F490653

General Info

Members Datasets Scaffolds Average Seq Length
1137 633 2274 251

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_39189_c1|nmdc:mga0yw44_39189_c1_935_1783
Length 282
Sequence LVGALARALDCFVASLLAMTVGARLHQTSKDPRVLVVDGLVKRFGGFTAVSNVSFKVEQGEILGLIGPNGSGKSTIFNMLSGTFAPTSGSMKFLGAELSGLPPHRIINSGIGRTFQIPRPFHRLTIFENVALAGYFGQGRKSRTEAEAAAERALAMVGLPTDRFSVVEGLGAAGLKKLELAKALATAPKLLLADESLGGLDETEMEQAADMLRKIRDELGITIIWVEHIMGVLMRVVDRVMVLDHGEKISEGLPAEVASDPRVIEVYLGTDANAVQAAAARG

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
119 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
120 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
121 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
191 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
207 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
361 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
362 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
386 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
387 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
388 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
389 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
390 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
391 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
395 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
398 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
399 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
400 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
405 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
406 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
407 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
408 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
409 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
410 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
411 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
412 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
415 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
416 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
417 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
418 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
419 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
420 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
421 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
422 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
423 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
424 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
425 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
426 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
427 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
428 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
429 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
430 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
431 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
432 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
433 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
434 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
435 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
436 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
437 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
438 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
439 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
440 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
441 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
442 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
443 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
444 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
445 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
446 2791355199
447 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
448 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
449 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
450 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
451 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
452 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
453 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
454 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
455 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
456 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
457 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
458 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
459 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
460 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
461 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
462 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
463 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
464 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
465 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
466 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
467 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
468 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
469 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
470 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
471 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
472 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
473 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
474 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
475 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
476 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
477 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
478 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
479 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
480 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
481 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
482 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
483 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
484 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
485 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
486 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
487 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
488 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
489 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
490 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
491 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
492 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
493 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
494 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
495 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
496 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
497 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
498 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
499 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
500 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
501 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
502 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
503 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
504 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
505 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
506 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
507 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
508 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
509 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
510 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
511 2904699407
512 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
513 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
514 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
515 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
516 2906610324
517 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
518 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
519 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
520 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
521 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
522 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
523 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
524 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
525 2922368715
526 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
527 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
528 2922425934
529 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
530 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
531 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
532 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
533 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
534 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
535 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
536 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
537 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
538 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
539 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
540 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
541 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
542 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
543 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
544 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
545 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
546 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
547 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
548 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
549 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
550 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
551 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
552 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
553 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
554 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
555 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
556 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
557 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
558 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
559 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
560 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
561 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
562 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
563 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
564 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
565 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
566 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
567 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
568 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
569 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
570 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
571 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
572 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
573 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
574 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
575 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
576 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
577 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
578 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
579 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
580 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
581 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
582 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
583 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
584 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
585 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
586 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
587 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
588 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
589 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
590 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
591 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
592 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
593 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
594 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
595 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
596 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
597 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
598 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
599 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
600 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
601 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
602 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
603 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
604 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
605 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
606 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
607 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
608 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
609 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
610 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
611 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
612 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
613 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
614 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
615 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
616 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
617 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
618 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
619 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
620 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
621 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
622 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
623 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
624 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
625 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
626 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
627 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
628 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
629 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
630 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
631 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
632 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
633 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.01
Metatranscriptomes 0.09
Isolates 18.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.64
Nodule 15.3
Rhizoplane 4.57
Rhizosphere 61.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_39189_c1 3300050492 Bacteria 2808
2 JGI25406J46586_10000021 3300003203 Bacteria 84514
3 JGI25406J46586_10071581 3300003203 Bacteria 1087
4 JGI25165J46597_1013442 3300003214 Bacteria 1127
5 JGI25165J46597_1013978 3300003214 Bacteria 1097
6 JGI25153J46596_10001764 3300003215 Bacteria 12825
7 JGI25153J46596_10007736 3300003215 Bacteria 5231
8 JGI25153J46596_10041659 3300003215 Bacteria 1410
9 JGI25160J50197_1000533 3300003354 Bacteria 21926
10 JGI25160J50197_1002209 3300003354 Bacteria 9141
11 JGI25160J50197_1002315 3300003354 Bacteria 8917
12 Ga0055531_10010491 3300003794 Bacteria 4596
13 Ga0065165_1000437 3300005262 Bacteria 65503
14 Ga0065165_1001951 3300005262 Bacteria 19574
15 Ga0065165_1005934 3300005262 Bacteria 6618
16 Ga0065704_10079857 3300005289 Bacteria 4063
17 Ga0070658_10017440 3300005327 Bacteria 5745
18 Ga0070658_10249576 3300005327 Bacteria 1505
19 Ga0070658_10259658 3300005327 Bacteria 1475
20 Ga0070683_100007819 3300005329 Bacteria 9055
21 Ga0070683_100018850 3300005329 Bacteria 6122
22 Ga0070683_100138115 3300005329 Bacteria 2309
23 Ga0070670_100360731 3300005331 Bacteria 1278
24 Ga0070680_100006251 3300005336 Bacteria 9034
25 Ga0070680_100032424 3300005336 Bacteria 4205
26 Ga0070680_100070553 3300005336 Bacteria 2869
27 Ga0070680_100078969 3300005336 Bacteria 2712
28 Ga0070682_100278749 3300005337 Bacteria 1218
29 Ga0070682_100453505 3300005337 Bacteria 983
30 Ga0068868_100036837 3300005338 Bacteria 3789
31 Ga0068868_100232222 3300005338 Bacteria 1548
32 Ga0068868_100754659 3300005338 Bacteria 874
33 Ga0070660_100009076 3300005339 Bacteria 6981
34 Ga0070660_100012308 3300005339 Bacteria 6106
35 Ga0070660_100551601 3300005339 Bacteria 961
36 Ga0070689_100491852 3300005340 Bacteria 1049
37 Ga0070691_10029547 3300005341 Bacteria 2565
38 Ga0070661_100268111 3300005344 Bacteria 1321
39 Ga0070661_100495007 3300005344 Bacteria 978
40 Ga0070668_100076646 3300005347 Bacteria 2612
41 Ga0070669_100115646 3300005353 Bacteria 2041
42 Ga0070669_100312295 3300005353 Bacteria 1267
43 Ga0070669_100437785 3300005353 Bacteria 1075
44 Ga0070675_100125583 3300005354 Bacteria 2182
45 Ga0070671_100006274 3300005355 Bacteria 9475
46 Ga0070671_100117771 3300005355 Bacteria 2233
47 Ga0070674_100122168 3300005356 Bacteria 1929
48 Ga0070674_100245063 3300005356 Bacteria 1405
49 Ga0070673_100150646 3300005364 Bacteria 1970
50 Ga0070688_100022950 3300005365 Bacteria 3663
51 Ga0070659_100030190 3300005366 Bacteria 4193
52 Ga0070667_100068279 3300005367 Bacteria 3024
53 Ga0070667_100378558 3300005367 Bacteria 1285
54 Ga0070667_100441429 3300005367 Bacteria 1188
55 Ga0070709_10008334 3300005434 Bacteria 5691
56 Ga0070714_100003380 3300005435 Bacteria 11890
57 Ga0070714_100012203 3300005435 Bacteria 6851
58 Ga0070713_100000939 3300005436 Bacteria 18616
59 Ga0070713_100087752 3300005436 Bacteria 2669
60 Ga0070713_100681701 3300005436 Bacteria 980
61 Ga0070713_100767846 3300005436 Bacteria 923
62 Ga0070710_10005443 3300005437 Bacteria 6048
63 Ga0070710_10056700 3300005437 Bacteria 2217
64 Ga0070710_10282229 3300005437 Bacteria 1078
65 Ga0070711_100022144 3300005439 Bacteria 4115
66 Ga0070711_100028249 3300005439 Bacteria 3690
67 Ga0070711_100029733 3300005439 Bacteria 3609
68 Ga0070711_100277063 3300005439 Bacteria 1326
69 Ga0070711_100369753 3300005439 Bacteria 1157
70 Ga0070694_100305324 3300005444 Bacteria 1221
71 Ga0070708_100028554 3300005445 Bacteria 4802
72 Ga0070708_100269230 3300005445 Bacteria 1602
73 Ga0070663_100054671 3300005455 Bacteria 2854
74 Ga0070663_100080851 3300005455 Bacteria 2387
75 Ga0070663_100121355 3300005455 Bacteria 1974
76 Ga0070678_100049644 3300005456 Bacteria 3029
77 Ga0070678_100123124 3300005456 Bacteria 2048
78 Ga0070681_10020913 3300005458 Bacteria 6554
79 Ga0070681_10150518 3300005458 Bacteria 2254
80 Ga0070681_10167923 3300005458 Bacteria 2116
81 Ga0070706_100039312 3300005467 Bacteria 4367
82 Ga0070707_100040622 3300005468 Bacteria 4451
83 Ga0070707_100055661 3300005468 Bacteria 3792
84 Ga0070707_100062519 3300005468 Bacteria 3572
85 Ga0070698_100001171 3300005471 Bacteria 29108
86 Ga0070679_100005687 3300005530 Bacteria 11562
87 Ga0070679_100027474 3300005530 Bacteria 5601
88 Ga0070679_100034479 3300005530 Bacteria 5016
89 Ga0070684_100011854 3300005535 Bacteria 6960
90 Ga0070684_100094848 3300005535 Bacteria 2658
91 Ga0070684_100129711 3300005535 Bacteria 2274
92 Ga0070684_100609185 3300005535 Bacteria 1016
93 Ga0070697_100001434 3300005536 Bacteria 18124
94 Ga0070697_100013379 3300005536 Bacteria 6436
95 Ga0068853_100007962 3300005539 Bacteria 8498
96 Ga0068853_100084860 3300005539 Bacteria 2775
97 Ga0070672_100500756 3300005543 Bacteria 1051
98 Ga0070686_100108526 3300005544 Bacteria 1887
99 Ga0070665_100003622 3300005548 Bacteria 16361
100 Ga0070665_100131091 3300005548 Bacteria 2509
101 Ga0070665_100201173 3300005548 Bacteria 1992
102 Ga0070665_100599469 3300005548 Bacteria 1115
103 Ga0068855_100035351 3300005563 Bacteria 5952
104 Ga0068855_100084816 3300005563 Bacteria 3666
105 Ga0068855_100145510 3300005563 Bacteria 2698
106 Ga0068855_100463973 3300005563 Bacteria 1381
107 Ga0068855_100508234 3300005563 Bacteria 1309
108 Ga0070664_100077079 3300005564 Bacteria 2866
109 Ga0070664_100232809 3300005564 Bacteria 1651
110 Ga0070664_100293980 3300005564 Bacteria 1467
111 Ga0070664_100329970 3300005564 Bacteria 1384
112 Ga0070664_100469444 3300005564 Bacteria 1157
113 Ga0068857_100004239 3300005577 Bacteria 12087
114 Ga0068857_100070627 3300005577 Bacteria 3111
115 Ga0068857_100192524 3300005577 Bacteria 1857
116 Ga0068857_100497522 3300005577 Bacteria 1144
117 Ga0068856_100036156 3300005614 Bacteria 4843
118 Ga0068856_100038973 3300005614 Bacteria 4666
119 Ga0068856_100041669 3300005614 Bacteria 4513
120 Ga0068856_100059548 3300005614 Bacteria 3772
121 Ga0068856_100306205 3300005614 Bacteria 1607
122 Ga0068856_100853679 3300005614 Bacteria 930
123 Ga0070702_100115063 3300005615 Bacteria 1674
124 Ga0070702_100268937 3300005615 Bacteria 1164
125 Ga0068852_100009742 3300005616 Bacteria 7142
126 Ga0068852_100037809 3300005616 Bacteria 4051
127 Ga0068852_100171045 3300005616 Bacteria 2036
128 Ga0068852_100562699 3300005616 Bacteria 1141
129 Ga0068864_100291144 3300005618 Bacteria 1526
130 Ga0068866_10118362 3300005718 Bacteria 1489
131 Ga0068866_10170388 3300005718 Bacteria 1277
132 Ga0068861_100358014 3300005719 Bacteria 1282
133 Ga0068870_10137818 3300005840 Bacteria 1425
134 Ga0068870_10156974 3300005840 Bacteria 1346
135 Ga0068870_10494468 3300005840 Bacteria 814
136 Ga0068863_100428954 3300005841 Bacteria 1296
137 Ga0068863_100531831 3300005841 Bacteria 1160
138 Ga0068858_100086252 3300005842 Bacteria 2920
139 Ga0068860_100017528 3300005843 Bacteria 6977
140 Ga0068860_100750385 3300005843 Bacteria 987
141 Ga0068862_100243694 3300005844 Bacteria 1635
142 Ga0081455_10002021 3300005937 Bacteria 24257
143 Ga0081455_10005318 3300005937 Bacteria 14137
144 Ga0081455_10010563 3300005937 Bacteria 9350
145 Ga0081455_10021579 3300005937 Bacteria 6037
146 Ga0081455_10033400 3300005937 Bacteria 4624
147 Ga0081455_10406680 3300005937 Bacteria 943
148 Ga0081538_10071692 3300005981 Bacteria 1904
149 Ga0081540_1002252 3300005983 Bacteria 15882
150 Ga0081540_1004972 3300005983 Bacteria 9997
151 Ga0081540_1005512 3300005983 Bacteria 9439
152 Ga0081540_1023004 3300005983 Bacteria 3662
153 Ga0081539_10000051 3300005985 Bacteria 268337
154 Ga0081539_10031311 3300005985 Bacteria 3282
155 Ga0081539_10155619 3300005985 Bacteria 1095
156 Ga0070717_10001555 3300006028 Bacteria 15906
157 Ga0070717_10176264 3300006028 Bacteria 1862
158 Ga0075365_10003263 3300006038 Bacteria 8312
159 Ga0075365_10006261 3300006038 Bacteria 6528
160 Ga0075365_10052047 3300006038 Bacteria 2707
161 Ga0075365_10130310 3300006038 Bacteria 1740
162 Ga0075365_10149555 3300006038 Bacteria 1624
163 Ga0075365_10187342 3300006038 Bacteria 1447
164 Ga0075368_10003112 3300006042 Bacteria 5506
165 Ga0075368_10117910 3300006042 Bacteria 1098
166 Ga0075363_100022684 3300006048 Bacteria 3175
167 Ga0075364_10026988 3300006051 Bacteria 3666
168 Ga0070715_10000321 3300006163 Bacteria 11851
169 Ga0070716_100018951 3300006173 Bacteria 3591
170 Ga0070712_100027309 3300006175 Bacteria 3810
171 Ga0070712_100293545 3300006175 Bacteria 1313
172 Ga0070712_100355147 3300006175 Bacteria 1201
173 Ga0070712_100363135 3300006175 Bacteria 1188
174 Ga0075362_10096079 3300006177 Bacteria 1380
175 Ga0075362_10164181 3300006177 Bacteria 1070
176 Ga0075367_10018878 3300006178 Bacteria 3812
177 Ga0075367_10022791 3300006178 Bacteria 3516
178 Ga0075367_10092278 3300006178 Bacteria 1843
179 Ga0075367_10122321 3300006178 Bacteria 1604
180 Ga0075369_10002166 3300006186 Bacteria 6941
181 Ga0075369_10015331 3300006186 Bacteria 3074
182 Ga0075369_10019801 3300006186 Bacteria 2750
183 Ga0075366_10007150 3300006195 Bacteria 6148
184 Ga0075366_10025959 3300006195 Bacteria 3427
185 Ga0097621_100055265 3300006237 Bacteria 3241
186 Ga0097621_100228350 3300006237 Bacteria 1624
187 Ga0075370_10073310 3300006353 Bacteria 1960
188 Ga0075370_10139916 3300006353 Bacteria 1414
189 Ga0075370_10271548 3300006353 Bacteria 1006
190 Ga0075428_100673822 3300006844 Bacteria 1102
191 Ga0075431_100133077 3300006847 Bacteria 2564
192 Ga0075433_10254554 3300006852 Bacteria 1557
193 Ga0075434_100006679 3300006871 Bacteria 10594
194 Ga0075434_100736311 3300006871 Bacteria 1003
195 Ga0068865_100135239 3300006881 Bacteria 1851
196 Ga0068865_100293503 3300006881 Bacteria 1299
197 Ga0068865_100306497 3300006881 Bacteria 1273
198 Ga0075436_100127649 3300006914 Bacteria 1782
199 Ga0099825_1026932 3300006941 Bacteria 2995
200 Ga0099825_1036080 3300006941 Bacteria 1725
201 Ga0099824_1004900 3300006942 Bacteria 19056
202 Ga0099824_1029293 3300006942 Bacteria 2370
203 Ga0099822_1000677 3300006943 Bacteria 34391
204 Ga0099794_10016964 3300007265 Bacteria 3238
205 Ga0099794_10032789 3300007265 Bacteria 2440
206 Ga0099794_10044823 3300007265 Bacteria 2114
207 Ga0099794_10134788 3300007265 Bacteria 1248
208 Ga0099794_10226182 3300007265 Bacteria 962
209 Ga0099795_10044876 3300007788 Bacteria 1587
210 Ga0099795_10068576 3300007788 Bacteria 1333
211 Ga0105240_10008025 3300009093 Bacteria 15195
212 Ga0105240_10027519 3300009093 Bacteria 7441
213 Ga0105240_10092107 3300009093 Bacteria 3702
214 Ga0105240_10102898 3300009093 Bacteria 3470
215 Ga0105240_10129550 3300009093 Bacteria 3028
216 Ga0105240_10191853 3300009093 Bacteria 2402
217 Ga0111539_10115084 3300009094 Bacteria 3154
218 Ga0111539_10814305 3300009094 Bacteria 1087
219 Ga0105245_10009595 3300009098 Bacteria 8440
220 Ga0105245_10046290 3300009098 Bacteria 3887
221 Ga0105245_10049453 3300009098 Bacteria 3765
222 Ga0105245_10200464 3300009098 Bacteria 1916
223 Ga0105247_10318583 3300009101 Bacteria 1084
224 Ga0105243_10230664 3300009148 Bacteria 1642
225 Ga0105241_10054382 3300009174 Bacteria 3064
226 Ga0105242_10560681 3300009176 Bacteria 1097
227 Ga0105248_10027404 3300009177 Bacteria 6343
228 Ga0105248_10137102 3300009177 Bacteria 2760
229 Ga0105248_10383139 3300009177 Bacteria 1583
230 Ga0105237_10003348 3300009545 Bacteria 19080
231 Ga0105237_10051893 3300009545 Bacteria 4119
232 Ga0105237_10233929 3300009545 Bacteria 1838
233 Ga0105237_10491428 3300009545 Bacteria 1234
234 Ga0105237_10949104 3300009545 Bacteria 867
235 Ga0105238_10193984 3300009551 Bacteria 2007
236 Ga0105238_10561585 3300009551 Bacteria 1146
237 Ga0099796_10014373 3300010159 Bacteria 2285
238 Ga0099796_10053888 3300010159 Bacteria 1404
239 Ga0099796_10061675 3300010159 Bacteria 1331
240 Ga0099796_10109316 3300010159 Bacteria 1050
241 Ga0105239_10018332 3300010375 Bacteria 7738
242 Ga0105239_10132942 3300010375 Bacteria 2768
243 Ga0105239_10139612 3300010375 Bacteria 2700
244 Ga0105246_10070617 3300011119 Bacteria 2457
245 Ga0105246_10132124 3300011119 Bacteria 1866
246 Ga0157320_1003403 3300012481 Bacteria 962
247 Ga0157370_10105927 3300013104 Bacteria 2631
248 Ga0157369_10043168 3300013105 Bacteria 4915
249 Ga0157369_10045599 3300013105 Bacteria 4766
250 Ga0157369_10313896 3300013105 Bacteria 1630
251 Ga0157369_10352908 3300013105 Bacteria 1527
252 Ga0157374_10024124 3300013296 Bacteria 5449
253 Ga0157378_10399533 3300013297 Bacteria 1354
254 Ga0157378_10706135 3300013297 Bacteria 1028
255 Ga0163162_10122853 3300013306 Bacteria 2701
256 Ga0163162_10129762 3300013306 Bacteria 2629
257 Ga0157372_10591317 3300013307 Bacteria 1294
258 Ga0157375_10038248 3300013308 Bacteria 4606
259 Ga0157375_10410319 3300013308 Bacteria 1521
260 Ga0157375_10433628 3300013308 Bacteria 1480
261 Ga0157375_11146602 3300013308 Bacteria 911
262 Ga0163163_10063041 3300014325 Bacteria 3675
263 Ga0163163_10381062 3300014325 Bacteria 1468
264 Ga0163163_10627665 3300014325 Bacteria 1138
265 Ga0163163_10723462 3300014325 Bacteria 1059
266 Ga0157380_10075130 3300014326 Bacteria 2746
267 Ga0157379_10133256 3300014968 Bacteria 2238
268 Ga0157376_10066771 3300014969 Bacteria 3041
269 Ga0157376_10250391 3300014969 Bacteria 1654
270 Ga0157376_10270500 3300014969 Bacteria 1596
271 Ga0163161_10131788 3300017792 Bacteria 1886
272 Ga0206353_11683564 3300020082 Bacteria 6347
273 Ga0214544_1000026 3300021320 Bacteria 161530
274 Ga0214542_1000025 3300021321 Bacteria 183588
275 Ga0214545_1000014 3300021324 Bacteria 183588
276 Ga0214543_1000034 3300021327 Bacteria 183712
277 Ga0213871_10048088 3300021441 Bacteria 1162
278 Ga0209677_103618 3300025253 Bacteria 4887
279 Ga0209148_1002608 3300025254 Bacteria 5894
280 Ga0209233_1001880 3300025261 Bacteria 8058
281 Ga0209233_1011138 3300025261 Bacteria 2659
282 Ga0209455_1000714 3300025272 Bacteria 19245
283 Ga0209564_1012021 3300025295 Bacteria 3815
284 Ga0209758_1000141 3300025297 Bacteria 172481
285 Ga0209758_1000324 3300025297 Bacteria 91475
286 Ga0209758_1001019 3300025297 Bacteria 37066
287 Ga0209758_1002338 3300025297 Bacteria 19567
288 Ga0209758_1002921 3300025297 Bacteria 16464
289 Ga0209758_1003483 3300025297 Bacteria 14255
290 Ga0209758_1041951 3300025297 Bacteria 1703
291 Ga0209758_1049944 3300025297 Bacteria 1471
292 Ga0209256_1002956 3300025299 Bacteria 12733
293 Ga0207426_1000437 3300025302 Bacteria 67439
294 Ga0207426_1001139 3300025302 Bacteria 24022
295 Ga0207426_1012626 3300025302 Bacteria 3166
296 Ga0207426_1021983 3300025302 Bacteria 2196
297 Ga0209257_1003859 3300025304 Bacteria 12250
298 Ga0209257_1011469 3300025304 Bacteria 4263
299 Ga0207656_10167256 3300025321 Bacteria 1049
300 Ga0207692_10066855 3300025898 Bacteria 1880
301 Ga0207692_10191103 3300025898 Bacteria 1198
302 Ga0207710_10038841 3300025900 Bacteria 2105
303 Ga0207710_10075663 3300025900 Bacteria 1552
304 Ga0207688_10291507 3300025901 Bacteria 996
305 Ga0207647_10040227 3300025904 Bacteria 2946
306 Ga0207685_10010055 3300025905 Bacteria 2776
307 Ga0207685_10166020 3300025905 Bacteria 1012
308 Ga0207699_10060253 3300025906 Bacteria 2278
309 Ga0207645_10061804 3300025907 Bacteria 2393
310 Ga0207643_10136362 3300025908 Bacteria 1463
311 Ga0207643_10431633 3300025908 Bacteria 836
312 Ga0207705_10052750 3300025909 Bacteria 2928
313 Ga0207705_10205811 3300025909 Bacteria 1492
314 Ga0207684_10048065 3300025910 Bacteria 3619
315 Ga0207654_10012845 3300025911 Bacteria 4297
316 Ga0207707_10011843 3300025912 Bacteria 7585
317 Ga0207707_10043382 3300025912 Bacteria 3923
318 Ga0207707_10056384 3300025912 Bacteria 3418
319 Ga0207695_10000062 3300025913 Bacteria 351979
320 Ga0207695_10036649 3300025913 Bacteria 5300
321 Ga0207695_10050434 3300025913 Bacteria 4378
322 Ga0207695_10212050 3300025913 Bacteria 1847
323 Ga0207671_10001897 3300025914 Bacteria 23245
324 Ga0207671_10131265 3300025914 Bacteria 1923
325 Ga0207671_10278295 3300025914 Bacteria 1319
326 Ga0207671_10647273 3300025914 Bacteria 842
327 Ga0207693_10030645 3300025915 Bacteria 4249
328 Ga0207693_10035323 3300025915 Bacteria 3941
329 Ga0207693_10280293 3300025915 Bacteria 1306
330 Ga0207663_10000926 3300025916 Bacteria 13406
331 Ga0207663_10012381 3300025916 Bacteria 4611
332 Ga0207663_10012457 3300025916 Bacteria 4599
333 Ga0207663_10252150 3300025916 Bacteria 1299
334 Ga0207660_10010384 3300025917 Bacteria 6041
335 Ga0207660_10013462 3300025917 Bacteria 5361
336 Ga0207660_10064854 3300025917 Bacteria 2637
337 Ga0207662_10104306 3300025918 Bacteria 1760
338 Ga0207657_10011417 3300025919 Bacteria 8818
339 Ga0207657_10062591 3300025919 Bacteria 3185
340 Ga0207657_10095681 3300025919 Bacteria 2471
341 Ga0207657_10659467 3300025919 Bacteria 814
342 Ga0207649_10304132 3300025920 Bacteria 1167
343 Ga0207649_10312591 3300025920 Bacteria 1152
344 Ga0207652_10005840 3300025921 Bacteria 9970
345 Ga0207652_10008077 3300025921 Bacteria 8447
346 Ga0207652_10159211 3300025921 Bacteria 2024
347 Ga0207646_10092019 3300025922 Bacteria 2714
348 Ga0207681_10171301 3300025923 Bacteria 1646
349 Ga0207694_10041128 3300025924 Bacteria 3561
350 Ga0207694_10125399 3300025924 Bacteria 2054
351 Ga0207694_10332653 3300025924 Bacteria 1255
352 Ga0207694_10657440 3300025924 Bacteria 883
353 Ga0207650_10477340 3300025925 Bacteria 1040
354 Ga0207659_10306724 3300025926 Bacteria 1306
355 Ga0207659_10319165 3300025926 Bacteria 1281
356 Ga0207659_10380343 3300025926 Bacteria 1177
357 Ga0207687_10063361 3300025927 Bacteria 2617
358 Ga0207700_10030217 3300025928 Bacteria 3834
359 Ga0207700_10387998 3300025928 Bacteria 1222
360 Ga0207664_10114229 3300025929 Bacteria 2250
361 Ga0207664_10130542 3300025929 Bacteria 2114
362 Ga0207644_10091325 3300025931 Bacteria 2270
363 Ga0207644_10114849 3300025931 Bacteria 2041
364 Ga0207706_10039308 3300025933 Bacteria 4194
365 Ga0207686_10553293 3300025934 Bacteria 900
366 Ga0207709_10019091 3300025935 Bacteria 3847
367 Ga0207709_10081552 3300025935 Bacteria 2086
368 Ga0207670_10046656 3300025936 Bacteria 2880
369 Ga0207670_10073089 3300025936 Bacteria 2377
370 Ga0207669_10047148 3300025937 Bacteria 2550
371 Ga0207669_10211514 3300025937 Bacteria 1416
372 Ga0207669_10447414 3300025937 Bacteria 1023
373 Ga0207669_10651625 3300025937 Bacteria 861
374 Ga0207704_10072288 3300025938 Bacteria 2192
375 Ga0207704_10088136 3300025938 Bacteria 2029
376 Ga0207704_10470754 3300025938 Bacteria 1007
377 Ga0207665_10000715 3300025939 Bacteria 22506
378 Ga0207665_10261719 3300025939 Bacteria 1282
379 Ga0207691_10063675 3300025940 Bacteria 3344
380 Ga0207691_10116093 3300025940 Bacteria 2376
381 Ga0207691_10213593 3300025940 Bacteria 1675
382 Ga0207711_10032480 3300025941 Bacteria 4413
383 Ga0207711_10034481 3300025941 Bacteria 4286
384 Ga0207711_10095313 3300025941 Bacteria 2624
385 Ga0207711_10115517 3300025941 Bacteria 2392
386 Ga0207711_10745732 3300025941 Bacteria 913
387 Ga0207661_10125062 3300025944 Bacteria 2195
388 Ga0207679_10198149 3300025945 Bacteria 1675
389 Ga0207679_10207468 3300025945 Bacteria 1641
390 Ga0207679_10707392 3300025945 Bacteria 915
391 Ga0207667_10019759 3300025949 Bacteria 7509
392 Ga0207667_10040667 3300025949 Bacteria 4950
393 Ga0207667_10042644 3300025949 Bacteria 4821
394 Ga0207667_10181315 3300025949 Bacteria 2162
395 Ga0207651_10052902 3300025960 Bacteria 2772
396 Ga0207651_10295961 3300025960 Bacteria 1344
397 Ga0207712_10156362 3300025961 Bacteria 1767
398 Ga0207668_10029821 3300025972 Bacteria 3579
399 Ga0207668_10574674 3300025972 Bacteria 979
400 Ga0207640_10074823 3300025981 Bacteria 2293
401 Ga0207640_10083988 3300025981 Bacteria 2185
402 Ga0207677_10010248 3300026023 Bacteria 5298
403 Ga0207677_10087447 3300026023 Bacteria 2256
404 Ga0207677_10370482 3300026023 Bacteria 1206
405 Ga0207703_10186209 3300026035 Bacteria 1835
406 Ga0207639_10006228 3300026041 Bacteria 8104
407 Ga0207639_10058222 3300026041 Bacteria 2971
408 Ga0207639_10257163 3300026041 Bacteria 1525
409 Ga0207639_10289894 3300026041 Bacteria 1443
410 Ga0207678_10039631 3300026067 Bacteria 4088
411 Ga0207678_10076090 3300026067 Bacteria 2875
412 Ga0207678_10083060 3300026067 Bacteria 2740
413 Ga0207678_10085101 3300026067 Bacteria 2703
414 Ga0207678_10085928 3300026067 Bacteria 2689
415 Ga0207678_10095571 3300026067 Bacteria 2539
416 Ga0207678_10251846 3300026067 Bacteria 1512
417 Ga0207678_10317088 3300026067 Bacteria 1341
418 Ga0207678_10451613 3300026067 Bacteria 1117
419 Ga0207702_10023918 3300026078 Bacteria 5068
420 Ga0207702_10067051 3300026078 Bacteria 3079
421 Ga0207702_10232917 3300026078 Bacteria 1722
422 Ga0207702_10559492 3300026078 Bacteria 1119
423 Ga0207648_10411454 3300026089 Bacteria 1227
424 Ga0207676_10006987 3300026095 Bacteria 8001
425 Ga0207674_10008791 3300026116 Bacteria 11628
426 Ga0207674_10023230 3300026116 Bacteria 6643
427 Ga0207674_10384137 3300026116 Bacteria 1358
428 Ga0207674_10452030 3300026116 Bacteria 1242
429 Ga0207675_100414243 3300026118 Bacteria 1330
430 Ga0207683_10038111 3300026121 Bacteria 4187
431 Ga0207683_10062431 3300026121 Bacteria 3281
432 Ga0207683_10092916 3300026121 Bacteria 2688
433 Ga0207683_10107125 3300026121 Bacteria 2500
434 Ga0207683_10402777 3300026121 Bacteria 1259
435 Ga0207683_10607401 3300026121 Bacteria 1013
436 Ga0207698_10055595 3300026142 Bacteria 3051
437 Ga0209389_1000004 3300027296 Bacteria 263759
438 Ga0209389_1000023 3300027296 Bacteria 150730
439 Ga0209589_1000006 3300027357 Bacteria 436292
440 Ga0209589_1000010 3300027357 Bacteria 237657
441 Ga0209489_100007 3300027361 Bacteria 436292
442 Ga0209489_100011 3300027361 Bacteria 244710
443 Ga0209489_100777 3300027361 Bacteria 63061
444 Ga0209700_100008 3300027363 Bacteria 436292
445 Ga0209700_100013 3300027363 Bacteria 341906
446 Ga0209179_1028101 3300027512 Bacteria 1138
447 Ga0209813_10074995 3300027866 Bacteria 1107
448 Ga0268266_10007855 3300028379 Bacteria 9556
449 Ga0268266_10060020 3300028379 Bacteria 3277
450 Ga0268266_10075867 3300028379 Bacteria 2920
451 Ga0268266_10102049 3300028379 Bacteria 2530
452 Ga0268266_10317838 3300028379 Bacteria 1456
453 Ga0268266_10336916 3300028379 Bacteria 1415
454 Ga0268266_10405734 3300028379 Bacteria 1289
455 Ga0268265_10072751 3300028380 Bacteria 2682
456 Ga0268265_10264389 3300028380 Bacteria 1531
457 Ga0268264_10004708 3300028381 Bacteria 11595
458 Ga0268264_10769153 3300028381 Bacteria 960
459 Ga0265334_10011723 3300028573 Bacteria 3685
460 Ga0307517_10000102 3300028786 Bacteria 123775
461 Ga0307515_10163632 3300028794 Bacteria 2255
462 Ga0307515_10251290 3300028794 Bacteria 1520
463 Ga0265338_10016198 3300028800 Bacteria 8130
464 Ga0307512_10009735 3300030522 Bacteria 9232
465 Ga0265340_10030010 3300031247 Bacteria 2728
466 Ga0307408_100139822 3300031548 Bacteria 1899
467 Ga0316575_10108947 3300031665 Bacteria 1129
468 Ga0316579_10013729 3300031691 Bacteria 3488
469 Ga0307516_10036663 3300031730 Bacteria 4907
470 Ga0307516_10358347 3300031730 Bacteria 1123
471 Ga0307413_10121182 3300031824 Bacteria 1772
472 Ga0307413_10143469 3300031824 Bacteria 1653
473 Ga0307413_10334269 3300031824 Bacteria 1162
474 Ga0307410_10086323 3300031852 Bacteria 2216
475 Ga0307407_10068519 3300031903 Bacteria 2102
476 Ga0307407_10100790 3300031903 Bacteria 1792
477 Ga0307412_10180317 3300031911 Bacteria 1588
478 Ga0307412_10667717 3300031911 Bacteria 888
479 Ga0307409_100070083 3300031995 Bacteria 2781
480 Ga0307416_100123369 3300032002 Bacteria 2315
481 Ga0307416_100996608 3300032002 Bacteria 941
482 Ga0307411_10065049 3300032005 Bacteria 2444
483 Ga0307411_10374801 3300032005 Bacteria 1168
484 Ga0307415_100428988 3300032126 Bacteria 1137
485 Ga0307415_100459808 3300032126 Bacteria 1102
486 Ga0307510_10027691 3300033180 Bacteria 6487
487 Ga0307510_10069562 3300033180 Bacteria 3524
488 Ga0307510_10082857 3300033180 Bacteria 3100
489 Ga0315911_1000010 3300033442 Bacteria 322197
490 Ga0373934_0135960 3300035086 Bacteria 1004
491 Ga0373923_0049292 3300035111 Bacteria 1761
492 Ga0373936_0005468 3300035113 Bacteria 4793
493 Ga0373945_0010695 3300035116 Bacteria 3026
494 Ga0373953_0014626 3300035117 Bacteria 2827
495 Ga0373954_0000663 3300035118 Bacteria 13181
496 Ga0373954_0011852 3300035118 Bacteria 3872
497 Ga0373954_0075141 3300035118 Bacteria 1609
498 Ga0373956_0000275 3300035119 Bacteria 20650
499 Ga0373956_0035123 3300035119 Bacteria 2210
500 Ga0373956_0281819 3300035119 Bacteria 791
501 Ga0373943_0006136 3300035170 Bacteria 5399
502 Ga0373946_0031028 3300035171 Bacteria 2137
503 Ga0373955_0011037 3300035172 Bacteria 4290
504 Ga0373955_0016347 3300035172 Bacteria 3650
505 Ga0373962_0082935 3300035242 Bacteria 976
506 Ga0373924_0020143 3300035410 Bacteria 2590
507 Ga0373924_0050650 3300035410 Bacteria 1720
508 Ga0373931_0008479 3300035691 Bacteria 4878
509 Ga0373935_0000229 3300035692 Bacteria 27393
510 Ga0373935_0026632 3300035692 Bacteria 3571
511 Ga0373935_0300640 3300035692 Bacteria 1134
512 Ga0373935_0363066 3300035692 Bacteria 1034
513 Ga0373927_0000071 3300035695 Bacteria 73794
514 Ga0373927_0007062 3300035695 Bacteria 7614
515 Ga0373927_0011507 3300035695 Bacteria 5895
516 Ga0373927_0199615 3300035695 Bacteria 1313
517 Ga0373927_0438548 3300035695 Bacteria 862
518 Ga0373933_0004204 3300035724 Bacteria 7938
519 Ga0373933_0019834 3300035724 Bacteria 3805
520 Ga0373933_0034112 3300035724 Bacteria 2964
521 Ga0373933_0178675 3300035724 Bacteria 1353
522 Ga0373947_0000540 3300035725 Bacteria 22139
523 Ga0373947_0003876 3300035725 Bacteria 8805
524 Ga0373947_0306180 3300035725 Bacteria 1060
525 Ga0373937_0031431 3300036401 Bacteria 4811
526 Ga0373937_0045462 3300036401 Bacteria 4012
527 Ga0373937_0290559 3300036401 Bacteria 1544
528 Ga0373937_0323409 3300036401 Bacteria 1459
529 Ga0373925_0040457 3300037068 Bacteria 3451
530 Ga0373925_0054967 3300037068 Bacteria 2979
531 Ga0373925_0358485 3300037068 Bacteria 1185
532 Ga0395899_0001776 3300037312 Bacteria 17868
533 Ga0395899_0008599 3300037312 Bacteria 7860
534 Ga0395900_0013738 3300037418 Bacteria 8266
535 Ga0395900_0021345 3300037418 Bacteria 6619
536 Ga0395898_0006919 3300037466 Bacteria 12054
537 Ga0395898_0065456 3300037466 Bacteria 3524
538 Ga0395898_0140754 3300037466 Bacteria 2310
539 Ga0395898_0145508 3300037466 Bacteria 2268
540 Ga0395905_0030266 3300037471 Bacteria 5102
541 Ga0395905_0142623 3300037471 Bacteria 2253
542 Ga0436364_1430269 3300037853 Bacteria 1169
543 Ga0395901_0025268 3300038443 Bacteria 6097
544 Ga0395901_0282825 3300038443 Bacteria 1723
545 Ga0436365_1867717 3300039437 Bacteria 1052
546 Ga0436360_0467044 3300039438 Bacteria 14377
547 Ga0436360_1111241 3300039438 Bacteria 889
548 Ga0436360_1354586 3300039438 Bacteria 1549
549 Ga0436361_0035005 3300039447 Bacteria 2152
550 Ga0436361_0614601 3300039447 Bacteria 2199
551 Ga0436363_0950317 3300039450 Bacteria 1175
552 Ga0436362_0170791 3300039453 Bacteria 1708
553 Ga0439465_0021545 3300041413 Bacteria 2022
554 Ga0439441_001670 3300042001 Bacteria 2973
555 Ga0466972_0000193 3300044658 Bacteria 46863
556 Ga0466972_0014447 3300044658 Bacteria 3954
557 Ga0466965_0050459 3300044683 Bacteria 2063
558 Ga0466966_0000551 3300044684 Bacteria 23873
559 Ga0466961_0000020 3300044693 Bacteria 107610
560 Ga0466963_0014002 3300044694 Bacteria 4939
561 Ga0466963_0119916 3300044694 Bacteria 1809
562 Ga0466968_0009179 3300044735 Bacteria 3803
563 Ga0466968_0054595 3300044735 Bacteria 1713
564 Ga0466968_0079203 3300044735 Bacteria 1441
565 Ga0466968_0170083 3300044735 Bacteria 1009
566 Ga0466960_0039543 3300044901 Bacteria 2225
567 Ga0466967_0002756 3300045976 Bacteria 11112
568 Ga0466967_0014710 3300045976 Bacteria 6109
569 Ga0466967_0070110 3300045976 Bacteria 3135
570 Ga0466967_0311379 3300045976 Bacteria 1517
571 Ga0495617_026442 3300046452 Bacteria 1954
572 Ga0495617_079410 3300046452 Bacteria 1075
573 Ga0495592_0003051 3300046454 Bacteria 11938
574 Ga0495592_0003383 3300046454 Bacteria 11439
575 Ga0495592_0026973 3300046454 Bacteria 4355
576 Ga0495592_0049426 3300046454 Bacteria 3126
577 Ga0495592_0058136 3300046454 Bacteria 2852
578 Ga0495592_0207004 3300046454 Bacteria 1320
579 Ga0495592_0352726 3300046454 Bacteria 943
580 Ga0495603_0000035 3300046455 Bacteria 57510
581 Ga0495603_0007225 3300046455 Bacteria 6667
582 Ga0495603_0048434 3300046455 Bacteria 2530
583 Ga0495603_0137158 3300046455 Bacteria 1424
584 Ga0495603_0204014 3300046455 Bacteria 1142
585 Ga0495629_0000081 3300046459 Bacteria 85305
586 Ga0495629_0000612 3300046459 Bacteria 29083
587 Ga0495629_0058439 3300046459 Bacteria 2696
588 Ga0495629_0084894 3300046459 Bacteria 2209
589 Ga0495629_0126450 3300046459 Bacteria 1781
590 Ga0495638_0004483 3300046460 Bacteria 10577
591 Ga0495641_0005556 3300046461 Bacteria 8464
592 Ga0495651_0009999 3300046462 Bacteria 7292
593 Ga0495651_0030088 3300046462 Bacteria 4234
594 Ga0495651_0031301 3300046462 Bacteria 4149
595 Ga0495651_0039871 3300046462 Bacteria 3654
596 Ga0495653_0000399 3300046463 Bacteria 34847
597 Ga0495653_0070117 3300046463 Bacteria 2624
598 Ga0495653_0153653 3300046463 Bacteria 1605
599 Ga0495653_0175940 3300046463 Bacteria 1473
600 Ga0495650_0036071 3300046471 Bacteria 2169
601 Ga0495650_0065016 3300046471 Bacteria 1449
602 Ga0495580_0005664 3300046472 Bacteria 10275
603 Ga0495582_0000021 3300046473 Bacteria 88264
604 Ga0495639_0000010 3300046475 Bacteria 93685
605 Ga0495662_0008429 3300046476 Bacteria 5070
606 Ga0495662_0106037 3300046476 Bacteria 1376
607 Ga0495664_0007307 3300046477 Bacteria 6129
608 Ga0495664_0007928 3300046477 Bacteria 5912
609 Ga0495664_0028294 3300046477 Bacteria 3273
610 Ga0495585_0228751 3300046492 Bacteria 935
611 Ga0495594_0000979 3300046499 Bacteria 14837
612 Ga0495594_0107316 3300046499 Bacteria 1573
613 Ga0495594_0113421 3300046499 Bacteria 1529
614 Ga0495596_0050138 3300046500 Bacteria 1636
615 Ga0495583_0075524 3300046506 Bacteria 1474
616 Ga0495606_0001170 3300046507 Bacteria 37016
617 Ga0495606_0034041 3300046507 Bacteria 3503
618 Ga0495606_0152856 3300046507 Bacteria 1353
619 Ga0495606_0179281 3300046507 Bacteria 1223
620 Ga0495608_0001226 3300046511 Bacteria 18178
621 Ga0495608_0021826 3300046511 Bacteria 4391
622 Ga0495608_0025523 3300046511 Bacteria 4034
623 Ga0495608_0031182 3300046511 Bacteria 3605
624 Ga0495610_0058582 3300046512 Bacteria 1842
625 Ga0495616_0103407 3300046513 Bacteria 1333
626 Ga0495618_0014879 3300046514 Bacteria 4746
627 Ga0495618_0046993 3300046514 Bacteria 2725
628 Ga0495618_0286493 3300046514 Bacteria 1026
629 Ga0495628_0009019 3300046516 Bacteria 8533
630 Ga0495628_0012048 3300046516 Bacteria 7293
631 Ga0495628_0029893 3300046516 Bacteria 4415
632 Ga0495628_0055067 3300046516 Bacteria 3133
633 Ga0495628_0137639 3300046516 Bacteria 1865
634 Ga0495628_0176827 3300046516 Bacteria 1616
635 Ga0495630_0035377 3300046517 Bacteria 3732
636 Ga0495630_0181558 3300046517 Bacteria 1605
637 Ga0495631_0110976 3300046518 Bacteria 1179
638 Ga0495632_0077303 3300046519 Bacteria 1591
639 Ga0495632_0090841 3300046519 Bacteria 1448
640 Ga0495643_0006750 3300046522 Bacteria 7506
641 Ga0495644_0066080 3300046523 Bacteria 1358
642 Ga0495648_0114432 3300046524 Bacteria 1461
643 Ga0495666_0031225 3300046526 Bacteria 2610
644 Ga0495642_0062148 3300046528 Bacteria 1551
645 Ga0495652_0008672 3300046529 Bacteria 9267
646 Ga0495652_0026299 3300046529 Bacteria 5142
647 Ga0495652_0027739 3300046529 Bacteria 4987
648 Ga0495652_0062055 3300046529 Bacteria 3152
649 Ga0495654_0081543 3300046530 Bacteria 1516
650 Ga0495665_0002966 3300046531 Bacteria 9167
651 Ga0495640_0032420 3300046533 Bacteria 3722
652 Ga0495640_0034597 3300046533 Bacteria 3581
653 Ga0495640_0159209 3300046533 Bacteria 1448
654 Ga0495640_0170778 3300046533 Bacteria 1389
655 Ga0495640_0214043 3300046533 Bacteria 1217
656 Ga0495586_0066244 3300046535 Bacteria 1969
657 Ga0495587_0015759 3300046536 Bacteria 4713
658 Ga0495587_0022963 3300046536 Bacteria 3836
659 Ga0495587_0034748 3300046536 Bacteria 3039
660 Ga0495587_0059702 3300046536 Bacteria 2237
661 Ga0495598_0010895 3300046537 Bacteria 2190
662 Ga0495645_0001776 3300046543 Bacteria 14687
663 Ga0495645_0001836 3300046543 Bacteria 14435
664 Ga0495645_0008749 3300046543 Bacteria 7070
665 Ga0495645_0019408 3300046543 Bacteria 4895
666 Ga0495622_0008049 3300046557 Bacteria 4887
667 Ga0495622_0116831 3300046557 Bacteria 1219
668 Ga0495633_0056982 3300046558 Bacteria 1836
669 Ga0495633_0175615 3300046558 Bacteria 987
670 Ga0495667_0008441 3300046559 Bacteria 6992
671 Ga0495667_0021237 3300046559 Bacteria 4380
672 Ga0495667_0040223 3300046559 Bacteria 3105
673 Ga0495667_0113933 3300046559 Bacteria 1747
674 Ga0495656_0012418 3300046615 Bacteria 3142
675 Ga0495656_0042463 3300046615 Bacteria 1904
676 Ga0495634_0000261 3300046642 Bacteria 49735
677 Ga0495634_0011593 3300046642 Bacteria 6413
678 Ga0495634_0086449 3300046642 Bacteria 2042
679 Ga0495634_0096210 3300046642 Bacteria 1917
680 Ga0495635_0000088 3300046663 Bacteria 54355
681 Ga0495635_0001380 3300046663 Bacteria 16199
682 Ga0495635_0003521 3300046663 Bacteria 10832
683 Ga0495635_0017940 3300046663 Bacteria 4943
684 Ga0495635_0066717 3300046663 Bacteria 2468
685 Ga0495635_0132674 3300046663 Bacteria 1698
686 Ga0495659_0071498 3300046664 Bacteria 1300
687 Ga0495661_0093526 3300046665 Bacteria 1706
688 Ga0495588_0019653 3300046674 Bacteria 3311
689 Ga0495657_0008178 3300046675 Bacteria 8016
690 Ga0495657_0010455 3300046675 Bacteria 6983
691 Ga0495657_0012948 3300046675 Bacteria 6176
692 Ga0495657_0041171 3300046675 Bacteria 3164
693 Ga0495657_0061813 3300046675 Bacteria 2477
694 Ga0495599_0001137 3300046678 Bacteria 15035
695 Ga0495599_0010283 3300046678 Bacteria 5726
696 Ga0495599_0140653 3300046678 Bacteria 1497
697 Ga0495623_0010588 3300046679 Bacteria 5969
698 Ga0495623_0012243 3300046679 Bacteria 5556
699 Ga0495646_0002433 3300046680 Bacteria 11422
700 Ga0495646_0048965 3300046680 Bacteria 2566
701 Ga0495646_0052130 3300046680 Bacteria 2473
702 Ga0495646_0197696 3300046680 Bacteria 1096
703 Ga0495647_0003550 3300046681 Bacteria 4998
704 Ga0495658_0000771 3300046683 Bacteria 17323
705 Ga0495658_0144277 3300046683 Bacteria 1458
706 Ga0495658_0154840 3300046683 Bacteria 1410
707 Ga0495613_0045342 3300046689 Bacteria 3252
708 Ga0495613_0100556 3300046689 Bacteria 2088
709 Ga0495613_0111521 3300046689 Bacteria 1970
710 Ga0495613_0202755 3300046689 Bacteria 1398
711 Ga0495613_0249880 3300046689 Bacteria 1238
712 Ga0495624_0000682 3300046690 Bacteria 26624
713 Ga0495670_0045283 3300046691 Bacteria 2197
714 Ga0495649_0164850 3300046694 Bacteria 1161
715 Ga0495600_0000484 3300046809 Bacteria 20528
716 Ga0495600_0018989 3300046809 Bacteria 4387
717 Ga0495600_0023629 3300046809 Bacteria 3955
718 Ga0495600_0072934 3300046809 Bacteria 2242
719 Ga0495600_0113601 3300046809 Bacteria 1763
720 Ga0495581_0000018 3300047315 Bacteria 58791
721 Ga0495581_0012302 3300047315 Bacteria 4958
722 Ga0495581_0114277 3300047315 Bacteria 1570
723 Ga0495604_0002253 3300047317 Bacteria 15447
724 Ga0495604_0005171 3300047317 Bacteria 10334
725 Ga0495604_0007540 3300047317 Bacteria 8607
726 Ga0495604_0048968 3300047317 Bacteria 3285
727 Ga0495636_0101802 3300047318 Bacteria 1257
728 Ga0495674_0001257 3300047319 Bacteria 24613
729 Ga0495674_0006731 3300047319 Bacteria 11003
730 Ga0495674_0010560 3300047319 Bacteria 8740
731 Ga0495674_0120810 3300047319 Bacteria 2213
732 Ga0495674_0620313 3300047319 Bacteria 855
733 Ga0495676_0025835 3300047321 Bacteria 5062
734 Ga0495676_0104485 3300047321 Bacteria 2090
735 Ga0495680_0004231 3300047322 Bacteria 13778
736 Ga0495680_0006139 3300047322 Bacteria 11212
737 Ga0495680_0047618 3300047322 Bacteria 3371
738 Ga0495680_0125770 3300047322 Bacteria 1888
739 Ga0495680_0134996 3300047322 Bacteria 1810
740 Ga0495687_110927 3300047443 Bacteria 1008
741 Ga0495675_0000977 3300047444 Bacteria 17351
742 Ga0495675_0006091 3300047444 Bacteria 7382
743 Ga0495675_0010571 3300047444 Bacteria 5769
744 Ga0495675_0060191 3300047444 Bacteria 2407
745 Ga0495675_0276580 3300047444 Bacteria 1002
746 Ga0495685_046535 3300047447 Bacteria 1476
747 Ga0495673_0109357 3300047469 Bacteria 1107
748 Ga0495684_0001326 3300047471 Bacteria 19921
749 Ga0495684_0024356 3300047471 Bacteria 4660
750 Ga0495684_0052531 3300047471 Bacteria 3110
751 Ga0495684_0244257 3300047471 Bacteria 1308
752 Ga0495686_0239416 3300047472 Bacteria 1024
753 Ga0495593_0000072 3300047673 Bacteria 43039
754 Ga0495593_0000566 3300047673 Bacteria 21032
755 Ga0495602_0001719 3300048088 Bacteria 21809
756 Ga0495602_0004704 3300048088 Bacteria 14269
757 Ga0495602_0024014 3300048088 Bacteria 5922
758 Ga0495602_0105585 3300048088 Bacteria 2301
759 Ga0495602_0241124 3300048088 Bacteria 1352
760 Ga0495614_0036953 3300048089 Bacteria 2096
761 Ga0496100_0049800 3300048903 Bacteria 2711
762 Ga0496101_0094499 3300048904 Bacteria 2228
763 Ga0496102_0010809 3300048905 Bacteria 7862
764 Ga0496102_0019492 3300048905 Bacteria 5974
765 Ga0496102_0028260 3300048905 Bacteria 5008
766 Ga0496103_0030063 3300048906 Bacteria 3304
767 Ga0496103_0047327 3300048906 Bacteria 2657
768 Ga0496104_0002128 3300048907 Bacteria 17188
769 Ga0496104_0106223 3300048907 Bacteria 2690
770 Ga0496104_0140632 3300048907 Bacteria 2319
771 Ga0496104_0437605 3300048907 Bacteria 1219
772 Ga0496105_0009083 3300048908 Bacteria 7754
773 Ga0496105_0219624 3300048908 Bacteria 1547
774 Ga0496105_0637402 3300048908 Bacteria 823
775 Ga0496106_0019749 3300048909 Bacteria 4997
776 Ga0496106_0159952 3300048909 Bacteria 1781
777 Ga0496106_0296899 3300048909 Bacteria 1295
778 Ga0496106_0349969 3300048909 Bacteria 1187
779 Ga0496107_0001840 3300048910 Bacteria 13399
780 Ga0496108_0052175 3300048911 Bacteria 3426
781 Ga0496108_0099369 3300048911 Bacteria 2480
782 Ga0496108_0422121 3300048911 Bacteria 1165
783 Ga0496108_0430229 3300048911 Bacteria 1153
784 Ga0496109_0263823 3300048912 Bacteria 1622
785 Ga0496109_0329957 3300048912 Bacteria 1440
786 Ga0496110_0172799 3300048913 Bacteria 1961
787 Ga0496110_0293725 3300048913 Bacteria 1480
788 Ga0496110_0485161 3300048913 Bacteria 1126
789 Ga0496111_0030570 3300048914 Bacteria 3830
790 Ga0496111_0062541 3300048914 Bacteria 2699
791 Ga0496111_0143132 3300048914 Bacteria 1772
792 Ga0496112_0000004 3300048915 Bacteria 553294
793 Ga0496112_0017832 3300048915 Bacteria 6681
794 Ga0496112_0019008 3300048915 Bacteria 6477
795 Ga0496112_0044369 3300048915 Bacteria 4355
796 Ga0496112_0070772 3300048915 Bacteria 3447
797 Ga0496112_0079630 3300048915 Bacteria 3241
798 Ga0496112_0213500 3300048915 Bacteria 1886
799 Ga0496112_0598646 3300048915 Bacteria 1034
800 Ga0496113_0035814 3300048916 Bacteria 3632
801 Ga0496113_0148147 3300048916 Bacteria 1850
802 Ga0496114_0008932 3300048917 Bacteria 7944
803 Ga0496114_0025141 3300048917 Bacteria 4865
804 Ga0496114_0299360 3300048917 Bacteria 1420
805 Ga0496115_0001528 3300048918 Bacteria 16623
806 Ga0496115_0014005 3300048918 Bacteria 6071
807 Ga0496115_0029472 3300048918 Bacteria 4311
808 Ga0496115_0036766 3300048918 Bacteria 3878
809 Ga0496115_0100979 3300048918 Bacteria 2365
810 Ga0496115_0254436 3300048918 Bacteria 1445
811 Ga0496115_0270760 3300048918 Bacteria 1395
812 Ga0496116_0078352 3300048919 Bacteria 2061
813 Ga0496119_0051978 3300048922 Bacteria 2513
814 Ga0496119_0085829 3300048922 Bacteria 1801
815 Ga0496120_0009415 3300048923 Bacteria 6938
816 Ga0496121_0000495 3300048924 Bacteria 75339
817 Ga0496121_0153112 3300048924 Bacteria 1694
818 Ga0496123_0219919 3300048926 Bacteria 959
819 Ga0496124_0012283 3300048927 Bacteria 8461
820 Ga0496124_0016688 3300048927 Bacteria 6967
821 Ga0496124_0530285 3300048927 Bacteria 782
822 Ga0496125_0002695 3300048928 Bacteria 22608
823 Ga0496125_0334400 3300048928 Bacteria 912
824 Ga0496126_0014622 3300048929 Bacteria 7924
825 Ga0496126_0443081 3300048929 Bacteria 1046
826 Ga0501034_0001552 3300049571 Bacteria 30135
827 Ga0501034_0050571 3300049571 Bacteria 4191
828 Ga0501047_0212292 3300049581 Bacteria 1793
829 Ga0501047_0300209 3300049581 Bacteria 1449
830 Ga0501067_0097404 3300049583 Bacteria 1634
831 Ga0501068_0011379 3300049584 Bacteria 5023
832 Ga0501070_0527838 3300049586 Bacteria 947
833 Ga0501044_0103293 3300049823 Bacteria 2865
834 nmdc:mga03683_2720_c1 3300050489 Bacteria 5547
835 nmdc:mga03683_8320_c1 3300050489 Bacteria 3642
836 nmdc:mga03n38_28451_c1 3300050490 Bacteria 2330
837 nmdc:mga00v17_24636_c1 3300050491 Bacteria 3491
838 nmdc:mga00v17_9842_c1 3300050491 Bacteria 5195
839 nmdc:mga0yw44_136242_c1 3300050492 Bacteria 1593
840 nmdc:mga0yw44_6189_c1 3300050492 Bacteria 5755
841 nmdc:mga0yw44_86569_c1 3300050492 Bacteria 1974
842 nmdc:mga0yw44_95292_c1 3300050492 Bacteria 1888
843 nmdc:mga0k408_2600_c1 3300050493 Bacteria 9588
844 nmdc:mga06z11_107538_c1 3300050494 Bacteria 1540
845 nmdc:mga06z11_351725_c1 3300050494 Bacteria 882
846 nmdc:mga06z11_9486_c1 3300050494 Bacteria 4103
847 nmdc:mga04h51_89224_c1 3300050495 Bacteria 1107
848 nmdc:mga07m45_105163_c1 3300050496 Bacteria 1623
849 nmdc:mga07m45_106329_c1 3300050496 Bacteria 1614
850 nmdc:mga07m45_43458_c1 3300050496 Bacteria 2519
851 nmdc:mga07m45_55768_c1 3300050496 Bacteria 2234
852 nmdc:mga07m45_64225_c1 3300050496 Bacteria 2083
853 nmdc:mga05p37_154854_c1 3300050507 Bacteria 2801
854 nmdc:mga08y16_243008_c1 3300050511 Bacteria 1861
855 nmdc:mga08y16_47150_c1 3300050511 Bacteria 4511
856 nmdc:mga0n895_371876_c1 3300050512 Bacteria 1447
857 nmdc:mga0n895_48696_c1 3300050512 Bacteria 4150
858 nmdc:mga0n895_77721_c1 3300050512 Bacteria 3302
859 nmdc:mga0rr50_19503_c1 3300050513 Bacteria 4579
860 nmdc:mga08x19_123659_c1 3300050514 Bacteria 1736
861 nmdc:mga0sz30_126531_c1 3300050516 Bacteria 1125
862 nmdc:mga0sz30_445_c1 3300050516 Bacteria 15645
863 nmdc:mga0sz30_48238_c1 3300050516 Bacteria 1801
864 nmdc:mga0sz30_73941_c1 3300050516 Bacteria 1469
865 Ga0495601_0017967 3300053077 Bacteria 4299
866 Ga0495601_0043529 3300053077 Bacteria 2819
867 Ga0495612_0008637 3300053078 Bacteria 4129
868 Ga0495612_0012593 3300053078 Bacteria 3409
869 Ga0500635_0033796 3300053080 Bacteria 1671
870 Ga0500635_0048219 3300053080 Bacteria 1450
871 Ga0500635_0088116 3300053080 Bacteria 1125
872 Ga0495655_0084383 3300053083 Bacteria 914
873 Ga0495595_0000480 3300053084 Bacteria 15215
874 Ga0495595_0010420 3300053084 Bacteria 3863
875 Ga0495595_0013899 3300053084 Bacteria 3408
876 Ga0495595_0018087 3300053084 Bacteria 3041
877 Ga0495619_0000332 3300053085 Bacteria 33066
878 Ga0495619_0006966 3300053085 Bacteria 7154
879 Ga0495619_0028628 3300053085 Bacteria 3595
880 Ga0495619_0136174 3300053085 Bacteria 1689
881 Ga0500643_000018 3300053087 Bacteria 296505
882 Ga0500644_0025827 3300053088 Bacteria 1812
883 Ga0500647_0043349 3300053091 Bacteria 2160
884 Ga0500651_0314908 3300053093 Bacteria 895
885 Ga0500566_0006255 3300053094 Bacteria 7073
886 Ga0500566_0016949 3300053094 Bacteria 4278
887 Ga0500566_0120382 3300053094 Bacteria 1416
888 Ga0500641_0005072 3300053096 Bacteria 4667
889 Ga0500554_005396 3300053102 Bacteria 2783
890 Ga0500557_000008 3300053105 Bacteria 127284
891 Ga0500562_033507 3300053108 Bacteria 1357
892 Ga0500562_040058 3300053108 Bacteria 1245
893 Ga0500569_021584 3300053109 Bacteria 1704
894 Ga0500595_000232 3300053119 Bacteria 37646
895 Ga0500595_006829 3300053119 Bacteria 4804
896 Ga0500608_142638 3300053122 Bacteria 1060
897 Ga0500559_0014503 3300053136 Bacteria 3330
898 Ga0500568_0042033 3300053139 Bacteria 1833
899 Ga0500577_0073316 3300053142 Bacteria 1348
900 Ga0500590_116331 3300053148 Bacteria 1260
901 Ga0500603_000468 3300053150 Bacteria 10357
902 Ga0500604_0045641 3300053151 Bacteria 1338
903 Ga0500616_0002167 3300053153 Bacteria 16975
904 Ga0500619_021708 3300053154 Bacteria 1853
905 Ga0500622_0006295 3300053156 Bacteria 6929
906 Ga0500633_0027600 3300053160 Bacteria 1798
907 Ga0500638_005675 3300053162 Bacteria 5010
908 Ga0500636_0000847 3300053177 Bacteria 16470
909 Ga0500637_0000260 3300053178 Bacteria 19731
910 Ga0500637_0000405 3300053178 Bacteria 16453
911 Ga0500625_012504 3300053729 Bacteria 3881
912 Ga0500609_011156 3300053731 Bacteria 1213
913 Ga0500609_014170 3300053731 Bacteria 1080
914 Ga0500599_000323 3300053736 Bacteria 4694
915 Ga0500601_000062 3300053737 Bacteria 22260
916 Ga0500661_000357 3300055283 Bacteria 8385
917 Ga0501082_0427361 3300060353 Bacteria 1157
918 Ga0530510_0000222 3300061734 Bacteria 35471
919 2507510893 2507262055 Bacteria 8048963
920 2508544706 2508501009 Bacteria 7784016
921 2508697066 2508501042 Bacteria 8719808
922 2511394420 2511231028 Bacteria 8046582
923 2513629155 2513237092 Bacteria 8341956
924 2513637596 2513237094 Bacteria 8789602
925 2513649554 2513237095 Bacteria 8976980
926 2513654907 2513237096 Bacteria 8722461
927 2513697330 2513237101 Bacteria 7952346
928 2513700056 2513237102 Bacteria 7703324
929 2513719255 2513237104 Bacteria 10034502
930 2513861295 2513237137 Bacteria 9558895
931 2513874544 2513237139 Bacteria 8737671
932 2513916070 2513237145 Bacteria 8979722
933 2514015554 2513237161 Bacteria 8871253
934 2515625563 2515154112 Bacteria 8294334
935 2517100472 2517093001 Bacteria 9002274
936 2517894627 2517572143 Bacteria 9484767
937 2524437333 2524023205 Bacteria 8918781
938 2524534358 2524023228 Bacteria 10118060
939 2528853219 2528768022 Bacteria 10457665
940 2617350650 2617270735 Bacteria 9163226
941 2617377939 2617270741 Bacteria 8201522
942 2644456504 2643221681 Bacteria 3707866
943 2671119054 2667528175 Bacteria 7532676
944 2723843176 2721755755 Bacteria 8322773
945 2728747712 2728368998 Bacteria 8720350
946 2745076808 2744054633 Bacteria 8678936
947 2776910827 2775507049 Bacteria 6284736
948 2793065176 2791355196 Bacteria 7323613
949 2793072307 2791355197 Bacteria 8420563
950 2793083115
951 2805916539 2802429603 Bacteria 8777136
952 2818238024 2816332527 Bacteria 8933356
953 2824606126 2824600985 Bacteria 8488197
954 2824616046 2824609381 Bacteria 8672835
955 2824618972 2824617872 Bacteria 8814715
956 2824627508 2824626560 Bacteria 8813858
957 2824638833 2824635225 Bacteria 8785348
958 2824649010 2824644064 Bacteria 8743947
959 2824657344 2824653114 Bacteria 8493680
960 2824663087 2824661429 Bacteria 9877870
961 2824676954 2824671348 Bacteria 8369588
962 2824682051 2824679649 Bacteria 8248951
963 2824693643 2824687955 Bacteria 8360029
964 2824698722 2824696289 Bacteria 8335049
965 2824706498 2824704595 Bacteria 9667483
966 2824716476 2824714736 Bacteria 8717648
967 2824726422 2824723954 Bacteria 8758240
968 2824737951 2824732956 Bacteria 7810675
969 2824753005 2824746037 Bacteria 7911610
970 2824756954 2824753945 Bacteria 9787441
971 2824769750 2824763712 Bacteria 9792355
972 2824778487 2824773399 Bacteria 8360218
973 2838127782 2838122688 Bacteria 8803140
974 2841943075 2841941048 Bacteria 8688029
975 2841956096 2841949485 Bacteria 8680857
976 2841960332 2841957949 Bacteria 8652217
977 2841968283 2841966195 Bacteria 8673214
978 2841976503 2841974524 Bacteria 8931498
979 2841987879 2841983080 Bacteria 8395090
980 2842042822 2842038055 Bacteria 8002051
981 2842050863 2842045827 Bacteria 8006841
982 2844317038 2844315083 Bacteria 8138177
983 2847938456 2847930680 Bacteria 9342022
984 2847944346 2847939898 Bacteria 8606328
985 2849081411 2849076700 Bacteria 7039503
986 2857512073 2857509624 Bacteria 7472071
987 2874597618 2874590934 Bacteria 8299676
988 2874612488 2874604998 Bacteria 7834745
989 2874618411 2874612657 Bacteria 8252029
990 2874623541 2874620515 Bacteria 8290088
991 2874630522 2874628541 Bacteria 8630250
992 2874649182 2874645413 Bacteria 8214782
993 2876767784 2876761206 Bacteria 10111113
994 2876774909 2876771140 Bacteria 8287509
995 2876822339 2876818435 Bacteria 8274608
996 2879077997 2879074833 Bacteria 8279565
997 2879088695 2879083081 Bacteria 8587928
998 2879103944 2879099564 Bacteria 10442239
999 2879117932 2879110137 Bacteria 8907982
1000 2879132452 2879127579 Bacteria 8294491
1001 2879145249 2879142872 Bacteria 8267021
1002 2881370570 2881364244 Bacteria 7710352
1003 2881667335 2881665667 Bacteria 8175609
1004 2885367040 2885366525 Bacteria 8326213
1005 2885378083 2885374607 Bacteria 8927485
1006 2885416538 2885409591 Bacteria 9235467
1007 2888381659 2888378607 Bacteria 9652610
1008 2888388974 2888388044 Bacteria 7304136
1009 2888422049 2888419890 Bacteria 7857137
1010 2889033517 2889033259 Bacteria 9099371
1011 2903735004 2903727486 Bacteria 8281579
1012 2903754862 2903748898 Bacteria 9972761
1013 2904667655 2904666416 Bacteria 8226587
1014 2904697035 2904690495 Bacteria 9412302
1015 2904705654
1016 2904719082 2904711408 Bacteria 9771557
1017 2904770761 2904765812 Bacteria 5369154
1018 2904776145 2904770941 Bacteria 5580202
1019 2906604121 2906602504 Bacteria 8295279
1020 2906611361
1021 2906633018 2906626472 Bacteria 8826946
1022 2906643465 2906635258 Bacteria 8601019
1023 2906648247 2906643746 Bacteria 8722424
1024 2906661311 2906660503 Bacteria 8595048
1025 2908744943 2908739725 Bacteria 8628932
1026 2908762696 2908756301 Bacteria 8864324
1027 2908782011 2908775508 Bacteria 8092255
1028 2922362692 2922361189 Bacteria 7436256
1029 2922371329
1030 2922390321 2922386360 Bacteria 7017218
1031 2922393767 2922393267 Bacteria 8285685
1032 2922428013
1033 2929619707 2929615660 Bacteria 9193770
1034 2929627822 2929624759 Bacteria 9339455
1035 2932786039 2932784394 Bacteria 9704911
1036 2932798194 2932794094 Bacteria 7915132
1037 2932803987 2932801729 Bacteria 7987968
1038 2932817013 2932809354 Bacteria 9135765
1039 2932822496 2932818245 Bacteria 9955613
1040 2932831083 2932828146 Bacteria 9745859
1041 2933581626 2933577622 Bacteria 9116884
1042 2935612889 2935608549 Bacteria 8203142
1043 2935624130 2935616580 Bacteria 9032984
1044 2935632062 2935630451 Bacteria 8169952
1045 2935640224 2935638405 Bacteria 10015038
1046 2935655014 2935648319 Bacteria 8801166
1047 2935663894 2935656913 Bacteria 8965014
1048 2935666938 2935665750 Bacteria 9571747
1049 2935680423 2935675223 Bacteria 9928132
1050 2935690069 2935684952 Bacteria 9590419
1051 2935699849 2935694250 Bacteria 9291695
1052 2935704693 2935703347 Bacteria 10242284
1053 2935722219 2935713505 Bacteria 9608509
1054 2935731528 2935722832 Bacteria 9608746
1055 2935735384 2935732158 Bacteria 9706831
1056 2935745345 2935741537 Bacteria 9707219
1057 2935755080 2935750917 Bacteria 9590372
1058 2935762406 2935760218 Bacteria 9817913
1059 2935775441 2935769743 Bacteria 7878163
1060 2935780343 2935777560 Bacteria 8077691
1061 2935790690 2935785616 Bacteria 7962367
1062 2935799127 2935793552 Bacteria 8012592
1063 2935803904 2935801545 Bacteria 9301974
1064 2935811822 2935810662 Bacteria 9401221
1065 2935824377 2935819856 Bacteria 8261050
1066 2935829707 2935827899 Bacteria 10038562
1067 2935842961 2935837841 Bacteria 9454360
1068 2935852478 2935847175 Bacteria 8228321
1069 2935862370 2935855204 Bacteria 9035059
1070 2935870505 2935864058 Bacteria 9784707
1071 2935881087 2935873716 Bacteria 9632195
1072 2935884207 2935883170 Bacteria 7964738
1073 2935912367 2935908558 Bacteria 8568796
1074 2935923959 2935916978 Bacteria 9113783
1075 2935929396 2935926038 Bacteria 8601059
1076 2935936027 2935934488 Bacteria 8602579
1077 2935949927 2935942939 Bacteria 8599779
1078 2935957307 2935951376 Bacteria 8602333
1079 2935962174 2935959822 Bacteria 7869783
1080 2935968338 2935967501 Bacteria 8603075
1081 2935976524 2935975950 Bacteria 8347125
1082 2935988030 2935984226 Bacteria 8302647
1083 2935993584 2935992306 Bacteria 9802711
1084 2936004480 2936002035 Bacteria 9362176
1085 2936018037 2936011229 Bacteria 8801034
1086 2936026553 2936019824 Bacteria 8804134
1087 2936035296 2936028420 Bacteria 8965941
1088 2936038405 2936037263 Bacteria 9446081
1089 2936053432 2936046547 Bacteria 8903709
1090 2936059413 2936055302 Bacteria 8785755
1091 2940561640 2940556831 Bacteria 9590747
1092 2941508010 2941507105 Bacteria 8166816
1093 2941515485 2941515067 Bacteria 8166720
1094 2941523940 2941523033 Bacteria 8169134
1095 2941533819 2941531003 Bacteria 7653939
1096 2941544185 2941538514 Bacteria 9402094
1097 3005477712 3005474847 Bacteria 9259049
1098 3005485387 3005483717 Bacteria 7877331
1099 3005507241 3005506211 Bacteria 6943378
1100 3005594601 3005587118 Bacteria 7794411
1101 3005596680 3005594810 Bacteria 8716512
1102 3005712748 3005710791 Bacteria 7622528
1103 3005719800 3005718088 Bacteria 8283608
1104 8006933141 8006926726 Bacteria 6749210
1105 8006933501 8006933436 Bacteria 10410654
1106 8006971307 8006964411 Bacteria 8966052
1107 8006983174 8006973647 Bacteria 10679141
1108 8006989257 8006984368 Bacteria 9651211
1109 8006997732 8006994254 Bacteria 8309700
1110 8016516298 8016511872 Bacteria 9921665
1111 8016523693 8016522445 Bacteria 8156687
1112 8016537213 8016530956 Bacteria 8155261
1113 8016541475 8016539877 Bacteria 8155419
1114 8016560167 8016557553 Bacteria 8154380
1115 8016579599 8016575299 Bacteria 8154085
1116 8016598084 8016595262 Bacteria 8149947
1117 8016633708 8016630954 Bacteria 9217207
1118 8017060236 8017057580 Bacteria 10023680
1119 8019542626 8019538911 Bacteria 7872763
1120 8019548111 8019547302 Bacteria 7996444
1121 8019559417 8019555841 Bacteria 9642137
1122 8019569513 8019565922 Bacteria 9639779
1123 8019579758 8019576017 Bacteria 10049540
1124 8019587468 8019586578 Bacteria 10212056
1125 8019603874 8019597564 Bacteria 10041141
1126 8019614664 8019608314 Bacteria 10042931
1127 8019636907 8019629233 Bacteria 8687553
1128 8019642701 8019638758 Bacteria 9062356
1129 8019649884 8019648815 Bacteria 10014479
1130 8019664726 8019659431 Bacteria 8577854
1131 8019674312 8019668869 Bacteria 8791617
1132 8019681805 8019678201 Bacteria 8863603
1133 8019693975 8019687851 Bacteria 8712826
1134 8055749037 8055742211 Bacteria 9226248
1135 8056674773 8056673599 Bacteria 7871253
1136 8056695059 8056689827 Bacteria 6712655
1137 8056969886 8056967851 Bacteria 9038162
1138 nmdc:mga0yw44_39189_c1
1139 JGI25406J46586_10000021
1140 JGI25406J46586_10071581
1141 JGI25165J46597_1013442
1142 JGI25165J46597_1013978
1143 JGI25153J46596_10001764
1144 JGI25153J46596_10007736
1145 JGI25153J46596_10041659
1146 JGI25160J50197_1000533
1147 JGI25160J50197_1002209
1148 JGI25160J50197_1002315
1149 Ga0055531_10010491
1150 Ga0065165_1000437
1151 Ga0065165_1001951
1152 Ga0065165_1005934
1153 Ga0065704_10079857
1154 Ga0070658_10017440
1155 Ga0070658_10249576
1156 Ga0070658_10259658
1157 Ga0070683_100007819
1158 Ga0070683_100018850
1159 Ga0070683_100138115
1160 Ga0070670_100360731
1161 Ga0070680_100006251
1162 Ga0070680_100032424
1163 Ga0070680_100070553
1164 Ga0070680_100078969
1165 Ga0070682_100278749
1166 Ga0070682_100453505
1167 Ga0068868_100036837
1168 Ga0068868_100232222
1169 Ga0068868_100754659
1170 Ga0070660_100009076
1171 Ga0070660_100012308
1172 Ga0070660_100551601
1173 Ga0070689_100491852
1174 Ga0070691_10029547
1175 Ga0070661_100268111
1176 Ga0070661_100495007
1177 Ga0070668_100076646
1178 Ga0070669_100115646
1179 Ga0070669_100312295
1180 Ga0070669_100437785
1181 Ga0070675_100125583
1182 Ga0070671_100006274
1183 Ga0070671_100117771
1184 Ga0070674_100122168
1185 Ga0070674_100245063
1186 Ga0070673_100150646
1187 Ga0070688_100022950
1188 Ga0070659_100030190
1189 Ga0070667_100068279
1190 Ga0070667_100378558
1191 Ga0070667_100441429
1192 Ga0070709_10008334
1193 Ga0070714_100003380
1194 Ga0070714_100012203
1195 Ga0070713_100000939
1196 Ga0070713_100087752
1197 Ga0070713_100681701
1198 Ga0070713_100767846
1199 Ga0070710_10005443
1200 Ga0070710_10056700
1201 Ga0070710_10282229
1202 Ga0070711_100022144
1203 Ga0070711_100028249
1204 Ga0070711_100029733
1205 Ga0070711_100277063
1206 Ga0070711_100369753
1207 Ga0070694_100305324
1208 Ga0070708_100028554
1209 Ga0070708_100269230
1210 Ga0070663_100054671
1211 Ga0070663_100080851
1212 Ga0070663_100121355
1213 Ga0070678_100049644
1214 Ga0070678_100123124
1215 Ga0070681_10020913
1216 Ga0070681_10150518
1217 Ga0070681_10167923
1218 Ga0070706_100039312
1219 Ga0070707_100040622
1220 Ga0070707_100055661
1221 Ga0070707_100062519
1222 Ga0070698_100001171
1223 Ga0070679_100005687
1224 Ga0070679_100027474
1225 Ga0070679_100034479
1226 Ga0070684_100011854
1227 Ga0070684_100094848
1228 Ga0070684_100129711
1229 Ga0070684_100609185
1230 Ga0070697_100001434
1231 Ga0070697_100013379
1232 Ga0068853_100007962
1233 Ga0068853_100084860
1234 Ga0070672_100500756
1235 Ga0070686_100108526
1236 Ga0070665_100003622
1237 Ga0070665_100131091
1238 Ga0070665_100201173
1239 Ga0070665_100599469
1240 Ga0068855_100035351
1241 Ga0068855_100084816
1242 Ga0068855_100145510
1243 Ga0068855_100463973
1244 Ga0068855_100508234
1245 Ga0070664_100077079
1246 Ga0070664_100232809
1247 Ga0070664_100293980
1248 Ga0070664_100329970
1249 Ga0070664_100469444
1250 Ga0068857_100004239
1251 Ga0068857_100070627
1252 Ga0068857_100192524
1253 Ga0068857_100497522
1254 Ga0068856_100036156
1255 Ga0068856_100038973
1256 Ga0068856_100041669
1257 Ga0068856_100059548
1258 Ga0068856_100306205
1259 Ga0068856_100853679
1260 Ga0070702_100115063
1261 Ga0070702_100268937
1262 Ga0068852_100009742
1263 Ga0068852_100037809
1264 Ga0068852_100171045
1265 Ga0068852_100562699
1266 Ga0068864_100291144
1267 Ga0068866_10118362
1268 Ga0068866_10170388
1269 Ga0068861_100358014
1270 Ga0068870_10137818
1271 Ga0068870_10156974
1272 Ga0068870_10494468
1273 Ga0068863_100428954
1274 Ga0068863_100531831
1275 Ga0068858_100086252
1276 Ga0068860_100017528
1277 Ga0068860_100750385
1278 Ga0068862_100243694
1279 Ga0081455_10002021
1280 Ga0081455_10005318
1281 Ga0081455_10010563
1282 Ga0081455_10021579
1283 Ga0081455_10033400
1284 Ga0081455_10406680
1285 Ga0081538_10071692
1286 Ga0081540_1002252
1287 Ga0081540_1004972
1288 Ga0081540_1005512
1289 Ga0081540_1023004
1290 Ga0081539_10000051
1291 Ga0081539_10031311
1292 Ga0081539_10155619
1293 Ga0070717_10001555
1294 Ga0070717_10176264
1295 Ga0075365_10003263
1296 Ga0075365_10006261
1297 Ga0075365_10052047
1298 Ga0075365_10130310
1299 Ga0075365_10149555
1300 Ga0075365_10187342
1301 Ga0075368_10003112
1302 Ga0075368_10117910
1303 Ga0075363_100022684
1304 Ga0075364_10026988
1305 Ga0070715_10000321
1306 Ga0070716_100018951
1307 Ga0070712_100027309
1308 Ga0070712_100293545
1309 Ga0070712_100355147
1310 Ga0070712_100363135
1311 Ga0075362_10096079
1312 Ga0075362_10164181
1313 Ga0075367_10018878
1314 Ga0075367_10022791
1315 Ga0075367_10092278
1316 Ga0075367_10122321
1317 Ga0075369_10002166
1318 Ga0075369_10015331
1319 Ga0075369_10019801
1320 Ga0075366_10007150
1321 Ga0075366_10025959
1322 Ga0097621_100055265
1323 Ga0097621_100228350
1324 Ga0075370_10073310
1325 Ga0075370_10139916
1326 Ga0075370_10271548
1327 Ga0075428_100673822
1328 Ga0075431_100133077
1329 Ga0075433_10254554
1330 Ga0075434_100006679
1331 Ga0075434_100736311
1332 Ga0068865_100135239
1333 Ga0068865_100293503
1334 Ga0068865_100306497
1335 Ga0075436_100127649
1336 Ga0099825_1026932
1337 Ga0099825_1036080
1338 Ga0099824_1004900
1339 Ga0099824_1029293
1340 Ga0099822_1000677
1341 Ga0099794_10016964
1342 Ga0099794_10032789
1343 Ga0099794_10044823
1344 Ga0099794_10134788
1345 Ga0099794_10226182
1346 Ga0099795_10044876
1347 Ga0099795_10068576
1348 Ga0105240_10008025
1349 Ga0105240_10027519
1350 Ga0105240_10092107
1351 Ga0105240_10102898
1352 Ga0105240_10129550
1353 Ga0105240_10191853
1354 Ga0111539_10115084
1355 Ga0111539_10814305
1356 Ga0105245_10009595
1357 Ga0105245_10046290
1358 Ga0105245_10049453
1359 Ga0105245_10200464
1360 Ga0105247_10318583
1361 Ga0105243_10230664
1362 Ga0105241_10054382
1363 Ga0105242_10560681
1364 Ga0105248_10027404
1365 Ga0105248_10137102
1366 Ga0105248_10383139
1367 Ga0105237_10003348
1368 Ga0105237_10051893
1369 Ga0105237_10233929
1370 Ga0105237_10491428
1371 Ga0105237_10949104
1372 Ga0105238_10193984
1373 Ga0105238_10561585
1374 Ga0099796_10014373
1375 Ga0099796_10053888
1376 Ga0099796_10061675
1377 Ga0099796_10109316
1378 Ga0105239_10018332
1379 Ga0105239_10132942
1380 Ga0105239_10139612
1381 Ga0105246_10070617
1382 Ga0105246_10132124
1383 Ga0157320_1003403
1384 Ga0157370_10105927
1385 Ga0157369_10043168
1386 Ga0157369_10045599
1387 Ga0157369_10313896
1388 Ga0157369_10352908
1389 Ga0157374_10024124
1390 Ga0157378_10399533
1391 Ga0157378_10706135
1392 Ga0163162_10122853
1393 Ga0163162_10129762
1394 Ga0157372_10591317
1395 Ga0157375_10038248
1396 Ga0157375_10410319
1397 Ga0157375_10433628
1398 Ga0157375_11146602
1399 Ga0163163_10063041
1400 Ga0163163_10381062
1401 Ga0163163_10627665
1402 Ga0163163_10723462
1403 Ga0157380_10075130
1404 Ga0157379_10133256
1405 Ga0157376_10066771
1406 Ga0157376_10250391
1407 Ga0157376_10270500
1408 Ga0163161_10131788
1409 Ga0206353_11683564
1410 Ga0214544_1000026
1411 Ga0214542_1000025
1412 Ga0214545_1000014
1413 Ga0214543_1000034
1414 Ga0213871_10048088
1415 Ga0209677_103618
1416 Ga0209148_1002608
1417 Ga0209233_1001880
1418 Ga0209233_1011138
1419 Ga0209455_1000714
1420 Ga0209564_1012021
1421 Ga0209758_1000141
1422 Ga0209758_1000324
1423 Ga0209758_1001019
1424 Ga0209758_1002338
1425 Ga0209758_1002921
1426 Ga0209758_1003483
1427 Ga0209758_1041951
1428 Ga0209758_1049944
1429 Ga0209256_1002956
1430 Ga0207426_1000437
1431 Ga0207426_1001139
1432 Ga0207426_1012626
1433 Ga0207426_1021983
1434 Ga0209257_1003859
1435 Ga0209257_1011469
1436 Ga0207656_10167256
1437 Ga0207692_10066855
1438 Ga0207692_10191103
1439 Ga0207710_10038841
1440 Ga0207710_10075663
1441 Ga0207688_10291507
1442 Ga0207647_10040227
1443 Ga0207685_10010055
1444 Ga0207685_10166020
1445 Ga0207699_10060253
1446 Ga0207645_10061804
1447 Ga0207643_10136362
1448 Ga0207643_10431633
1449 Ga0207705_10052750
1450 Ga0207705_10205811
1451 Ga0207684_10048065
1452 Ga0207654_10012845
1453 Ga0207707_10011843
1454 Ga0207707_10043382
1455 Ga0207707_10056384
1456 Ga0207695_10000062
1457 Ga0207695_10036649
1458 Ga0207695_10050434
1459 Ga0207695_10212050
1460 Ga0207671_10001897
1461 Ga0207671_10131265
1462 Ga0207671_10278295
1463 Ga0207671_10647273
1464 Ga0207693_10030645
1465 Ga0207693_10035323
1466 Ga0207693_10280293
1467 Ga0207663_10000926
1468 Ga0207663_10012381
1469 Ga0207663_10012457
1470 Ga0207663_10252150
1471 Ga0207660_10010384
1472 Ga0207660_10013462
1473 Ga0207660_10064854
1474 Ga0207662_10104306
1475 Ga0207657_10011417
1476 Ga0207657_10062591
1477 Ga0207657_10095681
1478 Ga0207657_10659467
1479 Ga0207649_10304132
1480 Ga0207649_10312591
1481 Ga0207652_10005840
1482 Ga0207652_10008077
1483 Ga0207652_10159211
1484 Ga0207646_10092019
1485 Ga0207681_10171301
1486 Ga0207694_10041128
1487 Ga0207694_10125399
1488 Ga0207694_10332653
1489 Ga0207694_10657440
1490 Ga0207650_10477340
1491 Ga0207659_10306724
1492 Ga0207659_10319165
1493 Ga0207659_10380343
1494 Ga0207687_10063361
1495 Ga0207700_10030217
1496 Ga0207700_10387998
1497 Ga0207664_10114229
1498 Ga0207664_10130542
1499 Ga0207644_10091325
1500 Ga0207644_10114849
1501 Ga0207706_10039308
1502 Ga0207686_10553293
1503 Ga0207709_10019091
1504 Ga0207709_10081552
1505 Ga0207670_10046656
1506 Ga0207670_10073089
1507 Ga0207669_10047148
1508 Ga0207669_10211514
1509 Ga0207669_10447414
1510 Ga0207669_10651625
1511 Ga0207704_10072288
1512 Ga0207704_10088136
1513 Ga0207704_10470754
1514 Ga0207665_10000715
1515 Ga0207665_10261719
1516 Ga0207691_10063675
1517 Ga0207691_10116093
1518 Ga0207691_10213593
1519 Ga0207711_10032480
1520 Ga0207711_10034481
1521 Ga0207711_10095313
1522 Ga0207711_10115517
1523 Ga0207711_10745732
1524 Ga0207661_10125062
1525 Ga0207679_10198149
1526 Ga0207679_10207468
1527 Ga0207679_10707392
1528 Ga0207667_10019759
1529 Ga0207667_10040667
1530 Ga0207667_10042644
1531 Ga0207667_10181315
1532 Ga0207651_10052902
1533 Ga0207651_10295961
1534 Ga0207712_10156362
1535 Ga0207668_10029821
1536 Ga0207668_10574674
1537 Ga0207640_10074823
1538 Ga0207640_10083988
1539 Ga0207677_10010248
1540 Ga0207677_10087447
1541 Ga0207677_10370482
1542 Ga0207703_10186209
1543 Ga0207639_10006228
1544 Ga0207639_10058222
1545 Ga0207639_10257163
1546 Ga0207639_10289894
1547 Ga0207678_10039631
1548 Ga0207678_10076090
1549 Ga0207678_10083060
1550 Ga0207678_10085101
1551 Ga0207678_10085928
1552 Ga0207678_10095571
1553 Ga0207678_10251846
1554 Ga0207678_10317088
1555 Ga0207678_10451613
1556 Ga0207702_10023918
1557 Ga0207702_10067051
1558 Ga0207702_10232917
1559 Ga0207702_10559492
1560 Ga0207648_10411454
1561 Ga0207676_10006987
1562 Ga0207674_10008791
1563 Ga0207674_10023230
1564 Ga0207674_10384137
1565 Ga0207674_10452030
1566 Ga0207675_100414243
1567 Ga0207683_10038111
1568 Ga0207683_10062431
1569 Ga0207683_10092916
1570 Ga0207683_10107125
1571 Ga0207683_10402777
1572 Ga0207683_10607401
1573 Ga0207698_10055595
1574 Ga0209389_1000004
1575 Ga0209389_1000023
1576 Ga0209589_1000006
1577 Ga0209589_1000010
1578 Ga0209489_100007
1579 Ga0209489_100011
1580 Ga0209489_100777
1581 Ga0209700_100008
1582 Ga0209700_100013
1583 Ga0209179_1028101
1584 Ga0209813_10074995
1585 Ga0268266_10007855
1586 Ga0268266_10060020
1587 Ga0268266_10075867
1588 Ga0268266_10102049
1589 Ga0268266_10317838
1590 Ga0268266_10336916
1591 Ga0268266_10405734
1592 Ga0268265_10072751
1593 Ga0268265_10264389
1594 Ga0268264_10004708
1595 Ga0268264_10769153
1596 Ga0265334_10011723
1597 Ga0307517_10000102
1598 Ga0307515_10163632
1599 Ga0307515_10251290
1600 Ga0265338_10016198
1601 Ga0307512_10009735
1602 Ga0265340_10030010
1603 Ga0307408_100139822
1604 Ga0316575_10108947
1605 Ga0316579_10013729
1606 Ga0307516_10036663
1607 Ga0307516_10358347
1608 Ga0307413_10121182
1609 Ga0307413_10143469
1610 Ga0307413_10334269
1611 Ga0307410_10086323
1612 Ga0307407_10068519
1613 Ga0307407_10100790
1614 Ga0307412_10180317
1615 Ga0307412_10667717
1616 Ga0307409_100070083
1617 Ga0307416_100123369
1618 Ga0307416_100996608
1619 Ga0307411_10065049
1620 Ga0307411_10374801
1621 Ga0307415_100428988
1622 Ga0307415_100459808
1623 Ga0307510_10027691
1624 Ga0307510_10069562
1625 Ga0307510_10082857
1626 Ga0315911_1000010
1627 Ga0373934_0135960
1628 Ga0373923_0049292
1629 Ga0373936_0005468
1630 Ga0373945_0010695
1631 Ga0373953_0014626
1632 Ga0373954_0000663
1633 Ga0373954_0011852
1634 Ga0373954_0075141
1635 Ga0373956_0000275
1636 Ga0373956_0035123
1637 Ga0373956_0281819
1638 Ga0373943_0006136
1639 Ga0373946_0031028
1640 Ga0373955_0011037
1641 Ga0373955_0016347
1642 Ga0373962_0082935
1643 Ga0373924_0020143
1644 Ga0373924_0050650
1645 Ga0373931_0008479
1646 Ga0373935_0000229
1647 Ga0373935_0026632
1648 Ga0373935_0300640
1649 Ga0373935_0363066
1650 Ga0373927_0000071
1651 Ga0373927_0007062
1652 Ga0373927_0011507
1653 Ga0373927_0199615
1654 Ga0373927_0438548
1655 Ga0373933_0004204
1656 Ga0373933_0019834
1657 Ga0373933_0034112
1658 Ga0373933_0178675
1659 Ga0373947_0000540
1660 Ga0373947_0003876
1661 Ga0373947_0306180
1662 Ga0373937_0031431
1663 Ga0373937_0045462
1664 Ga0373937_0290559
1665 Ga0373937_0323409
1666 Ga0373925_0040457
1667 Ga0373925_0054967
1668 Ga0373925_0358485
1669 Ga0395899_0001776
1670 Ga0395899_0008599
1671 Ga0395900_0013738
1672 Ga0395900_0021345
1673 Ga0395898_0006919
1674 Ga0395898_0065456
1675 Ga0395898_0140754
1676 Ga0395898_0145508
1677 Ga0395905_0030266
1678 Ga0395905_0142623
1679 Ga0436364_1430269
1680 Ga0395901_0025268
1681 Ga0395901_0282825
1682 Ga0436365_1867717
1683 Ga0436360_0467044
1684 Ga0436360_1111241
1685 Ga0436360_1354586
1686 Ga0436361_0035005
1687 Ga0436361_0614601
1688 Ga0436363_0950317
1689 Ga0436362_0170791
1690 Ga0439465_0021545
1691 Ga0439441_001670
1692 Ga0466972_0000193
1693 Ga0466972_0014447
1694 Ga0466965_0050459
1695 Ga0466966_0000551
1696 Ga0466961_0000020
1697 Ga0466963_0014002
1698 Ga0466963_0119916
1699 Ga0466968_0009179
1700 Ga0466968_0054595
1701 Ga0466968_0079203
1702 Ga0466968_0170083
1703 Ga0466960_0039543
1704 Ga0466967_0002756
1705 Ga0466967_0014710
1706 Ga0466967_0070110
1707 Ga0466967_0311379
1708 Ga0495617_026442
1709 Ga0495617_079410
1710 Ga0495592_0003051
1711 Ga0495592_0003383
1712 Ga0495592_0026973
1713 Ga0495592_0049426
1714 Ga0495592_0058136
1715 Ga0495592_0207004
1716 Ga0495592_0352726
1717 Ga0495603_0000035
1718 Ga0495603_0007225
1719 Ga0495603_0048434
1720 Ga0495603_0137158
1721 Ga0495603_0204014
1722 Ga0495629_0000081
1723 Ga0495629_0000612
1724 Ga0495629_0058439
1725 Ga0495629_0084894
1726 Ga0495629_0126450
1727 Ga0495638_0004483
1728 Ga0495641_0005556
1729 Ga0495651_0009999
1730 Ga0495651_0030088
1731 Ga0495651_0031301
1732 Ga0495651_0039871
1733 Ga0495653_0000399
1734 Ga0495653_0070117
1735 Ga0495653_0153653
1736 Ga0495653_0175940
1737 Ga0495650_0036071
1738 Ga0495650_0065016
1739 Ga0495580_0005664
1740 Ga0495582_0000021
1741 Ga0495639_0000010
1742 Ga0495662_0008429
1743 Ga0495662_0106037
1744 Ga0495664_0007307
1745 Ga0495664_0007928
1746 Ga0495664_0028294
1747 Ga0495585_0228751
1748 Ga0495594_0000979
1749 Ga0495594_0107316
1750 Ga0495594_0113421
1751 Ga0495596_0050138
1752 Ga0495583_0075524
1753 Ga0495606_0001170
1754 Ga0495606_0034041
1755 Ga0495606_0152856
1756 Ga0495606_0179281
1757 Ga0495608_0001226
1758 Ga0495608_0021826
1759 Ga0495608_0025523
1760 Ga0495608_0031182
1761 Ga0495610_0058582
1762 Ga0495616_0103407
1763 Ga0495618_0014879
1764 Ga0495618_0046993
1765 Ga0495618_0286493
1766 Ga0495628_0009019
1767 Ga0495628_0012048
1768 Ga0495628_0029893
1769 Ga0495628_0055067
1770 Ga0495628_0137639
1771 Ga0495628_0176827
1772 Ga0495630_0035377
1773 Ga0495630_0181558
1774 Ga0495631_0110976
1775 Ga0495632_0077303
1776 Ga0495632_0090841
1777 Ga0495643_0006750
1778 Ga0495644_0066080
1779 Ga0495648_0114432
1780 Ga0495666_0031225
1781 Ga0495642_0062148
1782 Ga0495652_0008672
1783 Ga0495652_0026299
1784 Ga0495652_0027739
1785 Ga0495652_0062055
1786 Ga0495654_0081543
1787 Ga0495665_0002966
1788 Ga0495640_0032420
1789 Ga0495640_0034597
1790 Ga0495640_0159209
1791 Ga0495640_0170778
1792 Ga0495640_0214043
1793 Ga0495586_0066244
1794 Ga0495587_0015759
1795 Ga0495587_0022963
1796 Ga0495587_0034748
1797 Ga0495587_0059702
1798 Ga0495598_0010895
1799 Ga0495645_0001776
1800 Ga0495645_0001836
1801 Ga0495645_0008749
1802 Ga0495645_0019408
1803 Ga0495622_0008049
1804 Ga0495622_0116831
1805 Ga0495633_0056982
1806 Ga0495633_0175615
1807 Ga0495667_0008441
1808 Ga0495667_0021237
1809 Ga0495667_0040223
1810 Ga0495667_0113933
1811 Ga0495656_0012418
1812 Ga0495656_0042463
1813 Ga0495634_0000261
1814 Ga0495634_0011593
1815 Ga0495634_0086449
1816 Ga0495634_0096210
1817 Ga0495635_0000088
1818 Ga0495635_0001380
1819 Ga0495635_0003521
1820 Ga0495635_0017940
1821 Ga0495635_0066717
1822 Ga0495635_0132674
1823 Ga0495659_0071498
1824 Ga0495661_0093526
1825 Ga0495588_0019653
1826 Ga0495657_0008178
1827 Ga0495657_0010455
1828 Ga0495657_0012948
1829 Ga0495657_0041171
1830 Ga0495657_0061813
1831 Ga0495599_0001137
1832 Ga0495599_0010283
1833 Ga0495599_0140653
1834 Ga0495623_0010588
1835 Ga0495623_0012243
1836 Ga0495646_0002433
1837 Ga0495646_0048965
1838 Ga0495646_0052130
1839 Ga0495646_0197696
1840 Ga0495647_0003550
1841 Ga0495658_0000771
1842 Ga0495658_0144277
1843 Ga0495658_0154840
1844 Ga0495613_0045342
1845 Ga0495613_0100556
1846 Ga0495613_0111521
1847 Ga0495613_0202755
1848 Ga0495613_0249880
1849 Ga0495624_0000682
1850 Ga0495670_0045283
1851 Ga0495649_0164850
1852 Ga0495600_0000484
1853 Ga0495600_0018989
1854 Ga0495600_0023629
1855 Ga0495600_0072934
1856 Ga0495600_0113601
1857 Ga0495581_0000018
1858 Ga0495581_0012302
1859 Ga0495581_0114277
1860 Ga0495604_0002253
1861 Ga0495604_0005171
1862 Ga0495604_0007540
1863 Ga0495604_0048968
1864 Ga0495636_0101802
1865 Ga0495674_0001257
1866 Ga0495674_0006731
1867 Ga0495674_0010560
1868 Ga0495674_0120810
1869 Ga0495674_0620313
1870 Ga0495676_0025835
1871 Ga0495676_0104485
1872 Ga0495680_0004231
1873 Ga0495680_0006139
1874 Ga0495680_0047618
1875 Ga0495680_0125770
1876 Ga0495680_0134996
1877 Ga0495687_110927
1878 Ga0495675_0000977
1879 Ga0495675_0006091
1880 Ga0495675_0010571
1881 Ga0495675_0060191
1882 Ga0495675_0276580
1883 Ga0495685_046535
1884 Ga0495673_0109357
1885 Ga0495684_0001326
1886 Ga0495684_0024356
1887 Ga0495684_0052531
1888 Ga0495684_0244257
1889 Ga0495686_0239416
1890 Ga0495593_0000072
1891 Ga0495593_0000566
1892 Ga0495602_0001719
1893 Ga0495602_0004704
1894 Ga0495602_0024014
1895 Ga0495602_0105585
1896 Ga0495602_0241124
1897 Ga0495614_0036953
1898 Ga0496100_0049800
1899 Ga0496101_0094499
1900 Ga0496102_0010809
1901 Ga0496102_0019492
1902 Ga0496102_0028260
1903 Ga0496103_0030063
1904 Ga0496103_0047327
1905 Ga0496104_0002128
1906 Ga0496104_0106223
1907 Ga0496104_0140632
1908 Ga0496104_0437605
1909 Ga0496105_0009083
1910 Ga0496105_0219624
1911 Ga0496105_0637402
1912 Ga0496106_0019749
1913 Ga0496106_0159952
1914 Ga0496106_0296899
1915 Ga0496106_0349969
1916 Ga0496107_0001840
1917 Ga0496108_0052175
1918 Ga0496108_0099369
1919 Ga0496108_0422121
1920 Ga0496108_0430229
1921 Ga0496109_0263823
1922 Ga0496109_0329957
1923 Ga0496110_0172799
1924 Ga0496110_0293725
1925 Ga0496110_0485161
1926 Ga0496111_0030570
1927 Ga0496111_0062541
1928 Ga0496111_0143132
1929 Ga0496112_0000004
1930 Ga0496112_0017832
1931 Ga0496112_0019008
1932 Ga0496112_0044369
1933 Ga0496112_0070772
1934 Ga0496112_0079630
1935 Ga0496112_0213500
1936 Ga0496112_0598646
1937 Ga0496113_0035814
1938 Ga0496113_0148147
1939 Ga0496114_0008932
1940 Ga0496114_0025141
1941 Ga0496114_0299360
1942 Ga0496115_0001528
1943 Ga0496115_0014005
1944 Ga0496115_0029472
1945 Ga0496115_0036766
1946 Ga0496115_0100979
1947 Ga0496115_0254436
1948 Ga0496115_0270760
1949 Ga0496116_0078352
1950 Ga0496119_0051978
1951 Ga0496119_0085829
1952 Ga0496120_0009415
1953 Ga0496121_0000495
1954 Ga0496121_0153112
1955 Ga0496123_0219919
1956 Ga0496124_0012283
1957 Ga0496124_0016688
1958 Ga0496124_0530285
1959 Ga0496125_0002695
1960 Ga0496125_0334400
1961 Ga0496126_0014622
1962 Ga0496126_0443081
1963 Ga0501034_0001552
1964 Ga0501034_0050571
1965 Ga0501047_0212292
1966 Ga0501047_0300209
1967 Ga0501067_0097404
1968 Ga0501068_0011379
1969 Ga0501070_0527838
1970 Ga0501044_0103293
1971 nmdc:mga03683_2720_c1
1972 nmdc:mga03683_8320_c1
1973 nmdc:mga03n38_28451_c1
1974 nmdc:mga00v17_24636_c1
1975 nmdc:mga00v17_9842_c1
1976 nmdc:mga0yw44_136242_c1
1977 nmdc:mga0yw44_6189_c1
1978 nmdc:mga0yw44_86569_c1
1979 nmdc:mga0yw44_95292_c1
1980 nmdc:mga0k408_2600_c1
1981 nmdc:mga06z11_107538_c1
1982 nmdc:mga06z11_351725_c1
1983 nmdc:mga06z11_9486_c1
1984 nmdc:mga04h51_89224_c1
1985 nmdc:mga07m45_105163_c1
1986 nmdc:mga07m45_106329_c1
1987 nmdc:mga07m45_43458_c1
1988 nmdc:mga07m45_55768_c1
1989 nmdc:mga07m45_64225_c1
1990 nmdc:mga05p37_154854_c1
1991 nmdc:mga08y16_243008_c1
1992 nmdc:mga08y16_47150_c1
1993 nmdc:mga0n895_371876_c1
1994 nmdc:mga0n895_48696_c1
1995 nmdc:mga0n895_77721_c1
1996 nmdc:mga0rr50_19503_c1
1997 nmdc:mga08x19_123659_c1
1998 nmdc:mga0sz30_126531_c1
1999 nmdc:mga0sz30_445_c1
2000 nmdc:mga0sz30_48238_c1
2001 nmdc:mga0sz30_73941_c1
2002 Ga0495601_0017967
2003 Ga0495601_0043529
2004 Ga0495612_0008637
2005 Ga0495612_0012593
2006 Ga0500635_0033796
2007 Ga0500635_0048219
2008 Ga0500635_0088116
2009 Ga0495655_0084383
2010 Ga0495595_0000480
2011 Ga0495595_0010420
2012 Ga0495595_0013899
2013 Ga0495595_0018087
2014 Ga0495619_0000332
2015 Ga0495619_0006966
2016 Ga0495619_0028628
2017 Ga0495619_0136174
2018 Ga0500643_000018
2019 Ga0500644_0025827
2020 Ga0500647_0043349
2021 Ga0500651_0314908
2022 Ga0500566_0006255
2023 Ga0500566_0016949
2024 Ga0500566_0120382
2025 Ga0500641_0005072
2026 Ga0500554_005396
2027 Ga0500557_000008
2028 Ga0500562_033507
2029 Ga0500562_040058
2030 Ga0500569_021584
2031 Ga0500595_000232
2032 Ga0500595_006829
2033 Ga0500608_142638
2034 Ga0500559_0014503
2035 Ga0500568_0042033
2036 Ga0500577_0073316
2037 Ga0500590_116331
2038 Ga0500603_000468
2039 Ga0500604_0045641
2040 Ga0500616_0002167
2041 Ga0500619_021708
2042 Ga0500622_0006295
2043 Ga0500633_0027600
2044 Ga0500638_005675
2045 Ga0500636_0000847
2046 Ga0500637_0000260
2047 Ga0500637_0000405
2048 Ga0500625_012504
2049 Ga0500609_011156
2050 Ga0500609_014170
2051 Ga0500599_000323
2052 Ga0500601_000062
2053 Ga0500661_000357
2054 Ga0501082_0427361
2055 Ga0530510_0000222
2056 2507510893
2057 2508544706
2058 2508697066
2059 2511394420
2060 2513629155
2061 2513637596
2062 2513649554
2063 2513654907
2064 2513697330
2065 2513700056
2066 2513719255
2067 2513861295
2068 2513874544
2069 2513916070
2070 2514015554
2071 2515625563
2072 2517100472
2073 2517894627
2074 2524437333
2075 2524534358
2076 2528853219
2077 2617350650
2078 2617377939
2079 2644456504
2080 2671119054
2081 2723843176
2082 2728747712
2083 2745076808
2084 2776910827
2085 2793065176
2086 2793072307
2087 2793083115
2088 2805916539
2089 2818238024
2090 2824606126
2091 2824616046
2092 2824618972
2093 2824627508
2094 2824638833
2095 2824649010
2096 2824657344
2097 2824663087
2098 2824676954
2099 2824682051
2100 2824693643
2101 2824698722
2102 2824706498
2103 2824716476
2104 2824726422
2105 2824737951
2106 2824753005
2107 2824756954
2108 2824769750
2109 2824778487
2110 2838127782
2111 2841943075
2112 2841956096
2113 2841960332
2114 2841968283
2115 2841976503
2116 2841987879
2117 2842042822
2118 2842050863
2119 2844317038
2120 2847938456
2121 2847944346
2122 2849081411
2123 2857512073
2124 2874597618
2125 2874612488
2126 2874618411
2127 2874623541
2128 2874630522
2129 2874649182
2130 2876767784
2131 2876774909
2132 2876822339
2133 2879077997
2134 2879088695
2135 2879103944
2136 2879117932
2137 2879132452
2138 2879145249
2139 2881370570
2140 2881667335
2141 2885367040
2142 2885378083
2143 2885416538
2144 2888381659
2145 2888388974
2146 2888422049
2147 2889033517
2148 2903735004
2149 2903754862
2150 2904667655
2151 2904697035
2152 2904705654
2153 2904719082
2154 2904770761
2155 2904776145
2156 2906604121
2157 2906611361
2158 2906633018
2159 2906643465
2160 2906648247
2161 2906661311
2162 2908744943
2163 2908762696
2164 2908782011
2165 2922362692
2166 2922371329
2167 2922390321
2168 2922393767
2169 2922428013
2170 2929619707
2171 2929627822
2172 2932786039
2173 2932798194
2174 2932803987
2175 2932817013
2176 2932822496
2177 2932831083
2178 2933581626
2179 2935612889
2180 2935624130
2181 2935632062
2182 2935640224
2183 2935655014
2184 2935663894
2185 2935666938
2186 2935680423
2187 2935690069
2188 2935699849
2189 2935704693
2190 2935722219
2191 2935731528
2192 2935735384
2193 2935745345
2194 2935755080
2195 2935762406
2196 2935775441
2197 2935780343
2198 2935790690
2199 2935799127
2200 2935803904
2201 2935811822
2202 2935824377
2203 2935829707
2204 2935842961
2205 2935852478
2206 2935862370
2207 2935870505
2208 2935881087
2209 2935884207
2210 2935912367
2211 2935923959
2212 2935929396
2213 2935936027
2214 2935949927
2215 2935957307
2216 2935962174
2217 2935968338
2218 2935976524
2219 2935988030
2220 2935993584
2221 2936004480
2222 2936018037
2223 2936026553
2224 2936035296
2225 2936038405
2226 2936053432
2227 2936059413
2228 2940561640
2229 2941508010
2230 2941515485
2231 2941523940
2232 2941533819
2233 2941544185
2234 3005477712
2235 3005485387
2236 3005507241
2237 3005594601
2238 3005596680
2239 3005712748
2240 3005719800
2241 8006933141
2242 8006933501
2243 8006971307
2244 8006983174
2245 8006989257
2246 8006997732
2247 8016516298
2248 8016523693
2249 8016537213
2250 8016541475
2251 8016560167
2252 8016579599
2253 8016598084
2254 8016633708
2255 8017060236
2256 8019542626
2257 8019548111
2258 8019559417
2259 8019569513
2260 8019579758
2261 8019587468
2262 8019603874
2263 8019614664
2264 8019636907
2265 8019642701
2266 8019649884
2267 8019664726
2268 8019674312
2269 8019681805
2270 8019693975
2271 8055749037
2272 8056674773
2273 8056695059
2274 8056969886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

50

198

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

247

273

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9287 1 224
7efo-assembly1.cif.gz_A lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.9174 2 236
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9152 2 235
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9145 2 224
2it1-assembly1.cif.gz_B structure of ph0203 protein from pyrococcus horikoshii 0.9127 2 233
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 2 236 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9396 2 64 3.40.50.300
af_A0A0R0IY12_408_566_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 2 64 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9355 2 219 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9339 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A318S435-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 1 (HAAT family) 0.9698 1 236 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7C2FT36-F1-model_v4 ABC transporter ATP-binding protein 0.969 1 230 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A511N2S9-F1-model_v4 ABC transporter ATP-binding protein 0.9648 1 238 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A1W9WR20-F1-model_v4 ABC transporter domain-containing protein 0.9639 2 236 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A847HSQ2-F1-model_v4 ABC transporter ATP-binding protein 0.9635 1 238 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map