria 702
523 Ga0265328_10010604 3300031239 Bacteria 3703
524 Ga0265331_10009248 3300031250 Bacteria 5550
525 Ga0265331_10043929 3300031250 Bacteria 2162
526 Ga0265327_10000257 3300031251 Bacteria 105278
527 Ga0307513_10007691 3300031456 Bacteria 13924
528 Ga0307513_10131291 3300031456 Bacteria 2450
529 Ga0307513_10371663 3300031456 Bacteria 1172
530 Ga0307509_10000106 3300031507 Bacteria 118906
531 Ga0307509_10010878 3300031507 Bacteria 11094
532 Ga0307509_10451185 3300031507 Bacteria 980
533 Ga0307408_100000018 3300031548 Bacteria 346872
534 Ga0307408_100033048 3300031548 Bacteria 3611
535 Ga0307408_100311254 3300031548 Bacteria 1323
536 Ga0307408_101885635 3300031548 Bacteria 573
537 Ga0265313_10145766 3300031595 Bacteria 1015
538 Ga0307508_10233110 3300031616 Bacteria 1439
539 Ga0307508_10521896 3300031616 Bacteria 784
540 Ga0307514_10176037 3300031649 Bacteria 1388
541 Ga0316575_10099611 3300031665 Bacteria 1181
542 Ga0316579_10063558 3300031691 Bacteria 1740
543 Ga0307516_10610677 3300031730 Bacteria 745
544 Ga0307405_10090701 3300031731 Bacteria 2023
545 Ga0307405_10468084 3300031731 Bacteria 1003
546 Ga0307405_11941457 3300031731 Bacteria 526
547 Ga0307413_10017181 3300031824 Bacteria 3762
548 Ga0307413_11120513 3300031824 Bacteria 681
549 Ga0307410_10071575 3300031852 Bacteria 2405
550 Ga0307410_10115992 3300031852 Bacteria 1945
551 Ga0307406_10191426 3300031901 Bacteria 1498
552 Ga0307407_10056224 3300031903 Bacteria 2277
553 Ga0307407_11178683 3300031903 Bacteria 598
554 Ga0307407_11624508 3300031903 Bacteria 513
555 Ga0307412_10003310 3300031911 Bacteria 8948
556 Ga0307412_10400796 3300031911 Bacteria 1117
557 Ga0307412_10571972 3300031911 Bacteria 952
558 Ga0307412_11019546 3300031911 Bacteria 732
559 Ga0307409_100018842 3300031995 Bacteria 4655
560 Ga0307409_100081177 3300031995 Bacteria 2620
561 Ga0307409_100504114 3300031995 Bacteria 1179
562 Ga0307409_100587372 3300031995 Bacteria 1099
563 Ga0307409_101047951 3300031995 Bacteria 835
564 Ga0307409_101566904 3300031995 Bacteria 687
565 Ga0307416_100131604 3300032002 Bacteria 2253
566 Ga0307416_100763542 3300032002 Bacteria 1060
567 Ga0307416_102842708 3300032002 Bacteria 579
568 Ga0307414_10005696 3300032004 Bacteria 6879
569 Ga0307414_10041817 3300032004 Bacteria 3108
570 Ga0307414_10094886 3300032004 Bacteria 2228
571 Ga0307414_10166931 3300032004 Bacteria 1755
572 Ga0307414_10463670 3300032004 Bacteria 1114
573 Ga0307414_11560905 3300032004 Bacteria 615
574 Ga0307414_11795147 3300032004 Bacteria 572
575 Ga0307411_10036622 3300032005 Bacteria 3076
576 Ga0307411_10150063 3300032005 Bacteria 1731
577 Ga0307411_10418724 3300032005 Bacteria 1112
578 Ga0307411_10542613 3300032005 Bacteria 991
579 Ga0307411_10652885 3300032005 Bacteria 911
580 Ga0307411_10973050 3300032005 Bacteria 758
581 Ga0307415_100059636 3300032126 Bacteria 2633
582 Ga0307415_100111161 3300032126 Bacteria 2033
583 Ga0307415_100164657 3300032126 Bacteria 1723
584 Ga0307415_100415207 3300032126 Bacteria 1153
585 Ga0316583_10037326 3300032133 Bacteria 1722
586 Ga0316583_10044155 3300032133 Bacteria 1575
587 Ga0316593_10000070 3300032168 Bacteria 12367
588 Ga0316593_10002365 3300032168 Bacteria 4441
589 Ga0316593_10009417 3300032168 Bacteria 2757
590 Ga0307510_10007161 3300033180 Bacteria 13283
591 Ga0316592_1000393 3300033524 Bacteria 5857
592 Ga0316592_1000847 3300033524 Bacteria 4605
593 Ga0316587_1003506 3300033529 Bacteria 2206
594 Ga0316596_1000074 3300033541 Bacteria 11676
595 Ga0316596_1001295 3300033541 Bacteria 4973
596 Ga0316596_1174280 3300033541 Bacteria 594
597 Ga0373934_0342372 3300035086 Bacteria 622
598 Ga0373932_0141077 3300035112 Bacteria 820
599 Ga0373956_0022091 3300035119 Bacteria 2720
600 Ga0373955_0079998 3300035172 Bacteria 1845
601 Ga0316574_0035103 3300035398 Bacteria 3063
602 Ga0316574_0127406 3300035398 Bacteria 1637
603 Ga0373935_0403821 3300035692 Bacteria 982
604 Ga0373947_0366317 3300035725 Bacteria 969
605 Ga0373947_0584623 3300035725 Bacteria 761
606 Ga0373947_0988674 3300035725 Bacteria 574
607 Ga0373937_0188162 3300036401 Bacteria 1939
608 Ga0316582_0007638 3300036647 Bacteria 5768
609 Ga0316582_0135851 3300036647 Bacteria 1655
610 Ga0316584_0017052 3300036712 Bacteria 5214
611 Ga0316584_0997739 3300036712 Bacteria 559
612 Ga0373925_1001531 3300037068 Bacteria 688
613 Ga0395899_0172179 3300037312 Bacteria 1524
614 Ga0395900_0217336 3300037418 Bacteria 1928
615 Ga0395898_0302993 3300037466 Bacteria 1524
616 Ga0395901_0005497 3300038443 Bacteria 12837
617 Ga0400484_01091 3300038725 Bacteria 3285
618 Ga0400483_140319 3300039062 Bacteria 1870
619 Ga0400483_146212 3300039062 Bacteria 1830
620 Ga0400487_28495 3300039110 Bacteria 2144
621 Ga0436365_0324201 3300039437 Bacteria 854
622 Ga0436365_1379258 3300039437 Bacteria 504
623 Ga0436363_0555558 3300039450 Bacteria 848
624 Ga0436363_1533653 3300039450 Bacteria 605
625 Ga0439436_0000024 3300041404 Bacteria 58416
626 Ga0439436_0221812 3300041404 Bacteria 544
627 Ga0439466_0024073 3300041411 Bacteria 2138
628 Ga0439465_0000125 3300041413 Bacteria 18402
629 Ga0451789_1145622 3300041443 Bacteria 1111
630 Ga0451791_0097535 3300041451 Bacteria 1026
631 Ga0451791_1537909 3300041451 Bacteria 844
632 Ga0451793_1150667 3300041452 Bacteria 1119
633 Ga0451797_0522831 3300041453 Bacteria 1558
634 Ga0451795_0608584 3300041456 Bacteria 606
635 Ga0451798_0819397 3300041458 Bacteria 704
636 Ga0451802_0850503 3300041460 Bacteria 825
637 Ga0451802_1200763 3300041460 Bacteria 986
638 Ga0451802_1482254 3300041460 Bacteria 1171
639 Ga0451807_1090267 3300041486 Bacteria 792
640 Ga0451807_2221809 3300041486 Bacteria 728
641 Ga0451807_2383651 3300041486 Bacteria 522
642 Ga0451837_0347394 3300041494 Bacteria 864
643 Ga0451851_0854358 3300041507 Bacteria 2576
644 Ga0451853_0986352 3300041512 Bacteria 1249
645 Ga0439431_0008618 3300041997 Bacteria 2295
646 Ga0439431_0124884 3300041997 Bacteria 720
647 Ga0439431_0233699 3300041997 Bacteria 542
648 Ga0439437_000245 3300042000 Bacteria 4910
649 Ga0439437_001234 3300042000 Bacteria 2688
650 Ga0439448_0100034 3300042005 Bacteria 985
651 Ga0439432_021074 3300042006 Bacteria 2163
652 Ga0439456_003323 3300042013 Bacteria 3253
653 Ga0439457_082259 3300042014 Bacteria 741
654 Ga0450911_000001 3300042115 Bacteria 311012
655 Ga0450896_009245 3300042133 Bacteria 1372
656 Ga0450902_022221 3300042137 Bacteria 1050
657 Ga0450903_008093 3300042138 Bacteria 1723
658 Ga0450904_000136 3300042139 Bacteria 16261
659 Ga0450906_075328 3300042145 Bacteria 606
660 Ga0450908_000557 3300042184 Bacteria 7151
661 Ga0439459_0000450 3300042438 Bacteria 5308
662 Ga0439459_0001047 3300042438 Bacteria 3953
663 Ga0439459_0095687 3300042438 Bacteria 720
664 Ga0439459_0204338 3300042438 Bacteria 541
665 Ga0439464_0000157 3300042439 Bacteria 11190
666 Ga0450916_007609 3300042530 Bacteria 1304
667 Ga0450916_048603 3300042530 Bacteria 663
668 Ga0450918_020026 3300042531 Bacteria 1169
669 Ga0450893_0112423 3300042532 Bacteria 563
670 Ga0466969_0069722 3300044656 Bacteria 1692
671 Ga0466969_0137916 3300044656 Bacteria 1128
672 Ga0466972_0075646 3300044658 Bacteria 1604
673 Ga0466972_0302669 3300044658 Bacteria 747
674 Ga0466982_0000005 3300044672 Bacteria 364340
675 Ga0466982_0018787 3300044672 Bacteria 3886
676 Ga0466965_0021760 3300044683 Bacteria 3089
677 Ga0466965_0059107 3300044683 Bacteria 1912
678 Ga0466965_0229681 3300044683 Bacteria 991
679 Ga0466966_0015601 3300044684 Bacteria 5021
680 Ga0466961_0017052 3300044693 Bacteria 4664
681 Ga0466963_1154762 3300044694 Bacteria 544
682 Ga0466964_0274237 3300044706 Bacteria 840
683 Ga0453684_0001527 3300044712 Bacteria 64730
684 Ga0466971_0003924 3300044719 Bacteria 6382
685 Ga0466971_0007950 3300044719 Bacteria 4620
686 Ga0466968_0005794 3300044735 Bacteria 4635
687 Ga0466968_0012057 3300044735 Bacteria 3376
688 Ga0466968_0211606 3300044735 Bacteria 911
689 Ga0466970_0217254 3300044765 Bacteria 1066
690 Ga0466970_0308359 3300044765 Bacteria 893
691 Ga0466957_0023283 3300044842 Bacteria 3660
692 Ga0466957_0079445 3300044842 Bacteria 2041
693 Ga0466957_0088762 3300044842 Bacteria 1935
694 Ga0466957_0096733 3300044842 Bacteria 1856
695 Ga0466957_0270625 3300044842 Bacteria 1134
696 Ga0466960_0057111 3300044901 Bacteria 1902
697 Ga0466960_0090653 3300044901 Bacteria 1557
698 Ga0466959_0030203 3300045049 Bacteria 4013
699 Ga0451576_0000753 3300045051 Bacteria 64620
700 Ga0451576_0039099 3300045051 Bacteria 5021
701 Ga0466958_0022524 3300045836 Bacteria 3691
702 Ga0495617_000352 3300046452 Bacteria 25311
703 Ga0495617_000483 3300046452 Bacteria 21197
704 Ga0495627_000013 3300046453 Bacteria 332765
705 Ga0495627_016640 3300046453 Bacteria 2514
706 Ga0495603_0311808 3300046455 Bacteria 904
707 Ga0495590_0010025 3300046457 Bacteria 3579
708 Ga0495590_0071180 3300046457 Bacteria 1220
709 Ga0495590_0368384 3300046457 Bacteria 548
710 Ga0495590_0397933 3300046457 Bacteria 528
711 Ga0495591_000020 3300046458 Bacteria 217845
712 Ga0495638_0000019 3300046460 Bacteria 384671
713 Ga0495638_0000394 3300046460 Bacteria 53857
714 Ga0495638_0000426 3300046460 Bacteria 50926
715 Ga0495638_0001081 3300046460 Bacteria 26550
716 Ga0495638_0002385 3300046460 Bacteria 15389
717 Ga0495638_0015694 3300046460 Bacteria 5080
718 Ga0495638_0020527 3300046460 Bacteria 4363
719 Ga0495638_0026879 3300046460 Bacteria 3728
720 Ga0495638_0195217 3300046460 Bacteria 1146
721 Ga0495638_0304621 3300046460 Bacteria 857
722 Ga0495653_0033709 3300046463 Bacteria 4054
723 Ga0495650_0000206 3300046471 Bacteria 127713
724 Ga0495650_0000221 3300046471 Bacteria 118284
725 Ga0495650_0000369 3300046471 Bacteria 78529
726 Ga0495650_0001354 3300046471 Bacteria 24380
727 Ga0495650_0043787 3300046471 Bacteria 1896
728 Ga0495650_0126449 3300046471 Bacteria 936
729 Ga0495582_0095752 3300046473 Bacteria 1659
730 Ga0495639_0158877 3300046475 Bacteria 1093
731 Ga0495584_0009829 3300046491 Bacteria 4919
732 Ga0495584_0050009 3300046491 Bacteria 2105
733 Ga0495584_0215928 3300046491 Bacteria 975
734 Ga0495585_0000210 3300046492 Bacteria 61025
735 Ga0495585_0003200 3300046492 Bacteria 11174
736 Ga0495585_0006659 3300046492 Bacteria 7139
737 Ga0495585_0049563 3300046492 Bacteria 2331
738 Ga0495594_0626777 3300046499 Bacteria 609
739 Ga0495596_0062978 3300046500 Bacteria 1443
740 Ga0495607_0000040 3300046501 Bacteria 133419
741 Ga0495607_0000129 3300046501 Bacteria 80548
742 Ga0495607_0012990 3300046501 Bacteria 5474
743 Ga0495607_0020082 3300046501 Bacteria 4229
744 Ga0495607_0030664 3300046501 Bacteria 3299
745 Ga0495607_0046538 3300046501 Bacteria 2547
746 Ga0495607_0163207 3300046501 Bacteria 1130
747 Ga0495583_0008107 3300046506 Bacteria 6471
748 Ga0495583_0012896 3300046506 Bacteria 4697
749 Ga0495606_0000638 3300046507 Bacteria 55027
750 Ga0495606_0000669 3300046507 Bacteria 53621
751 Ga0495606_0001771 3300046507 Bacteria 27665
752 Ga0495606_0002189 3300046507 Bacteria 23439
753 Ga0495606_0003264 3300046507 Bacteria 17392
754 Ga0495606_0005069 3300046507 Bacteria 12815
755 Ga0495606_0008547 3300046507 Bacteria 8866
756 Ga0495606_0044131 3300046507 Bacteria 2967
757 Ga0495606_0053250 3300046507 Bacteria 2626
758 Ga0495606_0165026 3300046507 Bacteria 1289
759 Ga0495608_0587727 3300046511 Bacteria 669
760 Ga0495610_0000984 3300046512 Bacteria 26291
761 Ga0495610_0027797 3300046512 Bacteria 3000
762 Ga0495610_0085981 3300046512 Bacteria 1433
763 Ga0495616_0000045 3300046513 Bacteria 113226
764 Ga0495616_0001404 3300046513 Bacteria 16762
765 Ga0495616_0062638 3300046513 Bacteria 1820
766 Ga0495616_0073803 3300046513 Bacteria 1645
767 Ga0495616_0201451 3300046513 Bacteria 875
768 Ga0495620_0001475 3300046515 Bacteria 14075
769 Ga0495620_0007350 3300046515 Bacteria 5995
770 Ga0495620_0072801 3300046515 Bacteria 1402
771 Ga0495620_0118210 3300046515 Bacteria 1046
772 Ga0495630_0175818 3300046517 Bacteria 1632
773 Ga0495630_0364855 3300046517 Bacteria 1106
774 Ga0495631_0001589 3300046518 Bacteria 13644
775 Ga0495631_0003466 3300046518 Bacteria 8630
776 Ga0495631_0049096 3300046518 Bacteria 1848
777 Ga0495632_0000016 3300046519 Bacteria 232022
778 Ga0495632_0006854 3300046519 Bacteria 7259
779 Ga0495632_0006995 3300046519 Bacteria 7159
780 Ga0495632_0013188 3300046519 Bacteria 4727
781 Ga0495632_0070207 3300046519 Bacteria 1685
782 Ga0495632_0101558 3300046519 Bacteria 1355
783 Ga0495632_0173311 3300046519 Bacteria 990
784 Ga0495632_0215510 3300046519 Bacteria 870
785 Ga0495632_0238723 3300046519 Bacteria 818
786 Ga0495637_0016287 3300046520 Bacteria 3476
787 Ga0495637_0016816 3300046520 Bacteria 3416
788 Ga0495637_0050570 3300046520 Bacteria 1743
789 Ga0495643_0034666 3300046522 Bacteria 2784
790 Ga0495643_0145978 3300046522 Bacteria 1175
791 Ga0495644_0009353 3300046523 Bacteria 3779
792 Ga0495644_0181142 3300046523 Bacteria 810
793 Ga0495648_0002393 3300046524 Bacteria 17421
794 Ga0495648_0013423 3300046524 Bacteria 6057
795 Ga0495663_0013450 3300046525 Bacteria 2288
796 Ga0495654_0010949 3300046530 Bacteria 4927
797 Ga0495609_0012510 3300046538 Bacteria 4025
798 Ga0495621_0083965 3300046539 Bacteria 1192
799 Ga0495597_0000004 3300046542 Bacteria 307496
800 Ga0495597_0136887 3300046542 Bacteria 1012
801 Ga0495622_0015520 3300046557 Bacteria 3541
802 Ga0495622_0072540 3300046557 Bacteria 1588
803 Ga0495622_0225191 3300046557 Bacteria 830
804 Ga0495633_0005767 3300046558 Bacteria 7483
805 Ga0495656_0036930 3300046615 Bacteria 2015
806 Ga0495668_0009889 3300046616 Bacteria 5817
807 Ga0495668_0024612 3300046616 Bacteria 3424
808 Ga0495668_0059389 3300046616 Bacteria 2110
809 Ga0495668_0155175 3300046616 Bacteria 1254
810 Ga0495668_0224496 3300046616 Bacteria 1029
811 Ga0495668_0248720 3300046616 Bacteria 974
812 Ga0495668_0334177 3300046616 Bacteria 831
813 Ga0495634_0670122 3300046642 Bacteria 598
814 Ga0495611_0000001 3300046648 Bacteria 2628469
815 Ga0495611_0000044 3300046648 Bacteria 92551
816 Ga0495611_0000589 3300046648 Bacteria 20938
817 Ga0495611_0141365 3300046648 Bacteria 1124
818 Ga0495625_0000010 3300046660 Bacteria 381775
819 Ga0495625_0000041 3300046660 Bacteria 206598
820 Ga0495625_0006301 3300046660 Bacteria 10609
821 Ga0495625_0015613 3300046660 Bacteria 6007
822 Ga0495625_0028256 3300046660 Bacteria 4208
823 Ga0495625_0114269 3300046660 Bacteria 1843
824 Ga0495625_0140617 3300046660 Bacteria 1628
825 Ga0495625_0150536 3300046660 Bacteria 1564
826 Ga0495625_0302588 3300046660 Bacteria 1023
827 Ga0495625_0534511 3300046660 Bacteria 712
828 Ga0495625_0874772 3300046660 Bacteria 517
829 Ga0495661_0000095 3300046665 Bacteria 109100
830 Ga0495661_0028182 3300046665 Bacteria 3598
831 Ga0495661_0601930 3300046665 Bacteria 517
832 Ga0495588_0078646 3300046674 Bacteria 1721
833 Ga0495658_0034892 3300046683 Bacteria 2763
834 Ga0495670_0003718 3300046691 Bacteria 7502
835 Ga0495670_0004556 3300046691 Bacteria 6800
836 Ga0495671_0000404 3300046692 Bacteria 34984
837 Ga0495671_0005231 3300046692 Bacteria 7625
838 Ga0495671_0027170 3300046692 Bacteria 2957
839 Ga0495671_0245247 3300046692 Bacteria 865
840 Ga0495671_0408667 3300046692 Bacteria 650
841 Ga0495649_0002065 3300046694 Bacteria 14446
842 Ga0495649_0002986 3300046694 Bacteria 11622
843 Ga0495649_0004121 3300046694 Bacteria 9549
844 Ga0495649_0006003 3300046694 Bacteria 7606
845 Ga0495649_0021488 3300046694 Bacteria 3614
846 Ga0495649_0131725 3300046694 Bacteria 1319
847 Ga0495649_0206760 3300046694 Bacteria 1018
848 Ga0495589_0000008 3300046794 Bacteria 266071
849 Ga0495589_0112583 3300046794 Bacteria 1313
850 Ga0495660_0000369 3300046810 Bacteria 39465
851 Ga0495660_0000385 3300046810 Bacteria 38483
852 Ga0495660_0001556 3300046810 Bacteria 15425
853 Ga0495660_0010559 3300046810 Bacteria 5371
854 Ga0495660_0035663 3300046810 Bacteria 2778
855 Ga0495581_0076682 3300047315 Bacteria 1934
856 Ga0495636_0463357 3300047318 Bacteria 610
857 Ga0495672_0017310 3300047320 Bacteria 4824
858 Ga0495672_0018334 3300047320 Bacteria 4651
859 Ga0495672_0023104 3300047320 Bacteria 4031
860 Ga0495672_0234423 3300047320 Bacteria 899
861 Ga0495672_0299162 3300047320 Bacteria 763
862 Ga0495676_0000002 3300047321 Bacteria 373918
863 Ga0495680_0248836 3300047322 Unclassified 1260
864 Ga0495683_0000906 3300047323 Bacteria 20913
865 Ga0495683_0028927 3300047323 Bacteria 2832
866 Ga0495683_0453631 3300047323 Bacteria 526
867 Ga0495679_000004 3300047446 Bacteria 748056
868 Ga0495679_000992 3300047446 Bacteria 17496
869 Ga0495673_0000004 3300047469 Bacteria 1354526
870 Ga0495673_0000573 3300047469 Bacteria 37094
871 Ga0495673_0000615 3300047469 Bacteria 35229
872 Ga0495673_0020195 3300047469 Bacteria 3321
873 Ga0495673_0024811 3300047469 Bacteria 2888
874 Ga0495673_0033600 3300047469 Bacteria 2378
875 Ga0495673_0146537 3300047469 Bacteria 916
876 Ga0495673_0234567 3300047469 Bacteria 674
877 Ga0495681_0006389 3300047470 Bacteria 7757
878 Ga0495681_0028059 3300047470 Bacteria 2902
879 Ga0495686_0000108 3300047472 Bacteria 173579
880 Ga0495686_0001586 3300047472 Bacteria 24018
881 Ga0495686_0021439 3300047472 Bacteria 4290
882 Ga0495686_0077975 3300047472 Bacteria 2028
883 Ga0495686_0103776 3300047472 Bacteria 1712
884 Ga0495686_0126059 3300047472 Bacteria 1522
885 Ga0495626_0000007 3300048091 Bacteria 276374
886 Ga0495626_0074428 3300048091 Bacteria 1520
887 Ga0496100_0004296 3300048903 Bacteria 7542
888 Ga0496100_0176500 3300048903 Bacteria 1543
889 Ga0496100_0248465 3300048903 Bacteria 1315
890 Ga0496100_0912853 3300048903 Bacteria 690
891 Ga0496101_0001179 3300048904 Bacteria 15667
892 Ga0496101_0502088 3300048904 Bacteria 958
893 Ga0496101_1060374 3300048904 Bacteria 637
894 Ga0496102_0106044 3300048905 Bacteria 2615
895 Ga0496102_0356362 3300048905 Bacteria 1377
896 Ga0496102_0699010 3300048905 Bacteria 937
897 Ga0496102_1196474 3300048905 Bacteria 679
898 Ga0496103_0111558 3300048906 Bacteria 1738
899 Ga0496104_0174824 3300048907 Bacteria 2058
900 Ga0496104_0262591 3300048907 Bacteria 1639
901 Ga0496104_0806595 3300048907 Bacteria 845
902 Ga0496105_0001419 3300048908 Bacteria 16832
903 Ga0496105_0376831 3300048908 Bacteria 1130
904 Ga0496106_0000889 3300048909 Bacteria 21827
905 Ga0496106_0250750 3300048909 Bacteria 1415
906 Ga0496106_0327677 3300048909 Bacteria 1229
907 Ga0496107_0103199 3300048910 Bacteria 2092
908 Ga0496107_0379604 3300048910 Bacteria 1051
909 Ga0496109_0290998 3300048912 Bacteria 1540
910 Ga0496109_0563577 3300048912 Bacteria 1074
911 Ga0496112_0084918 3300048915 Bacteria 3132
912 Ga0496113_0003783 3300048916 Bacteria 9144
913 Ga0496113_0297545 3300048916 Bacteria 1292
914 Ga0496115_0000098 3300048918 Bacteria 82309
915 Ga0496115_0001149 3300048918 Bacteria 19121
916 Ga0496115_0013105 3300048918 Bacteria 6260
917 Ga0496115_0086517 3300048918 Bacteria 2557
918 Ga0496115_0178560 3300048918 Bacteria 1755
919 Ga0496116_0010634 3300048919 Bacteria 7694
920 Ga0496116_0126233 3300048919 Bacteria 1469
921 Ga0496117_0019392 3300048920 Bacteria 5587
922 Ga0496117_0019920 3300048920 Bacteria 5489
923 Ga0496117_0038715 3300048920 Bacteria 3530
924 Ga0496117_0079234 3300048920 Bacteria 2165
925 Ga0496117_0143007 3300048920 Bacteria 1429
926 Ga0496117_0158415 3300048920 Bacteria 1330
927 Ga0496117_0197926 3300048920 Bacteria 1138
928 Ga0496117_0208986 3300048920 Bacteria 1096
929 Ga0496118_0000169 3300048921 Bacteria 118190
930 Ga0496118_0002339 3300048921 Bacteria 25709
931 Ga0496118_0002650 3300048921 Bacteria 23696
932 Ga0496118_0004693 3300048921 Bacteria 16013
933 Ga0496118_0020525 3300048921 Bacteria 5854
934 Ga0496118_0071140 3300048921 Bacteria 2506
935 Ga0496118_0071668 3300048921 Bacteria 2493
936 Ga0496118_0095037 3300048921 Bacteria 2036
937 Ga0496118_0147560 3300048921 Bacteria 1478
938 Ga0496118_0195083 3300048921 Bacteria 1206
939 Ga0496118_0475548 3300048921 Bacteria 628
940 Ga0496119_0000255 3300048922 Bacteria 75611
941 Ga0496119_0001013 3300048922 Bacteria 35964
942 Ga0496119_0007613 3300048922 Bacteria 9714
943 Ga0496119_0019265 3300048922 Bacteria 5036
944 Ga0496120_0000240 3300048923 Bacteria 93297
945 Ga0496120_0002806 3300048923 Bacteria 16859
946 Ga0496120_0007069 3300048923 Bacteria 8428
947 Ga0496121_0000148 3300048924 Bacteria 154021
948 Ga0496121_0001780 3300048924 Bacteria 34943
949 Ga0496121_0005219 3300048924 Bacteria 16834
950 Ga0496121_0013002 3300048924 Bacteria 8995
951 Ga0496121_0022948 3300048924 Bacteria 6029
952 Ga0496121_0041348 3300048924 Bacteria 4029
953 Ga0496121_0056789 3300048924 Bacteria 3249
954 Ga0496121_0158112 3300048924 Bacteria 1660
955 Ga0496121_0430212 3300048924 Bacteria 856
956 Ga0496122_0004582 3300048925 Bacteria 17020
957 Ga0496122_0054948 3300048925 Bacteria 2984
958 Ga0496122_0148198 3300048925 Bacteria 1454
959 Ga0496122_0197661 3300048925 Bacteria 1179
960 Ga0496122_0215186 3300048925 Bacteria 1108
961 Ga0496122_0284328 3300048925 Bacteria 902
962 Ga0496123_0003097 3300048926 Bacteria 19096
963 Ga0496123_0019930 3300048926 Bacteria 5264
964 Ga0496123_0029007 3300048926 Bacteria 4084
965 Ga0496123_0042254 3300048926 Bacteria 3148
966 Ga0496123_0059448 3300048926 Bacteria 2471
967 Ga0496123_0078148 3300048926 Bacteria 2028
968 Ga0496123_0148149 3300048926 Bacteria 1271
969 Ga0496124_0000560 3300048927 Bacteria 62943
970 Ga0496124_0000764 3300048927 Bacteria 52565
971 Ga0496124_0010308 3300048927 Bacteria 9484
972 Ga0496124_0082173 3300048927 Bacteria 2645
973 Ga0496124_0192751 3300048927 Bacteria 1557
974 Ga0496124_0371612 3300048927 Bacteria 1003
975 Ga0496125_0003248 3300048928 Bacteria 20029
976 Ga0496125_0030500 3300048928 Bacteria 4823
977 Ga0496125_0032324 3300048928 Bacteria 4649
978 Ga0496125_0067005 3300048928 Bacteria 2832
979 Ga0496125_0152060 3300048928 Bacteria 1588
980 Ga0496126_0000708 3300048929 Bacteria 60934
981 Ga0496126_0002787 3300048929 Bacteria 23008
982 Ga0496126_0008157 3300048929 Bacteria 11333
983 Ga0496126_0012861 3300048929 Bacteria 8553
984 Ga0496126_0036296 3300048929 Bacteria 4609
985 Ga0496126_0237935 3300048929 Bacteria 1523
986 Ga0496126_0367155 3300048929 Bacteria 1174
987 Ga0496126_0550198 3300048929 Bacteria 916
988 Ga0496126_1055507 3300048929 Bacteria 606
989 Ga0495678_000116 3300049459 Bacteria 95210
990 Ga0495678_020813 3300049459 Bacteria 2898
991 Ga0495678_031013 3300049459 Bacteria 2233
992 Ga0495678_045143 3300049459 Bacteria 1739
993 Ga0495682_0000072 3300049460 Bacteria 93119
994 Ga0495682_0005082 3300049460 Bacteria 5519
995 Ga0495682_0021724 3300049460 Bacteria 2403
996 Ga0495682_0363398 3300049460 Bacteria 510
997 Ga0501297_061832 3300049520 Bacteria 574
998 Ga0501299_034239 3300049522 Bacteria 994
999 Ga0501303_031018 3300049526 Bacteria 624
1000 Ga0501314_007198 3300049530 Bacteria 984
1001 Ga0501031_0103640 3300049568 Bacteria 1856
1002 Ga0501031_0760434 3300049568 Bacteria 622
1003 Ga0501032_0014242 3300049569 Bacteria 5632
1004 Ga0501032_0082403 3300049569 Bacteria 2140
1005 Ga0501033_0837480 3300049570 Bacteria 620
1006 Ga0501034_0010312 3300049571 Bacteria 9741
1007 Ga0501034_0046079 3300049571 Bacteria 4406
1008 Ga0501034_1534877 3300049571 Bacteria 540
1009 Ga0501036_0024717 3300049572 Bacteria 5065
1010 Ga0501036_0648088 3300049572 Bacteria 874
1011 Ga0501036_1062130 3300049572 Bacteria 662
1012 Ga0501037_0013004 3300049573 Bacteria 6134
1013 Ga0501038_0012339 3300049574 Bacteria 7807
1014 Ga0501039_0047774 3300049575 Bacteria 3308
1015 Ga0501039_0376931 3300049575 Bacteria 1115
1016 Ga0501040_0000154 3300049576 Bacteria 38226
1017 Ga0501042_0000015 3300049578 Bacteria 52455
1018 Ga0501042_0209017 3300049578 Bacteria 1407
1019 Ga0501042_0679838 3300049578 Bacteria 748
1020 Ga0501043_0055715 3300049579 Bacteria 3106
1021 Ga0501046_0025490 3300049580 Bacteria 4839
1022 Ga0501046_0732090 3300049580 Bacteria 695
1023 Ga0501047_0104175 3300049581 Bacteria 2717
1024 Ga0501047_0113729 3300049581 Bacteria 2589
1025 Ga0501047_0600830 3300049581 Bacteria 922
1026 Ga0501048_0018493 3300049582 Bacteria 5122
1027 Ga0501048_0285637 3300049582 Bacteria 1173
1028 Ga0501068_0086317 3300049584 Bacteria 1932
1029 Ga0501068_0843886 3300049584 Bacteria 602
1030 Ga0501069_0378851 3300049585 Bacteria 836
1031 Ga0501069_0517076 3300049585 Bacteria 713
1032 Ga0501070_0188777 3300049586 Bacteria 1694
1033 Ga0501070_0351862 3300049586 Bacteria 1195
1034 Ga0501070_0774987 3300049586 Bacteria 754
1035 Ga0501073_0122319 3300049589 Bacteria 1803
1036 Ga0501073_0220470 3300049589 Bacteria 1310
1037 Ga0501073_0312153 3300049589 Bacteria 1085
1038 Ga0501074_0078530 3300049590 Bacteria 2369
1039 Ga0501239_011449 3300049672 Bacteria 991
1040 Ga0501243_104316 3300049675 Bacteria 575
1041 Ga0501249_031256 3300049679 Bacteria 1187
1042 Ga0501249_042546 3300049679 Bacteria 1033
1043 Ga0501259_162896 3300049688 Bacteria 558
1044 Ga0501080_0022768 3300049742 Bacteria 5804
1045 Ga0501080_0066732 3300049742 Bacteria 3346
1046 Ga0501080_0534120 3300049742 Bacteria 1046
1047 Ga0501035_0049199 3300049822 Bacteria 3778
1048 Ga0501044_0190321 3300049823 Bacteria 2015
1049 Ga0501226_000014 3300049853 Bacteria 166091
1050 Ga0501284_07946 3300050005 Bacteria 628
1051 nmdc:mga05p37_305609_c1 3300050507 Bacteria 1888
1052 nmdc:mga09592_57128_c1 3300050508 Bacteria 3298
1053 nmdc:mga0qj67_118800_c1 3300050509 Bacteria 2138
1054 nmdc:mga0qj67_19526_c1 3300050509 Bacteria 5178
1055 nmdc:mga06r32_5777_c1 3300050510 Bacteria 11149
1056 nmdc:mga08y16_1370944_c1 3300050511 Bacteria 671
1057 nmdc:mga08y16_198611_c1 3300050511 Bacteria 2079
1058 nmdc:mga08y16_65241_c1 3300050511 Bacteria 3801
1059 nmdc:mga08y16_995464_c1 3300050511 Bacteria 818
1060 nmdc:mga0sz30_11932_c1 3300050516 Bacteria 3369
1061 Ga0500643_000103 3300053087 Bacteria 87887
1062 Ga0500647_0072963 3300053091 Bacteria 1648
1063 Ga0500583_0047702 3300053092 Bacteria 1974
1064 Ga0500583_0062005 3300053092 Bacteria 1767
1065 Ga0500583_0077694 3300053092 Bacteria 1599
1066 Ga0500583_0151195 3300053092 Bacteria 1155
1067 Ga0500651_0274044 3300053093 Bacteria 975
1068 Ga0500651_0313339 3300053093 Bacteria 898
1069 Ga0500651_0503661 3300053093 Bacteria 667
1070 Ga0500650_0229959 3300053098 Bacteria 837
1071 Ga0500555_000551 3300053103 Bacteria 14941
1072 Ga0500556_0087502 3300053104 Bacteria 1186
1073 Ga0500594_0017489 3300053118 Bacteria 1757
1074 Ga0500595_146282 3300053119 Bacteria 661
1075 Ga0500617_033366 3300053124 Bacteria 2305
1076 Ga0500642_0144480 3300053130 Bacteria 1116
1077 Ga0500642_0200660 3300053130 Bacteria 928
1078 Ga0500652_070846 3300053131 Bacteria 1444
1079 Ga0500658_0034153 3300053134 Bacteria 2005
1080 Ga0500559_0326671 3300053136 Bacteria 719
1081 Ga0500559_0538403 3300053136 Bacteria 534
1082 Ga0500564_013817 3300053138 Bacteria 3621
1083 Ga0500568_0027470 3300053139 Bacteria 2379
1084 Ga0500568_0089089 3300053139 Bacteria 1165
1085 Ga0500588_0000369 3300053146 Bacteria 6954
1086 Ga0500588_0018445 3300053146 Bacteria 1838
1087 Ga0500589_103534 3300053147 Bacteria 1233
1088 Ga0500604_0021592 3300053151 Bacteria 1821
1089 Ga0500616_0000299 3300053153 Bacteria 72074
1090 Ga0500622_0001304 3300053156 Bacteria 20260
1091 Ga0500622_0013308 3300053156 Bacteria 4438
1092 Ga0500627_0387286 3300053158 Bacteria 598
1093 Ga0500633_0074965 3300053160 Bacteria 1215
1094 Ga0500637_0025672 3300053178 Bacteria 3240
1095 Ga0500611_055889 3300053727 Bacteria 919
1096 Ga0500645_001366 3300053730 Bacteria 12540
1097 Ga0500661_015697 3300055283 Bacteria 1357
1098 Ga0590071_041949 3300059421 Bacteria 1102
1099 Ga0466962_0003000 3300061719 Bacteria 8045
1100 Ga0466962_0003956 3300061719 Bacteria 7091
1101 2578458447 2576861471 Bacteria 4648976
1102 2595447041 2593339238 Bacteria 4182970
1103 2595449803 2593339239 Bacteria 4124669
1104 2643896715 2643221577 Bacteria 3710843
1105 2644478920 2643221685 Bacteria 3673288
1106 2721026295 2718218334 Bacteria 4765486
1107 2735833728 2734482264 Unclassified 5014763
1108 2739228716 2738543009 Bacteria 4944499
1109 2739732216 2739367700 Bacteria 4747630
1110 2816517019 2816332141 Bacteria 4436036
1111 2819564183 2818991440 Bacteria 4774720
1112 2842392996 2842391507 Bacteria 4486072
1113 2842757816 2842757796 Bacteria 3981385
1114 2842918073 2842914999 Bacteria 4419378
1115 2842920102 2842918807 Bacteria 4289178
1116 2874221601 2874220319 Bacteria 4594709
1117 2884341717 2884338543 Bacteria 4610696
1118 2884413645 2884411467 Bacteria 5246714
1119 2895396578 2895395659 Bacteria 3983269
1120 2904464820 2904463128 Bacteria 4775606
1121 2919087531 2919085039 Bacteria 4532964
1122 2919089734 2919089067 Bacteria 4560942
1123 2919137674 2919134579 Bacteria 4480386
1124 2919406337 2919404418 Bacteria 4232372
1125 2928499438 2928496128 Bacteria 4631123
1126 2928964901 2928963466 Bacteria 5165703
1127 2931380776 2931380184 Bacteria 4455911
1128 2939615228 2939611941 Bacteria 3892017
1129 2939627350 2939626828 Bacteria 4695272
1130 2941475353 2941471342 Bacteria 5018624
1131 2953995392 2953994433 Bacteria 4303959
1132 2961048368 2961047084 Bacteria 4594415
1133 2961066309 2961064222 Bacteria 4749990
1134 2987606405 2987605356 Bacteria 4187822
1135 3007318969 3007315729 Bacteria 5076637
1136 8002746429 8002745576 Bacteria 4840272
1137 8054359990 8054357960 Bacteria 2867777
1138 Ga0495686_0502319
1139 SwRhRL2b_contig_1463020
1140 SwRhRL2b_contig_209150
1141 JGI24736J21556_1037929
1142 JGI24741J21665_1058143
1143 JGI24740J21852_10035843
1144 JGI24739J22299_10000150
1145 JGI24737J22298_10023750
1146 JGI24735J21928_10000631
1147 JGI24735J21928_10017635
1148 JGI24738J21930_10001714
1149 JGI25162J39368_1000300
1150 JGI25162J39368_1000946
1151 JGI25162J39368_1012103
1152 JGI25157J39369_1001759
1153 JGI25164J39214_1000252
1154 JGI25406J46586_10003849
1155 JGI25165J46597_1000223
1156 JGI25165J46597_1030433
1157 JGI25153J46596_10026551
1158 JGI25153J46596_10105839
1159 rootH1_10089905
1160 rootH1_10112669
1161 rootH2_10014066
1162 rootH1_10182598
1163 Ga0006556J51387_1035474
1164 Ga0006554J51385_1028847
1165 Ga0006562J51391_1003360
1166 Ga0006562J51391_1003840
1167 Ga0055533_1000607
1168 Ga0055532_1026080
1169 Ga0055535_1006302
1170 Ga0055542_1000340
1171 Ga0055542_1016246
1172 Ga0055526_1000736
1173 Ga0055537_1000425
1174 Ga0055524_1017895
1175 Ga0055536_1006267
1176 Ga0055534_1000119
1177 Ga0055528_1000547
1178 Ga0058692_1000163
1179 Ga0058692_1027508
1180 Ga0055543_1020543
1181 Ga0065165_1000260
1182 Ga0065165_1003583
1183 Ga0065714_10089252
1184 Ga0065704_10030471
1185 Ga0065704_10072583
1186 Ga0065704_10237498
1187 Ga0065704_10415312
1188 Ga0065707_10082517
1189 Ga0065707_10083290
1190 Ga0065707_10093119
1191 Ga0070658_10003217
1192 Ga0070658_10638534
1193 Ga0070670_100099429
1194 Ga0070670_100165225
1195 Ga0070670_100229688
1196 Ga0070670_100435538
1197 Ga0070670_101757663
1198 Ga0068869_100374508
1199 Ga0068869_100510835
1200 Ga0070666_10000013
1201 Ga0070666_10007912
1202 Ga0070680_100189313
1203 Ga0070682_100013761
1204 Ga0070682_100057071
1205 Ga0070682_101397978
1206 Ga0068868_100915436
1207 Ga0070660_100257689
1208 Ga0070660_100489691
1209 Ga0070660_100494335
1210 Ga0070660_101318929
1211 Ga0070689_100006873
1212 Ga0070687_100380990
1213 Ga0070661_100004461
1214 Ga0070661_100006700
1215 Ga0070661_100062054
1216 Ga0070661_100200287
1217 Ga0070661_100333074
1218 Ga0070692_10021855
1219 Ga0070692_10699869
1220 Ga0070668_100378822
1221 Ga0070668_100501776
1222 Ga0070669_100169271
1223 Ga0070669_101148718
1224 Ga0070675_100070972
1225 Ga0070674_100028233
1226 Ga0070674_100065862
1227 Ga0070674_100244034
1228 Ga0070673_100048820
1229 Ga0070673_100059450
1230 Ga0070673_100077300
1231 Ga0070688_100849866
1232 Ga0070659_100106170
1233 Ga0070659_100217918
1234 Ga0070659_101231326
1235 Ga0070667_100000057
1236 Ga0070667_100075773
1237 Ga0070667_100194136
1238 Ga0070667_101289781
1239 Ga0070667_101804314
1240 Ga0070709_10702030
1241 Ga0070714_100000146
1242 Ga0070714_100006932
1243 Ga0070714_100288063
1244 Ga0070713_100001113
1245 Ga0070700_100023296
1246 Ga0070700_100143433
1247 Ga0070663_100038378
1248 Ga0070663_100163342
1249 Ga0070663_100625898
1250 Ga0070663_100874932
1251 Ga0070678_100064896
1252 Ga0070678_100226253
1253 Ga0070678_100847843
1254 Ga0070662_100178306
1255 Ga0070681_10399486
1256 Ga0068867_101797533
1257 Ga0068867_101909262
1258 Ga0070685_10149985
1259 Ga0070685_10222577
1260 Ga0070685_10716982
1261 Ga0070706_100704723
1262 Ga0070679_100080953
1263 Ga0070679_100428919
1264 Ga0070679_101050805
1265 Ga0068853_100238634
1266 Ga0070672_100136347
1267 Ga0070672_100457345
1268 Ga0070672_100560767
1269 Ga0070686_100250432
1270 Ga0070696_100037091
1271 Ga0070693_100080572
1272 Ga0070693_100086721
1273 Ga0070693_100274424
1274 Ga0070665_100001412
1275 Ga0070665_100001746
1276 Ga0070665_100292367
1277 Ga0070665_100419655
1278 Ga0070665_100430295
1279 Ga0070665_101655100
1280 Ga0068855_100001054
1281 Ga0068855_100376110
1282 Ga0070664_100229471
1283 Ga0070664_101076391
1284 Ga0068857_100005138
1285 Ga0068857_100011506
1286 Ga0068857_100022774
1287 Ga0068857_100306723
1288 Ga0068857_101431976
1289 Ga0068857_101837400
1290 Ga0068854_100003997
1291 Ga0068854_100653134
1292 Ga0068856_100028243
1293 Ga0068856_100053976
1294 Ga0068856_100126517
1295 Ga0068852_100013196
1296 Ga0068859_100205251
1297 Ga0068859_100284558
1298 Ga0068859_100412515
1299 Ga0068864_101227968
1300 Ga0068861_100034657
1301 Ga0068861_100078674
1302 Ga0068861_100085506
1303 Ga0068851_10005923
1304 Ga0068858_100149055
1305 Ga0068858_100163681
1306 Ga0068858_101353970
1307 Ga0068860_100176386
1308 Ga0068860_100230530
1309 Ga0068860_101181629
1310 Ga0068862_100020082
1311 Ga0068862_100239329
1312 Ga0068862_100622213
1313 Ga0081455_10000010
1314 Ga0081540_1145781
1315 Ga0081539_10000016
1316 Ga0075368_10023721
1317 Ga0075364_10213537
1318 Ga0075364_10490766
1319 Ga0070715_10292571
1320 Ga0070712_100392953
1321 Ga0075369_10047861
1322 Ga0075369_10084874
1323 Ga0075369_10596223
1324 Ga0097621_100121949
1325 Ga0068871_100208812
1326 Ga0068871_100256382
1327 Ga0068871_100705072
1328 Ga0075430_100069862
1329 Ga0075430_100938495
1330 Ga0075431_100703332
1331 Ga0068865_100071638
1332 Ga0068865_100674932
1333 Ga0097620_100205242
1334 Ga0097620_100284579
1335 Ga0097620_100412514
1336 Ga0099826_10137357
1337 Ga0105251_10000221
1338 Ga0105244_10000631
1339 Ga0105244_10272752
1340 Ga0105250_10000024
1341 Ga0105250_10000215
1342 Ga0105250_10095106
1343 Ga0105250_10532743
1344 Ga0105240_10030430
1345 Ga0105240_10093277
1346 Ga0105240_10965196
1347 Ga0111539_10042871
1348 Ga0111539_10539972
1349 Ga0111539_10996254
1350 Ga0111539_11484368
1351 Ga0105247_10003410
1352 Ga0105247_10020959
1353 Ga0105247_10253607
1354 Ga0105247_10666955
1355 Ga0105243_10010344
1356 Ga0105243_10112312
1357 Ga0105243_10818900
1358 Ga0105243_12209427
1359 Ga0105241_10187185
1360 Ga0105241_10264895
1361 Ga0105241_11170702
1362 Ga0105242_10036858
1363 Ga0105242_10114268
1364 Ga0105242_10141056
1365 Ga0105248_10003931
1366 Ga0105248_10107075
1367 Ga0105248_10465516
1368 Ga0105237_10000214
1369 Ga0105237_10175664
1370 Ga0105237_10373889
1371 Ga0105237_10857228
1372 Ga0105238_10000156
1373 Ga0105238_10010620
1374 Ga0105238_10020830
1375 Ga0105238_10638038
1376 Ga0105238_11089715
1377 Ga0105249_10107207
1378 Ga0105249_10679418
1379 Ga0105249_11892733
1380 Ga0105239_10001178
1381 Ga0105239_10028091
1382 Ga0105239_10255733
1383 Ga0105239_10271937
1384 Ga0105239_10398557
1385 Ga0105239_11281428
1386 Ga0105239_12535621
1387 Ga0105246_10634710
1388 Ga0157314_1000371
1389 Ga0157373_10001512
1390 Ga0157373_10026725
1391 Ga0157373_10058834
1392 Ga0157373_10549224
1393 Ga0157371_10001716
1394 Ga0157371_10008141
1395 Ga0157371_10032903
1396 Ga0157371_10953400
1397 Ga0157370_10005803
1398 Ga0157370_10006411
1399 Ga0157370_10032072
1400 Ga0157370_10049486
1401 Ga0157370_10064902
1402 Ga0157370_10491485
1403 Ga0157370_10864262
1404 Ga0157369_10000171
1405 Ga0157369_10066964
1406 Ga0157369_10080787
1407 Ga0157369_10120876
1408 Ga0157378_10163836
1409 Ga0157378_11824012
1410 Ga0163162_10000802
1411 Ga0163162_10110954
1412 Ga0163162_10113764
1413 Ga0163162_11215712
1414 Ga0157372_10011602
1415 Ga0157372_10043795
1416 Ga0157375_10017161
1417 Ga0157375_10219459
1418 Ga0157375_10232891
1419 Ga0157375_12926111
1420 Ga0163163_10009793
1421 Ga0163163_10029623
1422 Ga0163163_10072238
1423 Ga0163163_10134972
1424 Ga0157380_10000876
1425 Ga0157380_10022918
1426 Ga0157380_10324149
1427 Ga0157380_10559501
1428 Ga0157380_11495009
1429 Ga0182008_10006102
1430 Ga0182008_10014917
1431 Ga0182008_10020730
1432 Ga0182008_10026590
1433 Ga0182008_10071606
1434 Ga0157377_10338196
1435 Ga0157379_10000013
1436 Ga0157379_10026667
1437 Ga0157379_10073175
1438 Ga0157379_10321666
1439 Ga0157376_10097335
1440 Ga0157376_10161097
1441 Ga0157376_10306356
1442 Ga0157376_10671576
1443 Ga0182006_1000148
1444 Ga0182006_1000208
1445 Ga0182006_1029363
1446 Ga0182006_1029600
1447 Ga0182006_1057426
1448 Ga0182006_1077523
1449 Ga0182006_1251148
1450 Ga0182007_10000139
1451 Ga0182007_10013777
1452 Ga0182007_10022629
1453 Ga0182007_10107541
1454 Ga0182005_1000110
1455 Ga0182005_1000121
1456 Ga0182005_1002288
1457 Ga0182005_1002799
1458 Ga0182005_1007803
1459 Ga0182005_1028029
1460 Ga0183368_1002
1461 Ga0163161_10001733
1462 Ga0163161_10225623
1463 Ga0163161_10239475
1464 Ga0163161_11015005
1465 Ga0206353_11114430
1466 Ga0206353_11437260
1467 Ga0209674_100061
1468 Ga0209674_102951
1469 Ga0209672_101058
1470 Ga0209147_116127
1471 Ga0207427_100169
1472 Ga0207427_103201
1473 Ga0209437_100076
1474 Ga0209437_100244
1475 Ga0209437_100723
1476 Ga0209258_101900
1477 Ga0209258_106393
1478 Ga0207425_1029061
1479 Ga0209026_1000148
1480 Ga0209148_1000002
1481 Ga0209148_1002312
1482 Ga0209759_1019783
1483 Ga0209129_1001105
1484 Ga0209129_1007410
1485 Ga0209233_1000246
1486 Ga0209233_1006488
1487 Ga0209233_1024072
1488 Ga0209565_1000063
1489 Ga0209673_1000065
1490 Ga0209130_1011604
1491 Ga0209675_1000011
1492 Ga0209676_1000011
1493 Ga0209676_1000068
1494 Ga0209564_1000190
1495 Ga0209758_1000814
1496 Ga0209758_1008736
1497 Ga0209050_1000239
1498 Ga0209050_1000351
1499 Ga0209050_1009828
1500 Ga0209256_1015294
1501 Ga0209256_1016682
1502 Ga0209051_1004518
1503 Ga0209051_1031335
1504 Ga0209257_1000014
1505 Ga0209257_1031598
1506 Ga0207697_10035285
1507 Ga0207656_10002369
1508 Ga0207696_1000175
1509 Ga0207655_1000825
1510 Ga0207655_1075839
1511 Ga0207713_1000207
1512 Ga0207713_1054666
1513 Ga0207682_10271285
1514 Ga0207642_10068281
1515 Ga0207710_10051039
1516 Ga0207710_10053258
1517 Ga0207710_10095540
1518 Ga0207710_10715443
1519 Ga0207688_10392621
1520 Ga0207680_10000001
1521 Ga0207680_10003460
1522 Ga0207647_10000008
1523 Ga0207647_10044316
1524 Ga0207647_10046875
1525 Ga0207647_10089817
1526 Ga0207645_10057374
1527 Ga0207643_10012846
1528 Ga0207705_10006425
1529 Ga0207705_10014972
1530 Ga0207705_10152410
1531 Ga0207705_10800636
1532 Ga0207684_10652573
1533 Ga0207654_10163013
1534 Ga0207654_10280440
1535 Ga0207695_10000649
1536 Ga0207695_10001088
1537 Ga0207695_10023313
1538 Ga0207695_10209007
1539 Ga0207695_11281751
1540 Ga0207671_10000057
1541 Ga0207671_10267106
1542 Ga0207671_10617782
1543 Ga0207693_10372193
1544 Ga0207693_10416300
1545 Ga0207660_10052332
1546 Ga0207657_10148460
1547 Ga0207649_10058303
1548 Ga0207649_10060771
1549 Ga0207649_10120319
1550 Ga0207649_10236695
1551 Ga0207652_10059872
1552 Ga0207681_10468819
1553 Ga0207694_10004515
1554 Ga0207694_10022206
1555 Ga0207694_10059595
1556 Ga0207694_10075025
1557 Ga0207694_10199276
1558 Ga0207694_10884626
1559 Ga0207694_11573659
1560 Ga0207650_10534435
1561 Ga0207650_11361878
1562 Ga0207700_10014272
1563 Ga0207664_10000055
1564 Ga0207664_10004122
1565 Ga0207664_10069386
1566 Ga0207644_10261561
1567 Ga0207690_10001361
1568 Ga0207690_10001362
1569 Ga0207690_10003572
1570 Ga0207690_10068701
1571 Ga0207690_10839607
1572 Ga0207706_10014408
1573 Ga0207706_10103926
1574 Ga0207686_10232595
1575 Ga0207686_10550055
1576 Ga0207709_10004255
1577 Ga0207709_10229869
1578 Ga0207709_10282532
1579 Ga0207670_10014029
1580 Ga0207669_10068407
1581 Ga0207669_10356045
1582 Ga0207704_10915225
1583 Ga0207704_11553706
1584 Ga0207691_10011441
1585 Ga0207691_10024666
1586 Ga0207691_10928658
1587 Ga0207711_10570753
1588 Ga0207689_10020699
1589 Ga0207689_10399551
1590 Ga0207689_10794431
1591 Ga0207679_10905917
1592 Ga0207667_10000139
1593 Ga0207667_10000648
1594 Ga0207667_10001898
1595 Ga0207667_10016414
1596 Ga0207667_10164369
1597 Ga0207651_10015251
1598 Ga0207651_10093158
1599 Ga0207712_10073126
1600 Ga0207668_10172312
1601 Ga0207668_11072008
1602 Ga0207640_10000951
1603 Ga0207658_10000200
1604 Ga0207658_10550884
1605 Ga0207658_12006093
1606 Ga0207677_10590266
1607 Ga0207677_11975924
1608 Ga0207703_10146213
1609 Ga0207703_10201486
1610 Ga0207703_10864739
1611 Ga0207639_10007199
1612 Ga0207678_10072431
1613 Ga0207678_10072715
1614 Ga0207678_10155063
1615 Ga0207678_10191115
1616 Ga0207678_10307148
1617 Ga0207708_10085178
1618 Ga0207708_10327873
1619 Ga0207708_10346001
1620 Ga0207702_10039255
1621 Ga0207702_11324195
1622 Ga0207641_10302219
1623 Ga0207648_10439400
1624 Ga0207676_10447539
1625 Ga0207674_10010056
1626 Ga0207674_10032391
1627 Ga0207674_10044436
1628 Ga0207674_10249235
1629 Ga0207674_10375570
1630 Ga0207674_11242900
1631 Ga0207675_100015832
1632 Ga0207675_100048721
1633 Ga0207675_100113706
1634 Ga0207675_100118476
1635 Ga0207683_10074989
1636 Ga0207683_10179063
1637 Ga0207683_10263700
1638 Ga0207683_10750134
1639 Ga0207698_10002739
1640 Ga0209371_1000023
1641 Ga0209371_1003982
1642 Ga0209813_10080637
1643 Ga0268266_10000059
1644 Ga0268266_10016021
1645 Ga0268266_10258051
1646 Ga0268266_10948346
1647 Ga0268265_10064342
1648 Ga0268265_10202749
1649 Ga0268265_10557300
1650 Ga0268264_10024459
1651 Ga0268264_10228683
1652 Ga0307517_10313025
1653 Ga0307515_10101086
1654 Ga0307515_10145245
1655 Ga0268256_1000023
1656 Ga0268256_1001500
1657 Ga0307511_10389700
1658 Ga0316181_1273336
1659 Ga0265770_1060794
1660 Ga0265328_10010604
1661 Ga0265331_10009248
1662 Ga0265331_10043929
1663 Ga0265327_10000257
1664 Ga0307513_10007691
1665 Ga0307513_10131291
1666 Ga0307513_10371663
1667 Ga0307509_10000106
1668 Ga0307509_10010878
1669 Ga0307509_10451185
1670 Ga0307408_100000018
1671 Ga0307408_100033048
1672 Ga0307408_100311254
1673 Ga0307408_101885635
1674 Ga0265313_10145766
1675 Ga0307508_10233110
1676 Ga0307508_10521896
1677 Ga0307514_10176037
1678 Ga0316575_10099611
1679 Ga0316579_10063558
1680 Ga0307516_10610677
1681 Ga0307405_10090701
1682 Ga0307405_10468084
1683 Ga0307405_11941457
1684 Ga0307413_10017181
1685 Ga0307413_11120513
1686 Ga0307410_10071575
1687 Ga0307410_10115992
1688 Ga0307406_10191426
1689 Ga0307407_10056224
1690 Ga0307407_11178683
1691 Ga0307407_11624508
1692 Ga0307412_10003310
1693 Ga0307412_10400796
1694 Ga0307412_10571972
1695 Ga0307412_11019546
1696 Ga0307409_100018842
1697 Ga0307409_100081177
1698 Ga0307409_100504114
1699 Ga0307409_100587372
1700 Ga0307409_101047951
1701 Ga0307409_101566904
1702 Ga0307416_100131604
1703 Ga0307416_100763542
1704 Ga0307416_102842708
1705 Ga0307414_10005696
1706 Ga0307414_10041817
1707 Ga0307414_10094886
1708 Ga0307414_10166931
1709 Ga0307414_10463670
1710 Ga0307414_11560905
1711 Ga0307414_11795147
1712 Ga0307411_10036622
1713 Ga0307411_10150063
1714 Ga0307411_10418724
1715 Ga0307411_10542613
1716 Ga0307411_10652885
1717 Ga0307411_10973050
1718 Ga0307415_100059636
1719 Ga0307415_100111161
1720 Ga0307415_100164657
1721 Ga0307415_100415207
1722 Ga0316583_10037326
1723 Ga0316583_10044155
1724 Ga0316593_10000070
1725 Ga0316593_10002365
1726 Ga0316593_10009417
1727 Ga0307510_10007161
1728 Ga0316592_1000393
1729 Ga0316592_1000847
1730 Ga0316587_1003506
1731 Ga0316596_1000074
1732 Ga0316596_1001295
1733 Ga0316596_1174280
1734 Ga0373934_0342372
1735 Ga0373932_0141077
1736 Ga0373956_0022091
1737 Ga0373955_0079998
1738 Ga0316574_0035103
1739 Ga0316574_0127406
1740 Ga0373935_0403821
1741 Ga0373947_0366317
1742 Ga0373947_0584623
1743 Ga0373947_0988674
1744 Ga0373937_0188162
1745 Ga0316582_0007638
1746 Ga0316582_0135851
1747 Ga0316584_0017052
1748 Ga0316584_0997739
1749 Ga0373925_1001531
1750 Ga0395899_0172179
1751 Ga0395900_0217336
1752 Ga0395898_0302993
1753 Ga0395901_0005497
1754 Ga0400484_01091
1755 Ga0400483_140319
1756 Ga0400483_146212
1757 Ga0400487_28495
1758 Ga0436365_0324201
1759 Ga0436365_1379258
1760 Ga0436363_0555558
1761 Ga0436363_1533653
1762 Ga0439436_0000024
1763 Ga0439436_0221812
1764 Ga0439466_0024073
1765 Ga0439465_0000125
1766 Ga0451789_1145622
1767 Ga0451791_0097535
1768 Ga0451791_1537909
1769 Ga0451793_1150667
1770 Ga0451797_0522831
1771 Ga0451795_0608584
1772 Ga0451798_0819397
1773 Ga0451802_0850503
1774 Ga0451802_1200763
1775 Ga0451802_1482254
1776 Ga0451807_1090267
1777 Ga0451807_2221809
1778 Ga0451807_2383651
1779 Ga0451837_0347394
1780 Ga0451851_0854358
1781 Ga0451853_0986352
1782 Ga0439431_0008618
1783 Ga0439431_0124884
1784 Ga0439431_0233699
1785 Ga0439437_000245
1786 Ga0439437_001234
1787 Ga0439448_0100034
1788 Ga0439432_021074
1789 Ga0439456_003323
1790 Ga0439457_082259
1791 Ga0450911_000001
1792 Ga0450896_009245
1793 Ga0450902_022221
1794 Ga0450903_008093
1795 Ga0450904_000136
1796 Ga0450906_075328
1797 Ga0450908_000557
1798 Ga0439459_0000450
1799 Ga0439459_0001047
1800 Ga0439459_0095687
1801 Ga0439459_0204338
1802 Ga0439464_0000157
1803 Ga0450916_007609
1804 Ga0450916_048603
1805 Ga0450918_020026
1806 Ga0450893_0112423
1807 Ga0466969_0069722
1808 Ga0466969_0137916
1809 Ga0466972_0075646
1810 Ga0466972_0302669
1811 Ga0466982_0000005
1812 Ga0466982_0018787
1813 Ga0466965_0021760
1814 Ga0466965_0059107
1815 Ga0466965_0229681
1816 Ga0466966_0015601
1817 Ga0466961_0017052
1818 Ga0466963_1154762
1819 Ga0466964_0274237
1820 Ga0453684_0001527
1821 Ga0466971_0003924
1822 Ga0466971_0007950
1823 Ga0466968_0005794
1824 Ga0466968_0012057
1825 Ga0466968_0211606
1826 Ga0466970_0217254
1827 Ga0466970_0308359
1828 Ga0466957_0023283
1829 Ga0466957_0079445
1830 Ga0466957_0088762
1831 Ga0466957_0096733
1832 Ga0466957_0270625
1833 Ga0466960_0057111
1834 Ga0466960_0090653
1835 Ga0466959_0030203
1836 Ga0451576_0000753
1837 Ga0451576_0039099
1838 Ga0466958_0022524
1839 Ga0495617_000352
1840 Ga0495617_000483
1841 Ga0495627_000013
1842 Ga0495627_016640
1843 Ga0495603_0311808
1844 Ga0495590_0010025
1845 Ga0495590_0071180
1846 Ga0495590_0368384
1847 Ga0495590_0397933
1848 Ga0495591_000020
1849 Ga0495638_0000019
1850 Ga0495638_0000394
1851 Ga0495638_0000426
1852 Ga0495638_0001081
1853 Ga0495638_0002385
1854 Ga0495638_0015694
1855 Ga0495638_0020527
1856 Ga0495638_0026879
1857 Ga0495638_0195217
1858 Ga0495638_0304621
1859 Ga0495653_0033709
1860 Ga0495650_0000206
1861 Ga0495650_0000221
1862 Ga0495650_0000369
1863 Ga0495650_0001354
1864 Ga0495650_0043787
1865 Ga0495650_0126449
1866 Ga0495582_0095752
1867 Ga0495639_0158877
1868 Ga0495584_0009829
1869 Ga0495584_0050009
1870 Ga0495584_0215928
1871 Ga0495585_0000210
1872 Ga0495585_0003200
1873 Ga0495585_0006659
1874 Ga0495585_0049563
1875 Ga0495594_0626777
1876 Ga0495596_0062978
1877 Ga0495607_0000040
1878 Ga0495607_0000129
1879 Ga0495607_0012990
1880 Ga0495607_0020082
1881 Ga0495607_0030664
1882 Ga0495607_0046538
1883 Ga0495607_0163207
1884 Ga0495583_0008107
1885 Ga0495583_0012896
1886 Ga0495606_0000638
1887 Ga0495606_0000669
1888 Ga0495606_0001771
1889 Ga0495606_0002189
1890 Ga0495606_0003264
1891 Ga0495606_0005069
1892 Ga0495606_0008547
1893 Ga0495606_0044131
1894 Ga0495606_0053250
1895 Ga0495606_0165026
1896 Ga0495608_0587727
1897 Ga0495610_0000984
1898 Ga0495610_0027797
1899 Ga0495610_0085981
1900 Ga0495616_0000045
1901 Ga0495616_0001404
1902 Ga0495616_0062638
1903 Ga0495616_0073803
1904 Ga0495616_0201451
1905 Ga0495620_0001475
1906 Ga0495620_0007350
1907 Ga0495620_0072801
1908 Ga0495620_0118210
1909 Ga0495630_0175818
1910 Ga0495630_0364855
1911 Ga0495631_0001589
1912 Ga0495631_0003466
1913 Ga0495631_0049096
1914 Ga0495632_0000016
1915 Ga0495632_0006854
1916 Ga0495632_0006995
1917 Ga0495632_0013188
1918 Ga0495632_0070207
1919 Ga0495632_0101558
1920 Ga0495632_0173311
1921 Ga0495632_0215510
1922 Ga0495632_0238723
1923 Ga0495637_0016287
1924 Ga0495637_0016816
1925 Ga0495637_0050570
1926 Ga0495643_0034666
1927 Ga0495643_0145978
1928 Ga0495644_0009353
1929 Ga0495644_0181142
1930 Ga0495648_0002393
1931 Ga0495648_0013423
1932 Ga0495663_0013450
1933 Ga0495654_0010949
1934 Ga0495609_0012510
1935 Ga0495621_0083965
1936 Ga0495597_0000004
1937 Ga0495597_0136887
1938 Ga0495622_0015520
1939 Ga0495622_0072540
1940 Ga0495622_0225191
1941 Ga0495633_0005767
1942 Ga0495656_0036930
1943 Ga0495668_0009889
1944 Ga0495668_0024612
1945 Ga0495668_0059389
1946 Ga0495668_0155175
1947 Ga0495668_0224496
1948 Ga0495668_0248720
1949 Ga0495668_0334177
1950 Ga0495634_0670122
1951 Ga0495611_0000001
1952 Ga0495611_0000044
1953 Ga0495611_0000589
1954 Ga0495611_0141365
1955 Ga0495625_0000010
1956 Ga0495625_0000041
1957 Ga0495625_0006301
1958 Ga0495625_0015613
1959 Ga0495625_0028256
1960 Ga0495625_0114269
1961 Ga0495625_0140617
1962 Ga0495625_0150536
1963 Ga0495625_0302588
1964 Ga0495625_0534511
1965 Ga0495625_0874772
1966 Ga0495661_0000095
1967 Ga0495661_0028182
1968 Ga0495661_0601930
1969 Ga0495588_0078646
1970 Ga0495658_0034892
1971 Ga0495670_0003718
1972 Ga0495670_0004556
1973 Ga0495671_0000404
1974 Ga0495671_0005231
1975 Ga0495671_0027170
1976 Ga0495671_0245247
1977 Ga0495671_0408667
1978 Ga0495649_0002065
1979 Ga0495649_0002986
1980 Ga0495649_0004121
1981 Ga0495649_0006003
1982 Ga0495649_0021488
1983 Ga0495649_0131725
1984 Ga0495649_0206760
1985 Ga0495589_0000008
1986 Ga0495589_0112583
1987 Ga0495660_0000369
1988 Ga0495660_0000385
1989 Ga0495660_0001556
1990 Ga0495660_0010559
1991 Ga0495660_0035663
1992 Ga0495581_0076682
1993 Ga0495636_0463357
1994 Ga0495672_0017310
1995 Ga0495672_0018334
1996 Ga0495672_0023104
1997 Ga0495672_0234423
1998 Ga0495672_0299162
1999 Ga0495676_0000002
2000 Ga0495680_0248836
2001 Ga0495683_0000906
2002 Ga0495683_0028927
2003 Ga0495683_0453631
2004 Ga0495679_000004
2005 Ga0495679_000992
2006 Ga0495673_0000004
2007 Ga0495673_0000573
2008 Ga0495673_0000615
2009 Ga0495673_0020195
2010 Ga0495673_0024811
2011 Ga0495673_0033600
2012 Ga0495673_0146537
2013 Ga0495673_0234567
2014 Ga0495681_0006389
2015 Ga0495681_0028059
2016 Ga0495686_0000108
2017 Ga0495686_0001586
2018 Ga0495686_0021439
2019 Ga0495686_0077975
2020 Ga0495686_0103776
2021 Ga0495686_0126059
2022 Ga0495626_0000007
2023 Ga0495626_0074428
2024 Ga0496100_0004296
2025 Ga0496100_0176500
2026 Ga0496100_0248465
2027 Ga0496100_0912853
2028 Ga0496101_0001179
2029 Ga0496101_0502088
2030 Ga0496101_1060374
2031 Ga0496102_0106044
2032 Ga0496102_0356362
2033 Ga0496102_0699010
2034 Ga0496102_1196474
2035 Ga0496103_0111558
2036 Ga0496104_0174824
2037 Ga0496104_0262591
2038 Ga0496104_0806595
2039 Ga0496105_0001419
2040 Ga0496105_0376831
2041 Ga0496106_0000889
2042 Ga0496106_0250750
2043 Ga0496106_0327677
2044 Ga0496107_0103199
2045 Ga0496107_0379604
2046 Ga0496109_0290998
2047 Ga0496109_0563577
2048 Ga0496112_0084918
2049 Ga0496113_0003783
2050 Ga0496113_0297545
2051 Ga0496115_0000098
2052 Ga0496115_0001149
2053 Ga0496115_0013105
2054 Ga0496115_0086517
2055 Ga0496115_0178560
2056 Ga0496116_0010634
2057 Ga0496116_0126233
2058 Ga0496117_0019392
2059 Ga0496117_0019920
2060 Ga0496117_0038715
2061 Ga0496117_0079234
2062 Ga0496117_0143007
2063 Ga0496117_0158415
2064 Ga0496117_0197926
2065 Ga0496117_0208986
2066 Ga0496118_0000169
2067 Ga0496118_0002339
2068 Ga0496118_0002650
2069 Ga0496118_0004693
2070 Ga0496118_0020525
2071 Ga0496118_0071140
2072 Ga0496118_0071668
2073 Ga0496118_0095037
2074 Ga0496118_0147560
2075 Ga0496118_0195083
2076 Ga0496118_0475548
2077 Ga0496119_0000255
2078 Ga0496119_0001013
2079 Ga0496119_0007613
2080 Ga0496119_0019265
2081 Ga0496120_0000240
2082 Ga0496120_0002806
2083 Ga0496120_0007069
2084 Ga0496121_0000148
2085 Ga0496121_0001780
2086 Ga0496121_0005219
2087 Ga0496121_0013002
2088 Ga0496121_0022948
2089 Ga0496121_0041348
2090 Ga0496121_0056789
2091 Ga0496121_0158112
2092 Ga0496121_0430212
2093 Ga0496122_0004582
2094 Ga0496122_0054948
2095 Ga0496122_0148198
2096 Ga0496122_0197661
2097 Ga0496122_0215186
2098 Ga0496122_0284328
2099 Ga0496123_0003097
2100 Ga0496123_0019930
2101 Ga0496123_0029007
2102 Ga0496123_0042254
2103 Ga0496123_0059448
2104 Ga0496123_0078148
2105 Ga0496123_0148149
2106 Ga0496124_0000560
2107 Ga0496124_0000764
2108 Ga0496124_0010308
2109 Ga0496124_0082173
2110 Ga0496124_0192751
2111 Ga0496124_0371612
2112 Ga0496125_0003248
2113 Ga0496125_0030500
2114 Ga0496125_0032324
2115 Ga0496125_0067005
2116 Ga0496125_0152060
2117 Ga0496126_0000708
2118 Ga0496126_0002787
2119 Ga0496126_0008157
2120 Ga0496126_0012861
2121 Ga0496126_0036296
2122 Ga0496126_0237935
2123 Ga0496126_0367155
2124 Ga0496126_0550198
2125 Ga0496126_1055507
2126 Ga0495678_000116
2127 Ga0495678_020813
2128 Ga0495678_031013
2129 Ga0495678_045143
2130 Ga0495682_0000072
2131 Ga0495682_0005082
2132 Ga0495682_0021724
2133 Ga0495682_0363398
2134 Ga0501297_061832
2135 Ga0501299_034239
2136 Ga0501303_031018
2137 Ga0501314_007198
2138 Ga0501031_0103640
2139 Ga0501031_0760434
2140 Ga0501032_0014242
2141 Ga0501032_0082403
2142 Ga0501033_0837480
2143 Ga0501034_0010312
2144 Ga0501034_0046079
2145 Ga0501034_1534877
2146 Ga0501036_0024717
2147 Ga0501036_0648088
2148 Ga0501036_1062130
2149 Ga0501037_0013004
2150 Ga0501038_0012339
2151 Ga0501039_0047774
2152 Ga0501039_0376931
2153 Ga0501040_0000154
2154 Ga0501042_0000015
2155 Ga0501042_0209017
2156 Ga0501042_0679838
2157 Ga0501043_0055715
2158 Ga0501046_0025490
2159 Ga0501046_0732090
2160 Ga0501047_0104175
2161 Ga0501047_0113729
2162 Ga0501047_0600830
2163 Ga0501048_0018493
2164 Ga0501048_0285637
2165 Ga0501068_0086317
2166 Ga0501068_0843886
2167 Ga0501069_0378851
2168 Ga0501069_0517076
2169 Ga0501070_0188777
2170 Ga0501070_0351862
2171 Ga0501070_0774987
2172 Ga0501073_0122319
2173 Ga0501073_0220470
2174 Ga0501073_0312153
2175 Ga0501074_0078530
2176 Ga0501239_011449
2177 Ga0501243_104316
2178 Ga0501249_031256
2179 Ga0501249_042546
2180 Ga0501259_162896
2181 Ga0501080_0022768
2182 Ga0501080_0066732
2183 Ga0501080_0534120
2184 Ga0501035_0049199
2185 Ga0501044_0190321
2186 Ga0501226_000014
2187 Ga0501284_07946
2188 nmdc:mga05p37_305609_c1
2189 nmdc:mga09592_57128_c1
2190 nmdc:mga0qj67_118800_c1
2191 nmdc:mga0qj67_19526_c1
2192 nmdc:mga06r32_5777_c1
2193 nmdc:mga08y16_1370944_c1
2194 nmdc:mga08y16_198611_c1
2195 nmdc:mga08y16_65241_c1
2196 nmdc:mga08y16_995464_c1
2197 nmdc:mga0sz30_11932_c1
2198 Ga0500643_000103
2199 Ga0500647_0072963
2200 Ga0500583_0047702
2201 Ga0500583_0062005
2202 Ga0500583_0077694
2203 Ga0500583_0151195
2204 Ga0500651_0274044
2205 Ga0500651_0313339
2206 Ga0500651_0503661
2207 Ga0500650_0229959
2208 Ga0500555_000551
2209 Ga0500556_0087502
2210 Ga0500594_0017489
2211 Ga0500595_146282
2212 Ga0500617_033366
2213 Ga0500642_0144480
2214 Ga0500642_0200660
2215 Ga0500652_070846
2216 Ga0500658_0034153
2217 Ga0500559_0326671
2218 Ga0500559_0538403
2219 Ga0500564_013817
2220 Ga0500568_0027470
2221 Ga0500568_0089089
2222 Ga0500588_0000369
2223 Ga0500588_0018445
2224 Ga0500589_103534
2225 Ga0500604_0021592
2226 Ga0500616_0000299
2227 Ga0500622_0001304
2228 Ga0500622_0013308
2229 Ga0500627_0387286
2230 Ga0500633_0074965
2231 Ga0500637_0025672
2232 Ga0500611_055889
2233 Ga0500645_001366
2234 Ga0500661_015697
2235 Ga0590071_041949
2236 Ga0466962_0003000
2237 Ga0466962_0003956
2238 2578458447
2239 2595447041
2240 2595449803
2241 2643896715
2242 2644478920
2243 2721026295
2244 2735833728
2245 2739228716
2246 2739732216
2247 2816517019
2248 2819564183
2249 2842392996
2250 2842757816
2251 2842918073
2252 2842920102
2253 2874221601
2254 2884341717
2255 2884413645
2256 2895396578
2257 2904464820
2258 2919087531
2259 2919089734
2260 2919137674
2261 2919406337
2262 2928499438
2263 2928964901
2264 2931380776
2265 2939615228
2266 2939627350
2267 2941475353
2268 2953995392
2269 2961048368
2270 2961066309
2271 2987606405
2272 3007318969
2273 8002746429
2274 8054359990

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

29

142

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e6l-assembly1.cif.gz_A two-component signal transduction system d13a mutant of chey 0.9955 2 126
4hnq-assembly1.cif.gz_A crystal structure of the mutant q97a of vibrio cholerae chey3 0.9951 1 123
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9949 1 123
3to5-assembly1.cif.gz_A high resolution structure of chey3 from vibrio cholerae 0.9948 1 123
1d4z-assembly1.cif.gz_A crystal structure of chey-95iv, a hyperactive chey mutant 0.9935 1 127
ID Description Score Start End Superfamily
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9892 1 123 3.40.50.2300
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9735 1 123 3.40.50.2300
af_Q5A4X5_425_557_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9498 7 121 3.40.50.2300
af_A0A0R0KVT4_634_762_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.948 5 129 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9474 3 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A246HIK8-F1-model_v4 Response regulator 1.003 5 130 GO:0000160
AF-A0A2S6B2H8-F1-model_v4 Chemotaxis protein CheY 1.003 5 130 GO:0000160
AF-A0A1G4AJ01-F1-model_v4 deleted 1.003 5 130
AF-A0A3R8TY53-F1-model_v4 Response regulator 1.002 5 130 GO:0000160
AF-A0A6N7K3T3-F1-model_v4 deleted 1.001 5 130

Map