F490650
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1137 | 517 | 2274 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0502319|Ga0495686_0502319_130_588 |
| Length | 152 |
| Sequence | MRPMVLADDSRIPRWSAAGERTVSKEMKFLVVDDFSTMRRIIKNLLHDLGYANVTEADDGQTALPMLQAGAFDFLITDWNMPGMPGLDLLKAVRADARLKQMPVLMLTAESKREQIVEAAQAGVNGYVIKPFTAVTLKEKIDKILESRSAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 231 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 232 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 247 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 250 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 256 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 257 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 278 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 279 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 283 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 284 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 285 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 294 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 295 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 296 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 297 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 300 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 301 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 302 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 303 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 304 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 305 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 306 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 307 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 308 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 309 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 310 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 311 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 312 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 313 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 317 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 320 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 321 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 322 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 323 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 324 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 325 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 326 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 327 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 328 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 329 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 330 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 331 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 396 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 415 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 416 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 417 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 438 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 439 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 440 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 446 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 452 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 455 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 456 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 457 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 458 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 459 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 461 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 462 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 463 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 464 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 466 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 468 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 469 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 470 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 473 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 475 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 476 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 477 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 478 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 479 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 480 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 481 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 482 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 483 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 484 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 485 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 486 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 487 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 488 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 489 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 490 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 491 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 492 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 493 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 494 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 495 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 496 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 497 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 498 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 499 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 500 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 501 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 502 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 503 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 504 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 505 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 506 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 507 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 508 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 509 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 510 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 511 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 512 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 513 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 514 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 515 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 516 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 517 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.25 |
| Metatranscriptomes | 1.5 |
| Isolates | 3.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.15 |
| Nodule | 0.18 |
| Rhizoplane | 3.96 |
| Rhizosphere | 75.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0502319 | 3300047472 | Bacteria | 638 |
| 2 | SwRhRL2b_contig_1463020 | 2162886007 | Bacteria | 812 |
| 3 | SwRhRL2b_contig_209150 | 2162886007 | Bacteria | 1352 |
| 4 | JGI24736J21556_1037929 | 3300001904 | Bacteria | 742 |
| 5 | JGI24741J21665_1058143 | 3300001915 | Bacteria | 570 |
| 6 | JGI24740J21852_10035843 | 3300001979 | Bacteria | 1546 |
| 7 | JGI24739J22299_10000150 | 3300001989 | Bacteria | 22469 |
| 8 | JGI24737J22298_10023750 | 3300001990 | Bacteria | 1943 |
| 9 | JGI24735J21928_10000631 | 3300002067 | Bacteria | 12412 |
| 10 | JGI24735J21928_10017635 | 3300002067 | Bacteria | 2207 |
| 11 | JGI24738J21930_10001714 | 3300002075 | Bacteria | 5999 |
| 12 | JGI25162J39368_1000300 | 3300002737 | Bacteria | 45514 |
| 13 | JGI25162J39368_1000946 | 3300002737 | Bacteria | 18630 |
| 14 | JGI25162J39368_1012103 | 3300002737 | Bacteria | 1006 |
| 15 | JGI25157J39369_1001759 | 3300002741 | Bacteria | 7101 |
| 16 | JGI25164J39214_1000252 | 3300002772 | Bacteria | 40244 |
| 17 | JGI25406J46586_10003849 | 3300003203 | Bacteria | 7016 |
| 18 | JGI25165J46597_1000223 | 3300003214 | Bacteria | 79270 |
| 19 | JGI25165J46597_1030433 | 3300003214 | Bacteria | 696 |
| 20 | JGI25153J46596_10026551 | 3300003215 | Bacteria | 2047 |
| 21 | JGI25153J46596_10105839 | 3300003215 | Bacteria | 653 |
| 22 | rootH1_10089905 | 3300003316 | Bacteria | 2193 |
| 23 | rootH1_10112669 | 3300003316 | Bacteria | 3090 |
| 24 | rootH2_10014066 | 3300003320 | Bacteria | 23331 |
| 25 | rootH1_10182598 | 3300003323 | Bacteria | 1171 |
| 26 | Ga0006556J51387_1035474 | 3300003479 | Bacteria | 2165 |
| 27 | Ga0006554J51385_1028847 | 3300003567 | Bacteria | 1512 |
| 28 | Ga0006562J51391_1003360 | 3300003578 | Bacteria | 5610 |
| 29 | Ga0006562J51391_1003840 | 3300003578 | Bacteria | 26103 |
| 30 | Ga0055533_1000607 | 3300003756 | Bacteria | 12076 |
| 31 | Ga0055532_1026080 | 3300003758 | Bacteria | 572 |
| 32 | Ga0055535_1006302 | 3300003761 | Bacteria | 2428 |
| 33 | Ga0055542_1000340 | 3300003762 | Bacteria | 49481 |
| 34 | Ga0055542_1016246 | 3300003762 | Bacteria | 1177 |
| 35 | Ga0055526_1000736 | 3300003771 | Bacteria | 24682 |
| 36 | Ga0055537_1000425 | 3300003773 | Bacteria | 27504 |
| 37 | Ga0055524_1017895 | 3300003775 | Bacteria | 2482 |
| 38 | Ga0055536_1006267 | 3300003781 | Bacteria | 5605 |
| 39 | Ga0055534_1000119 | 3300003784 | Bacteria | 58422 |
| 40 | Ga0055528_1000547 | 3300003790 | Bacteria | 28685 |
| 41 | Ga0058692_1000163 | 3300003856 | Bacteria | 41448 |
| 42 | Ga0058692_1027508 | 3300003856 | Bacteria | 1106 |
| 43 | Ga0055543_1020543 | 3300004625 | Bacteria | 1212 |
| 44 | Ga0065165_1000260 | 3300005262 | Bacteria | 90953 |
| 45 | Ga0065165_1003583 | 3300005262 | Bacteria | 10704 |
| 46 | Ga0065714_10089252 | 3300005288 | Bacteria | 1964 |
| 47 | Ga0065704_10030471 | 3300005289 | Bacteria | 795 |
| 48 | Ga0065704_10072583 | 3300005289 | Bacteria | 8293 |
| 49 | Ga0065704_10237498 | 3300005289 | Bacteria | 1025 |
| 50 | Ga0065704_10415312 | 3300005289 | Bacteria | 737 |
| 51 | Ga0065707_10082517 | 3300005295 | Bacteria | 14244 |
| 52 | Ga0065707_10083290 | 3300005295 | Bacteria | 9631 |
| 53 | Ga0065707_10093119 | 3300005295 | Bacteria | 3672 |
| 54 | Ga0070658_10003217 | 3300005327 | Bacteria | 13484 |
| 55 | Ga0070658_10638534 | 3300005327 | Bacteria | 923 |
| 56 | Ga0070670_100099429 | 3300005331 | Bacteria | 2503 |
| 57 | Ga0070670_100165225 | 3300005331 | Bacteria | 1919 |
| 58 | Ga0070670_100229688 | 3300005331 | Bacteria | 1615 |
| 59 | Ga0070670_100435538 | 3300005331 | Bacteria | 1160 |
| 60 | Ga0070670_101757663 | 3300005331 | Bacteria | 571 |
| 61 | Ga0068869_100374508 | 3300005334 | Bacteria | 1166 |
| 62 | Ga0068869_100510835 | 3300005334 | Bacteria | 1004 |
| 63 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 64 | Ga0070666_10007912 | 3300005335 | Bacteria | 6569 |
| 65 | Ga0070680_100189313 | 3300005336 | Bacteria | 1733 |
| 66 | Ga0070682_100013761 | 3300005337 | Bacteria | 4664 |
| 67 | Ga0070682_100057071 | 3300005337 | Bacteria | 2458 |
| 68 | Ga0070682_101397978 | 3300005337 | Bacteria | 598 |
| 69 | Ga0068868_100915436 | 3300005338 | Bacteria | 798 |
| 70 | Ga0070660_100257689 | 3300005339 | Bacteria | 1424 |
| 71 | Ga0070660_100489691 | 3300005339 | Bacteria | 1022 |
| 72 | Ga0070660_100494335 | 3300005339 | Bacteria | 1017 |
| 73 | Ga0070660_101318929 | 3300005339 | Bacteria | 613 |
| 74 | Ga0070689_100006873 | 3300005340 | Bacteria | 7915 |
| 75 | Ga0070687_100380990 | 3300005343 | Bacteria | 919 |
| 76 | Ga0070661_100004461 | 3300005344 | Bacteria | 9651 |
| 77 | Ga0070661_100006700 | 3300005344 | Bacteria | 7946 |
| 78 | Ga0070661_100062054 | 3300005344 | Bacteria | 2744 |
| 79 | Ga0070661_100200287 | 3300005344 | Bacteria | 1525 |
| 80 | Ga0070661_100333074 | 3300005344 | Bacteria | 1187 |
| 81 | Ga0070692_10021855 | 3300005345 | Bacteria | 3117 |
| 82 | Ga0070692_10699869 | 3300005345 | Bacteria | 682 |
| 83 | Ga0070668_100378822 | 3300005347 | Bacteria | 1204 |
| 84 | Ga0070668_100501776 | 3300005347 | Bacteria | 1050 |
| 85 | Ga0070669_100169271 | 3300005353 | Bacteria | 1702 |
| 86 | Ga0070669_101148718 | 3300005353 | Bacteria | 670 |
| 87 | Ga0070675_100070972 | 3300005354 | Bacteria | 2888 |
| 88 | Ga0070674_100028233 | 3300005356 | Bacteria | 3684 |
| 89 | Ga0070674_100065862 | 3300005356 | Bacteria | 2544 |
| 90 | Ga0070674_100244034 | 3300005356 | Bacteria | 1408 |
| 91 | Ga0070673_100048820 | 3300005364 | Bacteria | 3301 |
| 92 | Ga0070673_100059450 | 3300005364 | Bacteria | 3026 |
| 93 | Ga0070673_100077300 | 3300005364 | Bacteria | 2689 |
| 94 | Ga0070688_100849866 | 3300005365 | Bacteria | 717 |
| 95 | Ga0070659_100106170 | 3300005366 | Bacteria | 2264 |
| 96 | Ga0070659_100217918 | 3300005366 | Bacteria | 1574 |
| 97 | Ga0070659_101231326 | 3300005366 | Bacteria | 662 |
| 98 | Ga0070667_100000057 | 3300005367 | Bacteria | 150501 |
| 99 | Ga0070667_100075773 | 3300005367 | Bacteria | 2872 |
| 100 | Ga0070667_100194136 | 3300005367 | Bacteria | 1799 |
| 101 | Ga0070667_101289781 | 3300005367 | Bacteria | 684 |
| 102 | Ga0070667_101804314 | 3300005367 | Bacteria | 576 |
| 103 | Ga0070709_10702030 | 3300005434 | Bacteria | 787 |
| 104 | Ga0070714_100000146 | 3300005435 | Bacteria | 56392 |
| 105 | Ga0070714_100006932 | 3300005435 | Bacteria | 8786 |
| 106 | Ga0070714_100288063 | 3300005435 | Bacteria | 1528 |
| 107 | Ga0070713_100001113 | 3300005436 | Bacteria | 17144 |
| 108 | Ga0070700_100023296 | 3300005441 | Bacteria | 3619 |
| 109 | Ga0070700_100143433 | 3300005441 | Bacteria | 1626 |
| 110 | Ga0070663_100038378 | 3300005455 | Bacteria | 3341 |
| 111 | Ga0070663_100163342 | 3300005455 | Bacteria | 1716 |
| 112 | Ga0070663_100625898 | 3300005455 | Bacteria | 908 |
| 113 | Ga0070663_100874932 | 3300005455 | Bacteria | 775 |
| 114 | Ga0070678_100064896 | 3300005456 | Bacteria | 2708 |
| 115 | Ga0070678_100226253 | 3300005456 | Bacteria | 1557 |
| 116 | Ga0070678_100847843 | 3300005456 | Bacteria | 832 |
| 117 | Ga0070662_100178306 | 3300005457 | Bacteria | 1673 |
| 118 | Ga0070681_10399486 | 3300005458 | Bacteria | 1286 |
| 119 | Ga0068867_101797533 | 3300005459 | Bacteria | 576 |
| 120 | Ga0068867_101909262 | 3300005459 | Bacteria | 560 |
| 121 | Ga0070685_10149985 | 3300005466 | Bacteria | 1477 |
| 122 | Ga0070685_10222577 | 3300005466 | Bacteria | 1237 |
| 123 | Ga0070685_10716982 | 3300005466 | Bacteria | 731 |
| 124 | Ga0070706_100704723 | 3300005467 | Bacteria | 936 |
| 125 | Ga0070679_100080953 | 3300005530 | Bacteria | 3237 |
| 126 | Ga0070679_100428919 | 3300005530 | Bacteria | 1267 |
| 127 | Ga0070679_101050805 | 3300005530 | Bacteria | 759 |
| 128 | Ga0068853_100238634 | 3300005539 | Bacteria | 1665 |
| 129 | Ga0070672_100136347 | 3300005543 | Bacteria | 2021 |
| 130 | Ga0070672_100457345 | 3300005543 | Bacteria | 1100 |
| 131 | Ga0070672_100560767 | 3300005543 | Bacteria | 992 |
| 132 | Ga0070686_100250432 | 3300005544 | Bacteria | 1293 |
| 133 | Ga0070696_100037091 | 3300005546 | Bacteria | 3362 |
| 134 | Ga0070693_100080572 | 3300005547 | Bacteria | 1940 |
| 135 | Ga0070693_100086721 | 3300005547 | Bacteria | 1878 |
| 136 | Ga0070693_100274424 | 3300005547 | Bacteria | 1127 |
| 137 | Ga0070665_100001412 | 3300005548 | Bacteria | 28208 |
| 138 | Ga0070665_100001746 | 3300005548 | Bacteria | 24877 |
| 139 | Ga0070665_100292367 | 3300005548 | Bacteria | 1631 |
| 140 | Ga0070665_100419655 | 3300005548 | Bacteria | 1347 |
| 141 | Ga0070665_100430295 | 3300005548 | Bacteria | 1329 |
| 142 | Ga0070665_101655100 | 3300005548 | Bacteria | 648 |
| 143 | Ga0068855_100001054 | 3300005563 | Bacteria | 34227 |
| 144 | Ga0068855_100376110 | 3300005563 | Bacteria | 1560 |
| 145 | Ga0070664_100229471 | 3300005564 | Bacteria | 1664 |
| 146 | Ga0070664_101076391 | 3300005564 | Bacteria | 757 |
| 147 | Ga0068857_100005138 | 3300005577 | Bacteria | 11127 |
| 148 | Ga0068857_100011506 | 3300005577 | Bacteria | 7697 |
| 149 | Ga0068857_100022774 | 3300005577 | Bacteria | 5512 |
| 150 | Ga0068857_100306723 | 3300005577 | Bacteria | 1464 |
| 151 | Ga0068857_101431976 | 3300005577 | Bacteria | 672 |
| 152 | Ga0068857_101837400 | 3300005577 | Bacteria | 593 |
| 153 | Ga0068854_100003997 | 3300005578 | Bacteria | 9255 |
| 154 | Ga0068854_100653134 | 3300005578 | Bacteria | 903 |
| 155 | Ga0068856_100028243 | 3300005614 | Bacteria | 5477 |
| 156 | Ga0068856_100053976 | 3300005614 | Bacteria | 3963 |
| 157 | Ga0068856_100126517 | 3300005614 | Bacteria | 2559 |
| 158 | Ga0068852_100013196 | 3300005616 | Bacteria | 6315 |
| 159 | Ga0068859_100205251 | 3300005617 | Bacteria | 2056 |
| 160 | Ga0068859_100284558 | 3300005617 | Bacteria | 1746 |
| 161 | Ga0068859_100412515 | 3300005617 | Bacteria | 1447 |
| 162 | Ga0068864_101227968 | 3300005618 | Bacteria | 749 |
| 163 | Ga0068861_100034657 | 3300005719 | Bacteria | 3734 |
| 164 | Ga0068861_100078674 | 3300005719 | Bacteria | 2576 |
| 165 | Ga0068861_100085506 | 3300005719 | Bacteria | 2477 |
| 166 | Ga0068851_10005923 | 3300005834 | Bacteria | 5564 |
| 167 | Ga0068858_100149055 | 3300005842 | Bacteria | 2198 |
| 168 | Ga0068858_100163681 | 3300005842 | Bacteria | 2095 |
| 169 | Ga0068858_101353970 | 3300005842 | Bacteria | 701 |
| 170 | Ga0068860_100176386 | 3300005843 | Bacteria | 2065 |
| 171 | Ga0068860_100230530 | 3300005843 | Bacteria | 1800 |
| 172 | Ga0068860_101181629 | 3300005843 | Bacteria | 785 |
| 173 | Ga0068862_100020082 | 3300005844 | Bacteria | 5578 |
| 174 | Ga0068862_100239329 | 3300005844 | Bacteria | 1650 |
| 175 | Ga0068862_100622213 | 3300005844 | Bacteria | 1039 |
| 176 | Ga0081455_10000010 | 3300005937 | Bacteria | 248212 |
| 177 | Ga0081540_1145781 | 3300005983 | Bacteria | 943 |
| 178 | Ga0081539_10000016 | 3300005985 | Bacteria | 381648 |
| 179 | Ga0075368_10023721 | 3300006042 | Bacteria | 2346 |
| 180 | Ga0075364_10213537 | 3300006051 | Bacteria | 1309 |
| 181 | Ga0075364_10490766 | 3300006051 | Bacteria | 840 |
| 182 | Ga0070715_10292571 | 3300006163 | Bacteria | 868 |
| 183 | Ga0070712_100392953 | 3300006175 | Bacteria | 1144 |
| 184 | Ga0075369_10047861 | 3300006186 | Bacteria | 1844 |
| 185 | Ga0075369_10084874 | 3300006186 | Bacteria | 1408 |
| 186 | Ga0075369_10596223 | 3300006186 | Bacteria | 529 |
| 187 | Ga0097621_100121949 | 3300006237 | Bacteria | 2211 |
| 188 | Ga0068871_100208812 | 3300006358 | Bacteria | 1688 |
| 189 | Ga0068871_100256382 | 3300006358 | Bacteria | 1525 |
| 190 | Ga0068871_100705072 | 3300006358 | Bacteria | 925 |
| 191 | Ga0075430_100069862 | 3300006846 | Bacteria | 2945 |
| 192 | Ga0075430_100938495 | 3300006846 | Bacteria | 713 |
| 193 | Ga0075431_100703332 | 3300006847 | Bacteria | 988 |
| 194 | Ga0068865_100071638 | 3300006881 | Bacteria | 2459 |
| 195 | Ga0068865_100674932 | 3300006881 | Bacteria | 880 |
| 196 | Ga0097620_100205242 | 3300006931 | Bacteria | 2056 |
| 197 | Ga0097620_100284579 | 3300006931 | Bacteria | 1746 |
| 198 | Ga0097620_100412514 | 3300006931 | Bacteria | 1447 |
| 199 | Ga0099826_10137357 | 3300006948 | Bacteria | 1417 |
| 200 | Ga0105251_10000221 | 3300009011 | Bacteria | 57628 |
| 201 | Ga0105244_10000631 | 3300009036 | Bacteria | 31164 |
| 202 | Ga0105244_10272752 | 3300009036 | Bacteria | 785 |
| 203 | Ga0105250_10000024 | 3300009092 | Bacteria | 218115 |
| 204 | Ga0105250_10000215 | 3300009092 | Bacteria | 47921 |
| 205 | Ga0105250_10095106 | 3300009092 | Bacteria | 1214 |
| 206 | Ga0105250_10532743 | 3300009092 | Bacteria | 537 |
| 207 | Ga0105240_10030430 | 3300009093 | Bacteria | 7016 |
| 208 | Ga0105240_10093277 | 3300009093 | Bacteria | 3675 |
| 209 | Ga0105240_10965196 | 3300009093 | Bacteria | 913 |
| 210 | Ga0111539_10042871 | 3300009094 | Bacteria | 5430 |
| 211 | Ga0111539_10539972 | 3300009094 | Bacteria | 1358 |
| 212 | Ga0111539_10996254 | 3300009094 | Bacteria | 974 |
| 213 | Ga0111539_11484368 | 3300009094 | Bacteria | 786 |
| 214 | Ga0105247_10003410 | 3300009101 | Bacteria | 10385 |
| 215 | Ga0105247_10020959 | 3300009101 | Bacteria | 3932 |
| 216 | Ga0105247_10253607 | 3300009101 | Bacteria | 1204 |
| 217 | Ga0105247_10666955 | 3300009101 | Bacteria | 779 |
| 218 | Ga0105243_10010344 | 3300009148 | Bacteria | 7085 |
| 219 | Ga0105243_10112312 | 3300009148 | Bacteria | 2283 |
| 220 | Ga0105243_10818900 | 3300009148 | Bacteria | 919 |
| 221 | Ga0105243_12209427 | 3300009148 | Bacteria | 587 |
| 222 | Ga0105241_10187185 | 3300009174 | Bacteria | 1721 |
| 223 | Ga0105241_10264895 | 3300009174 | Bacteria | 1462 |
| 224 | Ga0105241_11170702 | 3300009174 | Bacteria | 727 |
| 225 | Ga0105242_10036858 | 3300009176 | Bacteria | 3926 |
| 226 | Ga0105242_10114268 | 3300009176 | Bacteria | 2306 |
| 227 | Ga0105242_10141056 | 3300009176 | Bacteria | 2091 |
| 228 | Ga0105248_10003931 | 3300009177 | Bacteria | 16430 |
| 229 | Ga0105248_10107075 | 3300009177 | Bacteria | 3152 |
| 230 | Ga0105248_10465516 | 3300009177 | Bacteria | 1425 |
| 231 | Ga0105237_10000214 | 3300009545 | Bacteria | 82061 |
| 232 | Ga0105237_10175664 | 3300009545 | Bacteria | 2142 |
| 233 | Ga0105237_10373889 | 3300009545 | Bacteria | 1430 |
| 234 | Ga0105237_10857228 | 3300009545 | Bacteria | 915 |
| 235 | Ga0105238_10000156 | 3300009551 | Bacteria | 74551 |
| 236 | Ga0105238_10010620 | 3300009551 | Bacteria | 9247 |
| 237 | Ga0105238_10020830 | 3300009551 | Bacteria | 6679 |
| 238 | Ga0105238_10638038 | 3300009551 | Bacteria | 1075 |
| 239 | Ga0105238_11089715 | 3300009551 | Bacteria | 821 |
| 240 | Ga0105249_10107207 | 3300009553 | Bacteria | 2637 |
| 241 | Ga0105249_10679418 | 3300009553 | Bacteria | 1089 |
| 242 | Ga0105249_11892733 | 3300009553 | Bacteria | 669 |
| 243 | Ga0105239_10001178 | 3300010375 | Bacteria | 35871 |
| 244 | Ga0105239_10028091 | 3300010375 | Bacteria | 6190 |
| 245 | Ga0105239_10255733 | 3300010375 | Bacteria | 1968 |
| 246 | Ga0105239_10271937 | 3300010375 | Bacteria | 1906 |
| 247 | Ga0105239_10398557 | 3300010375 | Bacteria | 1557 |
| 248 | Ga0105239_11281428 | 3300010375 | Bacteria | 845 |
| 249 | Ga0105239_12535621 | 3300010375 | Bacteria | 598 |
| 250 | Ga0105246_10634710 | 3300011119 | Bacteria | 928 |
| 251 | Ga0157314_1000371 | 3300012500 | Bacteria | 4552 |
| 252 | Ga0157373_10001512 | 3300013100 | Bacteria | 17716 |
| 253 | Ga0157373_10026725 | 3300013100 | Bacteria | 4166 |
| 254 | Ga0157373_10058834 | 3300013100 | Bacteria | 2723 |
| 255 | Ga0157373_10549224 | 3300013100 | Bacteria | 838 |
| 256 | Ga0157371_10001716 | 3300013102 | Bacteria | 22279 |
| 257 | Ga0157371_10008141 | 3300013102 | Bacteria | 8378 |
| 258 | Ga0157371_10032903 | 3300013102 | Bacteria | 3729 |
| 259 | Ga0157371_10953400 | 3300013102 | Bacteria | 653 |
| 260 | Ga0157370_10005803 | 3300013104 | Bacteria | 13799 |
| 261 | Ga0157370_10006411 | 3300013104 | Bacteria | 12978 |
| 262 | Ga0157370_10032072 | 3300013104 | Bacteria | 5133 |
| 263 | Ga0157370_10049486 | 3300013104 | Bacteria | 4022 |
| 264 | Ga0157370_10064902 | 3300013104 | Bacteria | 3455 |
| 265 | Ga0157370_10491485 | 3300013104 | Bacteria | 1127 |
| 266 | Ga0157370_10864262 | 3300013104 | Bacteria | 822 |
| 267 | Ga0157369_10000171 | 3300013105 | Bacteria | 91555 |
| 268 | Ga0157369_10066964 | 3300013105 | Bacteria | 3863 |
| 269 | Ga0157369_10080787 | 3300013105 | Bacteria | 3480 |
| 270 | Ga0157369_10120876 | 3300013105 | Bacteria | 2779 |
| 271 | Ga0157378_10163836 | 3300013297 | Bacteria | 2081 |
| 272 | Ga0157378_11824012 | 3300013297 | Bacteria | 656 |
| 273 | Ga0163162_10000802 | 3300013306 | Bacteria | 29244 |
| 274 | Ga0163162_10110954 | 3300013306 | Bacteria | 2840 |
| 275 | Ga0163162_10113764 | 3300013306 | Bacteria | 2805 |
| 276 | Ga0163162_11215712 | 3300013306 | Bacteria | 855 |
| 277 | Ga0157372_10011602 | 3300013307 | Bacteria | 9379 |
| 278 | Ga0157372_10043795 | 3300013307 | Bacteria | 4958 |
| 279 | Ga0157375_10017161 | 3300013308 | Bacteria | 6527 |
| 280 | Ga0157375_10219459 | 3300013308 | Bacteria | 2060 |
| 281 | Ga0157375_10232891 | 3300013308 | Bacteria | 2001 |
| 282 | Ga0157375_12926111 | 3300013308 | Bacteria | 570 |
| 283 | Ga0163163_10009793 | 3300014325 | Bacteria | 8586 |
| 284 | Ga0163163_10029623 | 3300014325 | Bacteria | 5268 |
| 285 | Ga0163163_10072238 | 3300014325 | Bacteria | 3440 |
| 286 | Ga0163163_10134972 | 3300014325 | Bacteria | 2509 |
| 287 | Ga0157380_10000876 | 3300014326 | Bacteria | 18902 |
| 288 | Ga0157380_10022918 | 3300014326 | Bacteria | 4708 |
| 289 | Ga0157380_10324149 | 3300014326 | Bacteria | 1429 |
| 290 | Ga0157380_10559501 | 3300014326 | Bacteria | 1123 |
| 291 | Ga0157380_11495009 | 3300014326 | Bacteria | 728 |
| 292 | Ga0182008_10006102 | 3300014497 | Bacteria | 6774 |
| 293 | Ga0182008_10014917 | 3300014497 | Bacteria | 4064 |
| 294 | Ga0182008_10020730 | 3300014497 | Bacteria | 3381 |
| 295 | Ga0182008_10026590 | 3300014497 | Bacteria | 2934 |
| 296 | Ga0182008_10071606 | 3300014497 | Bacteria | 1705 |
| 297 | Ga0157377_10338196 | 3300014745 | Bacteria | 1006 |
| 298 | Ga0157379_10000013 | 3300014968 | Bacteria | 108546 |
| 299 | Ga0157379_10026667 | 3300014968 | Bacteria | 5144 |
| 300 | Ga0157379_10073175 | 3300014968 | Bacteria | 3067 |
| 301 | Ga0157379_10321666 | 3300014968 | Bacteria | 1412 |
| 302 | Ga0157376_10097335 | 3300014969 | Bacteria | 2563 |
| 303 | Ga0157376_10161097 | 3300014969 | Bacteria | 2034 |
| 304 | Ga0157376_10306356 | 3300014969 | Bacteria | 1505 |
| 305 | Ga0157376_10671576 | 3300014969 | Bacteria | 1039 |
| 306 | Ga0182006_1000148 | 3300015261 | Bacteria | 74813 |
| 307 | Ga0182006_1000208 | 3300015261 | Bacteria | 58504 |
| 308 | Ga0182006_1029363 | 3300015261 | Bacteria | 2228 |
| 309 | Ga0182006_1029600 | 3300015261 | Bacteria | 2217 |
| 310 | Ga0182006_1057426 | 3300015261 | Bacteria | 1480 |
| 311 | Ga0182006_1077523 | 3300015261 | Bacteria | 1219 |
| 312 | Ga0182006_1251148 | 3300015261 | Bacteria | 581 |
| 313 | Ga0182007_10000139 | 3300015262 | Bacteria | 49865 |
| 314 | Ga0182007_10013777 | 3300015262 | Bacteria | 3072 |
| 315 | Ga0182007_10022629 | 3300015262 | Bacteria | 2217 |
| 316 | Ga0182007_10107541 | 3300015262 | Bacteria | 926 |
| 317 | Ga0182005_1000110 | 3300015265 | Bacteria | 58820 |
| 318 | Ga0182005_1000121 | 3300015265 | Bacteria | 56978 |
| 319 | Ga0182005_1002288 | 3300015265 | Bacteria | 7002 |
| 320 | Ga0182005_1002799 | 3300015265 | Bacteria | 6083 |
| 321 | Ga0182005_1007803 | 3300015265 | Bacteria | 3186 |
| 322 | Ga0182005_1028029 | 3300015265 | Bacteria | 1536 |
| 323 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 324 | Ga0163161_10001733 | 3300017792 | Bacteria | 15977 |
| 325 | Ga0163161_10225623 | 3300017792 | Bacteria | 1452 |
| 326 | Ga0163161_10239475 | 3300017792 | Bacteria | 1411 |
| 327 | Ga0163161_11015005 | 3300017792 | Bacteria | 709 |
| 328 | Ga0206353_11114430 | 3300020082 | Bacteria | 931 |
| 329 | Ga0206353_11437260 | 3300020082 | Bacteria | 2343 |
| 330 | Ga0209674_100061 | 3300025226 | Bacteria | 280844 |
| 331 | Ga0209674_102951 | 3300025226 | Bacteria | 3337 |
| 332 | Ga0209672_101058 | 3300025228 | Bacteria | 11781 |
| 333 | Ga0209147_116127 | 3300025229 | Bacteria | 734 |
| 334 | Ga0207427_100169 | 3300025231 | Bacteria | 72582 |
| 335 | Ga0207427_103201 | 3300025231 | Bacteria | 3607 |
| 336 | Ga0209437_100076 | 3300025233 | Bacteria | 295194 |
| 337 | Ga0209437_100244 | 3300025233 | Bacteria | 88556 |
| 338 | Ga0209437_100723 | 3300025233 | Bacteria | 16832 |
| 339 | Ga0209258_101900 | 3300025242 | Bacteria | 6213 |
| 340 | Ga0209258_106393 | 3300025242 | Bacteria | 1853 |
| 341 | Ga0207425_1029061 | 3300025245 | Bacteria | 1117 |
| 342 | Ga0209026_1000148 | 3300025250 | Bacteria | 111280 |
| 343 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 344 | Ga0209148_1002312 | 3300025254 | Bacteria | 6816 |
| 345 | Ga0209759_1019783 | 3300025256 | Bacteria | 1585 |
| 346 | Ga0209129_1001105 | 3300025258 | Bacteria | 15718 |
| 347 | Ga0209129_1007410 | 3300025258 | Bacteria | 3276 |
| 348 | Ga0209233_1000246 | 3300025261 | Bacteria | 88556 |
| 349 | Ga0209233_1006488 | 3300025261 | Bacteria | 3764 |
| 350 | Ga0209233_1024072 | 3300025261 | Bacteria | 1529 |
| 351 | Ga0209565_1000063 | 3300025263 | Bacteria | 183711 |
| 352 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 353 | Ga0209130_1011604 | 3300025284 | Bacteria | 2351 |
| 354 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 355 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 356 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 357 | Ga0209564_1000190 | 3300025295 | Bacteria | 142675 |
| 358 | Ga0209758_1000814 | 3300025297 | Bacteria | 43940 |
| 359 | Ga0209758_1008736 | 3300025297 | Bacteria | 6471 |
| 360 | Ga0209050_1000239 | 3300025298 | Bacteria | 119530 |
| 361 | Ga0209050_1000351 | 3300025298 | Bacteria | 88847 |
| 362 | Ga0209050_1009828 | 3300025298 | Bacteria | 4818 |
| 363 | Ga0209256_1015294 | 3300025299 | Bacteria | 2693 |
| 364 | Ga0209256_1016682 | 3300025299 | Bacteria | 2486 |
| 365 | Ga0209051_1004518 | 3300025303 | Bacteria | 8536 |
| 366 | Ga0209051_1031335 | 3300025303 | Bacteria | 2048 |
| 367 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 368 | Ga0209257_1031598 | 3300025304 | Bacteria | 1691 |
| 369 | Ga0207697_10035285 | 3300025315 | Bacteria | 2047 |
| 370 | Ga0207656_10002369 | 3300025321 | Bacteria | 6329 |
| 371 | Ga0207696_1000175 | 3300025711 | Bacteria | 102142 |
| 372 | Ga0207655_1000825 | 3300025728 | Bacteria | 33516 |
| 373 | Ga0207655_1075839 | 3300025728 | Bacteria | 1232 |
| 374 | Ga0207713_1000207 | 3300025735 | Bacteria | 79895 |
| 375 | Ga0207713_1054666 | 3300025735 | Bacteria | 1563 |
| 376 | Ga0207682_10271285 | 3300025893 | Bacteria | 792 |
| 377 | Ga0207642_10068281 | 3300025899 | Bacteria | 1681 |
| 378 | Ga0207710_10051039 | 3300025900 | Bacteria | 1857 |
| 379 | Ga0207710_10053258 | 3300025900 | Bacteria | 1821 |
| 380 | Ga0207710_10095540 | 3300025900 | Bacteria | 1396 |
| 381 | Ga0207710_10715443 | 3300025900 | Bacteria | 525 |
| 382 | Ga0207688_10392621 | 3300025901 | Bacteria | 860 |
| 383 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 384 | Ga0207680_10003460 | 3300025903 | Bacteria | 7443 |
| 385 | Ga0207647_10000008 | 3300025904 | Bacteria | 192602 |
| 386 | Ga0207647_10044316 | 3300025904 | Bacteria | 2780 |
| 387 | Ga0207647_10046875 | 3300025904 | Bacteria | 2691 |
| 388 | Ga0207647_10089817 | 3300025904 | Bacteria | 1833 |
| 389 | Ga0207645_10057374 | 3300025907 | Bacteria | 2486 |
| 390 | Ga0207643_10012846 | 3300025908 | Bacteria | 4528 |
| 391 | Ga0207705_10006425 | 3300025909 | Bacteria | 8707 |
| 392 | Ga0207705_10014972 | 3300025909 | Bacteria | 5575 |
| 393 | Ga0207705_10152410 | 3300025909 | Bacteria | 1733 |
| 394 | Ga0207705_10800636 | 3300025909 | Bacteria | 731 |
| 395 | Ga0207684_10652573 | 3300025910 | Bacteria | 896 |
| 396 | Ga0207654_10163013 | 3300025911 | Bacteria | 1442 |
| 397 | Ga0207654_10280440 | 3300025911 | Bacteria | 1127 |
| 398 | Ga0207695_10000649 | 3300025913 | Bacteria | 69041 |
| 399 | Ga0207695_10001088 | 3300025913 | Bacteria | 47382 |
| 400 | Ga0207695_10023313 | 3300025913 | Bacteria | 6998 |
| 401 | Ga0207695_10209007 | 3300025913 | Bacteria | 1863 |
| 402 | Ga0207695_11281751 | 3300025913 | Bacteria | 613 |
| 403 | Ga0207671_10000057 | 3300025914 | Bacteria | 183729 |
| 404 | Ga0207671_10267106 | 3300025914 | Bacteria | 1347 |
| 405 | Ga0207671_10617782 | 3300025914 | Bacteria | 864 |
| 406 | Ga0207693_10372193 | 3300025915 | Bacteria | 1117 |
| 407 | Ga0207693_10416300 | 3300025915 | Bacteria | 1050 |
| 408 | Ga0207660_10052332 | 3300025917 | Bacteria | 2907 |
| 409 | Ga0207657_10148460 | 3300025919 | Bacteria | 1911 |
| 410 | Ga0207649_10058303 | 3300025920 | Bacteria | 2417 |
| 411 | Ga0207649_10060771 | 3300025920 | Bacteria | 2376 |
| 412 | Ga0207649_10120319 | 3300025920 | Bacteria | 1769 |
| 413 | Ga0207649_10236695 | 3300025920 | Bacteria | 1309 |
| 414 | Ga0207652_10059872 | 3300025921 | Bacteria | 3284 |
| 415 | Ga0207681_10468819 | 3300025923 | Bacteria | 1027 |
| 416 | Ga0207694_10004515 | 3300025924 | Bacteria | 10861 |
| 417 | Ga0207694_10022206 | 3300025924 | Bacteria | 4812 |
| 418 | Ga0207694_10059595 | 3300025924 | Bacteria | 2969 |
| 419 | Ga0207694_10075025 | 3300025924 | Bacteria | 2647 |
| 420 | Ga0207694_10199276 | 3300025924 | Bacteria | 1628 |
| 421 | Ga0207694_10884626 | 3300025924 | Bacteria | 755 |
| 422 | Ga0207694_11573659 | 3300025924 | Bacteria | 554 |
| 423 | Ga0207650_10534435 | 3300025925 | Bacteria | 982 |
| 424 | Ga0207650_11361878 | 3300025925 | Bacteria | 604 |
| 425 | Ga0207700_10014272 | 3300025928 | Bacteria | 5199 |
| 426 | Ga0207664_10000055 | 3300025929 | Bacteria | 126338 |
| 427 | Ga0207664_10004122 | 3300025929 | Bacteria | 9808 |
| 428 | Ga0207664_10069386 | 3300025929 | Bacteria | 2834 |
| 429 | Ga0207644_10261561 | 3300025931 | Bacteria | 1384 |
| 430 | Ga0207690_10001361 | 3300025932 | Bacteria | 15345 |
| 431 | Ga0207690_10001362 | 3300025932 | Bacteria | 15342 |
| 432 | Ga0207690_10003572 | 3300025932 | Bacteria | 9258 |
| 433 | Ga0207690_10068701 | 3300025932 | Bacteria | 2435 |
| 434 | Ga0207690_10839607 | 3300025932 | Bacteria | 760 |
| 435 | Ga0207706_10014408 | 3300025933 | Bacteria | 7166 |
| 436 | Ga0207706_10103926 | 3300025933 | Bacteria | 2499 |
| 437 | Ga0207686_10232595 | 3300025934 | Bacteria | 1337 |
| 438 | Ga0207686_10550055 | 3300025934 | Bacteria | 902 |
| 439 | Ga0207709_10004255 | 3300025935 | Bacteria | 8295 |
| 440 | Ga0207709_10229869 | 3300025935 | Bacteria | 1343 |
| 441 | Ga0207709_10282532 | 3300025935 | Bacteria | 1226 |
| 442 | Ga0207670_10014029 | 3300025936 | Bacteria | 4744 |
| 443 | Ga0207669_10068407 | 3300025937 | Bacteria | 2218 |
| 444 | Ga0207669_10356045 | 3300025937 | Bacteria | 1132 |
| 445 | Ga0207704_10915225 | 3300025938 | Bacteria | 738 |
| 446 | Ga0207704_11553706 | 3300025938 | Bacteria | 568 |
| 447 | Ga0207691_10011441 | 3300025940 | Bacteria | 8515 |
| 448 | Ga0207691_10024666 | 3300025940 | Bacteria | 5656 |
| 449 | Ga0207691_10928658 | 3300025940 | Bacteria | 728 |
| 450 | Ga0207711_10570753 | 3300025941 | Bacteria | 1055 |
| 451 | Ga0207689_10020699 | 3300025942 | Bacteria | 5530 |
| 452 | Ga0207689_10399551 | 3300025942 | Bacteria | 1145 |
| 453 | Ga0207689_10794431 | 3300025942 | Bacteria | 799 |
| 454 | Ga0207679_10905917 | 3300025945 | Bacteria | 807 |
| 455 | Ga0207667_10000139 | 3300025949 | Bacteria | 109949 |
| 456 | Ga0207667_10000648 | 3300025949 | Bacteria | 45080 |
| 457 | Ga0207667_10001898 | 3300025949 | Bacteria | 26237 |
| 458 | Ga0207667_10016414 | 3300025949 | Bacteria | 8371 |
| 459 | Ga0207667_10164369 | 3300025949 | Bacteria | 2282 |
| 460 | Ga0207651_10015251 | 3300025960 | Bacteria | 4461 |
| 461 | Ga0207651_10093158 | 3300025960 | Bacteria | 2211 |
| 462 | Ga0207712_10073126 | 3300025961 | Bacteria | 2471 |
| 463 | Ga0207668_10172312 | 3300025972 | Bacteria | 1698 |
| 464 | Ga0207668_11072008 | 3300025972 | Bacteria | 722 |
| 465 | Ga0207640_10000951 | 3300025981 | Bacteria | 16139 |
| 466 | Ga0207658_10000200 | 3300025986 | Bacteria | 62618 |
| 467 | Ga0207658_10550884 | 3300025986 | Bacteria | 1032 |
| 468 | Ga0207658_12006093 | 3300025986 | Bacteria | 526 |
| 469 | Ga0207677_10590266 | 3300026023 | Bacteria | 974 |
| 470 | Ga0207677_11975924 | 3300026023 | Bacteria | 542 |
| 471 | Ga0207703_10146213 | 3300026035 | Bacteria | 2056 |
| 472 | Ga0207703_10201486 | 3300026035 | Bacteria | 1769 |
| 473 | Ga0207703_10864739 | 3300026035 | Bacteria | 865 |
| 474 | Ga0207639_10007199 | 3300026041 | Bacteria | 7580 |
| 475 | Ga0207678_10072431 | 3300026067 | Bacteria | 2952 |
| 476 | Ga0207678_10072715 | 3300026067 | Bacteria | 2946 |
| 477 | Ga0207678_10155063 | 3300026067 | Bacteria | 1955 |
| 478 | Ga0207678_10191115 | 3300026067 | Bacteria | 1749 |
| 479 | Ga0207678_10307148 | 3300026067 | Bacteria | 1364 |
| 480 | Ga0207708_10085178 | 3300026075 | Bacteria | 2431 |
| 481 | Ga0207708_10327873 | 3300026075 | Bacteria | 1251 |
| 482 | Ga0207708_10346001 | 3300026075 | Bacteria | 1219 |
| 483 | Ga0207702_10039255 | 3300026078 | Bacteria | 3966 |
| 484 | Ga0207702_11324195 | 3300026078 | Bacteria | 714 |
| 485 | Ga0207641_10302219 | 3300026088 | Bacteria | 1512 |
| 486 | Ga0207648_10439400 | 3300026089 | Bacteria | 1187 |
| 487 | Ga0207676_10447539 | 3300026095 | Bacteria | 1217 |
| 488 | Ga0207674_10010056 | 3300026116 | Bacteria | 10762 |
| 489 | Ga0207674_10032391 | 3300026116 | Bacteria | 5484 |
| 490 | Ga0207674_10044436 | 3300026116 | Bacteria | 4575 |
| 491 | Ga0207674_10249235 | 3300026116 | Bacteria | 1723 |
| 492 | Ga0207674_10375570 | 3300026116 | Bacteria | 1374 |
| 493 | Ga0207674_11242900 | 3300026116 | Bacteria | 714 |
| 494 | Ga0207675_100015832 | 3300026118 | Bacteria | 7032 |
| 495 | Ga0207675_100048721 | 3300026118 | Bacteria | 3954 |
| 496 | Ga0207675_100113706 | 3300026118 | Bacteria | 2556 |
| 497 | Ga0207675_100118476 | 3300026118 | Bacteria | 2504 |
| 498 | Ga0207683_10074989 | 3300026121 | Bacteria | 2994 |
| 499 | Ga0207683_10179063 | 3300026121 | Bacteria | 1922 |
| 500 | Ga0207683_10263700 | 3300026121 | Bacteria | 1573 |
| 501 | Ga0207683_10750134 | 3300026121 | Bacteria | 906 |
| 502 | Ga0207698_10002739 | 3300026142 | Bacteria | 10506 |
| 503 | Ga0209371_1000023 | 3300027312 | Bacteria | 519553 |
| 504 | Ga0209371_1003982 | 3300027312 | Bacteria | 6740 |
| 505 | Ga0209813_10080637 | 3300027866 | Bacteria | 1075 |
| 506 | Ga0268266_10000059 | 3300028379 | Bacteria | 269485 |
| 507 | Ga0268266_10016021 | 3300028379 | Bacteria | 6410 |
| 508 | Ga0268266_10258051 | 3300028379 | Bacteria | 1614 |
| 509 | Ga0268266_10948346 | 3300028379 | Bacteria | 832 |
| 510 | Ga0268265_10064342 | 3300028380 | Bacteria | 2825 |
| 511 | Ga0268265_10202749 | 3300028380 | Bacteria | 1722 |
| 512 | Ga0268265_10557300 | 3300028380 | Bacteria | 1089 |
| 513 | Ga0268264_10024459 | 3300028381 | Bacteria | 4931 |
| 514 | Ga0268264_10228683 | 3300028381 | Bacteria | 1716 |
| 515 | Ga0307517_10313025 | 3300028786 | Bacteria | 873 |
| 516 | Ga0307515_10101086 | 3300028794 | Bacteria | 3484 |
| 517 | Ga0307515_10145245 | 3300028794 | Bacteria | 2517 |
| 518 | Ga0268256_1000023 | 3300030500 | Bacteria | 519631 |
| 519 | Ga0268256_1001500 | 3300030500 | Bacteria | 13823 |
| 520 | Ga0307511_10389700 | 3300030521 | Bacteria | 578 |
| 521 | Ga0316181_1273336 | 3300030744 | Bacteria | 882 |
| 522 | Ga0265770_1060794 | 3300030878 | Bacteria | 702 |
| 523 | Ga0265328_10010604 | 3300031239 | Bacteria | 3703 |
| 524 | Ga0265331_10009248 | 3300031250 | Bacteria | 5550 |
| 525 | Ga0265331_10043929 | 3300031250 | Bacteria | 2162 |
| 526 | Ga0265327_10000257 | 3300031251 | Bacteria | 105278 |
| 527 | Ga0307513_10007691 | 3300031456 | Bacteria | 13924 |
| 528 | Ga0307513_10131291 | 3300031456 | Bacteria | 2450 |
| 529 | Ga0307513_10371663 | 3300031456 | Bacteria | 1172 |
| 530 | Ga0307509_10000106 | 3300031507 | Bacteria | 118906 |
| 531 | Ga0307509_10010878 | 3300031507 | Bacteria | 11094 |
| 532 | Ga0307509_10451185 | 3300031507 | Bacteria | 980 |
| 533 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 534 | Ga0307408_100033048 | 3300031548 | Bacteria | 3611 |
| 535 | Ga0307408_100311254 | 3300031548 | Bacteria | 1323 |
| 536 | Ga0307408_101885635 | 3300031548 | Bacteria | 573 |
| 537 | Ga0265313_10145766 | 3300031595 | Bacteria | 1015 |
| 538 | Ga0307508_10233110 | 3300031616 | Bacteria | 1439 |
| 539 | Ga0307508_10521896 | 3300031616 | Bacteria | 784 |
| 540 | Ga0307514_10176037 | 3300031649 | Bacteria | 1388 |
| 541 | Ga0316575_10099611 | 3300031665 | Bacteria | 1181 |
| 542 | Ga0316579_10063558 | 3300031691 | Bacteria | 1740 |
| 543 | Ga0307516_10610677 | 3300031730 | Bacteria | 745 |
| 544 | Ga0307405_10090701 | 3300031731 | Bacteria | 2023 |
| 545 | Ga0307405_10468084 | 3300031731 | Bacteria | 1003 |
| 546 | Ga0307405_11941457 | 3300031731 | Bacteria | 526 |
| 547 | Ga0307413_10017181 | 3300031824 | Bacteria | 3762 |
| 548 | Ga0307413_11120513 | 3300031824 | Bacteria | 681 |
| 549 | Ga0307410_10071575 | 3300031852 | Bacteria | 2405 |
| 550 | Ga0307410_10115992 | 3300031852 | Bacteria | 1945 |
| 551 | Ga0307406_10191426 | 3300031901 | Bacteria | 1498 |
| 552 | Ga0307407_10056224 | 3300031903 | Bacteria | 2277 |
| 553 | Ga0307407_11178683 | 3300031903 | Bacteria | 598 |
| 554 | Ga0307407_11624508 | 3300031903 | Bacteria | 513 |
| 555 | Ga0307412_10003310 | 3300031911 | Bacteria | 8948 |
| 556 | Ga0307412_10400796 | 3300031911 | Bacteria | 1117 |
| 557 | Ga0307412_10571972 | 3300031911 | Bacteria | 952 |
| 558 | Ga0307412_11019546 | 3300031911 | Bacteria | 732 |
| 559 | Ga0307409_100018842 | 3300031995 | Bacteria | 4655 |
| 560 | Ga0307409_100081177 | 3300031995 | Bacteria | 2620 |
| 561 | Ga0307409_100504114 | 3300031995 | Bacteria | 1179 |
| 562 | Ga0307409_100587372 | 3300031995 | Bacteria | 1099 |
| 563 | Ga0307409_101047951 | 3300031995 | Bacteria | 835 |
| 564 | Ga0307409_101566904 | 3300031995 | Bacteria | 687 |
| 565 | Ga0307416_100131604 | 3300032002 | Bacteria | 2253 |
| 566 | Ga0307416_100763542 | 3300032002 | Bacteria | 1060 |
| 567 | Ga0307416_102842708 | 3300032002 | Bacteria | 579 |
| 568 | Ga0307414_10005696 | 3300032004 | Bacteria | 6879 |
| 569 | Ga0307414_10041817 | 3300032004 | Bacteria | 3108 |
| 570 | Ga0307414_10094886 | 3300032004 | Bacteria | 2228 |
| 571 | Ga0307414_10166931 | 3300032004 | Bacteria | 1755 |
| 572 | Ga0307414_10463670 | 3300032004 | Bacteria | 1114 |
| 573 | Ga0307414_11560905 | 3300032004 | Bacteria | 615 |
| 574 | Ga0307414_11795147 | 3300032004 | Bacteria | 572 |
| 575 | Ga0307411_10036622 | 3300032005 | Bacteria | 3076 |
| 576 | Ga0307411_10150063 | 3300032005 | Bacteria | 1731 |
| 577 | Ga0307411_10418724 | 3300032005 | Bacteria | 1112 |
| 578 | Ga0307411_10542613 | 3300032005 | Bacteria | 991 |
| 579 | Ga0307411_10652885 | 3300032005 | Bacteria | 911 |
| 580 | Ga0307411_10973050 | 3300032005 | Bacteria | 758 |
| 581 | Ga0307415_100059636 | 3300032126 | Bacteria | 2633 |
| 582 | Ga0307415_100111161 | 3300032126 | Bacteria | 2033 |
| 583 | Ga0307415_100164657 | 3300032126 | Bacteria | 1723 |
| 584 | Ga0307415_100415207 | 3300032126 | Bacteria | 1153 |
| 585 | Ga0316583_10037326 | 3300032133 | Bacteria | 1722 |
| 586 | Ga0316583_10044155 | 3300032133 | Bacteria | 1575 |
| 587 | Ga0316593_10000070 | 3300032168 | Bacteria | 12367 |
| 588 | Ga0316593_10002365 | 3300032168 | Bacteria | 4441 |
| 589 | Ga0316593_10009417 | 3300032168 | Bacteria | 2757 |
| 590 | Ga0307510_10007161 | 3300033180 | Bacteria | 13283 |
| 591 | Ga0316592_1000393 | 3300033524 | Bacteria | 5857 |
| 592 | Ga0316592_1000847 | 3300033524 | Bacteria | 4605 |
| 593 | Ga0316587_1003506 | 3300033529 | Bacteria | 2206 |
| 594 | Ga0316596_1000074 | 3300033541 | Bacteria | 11676 |
| 595 | Ga0316596_1001295 | 3300033541 | Bacteria | 4973 |
| 596 | Ga0316596_1174280 | 3300033541 | Bacteria | 594 |
| 597 | Ga0373934_0342372 | 3300035086 | Bacteria | 622 |
| 598 | Ga0373932_0141077 | 3300035112 | Bacteria | 820 |
| 599 | Ga0373956_0022091 | 3300035119 | Bacteria | 2720 |
| 600 | Ga0373955_0079998 | 3300035172 | Bacteria | 1845 |
| 601 | Ga0316574_0035103 | 3300035398 | Bacteria | 3063 |
| 602 | Ga0316574_0127406 | 3300035398 | Bacteria | 1637 |
| 603 | Ga0373935_0403821 | 3300035692 | Bacteria | 982 |
| 604 | Ga0373947_0366317 | 3300035725 | Bacteria | 969 |
| 605 | Ga0373947_0584623 | 3300035725 | Bacteria | 761 |
| 606 | Ga0373947_0988674 | 3300035725 | Bacteria | 574 |
| 607 | Ga0373937_0188162 | 3300036401 | Bacteria | 1939 |
| 608 | Ga0316582_0007638 | 3300036647 | Bacteria | 5768 |
| 609 | Ga0316582_0135851 | 3300036647 | Bacteria | 1655 |
| 610 | Ga0316584_0017052 | 3300036712 | Bacteria | 5214 |
| 611 | Ga0316584_0997739 | 3300036712 | Bacteria | 559 |
| 612 | Ga0373925_1001531 | 3300037068 | Bacteria | 688 |
| 613 | Ga0395899_0172179 | 3300037312 | Bacteria | 1524 |
| 614 | Ga0395900_0217336 | 3300037418 | Bacteria | 1928 |
| 615 | Ga0395898_0302993 | 3300037466 | Bacteria | 1524 |
| 616 | Ga0395901_0005497 | 3300038443 | Bacteria | 12837 |
| 617 | Ga0400484_01091 | 3300038725 | Bacteria | 3285 |
| 618 | Ga0400483_140319 | 3300039062 | Bacteria | 1870 |
| 619 | Ga0400483_146212 | 3300039062 | Bacteria | 1830 |
| 620 | Ga0400487_28495 | 3300039110 | Bacteria | 2144 |
| 621 | Ga0436365_0324201 | 3300039437 | Bacteria | 854 |
| 622 | Ga0436365_1379258 | 3300039437 | Bacteria | 504 |
| 623 | Ga0436363_0555558 | 3300039450 | Bacteria | 848 |
| 624 | Ga0436363_1533653 | 3300039450 | Bacteria | 605 |
| 625 | Ga0439436_0000024 | 3300041404 | Bacteria | 58416 |
| 626 | Ga0439436_0221812 | 3300041404 | Bacteria | 544 |
| 627 | Ga0439466_0024073 | 3300041411 | Bacteria | 2138 |
| 628 | Ga0439465_0000125 | 3300041413 | Bacteria | 18402 |
| 629 | Ga0451789_1145622 | 3300041443 | Bacteria | 1111 |
| 630 | Ga0451791_0097535 | 3300041451 | Bacteria | 1026 |
| 631 | Ga0451791_1537909 | 3300041451 | Bacteria | 844 |
| 632 | Ga0451793_1150667 | 3300041452 | Bacteria | 1119 |
| 633 | Ga0451797_0522831 | 3300041453 | Bacteria | 1558 |
| 634 | Ga0451795_0608584 | 3300041456 | Bacteria | 606 |
| 635 | Ga0451798_0819397 | 3300041458 | Bacteria | 704 |
| 636 | Ga0451802_0850503 | 3300041460 | Bacteria | 825 |
| 637 | Ga0451802_1200763 | 3300041460 | Bacteria | 986 |
| 638 | Ga0451802_1482254 | 3300041460 | Bacteria | 1171 |
| 639 | Ga0451807_1090267 | 3300041486 | Bacteria | 792 |
| 640 | Ga0451807_2221809 | 3300041486 | Bacteria | 728 |
| 641 | Ga0451807_2383651 | 3300041486 | Bacteria | 522 |
| 642 | Ga0451837_0347394 | 3300041494 | Bacteria | 864 |
| 643 | Ga0451851_0854358 | 3300041507 | Bacteria | 2576 |
| 644 | Ga0451853_0986352 | 3300041512 | Bacteria | 1249 |
| 645 | Ga0439431_0008618 | 3300041997 | Bacteria | 2295 |
| 646 | Ga0439431_0124884 | 3300041997 | Bacteria | 720 |
| 647 | Ga0439431_0233699 | 3300041997 | Bacteria | 542 |
| 648 | Ga0439437_000245 | 3300042000 | Bacteria | 4910 |
| 649 | Ga0439437_001234 | 3300042000 | Bacteria | 2688 |
| 650 | Ga0439448_0100034 | 3300042005 | Bacteria | 985 |
| 651 | Ga0439432_021074 | 3300042006 | Bacteria | 2163 |
| 652 | Ga0439456_003323 | 3300042013 | Bacteria | 3253 |
| 653 | Ga0439457_082259 | 3300042014 | Bacteria | 741 |
| 654 | Ga0450911_000001 | 3300042115 | Bacteria | 311012 |
| 655 | Ga0450896_009245 | 3300042133 | Bacteria | 1372 |
| 656 | Ga0450902_022221 | 3300042137 | Bacteria | 1050 |
| 657 | Ga0450903_008093 | 3300042138 | Bacteria | 1723 |
| 658 | Ga0450904_000136 | 3300042139 | Bacteria | 16261 |
| 659 | Ga0450906_075328 | 3300042145 | Bacteria | 606 |
| 660 | Ga0450908_000557 | 3300042184 | Bacteria | 7151 |
| 661 | Ga0439459_0000450 | 3300042438 | Bacteria | 5308 |
| 662 | Ga0439459_0001047 | 3300042438 | Bacteria | 3953 |
| 663 | Ga0439459_0095687 | 3300042438 | Bacteria | 720 |
| 664 | Ga0439459_0204338 | 3300042438 | Bacteria | 541 |
| 665 | Ga0439464_0000157 | 3300042439 | Bacteria | 11190 |
| 666 | Ga0450916_007609 | 3300042530 | Bacteria | 1304 |
| 667 | Ga0450916_048603 | 3300042530 | Bacteria | 663 |
| 668 | Ga0450918_020026 | 3300042531 | Bacteria | 1169 |
| 669 | Ga0450893_0112423 | 3300042532 | Bacteria | 563 |
| 670 | Ga0466969_0069722 | 3300044656 | Bacteria | 1692 |
| 671 | Ga0466969_0137916 | 3300044656 | Bacteria | 1128 |
| 672 | Ga0466972_0075646 | 3300044658 | Bacteria | 1604 |
| 673 | Ga0466972_0302669 | 3300044658 | Bacteria | 747 |
| 674 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 675 | Ga0466982_0018787 | 3300044672 | Bacteria | 3886 |
| 676 | Ga0466965_0021760 | 3300044683 | Bacteria | 3089 |
| 677 | Ga0466965_0059107 | 3300044683 | Bacteria | 1912 |
| 678 | Ga0466965_0229681 | 3300044683 | Bacteria | 991 |
| 679 | Ga0466966_0015601 | 3300044684 | Bacteria | 5021 |
| 680 | Ga0466961_0017052 | 3300044693 | Bacteria | 4664 |
| 681 | Ga0466963_1154762 | 3300044694 | Bacteria | 544 |
| 682 | Ga0466964_0274237 | 3300044706 | Bacteria | 840 |
| 683 | Ga0453684_0001527 | 3300044712 | Bacteria | 64730 |
| 684 | Ga0466971_0003924 | 3300044719 | Bacteria | 6382 |
| 685 | Ga0466971_0007950 | 3300044719 | Bacteria | 4620 |
| 686 | Ga0466968_0005794 | 3300044735 | Bacteria | 4635 |
| 687 | Ga0466968_0012057 | 3300044735 | Bacteria | 3376 |
| 688 | Ga0466968_0211606 | 3300044735 | Bacteria | 911 |
| 689 | Ga0466970_0217254 | 3300044765 | Bacteria | 1066 |
| 690 | Ga0466970_0308359 | 3300044765 | Bacteria | 893 |
| 691 | Ga0466957_0023283 | 3300044842 | Bacteria | 3660 |
| 692 | Ga0466957_0079445 | 3300044842 | Bacteria | 2041 |
| 693 | Ga0466957_0088762 | 3300044842 | Bacteria | 1935 |
| 694 | Ga0466957_0096733 | 3300044842 | Bacteria | 1856 |
| 695 | Ga0466957_0270625 | 3300044842 | Bacteria | 1134 |
| 696 | Ga0466960_0057111 | 3300044901 | Bacteria | 1902 |
| 697 | Ga0466960_0090653 | 3300044901 | Bacteria | 1557 |
| 698 | Ga0466959_0030203 | 3300045049 | Bacteria | 4013 |
| 699 | Ga0451576_0000753 | 3300045051 | Bacteria | 64620 |
| 700 | Ga0451576_0039099 | 3300045051 | Bacteria | 5021 |
| 701 | Ga0466958_0022524 | 3300045836 | Bacteria | 3691 |
| 702 | Ga0495617_000352 | 3300046452 | Bacteria | 25311 |
| 703 | Ga0495617_000483 | 3300046452 | Bacteria | 21197 |
| 704 | Ga0495627_000013 | 3300046453 | Bacteria | 332765 |
| 705 | Ga0495627_016640 | 3300046453 | Bacteria | 2514 |
| 706 | Ga0495603_0311808 | 3300046455 | Bacteria | 904 |
| 707 | Ga0495590_0010025 | 3300046457 | Bacteria | 3579 |
| 708 | Ga0495590_0071180 | 3300046457 | Bacteria | 1220 |
| 709 | Ga0495590_0368384 | 3300046457 | Bacteria | 548 |
| 710 | Ga0495590_0397933 | 3300046457 | Bacteria | 528 |
| 711 | Ga0495591_000020 | 3300046458 | Bacteria | 217845 |
| 712 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 713 | Ga0495638_0000394 | 3300046460 | Bacteria | 53857 |
| 714 | Ga0495638_0000426 | 3300046460 | Bacteria | 50926 |
| 715 | Ga0495638_0001081 | 3300046460 | Bacteria | 26550 |
| 716 | Ga0495638_0002385 | 3300046460 | Bacteria | 15389 |
| 717 | Ga0495638_0015694 | 3300046460 | Bacteria | 5080 |
| 718 | Ga0495638_0020527 | 3300046460 | Bacteria | 4363 |
| 719 | Ga0495638_0026879 | 3300046460 | Bacteria | 3728 |
| 720 | Ga0495638_0195217 | 3300046460 | Bacteria | 1146 |
| 721 | Ga0495638_0304621 | 3300046460 | Bacteria | 857 |
| 722 | Ga0495653_0033709 | 3300046463 | Bacteria | 4054 |
| 723 | Ga0495650_0000206 | 3300046471 | Bacteria | 127713 |
| 724 | Ga0495650_0000221 | 3300046471 | Bacteria | 118284 |
| 725 | Ga0495650_0000369 | 3300046471 | Bacteria | 78529 |
| 726 | Ga0495650_0001354 | 3300046471 | Bacteria | 24380 |
| 727 | Ga0495650_0043787 | 3300046471 | Bacteria | 1896 |
| 728 | Ga0495650_0126449 | 3300046471 | Bacteria | 936 |
| 729 | Ga0495582_0095752 | 3300046473 | Bacteria | 1659 |
| 730 | Ga0495639_0158877 | 3300046475 | Bacteria | 1093 |
| 731 | Ga0495584_0009829 | 3300046491 | Bacteria | 4919 |
| 732 | Ga0495584_0050009 | 3300046491 | Bacteria | 2105 |
| 733 | Ga0495584_0215928 | 3300046491 | Bacteria | 975 |
| 734 | Ga0495585_0000210 | 3300046492 | Bacteria | 61025 |
| 735 | Ga0495585_0003200 | 3300046492 | Bacteria | 11174 |
| 736 | Ga0495585_0006659 | 3300046492 | Bacteria | 7139 |
| 737 | Ga0495585_0049563 | 3300046492 | Bacteria | 2331 |
| 738 | Ga0495594_0626777 | 3300046499 | Bacteria | 609 |
| 739 | Ga0495596_0062978 | 3300046500 | Bacteria | 1443 |
| 740 | Ga0495607_0000040 | 3300046501 | Bacteria | 133419 |
| 741 | Ga0495607_0000129 | 3300046501 | Bacteria | 80548 |
| 742 | Ga0495607_0012990 | 3300046501 | Bacteria | 5474 |
| 743 | Ga0495607_0020082 | 3300046501 | Bacteria | 4229 |
| 744 | Ga0495607_0030664 | 3300046501 | Bacteria | 3299 |
| 745 | Ga0495607_0046538 | 3300046501 | Bacteria | 2547 |
| 746 | Ga0495607_0163207 | 3300046501 | Bacteria | 1130 |
| 747 | Ga0495583_0008107 | 3300046506 | Bacteria | 6471 |
| 748 | Ga0495583_0012896 | 3300046506 | Bacteria | 4697 |
| 749 | Ga0495606_0000638 | 3300046507 | Bacteria | 55027 |
| 750 | Ga0495606_0000669 | 3300046507 | Bacteria | 53621 |
| 751 | Ga0495606_0001771 | 3300046507 | Bacteria | 27665 |
| 752 | Ga0495606_0002189 | 3300046507 | Bacteria | 23439 |
| 753 | Ga0495606_0003264 | 3300046507 | Bacteria | 17392 |
| 754 | Ga0495606_0005069 | 3300046507 | Bacteria | 12815 |
| 755 | Ga0495606_0008547 | 3300046507 | Bacteria | 8866 |
| 756 | Ga0495606_0044131 | 3300046507 | Bacteria | 2967 |
| 757 | Ga0495606_0053250 | 3300046507 | Bacteria | 2626 |
| 758 | Ga0495606_0165026 | 3300046507 | Bacteria | 1289 |
| 759 | Ga0495608_0587727 | 3300046511 | Bacteria | 669 |
| 760 | Ga0495610_0000984 | 3300046512 | Bacteria | 26291 |
| 761 | Ga0495610_0027797 | 3300046512 | Bacteria | 3000 |
| 762 | Ga0495610_0085981 | 3300046512 | Bacteria | 1433 |
| 763 | Ga0495616_0000045 | 3300046513 | Bacteria | 113226 |
| 764 | Ga0495616_0001404 | 3300046513 | Bacteria | 16762 |
| 765 | Ga0495616_0062638 | 3300046513 | Bacteria | 1820 |
| 766 | Ga0495616_0073803 | 3300046513 | Bacteria | 1645 |
| 767 | Ga0495616_0201451 | 3300046513 | Bacteria | 875 |
| 768 | Ga0495620_0001475 | 3300046515 | Bacteria | 14075 |
| 769 | Ga0495620_0007350 | 3300046515 | Bacteria | 5995 |
| 770 | Ga0495620_0072801 | 3300046515 | Bacteria | 1402 |
| 771 | Ga0495620_0118210 | 3300046515 | Bacteria | 1046 |
| 772 | Ga0495630_0175818 | 3300046517 | Bacteria | 1632 |
| 773 | Ga0495630_0364855 | 3300046517 | Bacteria | 1106 |
| 774 | Ga0495631_0001589 | 3300046518 | Bacteria | 13644 |
| 775 | Ga0495631_0003466 | 3300046518 | Bacteria | 8630 |
| 776 | Ga0495631_0049096 | 3300046518 | Bacteria | 1848 |
| 777 | Ga0495632_0000016 | 3300046519 | Bacteria | 232022 |
| 778 | Ga0495632_0006854 | 3300046519 | Bacteria | 7259 |
| 779 | Ga0495632_0006995 | 3300046519 | Bacteria | 7159 |
| 780 | Ga0495632_0013188 | 3300046519 | Bacteria | 4727 |
| 781 | Ga0495632_0070207 | 3300046519 | Bacteria | 1685 |
| 782 | Ga0495632_0101558 | 3300046519 | Bacteria | 1355 |
| 783 | Ga0495632_0173311 | 3300046519 | Bacteria | 990 |
| 784 | Ga0495632_0215510 | 3300046519 | Bacteria | 870 |
| 785 | Ga0495632_0238723 | 3300046519 | Bacteria | 818 |
| 786 | Ga0495637_0016287 | 3300046520 | Bacteria | 3476 |
| 787 | Ga0495637_0016816 | 3300046520 | Bacteria | 3416 |
| 788 | Ga0495637_0050570 | 3300046520 | Bacteria | 1743 |
| 789 | Ga0495643_0034666 | 3300046522 | Bacteria | 2784 |
| 790 | Ga0495643_0145978 | 3300046522 | Bacteria | 1175 |
| 791 | Ga0495644_0009353 | 3300046523 | Bacteria | 3779 |
| 792 | Ga0495644_0181142 | 3300046523 | Bacteria | 810 |
| 793 | Ga0495648_0002393 | 3300046524 | Bacteria | 17421 |
| 794 | Ga0495648_0013423 | 3300046524 | Bacteria | 6057 |
| 795 | Ga0495663_0013450 | 3300046525 | Bacteria | 2288 |
| 796 | Ga0495654_0010949 | 3300046530 | Bacteria | 4927 |
| 797 | Ga0495609_0012510 | 3300046538 | Bacteria | 4025 |
| 798 | Ga0495621_0083965 | 3300046539 | Bacteria | 1192 |
| 799 | Ga0495597_0000004 | 3300046542 | Bacteria | 307496 |
| 800 | Ga0495597_0136887 | 3300046542 | Bacteria | 1012 |
| 801 | Ga0495622_0015520 | 3300046557 | Bacteria | 3541 |
| 802 | Ga0495622_0072540 | 3300046557 | Bacteria | 1588 |
| 803 | Ga0495622_0225191 | 3300046557 | Bacteria | 830 |
| 804 | Ga0495633_0005767 | 3300046558 | Bacteria | 7483 |
| 805 | Ga0495656_0036930 | 3300046615 | Bacteria | 2015 |
| 806 | Ga0495668_0009889 | 3300046616 | Bacteria | 5817 |
| 807 | Ga0495668_0024612 | 3300046616 | Bacteria | 3424 |
| 808 | Ga0495668_0059389 | 3300046616 | Bacteria | 2110 |
| 809 | Ga0495668_0155175 | 3300046616 | Bacteria | 1254 |
| 810 | Ga0495668_0224496 | 3300046616 | Bacteria | 1029 |
| 811 | Ga0495668_0248720 | 3300046616 | Bacteria | 974 |
| 812 | Ga0495668_0334177 | 3300046616 | Bacteria | 831 |
| 813 | Ga0495634_0670122 | 3300046642 | Bacteria | 598 |
| 814 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 815 | Ga0495611_0000044 | 3300046648 | Bacteria | 92551 |
| 816 | Ga0495611_0000589 | 3300046648 | Bacteria | 20938 |
| 817 | Ga0495611_0141365 | 3300046648 | Bacteria | 1124 |
| 818 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 819 | Ga0495625_0000041 | 3300046660 | Bacteria | 206598 |
| 820 | Ga0495625_0006301 | 3300046660 | Bacteria | 10609 |
| 821 | Ga0495625_0015613 | 3300046660 | Bacteria | 6007 |
| 822 | Ga0495625_0028256 | 3300046660 | Bacteria | 4208 |
| 823 | Ga0495625_0114269 | 3300046660 | Bacteria | 1843 |
| 824 | Ga0495625_0140617 | 3300046660 | Bacteria | 1628 |
| 825 | Ga0495625_0150536 | 3300046660 | Bacteria | 1564 |
| 826 | Ga0495625_0302588 | 3300046660 | Bacteria | 1023 |
| 827 | Ga0495625_0534511 | 3300046660 | Bacteria | 712 |
| 828 | Ga0495625_0874772 | 3300046660 | Bacteria | 517 |
| 829 | Ga0495661_0000095 | 3300046665 | Bacteria | 109100 |
| 830 | Ga0495661_0028182 | 3300046665 | Bacteria | 3598 |
| 831 | Ga0495661_0601930 | 3300046665 | Bacteria | 517 |
| 832 | Ga0495588_0078646 | 3300046674 | Bacteria | 1721 |
| 833 | Ga0495658_0034892 | 3300046683 | Bacteria | 2763 |
| 834 | Ga0495670_0003718 | 3300046691 | Bacteria | 7502 |
| 835 | Ga0495670_0004556 | 3300046691 | Bacteria | 6800 |
| 836 | Ga0495671_0000404 | 3300046692 | Bacteria | 34984 |
| 837 | Ga0495671_0005231 | 3300046692 | Bacteria | 7625 |
| 838 | Ga0495671_0027170 | 3300046692 | Bacteria | 2957 |
| 839 | Ga0495671_0245247 | 3300046692 | Bacteria | 865 |
| 840 | Ga0495671_0408667 | 3300046692 | Bacteria | 650 |
| 841 | Ga0495649_0002065 | 3300046694 | Bacteria | 14446 |
| 842 | Ga0495649_0002986 | 3300046694 | Bacteria | 11622 |
| 843 | Ga0495649_0004121 | 3300046694 | Bacteria | 9549 |
| 844 | Ga0495649_0006003 | 3300046694 | Bacteria | 7606 |
| 845 | Ga0495649_0021488 | 3300046694 | Bacteria | 3614 |
| 846 | Ga0495649_0131725 | 3300046694 | Bacteria | 1319 |
| 847 | Ga0495649_0206760 | 3300046694 | Bacteria | 1018 |
| 848 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 849 | Ga0495589_0112583 | 3300046794 | Bacteria | 1313 |
| 850 | Ga0495660_0000369 | 3300046810 | Bacteria | 39465 |
| 851 | Ga0495660_0000385 | 3300046810 | Bacteria | 38483 |
| 852 | Ga0495660_0001556 | 3300046810 | Bacteria | 15425 |
| 853 | Ga0495660_0010559 | 3300046810 | Bacteria | 5371 |
| 854 | Ga0495660_0035663 | 3300046810 | Bacteria | 2778 |
| 855 | Ga0495581_0076682 | 3300047315 | Bacteria | 1934 |
| 856 | Ga0495636_0463357 | 3300047318 | Bacteria | 610 |
| 857 | Ga0495672_0017310 | 3300047320 | Bacteria | 4824 |
| 858 | Ga0495672_0018334 | 3300047320 | Bacteria | 4651 |
| 859 | Ga0495672_0023104 | 3300047320 | Bacteria | 4031 |
| 860 | Ga0495672_0234423 | 3300047320 | Bacteria | 899 |
| 861 | Ga0495672_0299162 | 3300047320 | Bacteria | 763 |
| 862 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 863 | Ga0495680_0248836 | 3300047322 | Unclassified | 1260 |
| 864 | Ga0495683_0000906 | 3300047323 | Bacteria | 20913 |
| 865 | Ga0495683_0028927 | 3300047323 | Bacteria | 2832 |
| 866 | Ga0495683_0453631 | 3300047323 | Bacteria | 526 |
| 867 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 868 | Ga0495679_000992 | 3300047446 | Bacteria | 17496 |
| 869 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 870 | Ga0495673_0000573 | 3300047469 | Bacteria | 37094 |
| 871 | Ga0495673_0000615 | 3300047469 | Bacteria | 35229 |
| 872 | Ga0495673_0020195 | 3300047469 | Bacteria | 3321 |
| 873 | Ga0495673_0024811 | 3300047469 | Bacteria | 2888 |
| 874 | Ga0495673_0033600 | 3300047469 | Bacteria | 2378 |
| 875 | Ga0495673_0146537 | 3300047469 | Bacteria | 916 |
| 876 | Ga0495673_0234567 | 3300047469 | Bacteria | 674 |
| 877 | Ga0495681_0006389 | 3300047470 | Bacteria | 7757 |
| 878 | Ga0495681_0028059 | 3300047470 | Bacteria | 2902 |
| 879 | Ga0495686_0000108 | 3300047472 | Bacteria | 173579 |
| 880 | Ga0495686_0001586 | 3300047472 | Bacteria | 24018 |
| 881 | Ga0495686_0021439 | 3300047472 | Bacteria | 4290 |
| 882 | Ga0495686_0077975 | 3300047472 | Bacteria | 2028 |
| 883 | Ga0495686_0103776 | 3300047472 | Bacteria | 1712 |
| 884 | Ga0495686_0126059 | 3300047472 | Bacteria | 1522 |
| 885 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 886 | Ga0495626_0074428 | 3300048091 | Bacteria | 1520 |
| 887 | Ga0496100_0004296 | 3300048903 | Bacteria | 7542 |
| 888 | Ga0496100_0176500 | 3300048903 | Bacteria | 1543 |
| 889 | Ga0496100_0248465 | 3300048903 | Bacteria | 1315 |
| 890 | Ga0496100_0912853 | 3300048903 | Bacteria | 690 |
| 891 | Ga0496101_0001179 | 3300048904 | Bacteria | 15667 |
| 892 | Ga0496101_0502088 | 3300048904 | Bacteria | 958 |
| 893 | Ga0496101_1060374 | 3300048904 | Bacteria | 637 |
| 894 | Ga0496102_0106044 | 3300048905 | Bacteria | 2615 |
| 895 | Ga0496102_0356362 | 3300048905 | Bacteria | 1377 |
| 896 | Ga0496102_0699010 | 3300048905 | Bacteria | 937 |
| 897 | Ga0496102_1196474 | 3300048905 | Bacteria | 679 |
| 898 | Ga0496103_0111558 | 3300048906 | Bacteria | 1738 |
| 899 | Ga0496104_0174824 | 3300048907 | Bacteria | 2058 |
| 900 | Ga0496104_0262591 | 3300048907 | Bacteria | 1639 |
| 901 | Ga0496104_0806595 | 3300048907 | Bacteria | 845 |
| 902 | Ga0496105_0001419 | 3300048908 | Bacteria | 16832 |
| 903 | Ga0496105_0376831 | 3300048908 | Bacteria | 1130 |
| 904 | Ga0496106_0000889 | 3300048909 | Bacteria | 21827 |
| 905 | Ga0496106_0250750 | 3300048909 | Bacteria | 1415 |
| 906 | Ga0496106_0327677 | 3300048909 | Bacteria | 1229 |
| 907 | Ga0496107_0103199 | 3300048910 | Bacteria | 2092 |
| 908 | Ga0496107_0379604 | 3300048910 | Bacteria | 1051 |
| 909 | Ga0496109_0290998 | 3300048912 | Bacteria | 1540 |
| 910 | Ga0496109_0563577 | 3300048912 | Bacteria | 1074 |
| 911 | Ga0496112_0084918 | 3300048915 | Bacteria | 3132 |
| 912 | Ga0496113_0003783 | 3300048916 | Bacteria | 9144 |
| 913 | Ga0496113_0297545 | 3300048916 | Bacteria | 1292 |
| 914 | Ga0496115_0000098 | 3300048918 | Bacteria | 82309 |
| 915 | Ga0496115_0001149 | 3300048918 | Bacteria | 19121 |
| 916 | Ga0496115_0013105 | 3300048918 | Bacteria | 6260 |
| 917 | Ga0496115_0086517 | 3300048918 | Bacteria | 2557 |
| 918 | Ga0496115_0178560 | 3300048918 | Bacteria | 1755 |
| 919 | Ga0496116_0010634 | 3300048919 | Bacteria | 7694 |
| 920 | Ga0496116_0126233 | 3300048919 | Bacteria | 1469 |
| 921 | Ga0496117_0019392 | 3300048920 | Bacteria | 5587 |
| 922 | Ga0496117_0019920 | 3300048920 | Bacteria | 5489 |
| 923 | Ga0496117_0038715 | 3300048920 | Bacteria | 3530 |
| 924 | Ga0496117_0079234 | 3300048920 | Bacteria | 2165 |
| 925 | Ga0496117_0143007 | 3300048920 | Bacteria | 1429 |
| 926 | Ga0496117_0158415 | 3300048920 | Bacteria | 1330 |
| 927 | Ga0496117_0197926 | 3300048920 | Bacteria | 1138 |
| 928 | Ga0496117_0208986 | 3300048920 | Bacteria | 1096 |
| 929 | Ga0496118_0000169 | 3300048921 | Bacteria | 118190 |
| 930 | Ga0496118_0002339 | 3300048921 | Bacteria | 25709 |
| 931 | Ga0496118_0002650 | 3300048921 | Bacteria | 23696 |
| 932 | Ga0496118_0004693 | 3300048921 | Bacteria | 16013 |
| 933 | Ga0496118_0020525 | 3300048921 | Bacteria | 5854 |
| 934 | Ga0496118_0071140 | 3300048921 | Bacteria | 2506 |
| 935 | Ga0496118_0071668 | 3300048921 | Bacteria | 2493 |
| 936 | Ga0496118_0095037 | 3300048921 | Bacteria | 2036 |
| 937 | Ga0496118_0147560 | 3300048921 | Bacteria | 1478 |
| 938 | Ga0496118_0195083 | 3300048921 | Bacteria | 1206 |
| 939 | Ga0496118_0475548 | 3300048921 | Bacteria | 628 |
| 940 | Ga0496119_0000255 | 3300048922 | Bacteria | 75611 |
| 941 | Ga0496119_0001013 | 3300048922 | Bacteria | 35964 |
| 942 | Ga0496119_0007613 | 3300048922 | Bacteria | 9714 |
| 943 | Ga0496119_0019265 | 3300048922 | Bacteria | 5036 |
| 944 | Ga0496120_0000240 | 3300048923 | Bacteria | 93297 |
| 945 | Ga0496120_0002806 | 3300048923 | Bacteria | 16859 |
| 946 | Ga0496120_0007069 | 3300048923 | Bacteria | 8428 |
| 947 | Ga0496121_0000148 | 3300048924 | Bacteria | 154021 |
| 948 | Ga0496121_0001780 | 3300048924 | Bacteria | 34943 |
| 949 | Ga0496121_0005219 | 3300048924 | Bacteria | 16834 |
| 950 | Ga0496121_0013002 | 3300048924 | Bacteria | 8995 |
| 951 | Ga0496121_0022948 | 3300048924 | Bacteria | 6029 |
| 952 | Ga0496121_0041348 | 3300048924 | Bacteria | 4029 |
| 953 | Ga0496121_0056789 | 3300048924 | Bacteria | 3249 |
| 954 | Ga0496121_0158112 | 3300048924 | Bacteria | 1660 |
| 955 | Ga0496121_0430212 | 3300048924 | Bacteria | 856 |
| 956 | Ga0496122_0004582 | 3300048925 | Bacteria | 17020 |
| 957 | Ga0496122_0054948 | 3300048925 | Bacteria | 2984 |
| 958 | Ga0496122_0148198 | 3300048925 | Bacteria | 1454 |
| 959 | Ga0496122_0197661 | 3300048925 | Bacteria | 1179 |
| 960 | Ga0496122_0215186 | 3300048925 | Bacteria | 1108 |
| 961 | Ga0496122_0284328 | 3300048925 | Bacteria | 902 |
| 962 | Ga0496123_0003097 | 3300048926 | Bacteria | 19096 |
| 963 | Ga0496123_0019930 | 3300048926 | Bacteria | 5264 |
| 964 | Ga0496123_0029007 | 3300048926 | Bacteria | 4084 |
| 965 | Ga0496123_0042254 | 3300048926 | Bacteria | 3148 |
| 966 | Ga0496123_0059448 | 3300048926 | Bacteria | 2471 |
| 967 | Ga0496123_0078148 | 3300048926 | Bacteria | 2028 |
| 968 | Ga0496123_0148149 | 3300048926 | Bacteria | 1271 |
| 969 | Ga0496124_0000560 | 3300048927 | Bacteria | 62943 |
| 970 | Ga0496124_0000764 | 3300048927 | Bacteria | 52565 |
| 971 | Ga0496124_0010308 | 3300048927 | Bacteria | 9484 |
| 972 | Ga0496124_0082173 | 3300048927 | Bacteria | 2645 |
| 973 | Ga0496124_0192751 | 3300048927 | Bacteria | 1557 |
| 974 | Ga0496124_0371612 | 3300048927 | Bacteria | 1003 |
| 975 | Ga0496125_0003248 | 3300048928 | Bacteria | 20029 |
| 976 | Ga0496125_0030500 | 3300048928 | Bacteria | 4823 |
| 977 | Ga0496125_0032324 | 3300048928 | Bacteria | 4649 |
| 978 | Ga0496125_0067005 | 3300048928 | Bacteria | 2832 |
| 979 | Ga0496125_0152060 | 3300048928 | Bacteria | 1588 |
| 980 | Ga0496126_0000708 | 3300048929 | Bacteria | 60934 |
| 981 | Ga0496126_0002787 | 3300048929 | Bacteria | 23008 |
| 982 | Ga0496126_0008157 | 3300048929 | Bacteria | 11333 |
| 983 | Ga0496126_0012861 | 3300048929 | Bacteria | 8553 |
| 984 | Ga0496126_0036296 | 3300048929 | Bacteria | 4609 |
| 985 | Ga0496126_0237935 | 3300048929 | Bacteria | 1523 |
| 986 | Ga0496126_0367155 | 3300048929 | Bacteria | 1174 |
| 987 | Ga0496126_0550198 | 3300048929 | Bacteria | 916 |
| 988 | Ga0496126_1055507 | 3300048929 | Bacteria | 606 |
| 989 | Ga0495678_000116 | 3300049459 | Bacteria | 95210 |
| 990 | Ga0495678_020813 | 3300049459 | Bacteria | 2898 |
| 991 | Ga0495678_031013 | 3300049459 | Bacteria | 2233 |
| 992 | Ga0495678_045143 | 3300049459 | Bacteria | 1739 |
| 993 | Ga0495682_0000072 | 3300049460 | Bacteria | 93119 |
| 994 | Ga0495682_0005082 | 3300049460 | Bacteria | 5519 |
| 995 | Ga0495682_0021724 | 3300049460 | Bacteria | 2403 |
| 996 | Ga0495682_0363398 | 3300049460 | Bacteria | 510 |
| 997 | Ga0501297_061832 | 3300049520 | Bacteria | 574 |
| 998 | Ga0501299_034239 | 3300049522 | Bacteria | 994 |
| 999 | Ga0501303_031018 | 3300049526 | Bacteria | 624 |
| 1000 | Ga0501314_007198 | 3300049530 | Bacteria | 984 |
| 1001 | Ga0501031_0103640 | 3300049568 | Bacteria | 1856 |
| 1002 | Ga0501031_0760434 | 3300049568 | Bacteria | 622 |
| 1003 | Ga0501032_0014242 | 3300049569 | Bacteria | 5632 |
| 1004 | Ga0501032_0082403 | 3300049569 | Bacteria | 2140 |
| 1005 | Ga0501033_0837480 | 3300049570 | Bacteria | 620 |
| 1006 | Ga0501034_0010312 | 3300049571 | Bacteria | 9741 |
| 1007 | Ga0501034_0046079 | 3300049571 | Bacteria | 4406 |
| 1008 | Ga0501034_1534877 | 3300049571 | Bacteria | 540 |
| 1009 | Ga0501036_0024717 | 3300049572 | Bacteria | 5065 |
| 1010 | Ga0501036_0648088 | 3300049572 | Bacteria | 874 |
| 1011 | Ga0501036_1062130 | 3300049572 | Bacteria | 662 |
| 1012 | Ga0501037_0013004 | 3300049573 | Bacteria | 6134 |
| 1013 | Ga0501038_0012339 | 3300049574 | Bacteria | 7807 |
| 1014 | Ga0501039_0047774 | 3300049575 | Bacteria | 3308 |
| 1015 | Ga0501039_0376931 | 3300049575 | Bacteria | 1115 |
| 1016 | Ga0501040_0000154 | 3300049576 | Bacteria | 38226 |
| 1017 | Ga0501042_0000015 | 3300049578 | Bacteria | 52455 |
| 1018 | Ga0501042_0209017 | 3300049578 | Bacteria | 1407 |
| 1019 | Ga0501042_0679838 | 3300049578 | Bacteria | 748 |
| 1020 | Ga0501043_0055715 | 3300049579 | Bacteria | 3106 |
| 1021 | Ga0501046_0025490 | 3300049580 | Bacteria | 4839 |
| 1022 | Ga0501046_0732090 | 3300049580 | Bacteria | 695 |
| 1023 | Ga0501047_0104175 | 3300049581 | Bacteria | 2717 |
| 1024 | Ga0501047_0113729 | 3300049581 | Bacteria | 2589 |
| 1025 | Ga0501047_0600830 | 3300049581 | Bacteria | 922 |
| 1026 | Ga0501048_0018493 | 3300049582 | Bacteria | 5122 |
| 1027 | Ga0501048_0285637 | 3300049582 | Bacteria | 1173 |
| 1028 | Ga0501068_0086317 | 3300049584 | Bacteria | 1932 |
| 1029 | Ga0501068_0843886 | 3300049584 | Bacteria | 602 |
| 1030 | Ga0501069_0378851 | 3300049585 | Bacteria | 836 |
| 1031 | Ga0501069_0517076 | 3300049585 | Bacteria | 713 |
| 1032 | Ga0501070_0188777 | 3300049586 | Bacteria | 1694 |
| 1033 | Ga0501070_0351862 | 3300049586 | Bacteria | 1195 |
| 1034 | Ga0501070_0774987 | 3300049586 | Bacteria | 754 |
| 1035 | Ga0501073_0122319 | 3300049589 | Bacteria | 1803 |
| 1036 | Ga0501073_0220470 | 3300049589 | Bacteria | 1310 |
| 1037 | Ga0501073_0312153 | 3300049589 | Bacteria | 1085 |
| 1038 | Ga0501074_0078530 | 3300049590 | Bacteria | 2369 |
| 1039 | Ga0501239_011449 | 3300049672 | Bacteria | 991 |
| 1040 | Ga0501243_104316 | 3300049675 | Bacteria | 575 |
| 1041 | Ga0501249_031256 | 3300049679 | Bacteria | 1187 |
| 1042 | Ga0501249_042546 | 3300049679 | Bacteria | 1033 |
| 1043 | Ga0501259_162896 | 3300049688 | Bacteria | 558 |
| 1044 | Ga0501080_0022768 | 3300049742 | Bacteria | 5804 |
| 1045 | Ga0501080_0066732 | 3300049742 | Bacteria | 3346 |
| 1046 | Ga0501080_0534120 | 3300049742 | Bacteria | 1046 |
| 1047 | Ga0501035_0049199 | 3300049822 | Bacteria | 3778 |
| 1048 | Ga0501044_0190321 | 3300049823 | Bacteria | 2015 |
| 1049 | Ga0501226_000014 | 3300049853 | Bacteria | 166091 |
| 1050 | Ga0501284_07946 | 3300050005 | Bacteria | 628 |
| 1051 | nmdc:mga05p37_305609_c1 | 3300050507 | Bacteria | 1888 |
| 1052 | nmdc:mga09592_57128_c1 | 3300050508 | Bacteria | 3298 |
| 1053 | nmdc:mga0qj67_118800_c1 | 3300050509 | Bacteria | 2138 |
| 1054 | nmdc:mga0qj67_19526_c1 | 3300050509 | Bacteria | 5178 |
| 1055 | nmdc:mga06r32_5777_c1 | 3300050510 | Bacteria | 11149 |
| 1056 | nmdc:mga08y16_1370944_c1 | 3300050511 | Bacteria | 671 |
| 1057 | nmdc:mga08y16_198611_c1 | 3300050511 | Bacteria | 2079 |
| 1058 | nmdc:mga08y16_65241_c1 | 3300050511 | Bacteria | 3801 |
| 1059 | nmdc:mga08y16_995464_c1 | 3300050511 | Bacteria | 818 |
| 1060 | nmdc:mga0sz30_11932_c1 | 3300050516 | Bacteria | 3369 |
| 1061 | Ga0500643_000103 | 3300053087 | Bacteria | 87887 |
| 1062 | Ga0500647_0072963 | 3300053091 | Bacteria | 1648 |
| 1063 | Ga0500583_0047702 | 3300053092 | Bacteria | 1974 |
| 1064 | Ga0500583_0062005 | 3300053092 | Bacteria | 1767 |
| 1065 | Ga0500583_0077694 | 3300053092 | Bacteria | 1599 |
| 1066 | Ga0500583_0151195 | 3300053092 | Bacteria | 1155 |
| 1067 | Ga0500651_0274044 | 3300053093 | Bacteria | 975 |
| 1068 | Ga0500651_0313339 | 3300053093 | Bacteria | 898 |
| 1069 | Ga0500651_0503661 | 3300053093 | Bacteria | 667 |
| 1070 | Ga0500650_0229959 | 3300053098 | Bacteria | 837 |
| 1071 | Ga0500555_000551 | 3300053103 | Bacteria | 14941 |
| 1072 | Ga0500556_0087502 | 3300053104 | Bacteria | 1186 |
| 1073 | Ga0500594_0017489 | 3300053118 | Bacteria | 1757 |
| 1074 | Ga0500595_146282 | 3300053119 | Bacteria | 661 |
| 1075 | Ga0500617_033366 | 3300053124 | Bacteria | 2305 |
| 1076 | Ga0500642_0144480 | 3300053130 | Bacteria | 1116 |
| 1077 | Ga0500642_0200660 | 3300053130 | Bacteria | 928 |
| 1078 | Ga0500652_070846 | 3300053131 | Bacteria | 1444 |
| 1079 | Ga0500658_0034153 | 3300053134 | Bacteria | 2005 |
| 1080 | Ga0500559_0326671 | 3300053136 | Bacteria | 719 |
| 1081 | Ga0500559_0538403 | 3300053136 | Bacteria | 534 |
| 1082 | Ga0500564_013817 | 3300053138 | Bacteria | 3621 |
| 1083 | Ga0500568_0027470 | 3300053139 | Bacteria | 2379 |
| 1084 | Ga0500568_0089089 | 3300053139 | Bacteria | 1165 |
| 1085 | Ga0500588_0000369 | 3300053146 | Bacteria | 6954 |
| 1086 | Ga0500588_0018445 | 3300053146 | Bacteria | 1838 |
| 1087 | Ga0500589_103534 | 3300053147 | Bacteria | 1233 |
| 1088 | Ga0500604_0021592 | 3300053151 | Bacteria | 1821 |
| 1089 | Ga0500616_0000299 | 3300053153 | Bacteria | 72074 |
| 1090 | Ga0500622_0001304 | 3300053156 | Bacteria | 20260 |
| 1091 | Ga0500622_0013308 | 3300053156 | Bacteria | 4438 |
| 1092 | Ga0500627_0387286 | 3300053158 | Bacteria | 598 |
| 1093 | Ga0500633_0074965 | 3300053160 | Bacteria | 1215 |
| 1094 | Ga0500637_0025672 | 3300053178 | Bacteria | 3240 |
| 1095 | Ga0500611_055889 | 3300053727 | Bacteria | 919 |
| 1096 | Ga0500645_001366 | 3300053730 | Bacteria | 12540 |
| 1097 | Ga0500661_015697 | 3300055283 | Bacteria | 1357 |
| 1098 | Ga0590071_041949 | 3300059421 | Bacteria | 1102 |
| 1099 | Ga0466962_0003000 | 3300061719 | Bacteria | 8045 |
| 1100 | Ga0466962_0003956 | 3300061719 | Bacteria | 7091 |
| 1101 | 2578458447 | 2576861471 | Bacteria | 4648976 |
| 1102 | 2595447041 | 2593339238 | Bacteria | 4182970 |
| 1103 | 2595449803 | 2593339239 | Bacteria | 4124669 |
| 1104 | 2643896715 | 2643221577 | Bacteria | 3710843 |
| 1105 | 2644478920 | 2643221685 | Bacteria | 3673288 |
| 1106 | 2721026295 | 2718218334 | Bacteria | 4765486 |
| 1107 | 2735833728 | 2734482264 | Unclassified | 5014763 |
| 1108 | 2739228716 | 2738543009 | Bacteria | 4944499 |
| 1109 | 2739732216 | 2739367700 | Bacteria | 4747630 |
| 1110 | 2816517019 | 2816332141 | Bacteria | 4436036 |
| 1111 | 2819564183 | 2818991440 | Bacteria | 4774720 |
| 1112 | 2842392996 | 2842391507 | Bacteria | 4486072 |
| 1113 | 2842757816 | 2842757796 | Bacteria | 3981385 |
| 1114 | 2842918073 | 2842914999 | Bacteria | 4419378 |
| 1115 | 2842920102 | 2842918807 | Bacteria | 4289178 |
| 1116 | 2874221601 | 2874220319 | Bacteria | 4594709 |
| 1117 | 2884341717 | 2884338543 | Bacteria | 4610696 |
| 1118 | 2884413645 | 2884411467 | Bacteria | 5246714 |
| 1119 | 2895396578 | 2895395659 | Bacteria | 3983269 |
| 1120 | 2904464820 | 2904463128 | Bacteria | 4775606 |
| 1121 | 2919087531 | 2919085039 | Bacteria | 4532964 |
| 1122 | 2919089734 | 2919089067 | Bacteria | 4560942 |
| 1123 | 2919137674 | 2919134579 | Bacteria | 4480386 |
| 1124 | 2919406337 | 2919404418 | Bacteria | 4232372 |
| 1125 | 2928499438 | 2928496128 | Bacteria | 4631123 |
| 1126 | 2928964901 | 2928963466 | Bacteria | 5165703 |
| 1127 | 2931380776 | 2931380184 | Bacteria | 4455911 |
| 1128 | 2939615228 | 2939611941 | Bacteria | 3892017 |
| 1129 | 2939627350 | 2939626828 | Bacteria | 4695272 |
| 1130 | 2941475353 | 2941471342 | Bacteria | 5018624 |
| 1131 | 2953995392 | 2953994433 | Bacteria | 4303959 |
| 1132 | 2961048368 | 2961047084 | Bacteria | 4594415 |
| 1133 | 2961066309 | 2961064222 | Bacteria | 4749990 |
| 1134 | 2987606405 | 2987605356 | Bacteria | 4187822 |
| 1135 | 3007318969 | 3007315729 | Bacteria | 5076637 |
| 1136 | 8002746429 | 8002745576 | Bacteria | 4840272 |
| 1137 | 8054359990 | 8054357960 | Bacteria | 2867777 |
| 1138 | Ga0495686_0502319 | |||
| 1139 | SwRhRL2b_contig_1463020 | |||
| 1140 | SwRhRL2b_contig_209150 | |||
| 1141 | JGI24736J21556_1037929 | |||
| 1142 | JGI24741J21665_1058143 | |||
| 1143 | JGI24740J21852_10035843 | |||
| 1144 | JGI24739J22299_10000150 | |||
| 1145 | JGI24737J22298_10023750 | |||
| 1146 | JGI24735J21928_10000631 | |||
| 1147 | JGI24735J21928_10017635 | |||
| 1148 | JGI24738J21930_10001714 | |||
| 1149 | JGI25162J39368_1000300 | |||
| 1150 | JGI25162J39368_1000946 | |||
| 1151 | JGI25162J39368_1012103 | |||
| 1152 | JGI25157J39369_1001759 | |||
| 1153 | JGI25164J39214_1000252 | |||
| 1154 | JGI25406J46586_10003849 | |||
| 1155 | JGI25165J46597_1000223 | |||
| 1156 | JGI25165J46597_1030433 | |||
| 1157 | JGI25153J46596_10026551 | |||
| 1158 | JGI25153J46596_10105839 | |||
| 1159 | rootH1_10089905 | |||
| 1160 | rootH1_10112669 | |||
| 1161 | rootH2_10014066 | |||
| 1162 | rootH1_10182598 | |||
| 1163 | Ga0006556J51387_1035474 | |||
| 1164 | Ga0006554J51385_1028847 | |||
| 1165 | Ga0006562J51391_1003360 | |||
| 1166 | Ga0006562J51391_1003840 | |||
| 1167 | Ga0055533_1000607 | |||
| 1168 | Ga0055532_1026080 | |||
| 1169 | Ga0055535_1006302 | |||
| 1170 | Ga0055542_1000340 | |||
| 1171 | Ga0055542_1016246 | |||
| 1172 | Ga0055526_1000736 | |||
| 1173 | Ga0055537_1000425 | |||
| 1174 | Ga0055524_1017895 | |||
| 1175 | Ga0055536_1006267 | |||
| 1176 | Ga0055534_1000119 | |||
| 1177 | Ga0055528_1000547 | |||
| 1178 | Ga0058692_1000163 | |||
| 1179 | Ga0058692_1027508 | |||
| 1180 | Ga0055543_1020543 | |||
| 1181 | Ga0065165_1000260 | |||
| 1182 | Ga0065165_1003583 | |||
| 1183 | Ga0065714_10089252 | |||
| 1184 | Ga0065704_10030471 | |||
| 1185 | Ga0065704_10072583 | |||
| 1186 | Ga0065704_10237498 | |||
| 1187 | Ga0065704_10415312 | |||
| 1188 | Ga0065707_10082517 | |||
| 1189 | Ga0065707_10083290 | |||
| 1190 | Ga0065707_10093119 | |||
| 1191 | Ga0070658_10003217 | |||
| 1192 | Ga0070658_10638534 | |||
| 1193 | Ga0070670_100099429 | |||
| 1194 | Ga0070670_100165225 | |||
| 1195 | Ga0070670_100229688 | |||
| 1196 | Ga0070670_100435538 | |||
| 1197 | Ga0070670_101757663 | |||
| 1198 | Ga0068869_100374508 | |||
| 1199 | Ga0068869_100510835 | |||
| 1200 | Ga0070666_10000013 | |||
| 1201 | Ga0070666_10007912 | |||
| 1202 | Ga0070680_100189313 | |||
| 1203 | Ga0070682_100013761 | |||
| 1204 | Ga0070682_100057071 | |||
| 1205 | Ga0070682_101397978 | |||
| 1206 | Ga0068868_100915436 | |||
| 1207 | Ga0070660_100257689 | |||
| 1208 | Ga0070660_100489691 | |||
| 1209 | Ga0070660_100494335 | |||
| 1210 | Ga0070660_101318929 | |||
| 1211 | Ga0070689_100006873 | |||
| 1212 | Ga0070687_100380990 | |||
| 1213 | Ga0070661_100004461 | |||
| 1214 | Ga0070661_100006700 | |||
| 1215 | Ga0070661_100062054 | |||
| 1216 | Ga0070661_100200287 | |||
| 1217 | Ga0070661_100333074 | |||
| 1218 | Ga0070692_10021855 | |||
| 1219 | Ga0070692_10699869 | |||
| 1220 | Ga0070668_100378822 | |||
| 1221 | Ga0070668_100501776 | |||
| 1222 | Ga0070669_100169271 | |||
| 1223 | Ga0070669_101148718 | |||
| 1224 | Ga0070675_100070972 | |||
| 1225 | Ga0070674_100028233 | |||
| 1226 | Ga0070674_100065862 | |||
| 1227 | Ga0070674_100244034 | |||
| 1228 | Ga0070673_100048820 | |||
| 1229 | Ga0070673_100059450 | |||
| 1230 | Ga0070673_100077300 | |||
| 1231 | Ga0070688_100849866 | |||
| 1232 | Ga0070659_100106170 | |||
| 1233 | Ga0070659_100217918 | |||
| 1234 | Ga0070659_101231326 | |||
| 1235 | Ga0070667_100000057 | |||
| 1236 | Ga0070667_100075773 | |||
| 1237 | Ga0070667_100194136 | |||
| 1238 | Ga0070667_101289781 | |||
| 1239 | Ga0070667_101804314 | |||
| 1240 | Ga0070709_10702030 | |||
| 1241 | Ga0070714_100000146 | |||
| 1242 | Ga0070714_100006932 | |||
| 1243 | Ga0070714_100288063 | |||
| 1244 | Ga0070713_100001113 | |||
| 1245 | Ga0070700_100023296 | |||
| 1246 | Ga0070700_100143433 | |||
| 1247 | Ga0070663_100038378 | |||
| 1248 | Ga0070663_100163342 | |||
| 1249 | Ga0070663_100625898 | |||
| 1250 | Ga0070663_100874932 | |||
| 1251 | Ga0070678_100064896 | |||
| 1252 | Ga0070678_100226253 | |||
| 1253 | Ga0070678_100847843 | |||
| 1254 | Ga0070662_100178306 | |||
| 1255 | Ga0070681_10399486 | |||
| 1256 | Ga0068867_101797533 | |||
| 1257 | Ga0068867_101909262 | |||
| 1258 | Ga0070685_10149985 | |||
| 1259 | Ga0070685_10222577 | |||
| 1260 | Ga0070685_10716982 | |||
| 1261 | Ga0070706_100704723 | |||
| 1262 | Ga0070679_100080953 | |||
| 1263 | Ga0070679_100428919 | |||
| 1264 | Ga0070679_101050805 | |||
| 1265 | Ga0068853_100238634 | |||
| 1266 | Ga0070672_100136347 | |||
| 1267 | Ga0070672_100457345 | |||
| 1268 | Ga0070672_100560767 | |||
| 1269 | Ga0070686_100250432 | |||
| 1270 | Ga0070696_100037091 | |||
| 1271 | Ga0070693_100080572 | |||
| 1272 | Ga0070693_100086721 | |||
| 1273 | Ga0070693_100274424 | |||
| 1274 | Ga0070665_100001412 | |||
| 1275 | Ga0070665_100001746 | |||
| 1276 | Ga0070665_100292367 | |||
| 1277 | Ga0070665_100419655 | |||
| 1278 | Ga0070665_100430295 | |||
| 1279 | Ga0070665_101655100 | |||
| 1280 | Ga0068855_100001054 | |||
| 1281 | Ga0068855_100376110 | |||
| 1282 | Ga0070664_100229471 | |||
| 1283 | Ga0070664_101076391 | |||
| 1284 | Ga0068857_100005138 | |||
| 1285 | Ga0068857_100011506 | |||
| 1286 | Ga0068857_100022774 | |||
| 1287 | Ga0068857_100306723 | |||
| 1288 | Ga0068857_101431976 | |||
| 1289 | Ga0068857_101837400 | |||
| 1290 | Ga0068854_100003997 | |||
| 1291 | Ga0068854_100653134 | |||
| 1292 | Ga0068856_100028243 | |||
| 1293 | Ga0068856_100053976 | |||
| 1294 | Ga0068856_100126517 | |||
| 1295 | Ga0068852_100013196 | |||
| 1296 | Ga0068859_100205251 | |||
| 1297 | Ga0068859_100284558 | |||
| 1298 | Ga0068859_100412515 | |||
| 1299 | Ga0068864_101227968 | |||
| 1300 | Ga0068861_100034657 | |||
| 1301 | Ga0068861_100078674 | |||
| 1302 | Ga0068861_100085506 | |||
| 1303 | Ga0068851_10005923 | |||
| 1304 | Ga0068858_100149055 | |||
| 1305 | Ga0068858_100163681 | |||
| 1306 | Ga0068858_101353970 | |||
| 1307 | Ga0068860_100176386 | |||
| 1308 | Ga0068860_100230530 | |||
| 1309 | Ga0068860_101181629 | |||
| 1310 | Ga0068862_100020082 | |||
| 1311 | Ga0068862_100239329 | |||
| 1312 | Ga0068862_100622213 | |||
| 1313 | Ga0081455_10000010 | |||
| 1314 | Ga0081540_1145781 | |||
| 1315 | Ga0081539_10000016 | |||
| 1316 | Ga0075368_10023721 | |||
| 1317 | Ga0075364_10213537 | |||
| 1318 | Ga0075364_10490766 | |||
| 1319 | Ga0070715_10292571 | |||
| 1320 | Ga0070712_100392953 | |||
| 1321 | Ga0075369_10047861 | |||
| 1322 | Ga0075369_10084874 | |||
| 1323 | Ga0075369_10596223 | |||
| 1324 | Ga0097621_100121949 | |||
| 1325 | Ga0068871_100208812 | |||
| 1326 | Ga0068871_100256382 | |||
| 1327 | Ga0068871_100705072 | |||
| 1328 | Ga0075430_100069862 | |||
| 1329 | Ga0075430_100938495 | |||
| 1330 | Ga0075431_100703332 | |||
| 1331 | Ga0068865_100071638 | |||
| 1332 | Ga0068865_100674932 | |||
| 1333 | Ga0097620_100205242 | |||
| 1334 | Ga0097620_100284579 | |||
| 1335 | Ga0097620_100412514 | |||
| 1336 | Ga0099826_10137357 | |||
| 1337 | Ga0105251_10000221 | |||
| 1338 | Ga0105244_10000631 | |||
| 1339 | Ga0105244_10272752 | |||
| 1340 | Ga0105250_10000024 | |||
| 1341 | Ga0105250_10000215 | |||
| 1342 | Ga0105250_10095106 | |||
| 1343 | Ga0105250_10532743 | |||
| 1344 | Ga0105240_10030430 | |||
| 1345 | Ga0105240_10093277 | |||
| 1346 | Ga0105240_10965196 | |||
| 1347 | Ga0111539_10042871 | |||
| 1348 | Ga0111539_10539972 | |||
| 1349 | Ga0111539_10996254 | |||
| 1350 | Ga0111539_11484368 | |||
| 1351 | Ga0105247_10003410 | |||
| 1352 | Ga0105247_10020959 | |||
| 1353 | Ga0105247_10253607 | |||
| 1354 | Ga0105247_10666955 | |||
| 1355 | Ga0105243_10010344 | |||
| 1356 | Ga0105243_10112312 | |||
| 1357 | Ga0105243_10818900 | |||
| 1358 | Ga0105243_12209427 | |||
| 1359 | Ga0105241_10187185 | |||
| 1360 | Ga0105241_10264895 | |||
| 1361 | Ga0105241_11170702 | |||
| 1362 | Ga0105242_10036858 | |||
| 1363 | Ga0105242_10114268 | |||
| 1364 | Ga0105242_10141056 | |||
| 1365 | Ga0105248_10003931 | |||
| 1366 | Ga0105248_10107075 | |||
| 1367 | Ga0105248_10465516 | |||
| 1368 | Ga0105237_10000214 | |||
| 1369 | Ga0105237_10175664 | |||
| 1370 | Ga0105237_10373889 | |||
| 1371 | Ga0105237_10857228 | |||
| 1372 | Ga0105238_10000156 | |||
| 1373 | Ga0105238_10010620 | |||
| 1374 | Ga0105238_10020830 | |||
| 1375 | Ga0105238_10638038 | |||
| 1376 | Ga0105238_11089715 | |||
| 1377 | Ga0105249_10107207 | |||
| 1378 | Ga0105249_10679418 | |||
| 1379 | Ga0105249_11892733 | |||
| 1380 | Ga0105239_10001178 | |||
| 1381 | Ga0105239_10028091 | |||
| 1382 | Ga0105239_10255733 | |||
| 1383 | Ga0105239_10271937 | |||
| 1384 | Ga0105239_10398557 | |||
| 1385 | Ga0105239_11281428 | |||
| 1386 | Ga0105239_12535621 | |||
| 1387 | Ga0105246_10634710 | |||
| 1388 | Ga0157314_1000371 | |||
| 1389 | Ga0157373_10001512 | |||
| 1390 | Ga0157373_10026725 | |||
| 1391 | Ga0157373_10058834 | |||
| 1392 | Ga0157373_10549224 | |||
| 1393 | Ga0157371_10001716 | |||
| 1394 | Ga0157371_10008141 | |||
| 1395 | Ga0157371_10032903 | |||
| 1396 | Ga0157371_10953400 | |||
| 1397 | Ga0157370_10005803 | |||
| 1398 | Ga0157370_10006411 | |||
| 1399 | Ga0157370_10032072 | |||
| 1400 | Ga0157370_10049486 | |||
| 1401 | Ga0157370_10064902 | |||
| 1402 | Ga0157370_10491485 | |||
| 1403 | Ga0157370_10864262 | |||
| 1404 | Ga0157369_10000171 | |||
| 1405 | Ga0157369_10066964 | |||
| 1406 | Ga0157369_10080787 | |||
| 1407 | Ga0157369_10120876 | |||
| 1408 | Ga0157378_10163836 | |||
| 1409 | Ga0157378_11824012 | |||
| 1410 | Ga0163162_10000802 | |||
| 1411 | Ga0163162_10110954 | |||
| 1412 | Ga0163162_10113764 | |||
| 1413 | Ga0163162_11215712 | |||
| 1414 | Ga0157372_10011602 | |||
| 1415 | Ga0157372_10043795 | |||
| 1416 | Ga0157375_10017161 | |||
| 1417 | Ga0157375_10219459 | |||
| 1418 | Ga0157375_10232891 | |||
| 1419 | Ga0157375_12926111 | |||
| 1420 | Ga0163163_10009793 | |||
| 1421 | Ga0163163_10029623 | |||
| 1422 | Ga0163163_10072238 | |||
| 1423 | Ga0163163_10134972 | |||
| 1424 | Ga0157380_10000876 | |||
| 1425 | Ga0157380_10022918 | |||
| 1426 | Ga0157380_10324149 | |||
| 1427 | Ga0157380_10559501 | |||
| 1428 | Ga0157380_11495009 | |||
| 1429 | Ga0182008_10006102 | |||
| 1430 | Ga0182008_10014917 | |||
| 1431 | Ga0182008_10020730 | |||
| 1432 | Ga0182008_10026590 | |||
| 1433 | Ga0182008_10071606 | |||
| 1434 | Ga0157377_10338196 | |||
| 1435 | Ga0157379_10000013 | |||
| 1436 | Ga0157379_10026667 | |||
| 1437 | Ga0157379_10073175 | |||
| 1438 | Ga0157379_10321666 | |||
| 1439 | Ga0157376_10097335 | |||
| 1440 | Ga0157376_10161097 | |||
| 1441 | Ga0157376_10306356 | |||
| 1442 | Ga0157376_10671576 | |||
| 1443 | Ga0182006_1000148 | |||
| 1444 | Ga0182006_1000208 | |||
| 1445 | Ga0182006_1029363 | |||
| 1446 | Ga0182006_1029600 | |||
| 1447 | Ga0182006_1057426 | |||
| 1448 | Ga0182006_1077523 | |||
| 1449 | Ga0182006_1251148 | |||
| 1450 | Ga0182007_10000139 | |||
| 1451 | Ga0182007_10013777 | |||
| 1452 | Ga0182007_10022629 | |||
| 1453 | Ga0182007_10107541 | |||
| 1454 | Ga0182005_1000110 | |||
| 1455 | Ga0182005_1000121 | |||
| 1456 | Ga0182005_1002288 | |||
| 1457 | Ga0182005_1002799 | |||
| 1458 | Ga0182005_1007803 | |||
| 1459 | Ga0182005_1028029 | |||
| 1460 | Ga0183368_1002 | |||
| 1461 | Ga0163161_10001733 | |||
| 1462 | Ga0163161_10225623 | |||
| 1463 | Ga0163161_10239475 | |||
| 1464 | Ga0163161_11015005 | |||
| 1465 | Ga0206353_11114430 | |||
| 1466 | Ga0206353_11437260 | |||
| 1467 | Ga0209674_100061 | |||
| 1468 | Ga0209674_102951 | |||
| 1469 | Ga0209672_101058 | |||
| 1470 | Ga0209147_116127 | |||
| 1471 | Ga0207427_100169 | |||
| 1472 | Ga0207427_103201 | |||
| 1473 | Ga0209437_100076 | |||
| 1474 | Ga0209437_100244 | |||
| 1475 | Ga0209437_100723 | |||
| 1476 | Ga0209258_101900 | |||
| 1477 | Ga0209258_106393 | |||
| 1478 | Ga0207425_1029061 | |||
| 1479 | Ga0209026_1000148 | |||
| 1480 | Ga0209148_1000002 | |||
| 1481 | Ga0209148_1002312 | |||
| 1482 | Ga0209759_1019783 | |||
| 1483 | Ga0209129_1001105 | |||
| 1484 | Ga0209129_1007410 | |||
| 1485 | Ga0209233_1000246 | |||
| 1486 | Ga0209233_1006488 | |||
| 1487 | Ga0209233_1024072 | |||
| 1488 | Ga0209565_1000063 | |||
| 1489 | Ga0209673_1000065 | |||
| 1490 | Ga0209130_1011604 | |||
| 1491 | Ga0209675_1000011 | |||
| 1492 | Ga0209676_1000011 | |||
| 1493 | Ga0209676_1000068 | |||
| 1494 | Ga0209564_1000190 | |||
| 1495 | Ga0209758_1000814 | |||
| 1496 | Ga0209758_1008736 | |||
| 1497 | Ga0209050_1000239 | |||
| 1498 | Ga0209050_1000351 | |||
| 1499 | Ga0209050_1009828 | |||
| 1500 | Ga0209256_1015294 | |||
| 1501 | Ga0209256_1016682 | |||
| 1502 | Ga0209051_1004518 | |||
| 1503 | Ga0209051_1031335 | |||
| 1504 | Ga0209257_1000014 | |||
| 1505 | Ga0209257_1031598 | |||
| 1506 | Ga0207697_10035285 | |||
| 1507 | Ga0207656_10002369 | |||
| 1508 | Ga0207696_1000175 | |||
| 1509 | Ga0207655_1000825 | |||
| 1510 | Ga0207655_1075839 | |||
| 1511 | Ga0207713_1000207 | |||
| 1512 | Ga0207713_1054666 | |||
| 1513 | Ga0207682_10271285 | |||
| 1514 | Ga0207642_10068281 | |||
| 1515 | Ga0207710_10051039 | |||
| 1516 | Ga0207710_10053258 | |||
| 1517 | Ga0207710_10095540 | |||
| 1518 | Ga0207710_10715443 | |||
| 1519 | Ga0207688_10392621 | |||
| 1520 | Ga0207680_10000001 | |||
| 1521 | Ga0207680_10003460 | |||
| 1522 | Ga0207647_10000008 | |||
| 1523 | Ga0207647_10044316 | |||
| 1524 | Ga0207647_10046875 | |||
| 1525 | Ga0207647_10089817 | |||
| 1526 | Ga0207645_10057374 | |||
| 1527 | Ga0207643_10012846 | |||
| 1528 | Ga0207705_10006425 | |||
| 1529 | Ga0207705_10014972 | |||
| 1530 | Ga0207705_10152410 | |||
| 1531 | Ga0207705_10800636 | |||
| 1532 | Ga0207684_10652573 | |||
| 1533 | Ga0207654_10163013 | |||
| 1534 | Ga0207654_10280440 | |||
| 1535 | Ga0207695_10000649 | |||
| 1536 | Ga0207695_10001088 | |||
| 1537 | Ga0207695_10023313 | |||
| 1538 | Ga0207695_10209007 | |||
| 1539 | Ga0207695_11281751 | |||
| 1540 | Ga0207671_10000057 | |||
| 1541 | Ga0207671_10267106 | |||
| 1542 | Ga0207671_10617782 | |||
| 1543 | Ga0207693_10372193 | |||
| 1544 | Ga0207693_10416300 | |||
| 1545 | Ga0207660_10052332 | |||
| 1546 | Ga0207657_10148460 | |||
| 1547 | Ga0207649_10058303 | |||
| 1548 | Ga0207649_10060771 | |||
| 1549 | Ga0207649_10120319 | |||
| 1550 | Ga0207649_10236695 | |||
| 1551 | Ga0207652_10059872 | |||
| 1552 | Ga0207681_10468819 | |||
| 1553 | Ga0207694_10004515 | |||
| 1554 | Ga0207694_10022206 | |||
| 1555 | Ga0207694_10059595 | |||
| 1556 | Ga0207694_10075025 | |||
| 1557 | Ga0207694_10199276 | |||
| 1558 | Ga0207694_10884626 | |||
| 1559 | Ga0207694_11573659 | |||
| 1560 | Ga0207650_10534435 | |||
| 1561 | Ga0207650_11361878 | |||
| 1562 | Ga0207700_10014272 | |||
| 1563 | Ga0207664_10000055 | |||
| 1564 | Ga0207664_10004122 | |||
| 1565 | Ga0207664_10069386 | |||
| 1566 | Ga0207644_10261561 | |||
| 1567 | Ga0207690_10001361 | |||
| 1568 | Ga0207690_10001362 | |||
| 1569 | Ga0207690_10003572 | |||
| 1570 | Ga0207690_10068701 | |||
| 1571 | Ga0207690_10839607 | |||
| 1572 | Ga0207706_10014408 | |||
| 1573 | Ga0207706_10103926 | |||
| 1574 | Ga0207686_10232595 | |||
| 1575 | Ga0207686_10550055 | |||
| 1576 | Ga0207709_10004255 | |||
| 1577 | Ga0207709_10229869 | |||
| 1578 | Ga0207709_10282532 | |||
| 1579 | Ga0207670_10014029 | |||
| 1580 | Ga0207669_10068407 | |||
| 1581 | Ga0207669_10356045 | |||
| 1582 | Ga0207704_10915225 | |||
| 1583 | Ga0207704_11553706 | |||
| 1584 | Ga0207691_10011441 | |||
| 1585 | Ga0207691_10024666 | |||
| 1586 | Ga0207691_10928658 | |||
| 1587 | Ga0207711_10570753 | |||
| 1588 | Ga0207689_10020699 | |||
| 1589 | Ga0207689_10399551 | |||
| 1590 | Ga0207689_10794431 | |||
| 1591 | Ga0207679_10905917 | |||
| 1592 | Ga0207667_10000139 | |||
| 1593 | Ga0207667_10000648 | |||
| 1594 | Ga0207667_10001898 | |||
| 1595 | Ga0207667_10016414 | |||
| 1596 | Ga0207667_10164369 | |||
| 1597 | Ga0207651_10015251 | |||
| 1598 | Ga0207651_10093158 | |||
| 1599 | Ga0207712_10073126 | |||
| 1600 | Ga0207668_10172312 | |||
| 1601 | Ga0207668_11072008 | |||
| 1602 | Ga0207640_10000951 | |||
| 1603 | Ga0207658_10000200 | |||
| 1604 | Ga0207658_10550884 | |||
| 1605 | Ga0207658_12006093 | |||
| 1606 | Ga0207677_10590266 | |||
| 1607 | Ga0207677_11975924 | |||
| 1608 | Ga0207703_10146213 | |||
| 1609 | Ga0207703_10201486 | |||
| 1610 | Ga0207703_10864739 | |||
| 1611 | Ga0207639_10007199 | |||
| 1612 | Ga0207678_10072431 | |||
| 1613 | Ga0207678_10072715 | |||
| 1614 | Ga0207678_10155063 | |||
| 1615 | Ga0207678_10191115 | |||
| 1616 | Ga0207678_10307148 | |||
| 1617 | Ga0207708_10085178 | |||
| 1618 | Ga0207708_10327873 | |||
| 1619 | Ga0207708_10346001 | |||
| 1620 | Ga0207702_10039255 | |||
| 1621 | Ga0207702_11324195 | |||
| 1622 | Ga0207641_10302219 | |||
| 1623 | Ga0207648_10439400 | |||
| 1624 | Ga0207676_10447539 | |||
| 1625 | Ga0207674_10010056 | |||
| 1626 | Ga0207674_10032391 | |||
| 1627 | Ga0207674_10044436 | |||
| 1628 | Ga0207674_10249235 | |||
| 1629 | Ga0207674_10375570 | |||
| 1630 | Ga0207674_11242900 | |||
| 1631 | Ga0207675_100015832 | |||
| 1632 | Ga0207675_100048721 | |||
| 1633 | Ga0207675_100113706 | |||
| 1634 | Ga0207675_100118476 | |||
| 1635 | Ga0207683_10074989 | |||
| 1636 | Ga0207683_10179063 | |||
| 1637 | Ga0207683_10263700 | |||
| 1638 | Ga0207683_10750134 | |||
| 1639 | Ga0207698_10002739 | |||
| 1640 | Ga0209371_1000023 | |||
| 1641 | Ga0209371_1003982 | |||
| 1642 | Ga0209813_10080637 | |||
| 1643 | Ga0268266_10000059 | |||
| 1644 | Ga0268266_10016021 | |||
| 1645 | Ga0268266_10258051 | |||
| 1646 | Ga0268266_10948346 | |||
| 1647 | Ga0268265_10064342 | |||
| 1648 | Ga0268265_10202749 | |||
| 1649 | Ga0268265_10557300 | |||
| 1650 | Ga0268264_10024459 | |||
| 1651 | Ga0268264_10228683 | |||
| 1652 | Ga0307517_10313025 | |||
| 1653 | Ga0307515_10101086 | |||
| 1654 | Ga0307515_10145245 | |||
| 1655 | Ga0268256_1000023 | |||
| 1656 | Ga0268256_1001500 | |||
| 1657 | Ga0307511_10389700 | |||
| 1658 | Ga0316181_1273336 | |||
| 1659 | Ga0265770_1060794 | |||
| 1660 | Ga0265328_10010604 | |||
| 1661 | Ga0265331_10009248 | |||
| 1662 | Ga0265331_10043929 | |||
| 1663 | Ga0265327_10000257 | |||
| 1664 | Ga0307513_10007691 | |||
| 1665 | Ga0307513_10131291 | |||
| 1666 | Ga0307513_10371663 | |||
| 1667 | Ga0307509_10000106 | |||
| 1668 | Ga0307509_10010878 | |||
| 1669 | Ga0307509_10451185 | |||
| 1670 | Ga0307408_100000018 | |||
| 1671 | Ga0307408_100033048 | |||
| 1672 | Ga0307408_100311254 | |||
| 1673 | Ga0307408_101885635 | |||
| 1674 | Ga0265313_10145766 | |||
| 1675 | Ga0307508_10233110 | |||
| 1676 | Ga0307508_10521896 | |||
| 1677 | Ga0307514_10176037 | |||
| 1678 | Ga0316575_10099611 | |||
| 1679 | Ga0316579_10063558 | |||
| 1680 | Ga0307516_10610677 | |||
| 1681 | Ga0307405_10090701 | |||
| 1682 | Ga0307405_10468084 | |||
| 1683 | Ga0307405_11941457 | |||
| 1684 | Ga0307413_10017181 | |||
| 1685 | Ga0307413_11120513 | |||
| 1686 | Ga0307410_10071575 | |||
| 1687 | Ga0307410_10115992 | |||
| 1688 | Ga0307406_10191426 | |||
| 1689 | Ga0307407_10056224 | |||
| 1690 | Ga0307407_11178683 | |||
| 1691 | Ga0307407_11624508 | |||
| 1692 | Ga0307412_10003310 | |||
| 1693 | Ga0307412_10400796 | |||
| 1694 | Ga0307412_10571972 | |||
| 1695 | Ga0307412_11019546 | |||
| 1696 | Ga0307409_100018842 | |||
| 1697 | Ga0307409_100081177 | |||
| 1698 | Ga0307409_100504114 | |||
| 1699 | Ga0307409_100587372 | |||
| 1700 | Ga0307409_101047951 | |||
| 1701 | Ga0307409_101566904 | |||
| 1702 | Ga0307416_100131604 | |||
| 1703 | Ga0307416_100763542 | |||
| 1704 | Ga0307416_102842708 | |||
| 1705 | Ga0307414_10005696 | |||
| 1706 | Ga0307414_10041817 | |||
| 1707 | Ga0307414_10094886 | |||
| 1708 | Ga0307414_10166931 | |||
| 1709 | Ga0307414_10463670 | |||
| 1710 | Ga0307414_11560905 | |||
| 1711 | Ga0307414_11795147 | |||
| 1712 | Ga0307411_10036622 | |||
| 1713 | Ga0307411_10150063 | |||
| 1714 | Ga0307411_10418724 | |||
| 1715 | Ga0307411_10542613 | |||
| 1716 | Ga0307411_10652885 | |||
| 1717 | Ga0307411_10973050 | |||
| 1718 | Ga0307415_100059636 | |||
| 1719 | Ga0307415_100111161 | |||
| 1720 | Ga0307415_100164657 | |||
| 1721 | Ga0307415_100415207 | |||
| 1722 | Ga0316583_10037326 | |||
| 1723 | Ga0316583_10044155 | |||
| 1724 | Ga0316593_10000070 | |||
| 1725 | Ga0316593_10002365 | |||
| 1726 | Ga0316593_10009417 | |||
| 1727 | Ga0307510_10007161 | |||
| 1728 | Ga0316592_1000393 | |||
| 1729 | Ga0316592_1000847 | |||
| 1730 | Ga0316587_1003506 | |||
| 1731 | Ga0316596_1000074 | |||
| 1732 | Ga0316596_1001295 | |||
| 1733 | Ga0316596_1174280 | |||
| 1734 | Ga0373934_0342372 | |||
| 1735 | Ga0373932_0141077 | |||
| 1736 | Ga0373956_0022091 | |||
| 1737 | Ga0373955_0079998 | |||
| 1738 | Ga0316574_0035103 | |||
| 1739 | Ga0316574_0127406 | |||
| 1740 | Ga0373935_0403821 | |||
| 1741 | Ga0373947_0366317 | |||
| 1742 | Ga0373947_0584623 | |||
| 1743 | Ga0373947_0988674 | |||
| 1744 | Ga0373937_0188162 | |||
| 1745 | Ga0316582_0007638 | |||
| 1746 | Ga0316582_0135851 | |||
| 1747 | Ga0316584_0017052 | |||
| 1748 | Ga0316584_0997739 | |||
| 1749 | Ga0373925_1001531 | |||
| 1750 | Ga0395899_0172179 | |||
| 1751 | Ga0395900_0217336 | |||
| 1752 | Ga0395898_0302993 | |||
| 1753 | Ga0395901_0005497 | |||
| 1754 | Ga0400484_01091 | |||
| 1755 | Ga0400483_140319 | |||
| 1756 | Ga0400483_146212 | |||
| 1757 | Ga0400487_28495 | |||
| 1758 | Ga0436365_0324201 | |||
| 1759 | Ga0436365_1379258 | |||
| 1760 | Ga0436363_0555558 | |||
| 1761 | Ga0436363_1533653 | |||
| 1762 | Ga0439436_0000024 | |||
| 1763 | Ga0439436_0221812 | |||
| 1764 | Ga0439466_0024073 | |||
| 1765 | Ga0439465_0000125 | |||
| 1766 | Ga0451789_1145622 | |||
| 1767 | Ga0451791_0097535 | |||
| 1768 | Ga0451791_1537909 | |||
| 1769 | Ga0451793_1150667 | |||
| 1770 | Ga0451797_0522831 | |||
| 1771 | Ga0451795_0608584 | |||
| 1772 | Ga0451798_0819397 | |||
| 1773 | Ga0451802_0850503 | |||
| 1774 | Ga0451802_1200763 | |||
| 1775 | Ga0451802_1482254 | |||
| 1776 | Ga0451807_1090267 | |||
| 1777 | Ga0451807_2221809 | |||
| 1778 | Ga0451807_2383651 | |||
| 1779 | Ga0451837_0347394 | |||
| 1780 | Ga0451851_0854358 | |||
| 1781 | Ga0451853_0986352 | |||
| 1782 | Ga0439431_0008618 | |||
| 1783 | Ga0439431_0124884 | |||
| 1784 | Ga0439431_0233699 | |||
| 1785 | Ga0439437_000245 | |||
| 1786 | Ga0439437_001234 | |||
| 1787 | Ga0439448_0100034 | |||
| 1788 | Ga0439432_021074 | |||
| 1789 | Ga0439456_003323 | |||
| 1790 | Ga0439457_082259 | |||
| 1791 | Ga0450911_000001 | |||
| 1792 | Ga0450896_009245 | |||
| 1793 | Ga0450902_022221 | |||
| 1794 | Ga0450903_008093 | |||
| 1795 | Ga0450904_000136 | |||
| 1796 | Ga0450906_075328 | |||
| 1797 | Ga0450908_000557 | |||
| 1798 | Ga0439459_0000450 | |||
| 1799 | Ga0439459_0001047 | |||
| 1800 | Ga0439459_0095687 | |||
| 1801 | Ga0439459_0204338 | |||
| 1802 | Ga0439464_0000157 | |||
| 1803 | Ga0450916_007609 | |||
| 1804 | Ga0450916_048603 | |||
| 1805 | Ga0450918_020026 | |||
| 1806 | Ga0450893_0112423 | |||
| 1807 | Ga0466969_0069722 | |||
| 1808 | Ga0466969_0137916 | |||
| 1809 | Ga0466972_0075646 | |||
| 1810 | Ga0466972_0302669 | |||
| 1811 | Ga0466982_0000005 | |||
| 1812 | Ga0466982_0018787 | |||
| 1813 | Ga0466965_0021760 | |||
| 1814 | Ga0466965_0059107 | |||
| 1815 | Ga0466965_0229681 | |||
| 1816 | Ga0466966_0015601 | |||
| 1817 | Ga0466961_0017052 | |||
| 1818 | Ga0466963_1154762 | |||
| 1819 | Ga0466964_0274237 | |||
| 1820 | Ga0453684_0001527 | |||
| 1821 | Ga0466971_0003924 | |||
| 1822 | Ga0466971_0007950 | |||
| 1823 | Ga0466968_0005794 | |||
| 1824 | Ga0466968_0012057 | |||
| 1825 | Ga0466968_0211606 | |||
| 1826 | Ga0466970_0217254 | |||
| 1827 | Ga0466970_0308359 | |||
| 1828 | Ga0466957_0023283 | |||
| 1829 | Ga0466957_0079445 | |||
| 1830 | Ga0466957_0088762 | |||
| 1831 | Ga0466957_0096733 | |||
| 1832 | Ga0466957_0270625 | |||
| 1833 | Ga0466960_0057111 | |||
| 1834 | Ga0466960_0090653 | |||
| 1835 | Ga0466959_0030203 | |||
| 1836 | Ga0451576_0000753 | |||
| 1837 | Ga0451576_0039099 | |||
| 1838 | Ga0466958_0022524 | |||
| 1839 | Ga0495617_000352 | |||
| 1840 | Ga0495617_000483 | |||
| 1841 | Ga0495627_000013 | |||
| 1842 | Ga0495627_016640 | |||
| 1843 | Ga0495603_0311808 | |||
| 1844 | Ga0495590_0010025 | |||
| 1845 | Ga0495590_0071180 | |||
| 1846 | Ga0495590_0368384 | |||
| 1847 | Ga0495590_0397933 | |||
| 1848 | Ga0495591_000020 | |||
| 1849 | Ga0495638_0000019 | |||
| 1850 | Ga0495638_0000394 | |||
| 1851 | Ga0495638_0000426 | |||
| 1852 | Ga0495638_0001081 | |||
| 1853 | Ga0495638_0002385 | |||
| 1854 | Ga0495638_0015694 | |||
| 1855 | Ga0495638_0020527 | |||
| 1856 | Ga0495638_0026879 | |||
| 1857 | Ga0495638_0195217 | |||
| 1858 | Ga0495638_0304621 | |||
| 1859 | Ga0495653_0033709 | |||
| 1860 | Ga0495650_0000206 | |||
| 1861 | Ga0495650_0000221 | |||
| 1862 | Ga0495650_0000369 | |||
| 1863 | Ga0495650_0001354 | |||
| 1864 | Ga0495650_0043787 | |||
| 1865 | Ga0495650_0126449 | |||
| 1866 | Ga0495582_0095752 | |||
| 1867 | Ga0495639_0158877 | |||
| 1868 | Ga0495584_0009829 | |||
| 1869 | Ga0495584_0050009 | |||
| 1870 | Ga0495584_0215928 | |||
| 1871 | Ga0495585_0000210 | |||
| 1872 | Ga0495585_0003200 | |||
| 1873 | Ga0495585_0006659 | |||
| 1874 | Ga0495585_0049563 | |||
| 1875 | Ga0495594_0626777 | |||
| 1876 | Ga0495596_0062978 | |||
| 1877 | Ga0495607_0000040 | |||
| 1878 | Ga0495607_0000129 | |||
| 1879 | Ga0495607_0012990 | |||
| 1880 | Ga0495607_0020082 | |||
| 1881 | Ga0495607_0030664 | |||
| 1882 | Ga0495607_0046538 | |||
| 1883 | Ga0495607_0163207 | |||
| 1884 | Ga0495583_0008107 | |||
| 1885 | Ga0495583_0012896 | |||
| 1886 | Ga0495606_0000638 | |||
| 1887 | Ga0495606_0000669 | |||
| 1888 | Ga0495606_0001771 | |||
| 1889 | Ga0495606_0002189 | |||
| 1890 | Ga0495606_0003264 | |||
| 1891 | Ga0495606_0005069 | |||
| 1892 | Ga0495606_0008547 | |||
| 1893 | Ga0495606_0044131 | |||
| 1894 | Ga0495606_0053250 | |||
| 1895 | Ga0495606_0165026 | |||
| 1896 | Ga0495608_0587727 | |||
| 1897 | Ga0495610_0000984 | |||
| 1898 | Ga0495610_0027797 | |||
| 1899 | Ga0495610_0085981 | |||
| 1900 | Ga0495616_0000045 | |||
| 1901 | Ga0495616_0001404 | |||
| 1902 | Ga0495616_0062638 | |||
| 1903 | Ga0495616_0073803 | |||
| 1904 | Ga0495616_0201451 | |||
| 1905 | Ga0495620_0001475 | |||
| 1906 | Ga0495620_0007350 | |||
| 1907 | Ga0495620_0072801 | |||
| 1908 | Ga0495620_0118210 | |||
| 1909 | Ga0495630_0175818 | |||
| 1910 | Ga0495630_0364855 | |||
| 1911 | Ga0495631_0001589 | |||
| 1912 | Ga0495631_0003466 | |||
| 1913 | Ga0495631_0049096 | |||
| 1914 | Ga0495632_0000016 | |||
| 1915 | Ga0495632_0006854 | |||
| 1916 | Ga0495632_0006995 | |||
| 1917 | Ga0495632_0013188 | |||
| 1918 | Ga0495632_0070207 | |||
| 1919 | Ga0495632_0101558 | |||
| 1920 | Ga0495632_0173311 | |||
| 1921 | Ga0495632_0215510 | |||
| 1922 | Ga0495632_0238723 | |||
| 1923 | Ga0495637_0016287 | |||
| 1924 | Ga0495637_0016816 | |||
| 1925 | Ga0495637_0050570 | |||
| 1926 | Ga0495643_0034666 | |||
| 1927 | Ga0495643_0145978 | |||
| 1928 | Ga0495644_0009353 | |||
| 1929 | Ga0495644_0181142 | |||
| 1930 | Ga0495648_0002393 | |||
| 1931 | Ga0495648_0013423 | |||
| 1932 | Ga0495663_0013450 | |||
| 1933 | Ga0495654_0010949 | |||
| 1934 | Ga0495609_0012510 | |||
| 1935 | Ga0495621_0083965 | |||
| 1936 | Ga0495597_0000004 | |||
| 1937 | Ga0495597_0136887 | |||
| 1938 | Ga0495622_0015520 | |||
| 1939 | Ga0495622_0072540 | |||
| 1940 | Ga0495622_0225191 | |||
| 1941 | Ga0495633_0005767 | |||
| 1942 | Ga0495656_0036930 | |||
| 1943 | Ga0495668_0009889 | |||
| 1944 | Ga0495668_0024612 | |||
| 1945 | Ga0495668_0059389 | |||
| 1946 | Ga0495668_0155175 | |||
| 1947 | Ga0495668_0224496 | |||
| 1948 | Ga0495668_0248720 | |||
| 1949 | Ga0495668_0334177 | |||
| 1950 | Ga0495634_0670122 | |||
| 1951 | Ga0495611_0000001 | |||
| 1952 | Ga0495611_0000044 | |||
| 1953 | Ga0495611_0000589 | |||
| 1954 | Ga0495611_0141365 | |||
| 1955 | Ga0495625_0000010 | |||
| 1956 | Ga0495625_0000041 | |||
| 1957 | Ga0495625_0006301 | |||
| 1958 | Ga0495625_0015613 | |||
| 1959 | Ga0495625_0028256 | |||
| 1960 | Ga0495625_0114269 | |||
| 1961 | Ga0495625_0140617 | |||
| 1962 | Ga0495625_0150536 | |||
| 1963 | Ga0495625_0302588 | |||
| 1964 | Ga0495625_0534511 | |||
| 1965 | Ga0495625_0874772 | |||
| 1966 | Ga0495661_0000095 | |||
| 1967 | Ga0495661_0028182 | |||
| 1968 | Ga0495661_0601930 | |||
| 1969 | Ga0495588_0078646 | |||
| 1970 | Ga0495658_0034892 | |||
| 1971 | Ga0495670_0003718 | |||
| 1972 | Ga0495670_0004556 | |||
| 1973 | Ga0495671_0000404 | |||
| 1974 | Ga0495671_0005231 | |||
| 1975 | Ga0495671_0027170 | |||
| 1976 | Ga0495671_0245247 | |||
| 1977 | Ga0495671_0408667 | |||
| 1978 | Ga0495649_0002065 | |||
| 1979 | Ga0495649_0002986 | |||
| 1980 | Ga0495649_0004121 | |||
| 1981 | Ga0495649_0006003 | |||
| 1982 | Ga0495649_0021488 | |||
| 1983 | Ga0495649_0131725 | |||
| 1984 | Ga0495649_0206760 | |||
| 1985 | Ga0495589_0000008 | |||
| 1986 | Ga0495589_0112583 | |||
| 1987 | Ga0495660_0000369 | |||
| 1988 | Ga0495660_0000385 | |||
| 1989 | Ga0495660_0001556 | |||
| 1990 | Ga0495660_0010559 | |||
| 1991 | Ga0495660_0035663 | |||
| 1992 | Ga0495581_0076682 | |||
| 1993 | Ga0495636_0463357 | |||
| 1994 | Ga0495672_0017310 | |||
| 1995 | Ga0495672_0018334 | |||
| 1996 | Ga0495672_0023104 | |||
| 1997 | Ga0495672_0234423 | |||
| 1998 | Ga0495672_0299162 | |||
| 1999 | Ga0495676_0000002 | |||
| 2000 | Ga0495680_0248836 | |||
| 2001 | Ga0495683_0000906 | |||
| 2002 | Ga0495683_0028927 | |||
| 2003 | Ga0495683_0453631 | |||
| 2004 | Ga0495679_000004 | |||
| 2005 | Ga0495679_000992 | |||
| 2006 | Ga0495673_0000004 | |||
| 2007 | Ga0495673_0000573 | |||
| 2008 | Ga0495673_0000615 | |||
| 2009 | Ga0495673_0020195 | |||
| 2010 | Ga0495673_0024811 | |||
| 2011 | Ga0495673_0033600 | |||
| 2012 | Ga0495673_0146537 | |||
| 2013 | Ga0495673_0234567 | |||
| 2014 | Ga0495681_0006389 | |||
| 2015 | Ga0495681_0028059 | |||
| 2016 | Ga0495686_0000108 | |||
| 2017 | Ga0495686_0001586 | |||
| 2018 | Ga0495686_0021439 | |||
| 2019 | Ga0495686_0077975 | |||
| 2020 | Ga0495686_0103776 | |||
| 2021 | Ga0495686_0126059 | |||
| 2022 | Ga0495626_0000007 | |||
| 2023 | Ga0495626_0074428 | |||
| 2024 | Ga0496100_0004296 | |||
| 2025 | Ga0496100_0176500 | |||
| 2026 | Ga0496100_0248465 | |||
| 2027 | Ga0496100_0912853 | |||
| 2028 | Ga0496101_0001179 | |||
| 2029 | Ga0496101_0502088 | |||
| 2030 | Ga0496101_1060374 | |||
| 2031 | Ga0496102_0106044 | |||
| 2032 | Ga0496102_0356362 | |||
| 2033 | Ga0496102_0699010 | |||
| 2034 | Ga0496102_1196474 | |||
| 2035 | Ga0496103_0111558 | |||
| 2036 | Ga0496104_0174824 | |||
| 2037 | Ga0496104_0262591 | |||
| 2038 | Ga0496104_0806595 | |||
| 2039 | Ga0496105_0001419 | |||
| 2040 | Ga0496105_0376831 | |||
| 2041 | Ga0496106_0000889 | |||
| 2042 | Ga0496106_0250750 | |||
| 2043 | Ga0496106_0327677 | |||
| 2044 | Ga0496107_0103199 | |||
| 2045 | Ga0496107_0379604 | |||
| 2046 | Ga0496109_0290998 | |||
| 2047 | Ga0496109_0563577 | |||
| 2048 | Ga0496112_0084918 | |||
| 2049 | Ga0496113_0003783 | |||
| 2050 | Ga0496113_0297545 | |||
| 2051 | Ga0496115_0000098 | |||
| 2052 | Ga0496115_0001149 | |||
| 2053 | Ga0496115_0013105 | |||
| 2054 | Ga0496115_0086517 | |||
| 2055 | Ga0496115_0178560 | |||
| 2056 | Ga0496116_0010634 | |||
| 2057 | Ga0496116_0126233 | |||
| 2058 | Ga0496117_0019392 | |||
| 2059 | Ga0496117_0019920 | |||
| 2060 | Ga0496117_0038715 | |||
| 2061 | Ga0496117_0079234 | |||
| 2062 | Ga0496117_0143007 | |||
| 2063 | Ga0496117_0158415 | |||
| 2064 | Ga0496117_0197926 | |||
| 2065 | Ga0496117_0208986 | |||
| 2066 | Ga0496118_0000169 | |||
| 2067 | Ga0496118_0002339 | |||
| 2068 | Ga0496118_0002650 | |||
| 2069 | Ga0496118_0004693 | |||
| 2070 | Ga0496118_0020525 | |||
| 2071 | Ga0496118_0071140 | |||
| 2072 | Ga0496118_0071668 | |||
| 2073 | Ga0496118_0095037 | |||
| 2074 | Ga0496118_0147560 | |||
| 2075 | Ga0496118_0195083 | |||
| 2076 | Ga0496118_0475548 | |||
| 2077 | Ga0496119_0000255 | |||
| 2078 | Ga0496119_0001013 | |||
| 2079 | Ga0496119_0007613 | |||
| 2080 | Ga0496119_0019265 | |||
| 2081 | Ga0496120_0000240 | |||
| 2082 | Ga0496120_0002806 | |||
| 2083 | Ga0496120_0007069 | |||
| 2084 | Ga0496121_0000148 | |||
| 2085 | Ga0496121_0001780 | |||
| 2086 | Ga0496121_0005219 | |||
| 2087 | Ga0496121_0013002 | |||
| 2088 | Ga0496121_0022948 | |||
| 2089 | Ga0496121_0041348 | |||
| 2090 | Ga0496121_0056789 | |||
| 2091 | Ga0496121_0158112 | |||
| 2092 | Ga0496121_0430212 | |||
| 2093 | Ga0496122_0004582 | |||
| 2094 | Ga0496122_0054948 | |||
| 2095 | Ga0496122_0148198 | |||
| 2096 | Ga0496122_0197661 | |||
| 2097 | Ga0496122_0215186 | |||
| 2098 | Ga0496122_0284328 | |||
| 2099 | Ga0496123_0003097 | |||
| 2100 | Ga0496123_0019930 | |||
| 2101 | Ga0496123_0029007 | |||
| 2102 | Ga0496123_0042254 | |||
| 2103 | Ga0496123_0059448 | |||
| 2104 | Ga0496123_0078148 | |||
| 2105 | Ga0496123_0148149 | |||
| 2106 | Ga0496124_0000560 | |||
| 2107 | Ga0496124_0000764 | |||
| 2108 | Ga0496124_0010308 | |||
| 2109 | Ga0496124_0082173 | |||
| 2110 | Ga0496124_0192751 | |||
| 2111 | Ga0496124_0371612 | |||
| 2112 | Ga0496125_0003248 | |||
| 2113 | Ga0496125_0030500 | |||
| 2114 | Ga0496125_0032324 | |||
| 2115 | Ga0496125_0067005 | |||
| 2116 | Ga0496125_0152060 | |||
| 2117 | Ga0496126_0000708 | |||
| 2118 | Ga0496126_0002787 | |||
| 2119 | Ga0496126_0008157 | |||
| 2120 | Ga0496126_0012861 | |||
| 2121 | Ga0496126_0036296 | |||
| 2122 | Ga0496126_0237935 | |||
| 2123 | Ga0496126_0367155 | |||
| 2124 | Ga0496126_0550198 | |||
| 2125 | Ga0496126_1055507 | |||
| 2126 | Ga0495678_000116 | |||
| 2127 | Ga0495678_020813 | |||
| 2128 | Ga0495678_031013 | |||
| 2129 | Ga0495678_045143 | |||
| 2130 | Ga0495682_0000072 | |||
| 2131 | Ga0495682_0005082 | |||
| 2132 | Ga0495682_0021724 | |||
| 2133 | Ga0495682_0363398 | |||
| 2134 | Ga0501297_061832 | |||
| 2135 | Ga0501299_034239 | |||
| 2136 | Ga0501303_031018 | |||
| 2137 | Ga0501314_007198 | |||
| 2138 | Ga0501031_0103640 | |||
| 2139 | Ga0501031_0760434 | |||
| 2140 | Ga0501032_0014242 | |||
| 2141 | Ga0501032_0082403 | |||
| 2142 | Ga0501033_0837480 | |||
| 2143 | Ga0501034_0010312 | |||
| 2144 | Ga0501034_0046079 | |||
| 2145 | Ga0501034_1534877 | |||
| 2146 | Ga0501036_0024717 | |||
| 2147 | Ga0501036_0648088 | |||
| 2148 | Ga0501036_1062130 | |||
| 2149 | Ga0501037_0013004 | |||
| 2150 | Ga0501038_0012339 | |||
| 2151 | Ga0501039_0047774 | |||
| 2152 | Ga0501039_0376931 | |||
| 2153 | Ga0501040_0000154 | |||
| 2154 | Ga0501042_0000015 | |||
| 2155 | Ga0501042_0209017 | |||
| 2156 | Ga0501042_0679838 | |||
| 2157 | Ga0501043_0055715 | |||
| 2158 | Ga0501046_0025490 | |||
| 2159 | Ga0501046_0732090 | |||
| 2160 | Ga0501047_0104175 | |||
| 2161 | Ga0501047_0113729 | |||
| 2162 | Ga0501047_0600830 | |||
| 2163 | Ga0501048_0018493 | |||
| 2164 | Ga0501048_0285637 | |||
| 2165 | Ga0501068_0086317 | |||
| 2166 | Ga0501068_0843886 | |||
| 2167 | Ga0501069_0378851 | |||
| 2168 | Ga0501069_0517076 | |||
| 2169 | Ga0501070_0188777 | |||
| 2170 | Ga0501070_0351862 | |||
| 2171 | Ga0501070_0774987 | |||
| 2172 | Ga0501073_0122319 | |||
| 2173 | Ga0501073_0220470 | |||
| 2174 | Ga0501073_0312153 | |||
| 2175 | Ga0501074_0078530 | |||
| 2176 | Ga0501239_011449 | |||
| 2177 | Ga0501243_104316 | |||
| 2178 | Ga0501249_031256 | |||
| 2179 | Ga0501249_042546 | |||
| 2180 | Ga0501259_162896 | |||
| 2181 | Ga0501080_0022768 | |||
| 2182 | Ga0501080_0066732 | |||
| 2183 | Ga0501080_0534120 | |||
| 2184 | Ga0501035_0049199 | |||
| 2185 | Ga0501044_0190321 | |||
| 2186 | Ga0501226_000014 | |||
| 2187 | Ga0501284_07946 | |||
| 2188 | nmdc:mga05p37_305609_c1 | |||
| 2189 | nmdc:mga09592_57128_c1 | |||
| 2190 | nmdc:mga0qj67_118800_c1 | |||
| 2191 | nmdc:mga0qj67_19526_c1 | |||
| 2192 | nmdc:mga06r32_5777_c1 | |||
| 2193 | nmdc:mga08y16_1370944_c1 | |||
| 2194 | nmdc:mga08y16_198611_c1 | |||
| 2195 | nmdc:mga08y16_65241_c1 | |||
| 2196 | nmdc:mga08y16_995464_c1 | |||
| 2197 | nmdc:mga0sz30_11932_c1 | |||
| 2198 | Ga0500643_000103 | |||
| 2199 | Ga0500647_0072963 | |||
| 2200 | Ga0500583_0047702 | |||
| 2201 | Ga0500583_0062005 | |||
| 2202 | Ga0500583_0077694 | |||
| 2203 | Ga0500583_0151195 | |||
| 2204 | Ga0500651_0274044 | |||
| 2205 | Ga0500651_0313339 | |||
| 2206 | Ga0500651_0503661 | |||
| 2207 | Ga0500650_0229959 | |||
| 2208 | Ga0500555_000551 | |||
| 2209 | Ga0500556_0087502 | |||
| 2210 | Ga0500594_0017489 | |||
| 2211 | Ga0500595_146282 | |||
| 2212 | Ga0500617_033366 | |||
| 2213 | Ga0500642_0144480 | |||
| 2214 | Ga0500642_0200660 | |||
| 2215 | Ga0500652_070846 | |||
| 2216 | Ga0500658_0034153 | |||
| 2217 | Ga0500559_0326671 | |||
| 2218 | Ga0500559_0538403 | |||
| 2219 | Ga0500564_013817 | |||
| 2220 | Ga0500568_0027470 | |||
| 2221 | Ga0500568_0089089 | |||
| 2222 | Ga0500588_0000369 | |||
| 2223 | Ga0500588_0018445 | |||
| 2224 | Ga0500589_103534 | |||
| 2225 | Ga0500604_0021592 | |||
| 2226 | Ga0500616_0000299 | |||
| 2227 | Ga0500622_0001304 | |||
| 2228 | Ga0500622_0013308 | |||
| 2229 | Ga0500627_0387286 | |||
| 2230 | Ga0500633_0074965 | |||
| 2231 | Ga0500637_0025672 | |||
| 2232 | Ga0500611_055889 | |||
| 2233 | Ga0500645_001366 | |||
| 2234 | Ga0500661_015697 | |||
| 2235 | Ga0590071_041949 | |||
| 2236 | Ga0466962_0003000 | |||
| 2237 | Ga0466962_0003956 | |||
| 2238 | 2578458447 | |||
| 2239 | 2595447041 | |||
| 2240 | 2595449803 | |||
| 2241 | 2643896715 | |||
| 2242 | 2644478920 | |||
| 2243 | 2721026295 | |||
| 2244 | 2735833728 | |||
| 2245 | 2739228716 | |||
| 2246 | 2739732216 | |||
| 2247 | 2816517019 | |||
| 2248 | 2819564183 | |||
| 2249 | 2842392996 | |||
| 2250 | 2842757816 | |||
| 2251 | 2842918073 | |||
| 2252 | 2842920102 | |||
| 2253 | 2874221601 | |||
| 2254 | 2884341717 | |||
| 2255 | 2884413645 | |||
| 2256 | 2895396578 | |||
| 2257 | 2904464820 | |||
| 2258 | 2919087531 | |||
| 2259 | 2919089734 | |||
| 2260 | 2919137674 | |||
| 2261 | 2919406337 | |||
| 2262 | 2928499438 | |||
| 2263 | 2928964901 | |||
| 2264 | 2931380776 | |||
| 2265 | 2939615228 | |||
| 2266 | 2939627350 | |||
| 2267 | 2941475353 | |||
| 2268 | 2953995392 | |||
| 2269 | 2961048368 | |||
| 2270 | 2961066309 | |||
| 2271 | 2987606405 | |||
| 2272 | 3007318969 | |||
| 2273 | 8002746429 | |||
| 2274 | 8054359990 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1e6l-assembly1.cif.gz_A | two-component signal transduction system d13a mutant of chey | 0.9955 | 2 | 126 |
| 4hnq-assembly1.cif.gz_A | crystal structure of the mutant q97a of vibrio cholerae chey3 | 0.9951 | 1 | 123 |
| 4lx8-assembly1.cif.gz_A | crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae | 0.9949 | 1 | 123 |
| 3to5-assembly1.cif.gz_A | high resolution structure of chey3 from vibrio cholerae | 0.9948 | 1 | 123 |
| 1d4z-assembly1.cif.gz_A | crystal structure of chey-95iv, a hyperactive chey mutant | 0.9935 | 1 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9892 | 1 | 123 | 3.40.50.2300 |
| 4jp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9735 | 1 | 123 | 3.40.50.2300 |
| af_Q5A4X5_425_557_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9498 | 7 | 121 | 3.40.50.2300 |
| af_A0A0R0KVT4_634_762_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.948 | 5 | 129 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9474 | 3 | 122 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A246HIK8-F1-model_v4 | Response regulator | 1.003 | 5 | 130 |
GO:0000160
|
| AF-A0A2S6B2H8-F1-model_v4 | Chemotaxis protein CheY | 1.003 | 5 | 130 |
GO:0000160
|
| AF-A0A1G4AJ01-F1-model_v4 | deleted | 1.003 | 5 | 130 |
|
| AF-A0A3R8TY53-F1-model_v4 | Response regulator | 1.002 | 5 | 130 |
GO:0000160
|
| AF-A0A6N7K3T3-F1-model_v4 | deleted | 1.001 | 5 | 130 |
|