F490660

General Info

Members Datasets Scaffolds Average Seq Length
1138 326 1138 312

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100195545|Ga0075428_1001955452
Length 365
Sequence MAIPGIAERVGSCRSRLRIATLLYRSFRRLPLTTGFETMRTEDDPQRAAPRVAEAVMMRKKVTVVGAGHVGATTAQRLLDRQLADVVLIDILEGIPQGKGLDLLEAGPVEGYDCAALGTNDYAETKGSDVVVITAGLARKPGMSRDDLLLKNFQIVKSVTEQVARHSPEAILIIVSNPLDAMAHTALKVSGFPPHRVIGMAGVLDAARFRTFIAKELRVSVENVHAFVLGGHGDTMVPLPRYSTIAGVPITELLPKERIAALVDRTRNGGAEIVQYLKEGSAYYAPSASVVEMIDAIFHDRRKILPCAAYLQGEYGVQGLYVGVPVKLGARGIEEVFAITLTAEEQVGFAKSVDSVRELVAKLPL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
235 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
236 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
237 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.14
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10203824 3300003323 Bacteria 1595
2 JGI26129J50193_1000897 3300003349 Bacteria 1945
3 JGI25405J52794_10033467 3300003911 Bacteria 1072
4 Ga0058863_11887003 3300004799 Bacteria 1220
5 Ga0065712_10000707 3300005290 Bacteria 9696
6 Ga0065712_10005792 3300005290 Bacteria 5358
7 Ga0065715_10001398 3300005293 Bacteria 12739
8 Ga0065715_10011721 3300005293 Bacteria 3221
9 Ga0065707_10000713 3300005295 Bacteria 20978
10 Ga0065707_10082751 3300005295 Bacteria 12322
11 Ga0065707_10089547 3300005295 Bacteria 4341
12 Ga0065707_10094966 3300005295 Bacteria 3433
13 Ga0070658_10029362 3300005327 Bacteria 4417
14 Ga0070676_10001402 3300005328 Bacteria 12171
15 Ga0070676_10016980 3300005328 Bacteria 4024
16 Ga0070683_100028060 3300005329 Bacteria 5084
17 Ga0070683_100069593 3300005329 Bacteria 3281
18 Ga0070683_100088864 3300005329 Bacteria 2899
19 Ga0070683_100305246 3300005329 Bacteria 1514
20 Ga0070690_100008064 3300005330 Bacteria 6048
21 Ga0070690_100310252 3300005330 Bacteria 1134
22 Ga0070690_100355761 3300005330 Bacteria 1064
23 Ga0070670_100043773 3300005331 Bacteria 3848
24 Ga0070666_10003391 3300005335 Bacteria 9655
25 Ga0070666_10018770 3300005335 Bacteria 4453
26 Ga0070666_10031219 3300005335 Bacteria 3516
27 Ga0070680_100002409 3300005336 Bacteria 13849
28 Ga0070680_100017315 3300005336 Bacteria 5679
29 Ga0070680_100036951 3300005336 Bacteria 3946
30 Ga0070680_100371114 3300005336 Bacteria 1218
31 Ga0070680_100374286 3300005336 Bacteria 1212
32 Ga0070682_100000179 3300005337 Bacteria 47429
33 Ga0068868_100461650 3300005338 Bacteria 1106
34 Ga0070660_100000476 3300005339 Bacteria 26750
35 Ga0070660_100007316 3300005339 Bacteria 7692
36 Ga0070660_100167676 3300005339 Bacteria 1772
37 Ga0070689_100007429 3300005340 Bacteria 7661
38 Ga0070689_100106789 3300005340 Bacteria 2222
39 Ga0070689_100265329 3300005340 Bacteria 1420
40 Ga0070691_10018678 3300005341 Bacteria 3196
41 Ga0070691_10142517 3300005341 Bacteria 1222
42 Ga0070687_100038573 3300005343 Bacteria 2395
43 Ga0070661_100000876 3300005344 Bacteria 21630
44 Ga0070661_100005120 3300005344 Bacteria 9035
45 Ga0070692_10000828 3300005345 Bacteria 10344
46 Ga0070692_10001115 3300005345 Bacteria 9386
47 Ga0070668_100414852 3300005347 Bacteria 1152
48 Ga0070669_100000641 3300005353 Bacteria 25898
49 Ga0070669_100050119 3300005353 Bacteria 3049
50 Ga0070675_100045618 3300005354 Bacteria 3587
51 Ga0070675_100197762 3300005354 Bacteria 1744
52 Ga0070671_100031225 3300005355 Bacteria 4399
53 Ga0070671_100066615 3300005355 Bacteria 3001
54 Ga0070671_100146541 3300005355 Bacteria 1993
55 Ga0070671_100216448 3300005355 Bacteria 1625
56 Ga0070659_100000848 3300005366 Bacteria 22299
57 Ga0070667_100074041 3300005367 Bacteria 2905
58 Ga0070667_100112122 3300005367 Bacteria 2366
59 Ga0070667_100117293 3300005367 Bacteria 2312
60 Ga0070703_10001139 3300005406 Bacteria 8222
61 Ga0070709_10000256 3300005434 Bacteria 34164
62 Ga0070714_100443168 3300005435 Bacteria 1233
63 Ga0070713_100004492 3300005436 Bacteria 9384
64 Ga0070713_100041800 3300005436 Bacteria 3738
65 Ga0070713_100144079 3300005436 Bacteria 2113
66 Ga0070713_100384275 3300005436 Bacteria 1308
67 Ga0070701_10069613 3300005438 Bacteria 1877
68 Ga0070705_100000333 3300005440 Bacteria 27695
69 Ga0070705_100035395 3300005440 Bacteria 2799
70 Ga0070705_100089937 3300005440 Bacteria 1910
71 Ga0070705_100197270 3300005440 Bacteria 1377
72 Ga0070700_100034373 3300005441 Bacteria 3062
73 Ga0070694_100008838 3300005444 Bacteria 6171
74 Ga0070708_100016164 3300005445 Bacteria 6185
75 Ga0070708_100019387 3300005445 Bacteria 5715
76 Ga0070708_100020543 3300005445 Bacteria 5570
77 Ga0070708_100037768 3300005445 Bacteria 4216
78 Ga0070708_100055342 3300005445 Bacteria 3527
79 Ga0070708_100068820 3300005445 Bacteria 3182
80 Ga0070708_100173286 3300005445 Bacteria 2015
81 Ga0070708_100181406 3300005445 Bacteria 1968
82 Ga0070708_100203934 3300005445 Bacteria 1852
83 Ga0070708_100227743 3300005445 Bacteria 1749
84 Ga0070708_100404105 3300005445 Bacteria 1288
85 Ga0070663_100001828 3300005455 Bacteria 11851
86 Ga0070678_100019662 3300005456 Bacteria 4411
87 Ga0070662_100027185 3300005457 Bacteria 3969
88 Ga0070662_100105584 3300005457 Bacteria 2138
89 Ga0070662_100203761 3300005457 Bacteria 1571
90 Ga0070681_10004124 3300005458 Bacteria 13743
91 Ga0070681_10008880 3300005458 Bacteria 9877
92 Ga0070681_10024651 3300005458 Bacteria 6053
93 Ga0070681_10037004 3300005458 Bacteria 4898
94 Ga0070681_10102051 3300005458 Bacteria 2814
95 Ga0068867_100000455 3300005459 Bacteria 27140
96 Ga0068867_100217042 3300005459 Bacteria 1539
97 Ga0068867_100305131 3300005459 Bacteria 1314
98 Ga0068867_100308118 3300005459 Bacteria 1308
99 Ga0070685_10029077 3300005466 Bacteria 3068
100 Ga0070706_100005118 3300005467 Bacteria 12509
101 Ga0070706_100006898 3300005467 Bacteria 10719
102 Ga0070706_100031118 3300005467 Bacteria 4921
103 Ga0070706_100035655 3300005467 Bacteria 4592
104 Ga0070706_100039517 3300005467 Bacteria 4356
105 Ga0070706_100074452 3300005467 Bacteria 3143
106 Ga0070706_100096858 3300005467 Bacteria 2739
107 Ga0070706_100117748 3300005467 Bacteria 2474
108 Ga0070706_100122324 3300005467 Bacteria 2426
109 Ga0070706_100193516 3300005467 Bacteria 1900
110 Ga0070706_100314499 3300005467 Bacteria 1461
111 Ga0070706_100315313 3300005467 Bacteria 1459
112 Ga0070707_100000653 3300005468 Bacteria 34576
113 Ga0070707_100002097 3300005468 Bacteria 19110
114 Ga0070707_100017934 3300005468 Bacteria 6656
115 Ga0070707_100032582 3300005468 Bacteria 4966
116 Ga0070707_100077609 3300005468 Bacteria 3205
117 Ga0070707_100104809 3300005468 Bacteria 2742
118 Ga0070707_100285545 3300005468 Bacteria 1604
119 Ga0070698_100000691 3300005471 Bacteria 36018
120 Ga0070698_100011480 3300005471 Bacteria 9401
121 Ga0070698_100038889 3300005471 Bacteria 4901
122 Ga0070698_100240398 3300005471 Bacteria 1744
123 Ga0070699_100003274 3300005518 Bacteria 14324
124 Ga0070699_100013457 3300005518 Bacteria 7045
125 Ga0070699_100013570 3300005518 Bacteria 7013
126 Ga0070699_100031353 3300005518 Bacteria 4588
127 Ga0070699_100054916 3300005518 Bacteria 3449
128 Ga0070699_100061434 3300005518 Bacteria 3256
129 Ga0070699_100095975 3300005518 Bacteria 2596
130 Ga0070699_100395099 3300005518 Bacteria 1250
131 Ga0070679_100001099 3300005530 Bacteria 23680
132 Ga0070679_100007477 3300005530 Bacteria 10214
133 Ga0070679_100014328 3300005530 Bacteria 7614
134 Ga0070679_100121171 3300005530 Bacteria 2600
135 Ga0070684_100009497 3300005535 Bacteria 7663
136 Ga0070684_100110579 3300005535 Bacteria 2464
137 Ga0070684_100132871 3300005535 Bacteria 2246
138 Ga0070684_100195652 3300005535 Bacteria 1841
139 Ga0070697_100004541 3300005536 Bacteria 10676
140 Ga0070697_100007610 3300005536 Bacteria 8432
141 Ga0070697_100066285 3300005536 Bacteria 2952
142 Ga0070697_100070721 3300005536 Bacteria 2861
143 Ga0070697_100101330 3300005536 Bacteria 2393
144 Ga0070697_100131245 3300005536 Bacteria 2101
145 Ga0070697_100155279 3300005536 Bacteria 1931
146 Ga0068853_100008897 3300005539 Bacteria 8079
147 Ga0068853_100097293 3300005539 Bacteria 2598
148 Ga0070695_100001052 3300005545 Bacteria 15099
149 Ga0070695_100003891 3300005545 Bacteria 8713
150 Ga0070695_100008030 3300005545 Bacteria 6254
151 Ga0070695_100017709 3300005545 Bacteria 4322
152 Ga0070695_100052278 3300005545 Bacteria 2624
153 Ga0070695_100092848 3300005545 Bacteria 2019
154 Ga0070696_100004495 3300005546 Bacteria 9313
155 Ga0070696_100007274 3300005546 Bacteria 7389
156 Ga0070696_100012836 3300005546 Bacteria 5622
157 Ga0070696_100074212 3300005546 Bacteria 2398
158 Ga0070696_100211147 3300005546 Bacteria 1453
159 Ga0070696_100264456 3300005546 Bacteria 1306
160 Ga0070696_100332285 3300005546 Bacteria 1172
161 Ga0070693_100000190 3300005547 Bacteria 28502
162 Ga0070665_100000247 3300005548 Bacteria 89526
163 Ga0070665_100432172 3300005548 Bacteria 1326
164 Ga0070665_100466113 3300005548 Bacteria 1273
165 Ga0070704_100001272 3300005549 Bacteria 13323
166 Ga0070704_100046308 3300005549 Bacteria 3032
167 Ga0070704_100089574 3300005549 Bacteria 2289
168 Ga0070704_100345852 3300005549 Bacteria 1254
169 Ga0070704_100348875 3300005549 Bacteria 1249
170 Ga0068855_100000225 3300005563 Bacteria 72196
171 Ga0068855_100006191 3300005563 Bacteria 14589
172 Ga0068855_100083607 3300005563 Bacteria 3697
173 Ga0070664_100003468 3300005564 Bacteria 12737
174 Ga0068856_100001169 3300005614 Bacteria 27611
175 Ga0068856_100003133 3300005614 Bacteria 16873
176 Ga0068856_100010362 3300005614 Bacteria 9055
177 Ga0068856_100027461 3300005614 Bacteria 5553
178 Ga0068856_100101802 3300005614 Bacteria 2865
179 Ga0070702_100029783 3300005615 Bacteria 2972
180 Ga0070702_100071577 3300005615 Bacteria 2050
181 Ga0068852_100000413 3300005616 Bacteria 28547
182 Ga0068852_100025761 3300005616 Bacteria 4770
183 Ga0068852_100350186 3300005616 Bacteria 1442
184 Ga0068859_100000040 3300005617 Bacteria 162782
185 Ga0068859_100001393 3300005617 Bacteria 24544
186 Ga0068859_100057283 3300005617 Bacteria 3925
187 Ga0068859_100070757 3300005617 Bacteria 3524
188 Ga0068859_100169904 3300005617 Bacteria 2261
189 Ga0068859_100223356 3300005617 Bacteria 1971
190 Ga0068859_100289936 3300005617 Bacteria 1730
191 Ga0068859_100292052 3300005617 Bacteria 1723
192 Ga0068859_100308486 3300005617 Bacteria 1676
193 Ga0068859_100531489 3300005617 Bacteria 1271
194 Ga0068859_100577471 3300005617 Bacteria 1218
195 Ga0068864_100531738 3300005618 Bacteria 1134
196 Ga0068861_100045835 3300005719 Bacteria 3294
197 Ga0068861_100148342 3300005719 Bacteria 1922
198 Ga0068861_100158189 3300005719 Bacteria 1866
199 Ga0068861_100229488 3300005719 Bacteria 1574
200 Ga0068870_10000139 3300005840 Bacteria 25224
201 Ga0068863_100047062 3300005841 Bacteria 4093
202 Ga0068863_100096023 3300005841 Bacteria 2814
203 Ga0068863_100140124 3300005841 Bacteria 2311
204 Ga0068858_100010945 3300005842 Bacteria 8574
205 Ga0068858_100043981 3300005842 Bacteria 4140
206 Ga0068858_100059717 3300005842 Bacteria 3524
207 Ga0068858_100107201 3300005842 Bacteria 2608
208 Ga0068858_100320310 3300005842 Bacteria 1482
209 Ga0068860_100001109 3300005843 Bacteria 29627
210 Ga0068860_100010447 3300005843 Bacteria 9178
211 Ga0068860_100265987 3300005843 Bacteria 1672
212 Ga0068860_100279833 3300005843 Bacteria 1630
213 Ga0068860_100368764 3300005843 Bacteria 1416
214 Ga0068860_100450465 3300005843 Bacteria 1280
215 Ga0068862_100035340 3300005844 Bacteria 4231
216 Ga0068862_100062980 3300005844 Bacteria 3191
217 Ga0068862_100498227 3300005844 Bacteria 1156
218 Ga0068862_100524242 3300005844 Bacteria 1128
219 Ga0081455_10000554 3300005937 Bacteria 48600
220 Ga0081455_10022220 3300005937 Bacteria 5933
221 Ga0081455_10037696 3300005937 Bacteria 4289
222 Ga0081538_10015371 3300005981 Bacteria 5929
223 Ga0081540_1005034 3300005983 Bacteria 9916
224 Ga0081540_1036669 3300005983 Bacteria 2610
225 Ga0070715_10082589 3300006163 Bacteria 1462
226 Ga0070716_100002537 3300006173 Bacteria 8448
227 Ga0070716_100021204 3300006173 Bacteria 3421
228 Ga0070716_100066561 3300006173 Bacteria 2102
229 Ga0070712_100006589 3300006175 Bacteria 7212
230 Ga0097621_100084723 3300006237 Bacteria 2643
231 Ga0097621_100136102 3300006237 Bacteria 2096
232 Ga0068871_100217642 3300006358 Bacteria 1654
233 Ga0075428_100001380 3300006844 Bacteria 25833
234 Ga0075428_100001775 3300006844 Bacteria 23033
235 Ga0075428_100031347 3300006844 Bacteria 5878
236 Ga0075428_100048964 3300006844 Bacteria 4637
237 Ga0075428_100087024 3300006844 Bacteria 3408
238 Ga0075428_100138750 3300006844 Bacteria 2643
239 Ga0075428_100195545 3300006844 Bacteria 2187
240 Ga0075428_100207019 3300006844 Bacteria 2120
241 Ga0075428_100227269 3300006844 Bacteria 2014
242 Ga0075428_100438246 3300006844 Bacteria 1400
243 Ga0075428_100517344 3300006844 Bacteria 1276
244 Ga0075430_100000019 3300006846 Bacteria 86721
245 Ga0075430_100000487 3300006846 Bacteria 29740
246 Ga0075430_100046733 3300006846 Bacteria 3656
247 Ga0075430_100109251 3300006846 Bacteria 2307
248 Ga0075430_100133731 3300006846 Bacteria 2067
249 Ga0075430_100134568 3300006846 Bacteria 2060
250 Ga0075430_100153228 3300006846 Bacteria 1919
251 Ga0075430_100182788 3300006846 Bacteria 1744
252 Ga0075430_100285977 3300006846 Bacteria 1364
253 Ga0075430_100382099 3300006846 Bacteria 1162
254 Ga0075431_100000797 3300006847 Bacteria 27524
255 Ga0075431_100002180 3300006847 Bacteria 18719
256 Ga0075431_100002672 3300006847 Bacteria 17281
257 Ga0075431_100008469 3300006847 Bacteria 10298
258 Ga0075431_100018042 3300006847 Bacteria 7178
259 Ga0075431_100023868 3300006847 Bacteria 6261
260 Ga0075431_100040569 3300006847 Bacteria 4798
261 Ga0075431_100220308 3300006847 Bacteria 1936
262 Ga0075431_100252229 3300006847 Bacteria 1793
263 Ga0075431_100264455 3300006847 Bacteria 1745
264 Ga0075431_100293953 3300006847 Bacteria 1642
265 Ga0075431_100346866 3300006847 Bacteria 1493
266 Ga0075431_100356520 3300006847 Bacteria 1470
267 Ga0075433_10006565 3300006852 Bacteria 9208
268 Ga0075433_10007354 3300006852 Bacteria 8738
269 Ga0075433_10015834 3300006852 Bacteria 6199
270 Ga0075433_10020929 3300006852 Bacteria 5478
271 Ga0075433_10023410 3300006852 Bacteria 5198
272 Ga0075433_10033083 3300006852 Bacteria 4431
273 Ga0075433_10040066 3300006852 Bacteria 4053
274 Ga0075433_10041933 3300006852 Bacteria 3968
275 Ga0075433_10051693 3300006852 Bacteria 3579
276 Ga0075433_10079744 3300006852 Bacteria 2885
277 Ga0075433_10127899 3300006852 Bacteria 2256
278 Ga0075433_10154287 3300006852 Bacteria 2043
279 Ga0075433_10326631 3300006852 Bacteria 1357
280 Ga0075434_100006864 3300006871 Bacteria 10487
281 Ga0075434_100015414 3300006871 Bacteria 7327
282 Ga0075434_100022146 3300006871 Bacteria 6189
283 Ga0075434_100038924 3300006871 Bacteria 4711
284 Ga0075434_100056389 3300006871 Bacteria 3904
285 Ga0075434_100073504 3300006871 Bacteria 3411
286 Ga0075434_100093326 3300006871 Bacteria 3013
287 Ga0075434_100131081 3300006871 Bacteria 2526
288 Ga0075434_100213320 3300006871 Bacteria 1951
289 Ga0075434_100331832 3300006871 Bacteria 1541
290 Ga0075434_100337841 3300006871 Bacteria 1527
291 Ga0075434_100361835 3300006871 Bacteria 1472
292 Ga0075429_100030148 3300006880 Bacteria 4712
293 Ga0075429_100030538 3300006880 Bacteria 4682
294 Ga0075429_100065317 3300006880 Bacteria 3168
295 Ga0075429_100153039 3300006880 Bacteria 2019
296 Ga0075429_100200546 3300006880 Bacteria 1748
297 Ga0068865_100130061 3300006881 Bacteria 1885
298 Ga0075436_100000484 3300006914 Bacteria 25728
299 Ga0075436_100001157 3300006914 Bacteria 17854
300 Ga0075436_100013617 3300006914 Bacteria 5571
301 Ga0075436_100041000 3300006914 Bacteria 3195
302 Ga0075436_100055140 3300006914 Bacteria 2744
303 Ga0075436_100186358 3300006914 Bacteria 1468
304 Ga0097620_100000040 3300006931 Bacteria 162782
305 Ga0097620_100001393 3300006931 Bacteria 24544
306 Ga0097620_100057277 3300006931 Bacteria 3925
307 Ga0097620_100070757 3300006931 Bacteria 3524
308 Ga0097620_100169913 3300006931 Bacteria 2261
309 Ga0097620_100223378 3300006931 Bacteria 1971
310 Ga0097620_100289938 3300006931 Bacteria 1730
311 Ga0097620_100292036 3300006931 Bacteria 1723
312 Ga0097620_100308455 3300006931 Bacteria 1676
313 Ga0097620_100531502 3300006931 Bacteria 1271
314 Ga0097620_100577506 3300006931 Bacteria 1218
315 Ga0075435_100000661 3300007076 Bacteria 21221
316 Ga0075435_100000861 3300007076 Bacteria 18993
317 Ga0075435_100015397 3300007076 Bacteria 5748
318 Ga0075435_100021364 3300007076 Bacteria 4977
319 Ga0075435_100034254 3300007076 Bacteria 4023
320 Ga0075435_100045285 3300007076 Bacteria 3526
321 Ga0075435_100057445 3300007076 Bacteria 3148
322 Ga0075435_100243996 3300007076 Bacteria 1528
323 Ga0075435_100259714 3300007076 Bacteria 1480
324 Ga0099794_10007435 3300007265 Bacteria 4502
325 Ga0099794_10015411 3300007265 Bacteria 3373
326 Ga0105240_10001893 3300009093 Bacteria 34758
327 Ga0105240_10003511 3300009093 Bacteria 24318
328 Ga0105240_10481763 3300009093 Bacteria 1383
329 Ga0111539_10036648 3300009094 Bacteria 5928
330 Ga0111539_10151663 3300009094 Bacteria 2713
331 Ga0111539_10577173 3300009094 Bacteria 1310
332 Ga0105245_10020323 3300009098 Bacteria 5823
333 Ga0105245_10215441 3300009098 Bacteria 1850
334 Ga0105245_10223820 3300009098 Bacteria 1817
335 Ga0105247_10048807 3300009101 Bacteria 2600
336 Ga0114129_10000115 3300009147 Bacteria 80576
337 Ga0114129_10000606 3300009147 Bacteria 44322
338 Ga0114129_10000989 3300009147 Bacteria 37153
339 Ga0114129_10001447 3300009147 Bacteria 32031
340 Ga0114129_10004337 3300009147 Bacteria 20051
341 Ga0114129_10007160 3300009147 Bacteria 15874
342 Ga0114129_10009875 3300009147 Bacteria 13607
343 Ga0114129_10012822 3300009147 Bacteria 11929
344 Ga0114129_10037834 3300009147 Bacteria 6810
345 Ga0114129_10038521 3300009147 Bacteria 6742
346 Ga0114129_10043328 3300009147 Bacteria 6331
347 Ga0114129_10058310 3300009147 Bacteria 5400
348 Ga0114129_10195563 3300009147 Bacteria 2743
349 Ga0114129_10201748 3300009147 Bacteria 2693
350 Ga0114129_10209918 3300009147 Bacteria 2633
351 Ga0114129_10370493 3300009147 Bacteria 1893
352 Ga0114129_10407235 3300009147 Bacteria 1792
353 Ga0114129_10426875 3300009147 Bacteria 1742
354 Ga0114129_10470198 3300009147 Bacteria 1646
355 Ga0114129_10545854 3300009147 Bacteria 1508
356 Ga0114129_10645445 3300009147 Bacteria 1367
357 Ga0105243_10007774 3300009148 Bacteria 8242
358 Ga0105243_10062699 3300009148 Bacteria 2977
359 Ga0105243_10077839 3300009148 Bacteria 2698
360 Ga0105243_10078043 3300009148 Bacteria 2695
361 Ga0105243_10103999 3300009148 Bacteria 2363
362 Ga0105243_10193126 3300009148 Bacteria 1780
363 Ga0105241_10001038 3300009174 Bacteria 21150
364 Ga0105241_10005578 3300009174 Bacteria 9292
365 Ga0105241_10008056 3300009174 Bacteria 7752
366 Ga0105241_10039118 3300009174 Bacteria 3577
367 Ga0105241_10409047 3300009174 Bacteria 1192
368 Ga0105242_10001218 3300009176 Bacteria 20294
369 Ga0105242_10013788 3300009176 Bacteria 6255
370 Ga0105242_10016052 3300009176 Bacteria 5817
371 Ga0105242_10020833 3300009176 Bacteria 5143
372 Ga0105242_10140548 3300009176 Bacteria 2094
373 Ga0105242_10250940 3300009176 Bacteria 1594
374 Ga0105248_10236579 3300009177 Bacteria 2056
375 Ga0105248_10398239 3300009177 Bacteria 1550
376 Ga0105248_10606946 3300009177 Bacteria 1234
377 Ga0105237_10113157 3300009545 Bacteria 2706
378 Ga0105237_10132541 3300009545 Bacteria 2486
379 Ga0105237_10137593 3300009545 Bacteria 2437
380 Ga0105237_10163938 3300009545 Bacteria 2221
381 Ga0105238_10004145 3300009551 Bacteria 14382
382 Ga0105238_10230465 3300009551 Bacteria 1829
383 Ga0105249_10064030 3300009553 Bacteria 3380
384 Ga0105249_10068385 3300009553 Bacteria 3275
385 Ga0105249_10185970 3300009553 Bacteria 2024
386 Ga0105249_10271515 3300009553 Bacteria 1690
387 Ga0105239_10007108 3300010375 Bacteria 12883
388 Ga0105239_10055844 3300010375 Bacteria 4332
389 Ga0105239_10087398 3300010375 Bacteria 3437
390 Ga0105239_10087761 3300010375 Bacteria 3429
391 Ga0105239_10339550 3300010375 Bacteria 1695
392 Ga0105239_10447288 3300010375 Bacteria 1465
393 Ga0105239_10524203 3300010375 Bacteria 1348
394 Ga0105239_10849962 3300010375 Bacteria 1047
395 Ga0105246_10001112 3300011119 Bacteria 15639
396 Ga0105246_10016830 3300011119 Bacteria 4639
397 Ga0105246_10088990 3300011119 Bacteria 2220
398 Ga0105246_10117252 3300011119 Bacteria 1967
399 Ga0105246_10305830 3300011119 Bacteria 1286
400 Ga0157373_10000388 3300013100 Bacteria 35150
401 Ga0157371_10296601 3300013102 Bacteria 1170
402 Ga0157370_10000198 3300013104 Bacteria 75713
403 Ga0157370_10000818 3300013104 Bacteria 39362
404 Ga0157370_10046261 3300013104 Bacteria 4172
405 Ga0157370_10249868 3300013104 Bacteria 1640
406 Ga0157370_10368484 3300013104 Bacteria 1324
407 Ga0157369_10001245 3300013105 Bacteria 31743
408 Ga0157369_10001661 3300013105 Bacteria 27115
409 Ga0157369_10030573 3300013105 Bacteria 5938
410 Ga0157369_10031785 3300013105 Bacteria 5808
411 Ga0157374_10368231 3300013296 Bacteria 1430
412 Ga0157374_10495130 3300013296 Bacteria 1226
413 Ga0157378_10152659 3300013297 Bacteria 2153
414 Ga0163162_10015647 3300013306 Bacteria 7413
415 Ga0163162_10036341 3300013306 Bacteria 4909
416 Ga0163162_10121502 3300013306 Bacteria 2716
417 Ga0163162_10406344 3300013306 Bacteria 1494
418 Ga0163162_10512014 3300013306 Bacteria 1330
419 Ga0157372_10000105 3300013307 Bacteria 88007
420 Ga0157372_10001637 3300013307 Bacteria 24320
421 Ga0157372_10011528 3300013307 Bacteria 9402
422 Ga0157372_10024982 3300013307 Bacteria 6493
423 Ga0157372_10072881 3300013307 Bacteria 3870
424 Ga0157372_10246811 3300013307 Bacteria 2072
425 Ga0157375_10004925 3300013308 Bacteria 11612
426 Ga0157375_10067766 3300013308 Bacteria 3567
427 Ga0163163_10046665 3300014325 Bacteria 4255
428 Ga0163163_10079414 3300014325 Bacteria 3279
429 Ga0163163_10128371 3300014325 Bacteria 2574
430 Ga0163163_10230416 3300014325 Bacteria 1901
431 Ga0157380_10314060 3300014326 Bacteria 1450
432 Ga0157380_10435084 3300014326 Bacteria 1255
433 Ga0157377_10118760 3300014745 Bacteria 1599
434 Ga0157379_10000880 3300014968 Bacteria 24318
435 Ga0157379_10045052 3300014968 Bacteria 3938
436 Ga0157379_10111783 3300014968 Bacteria 2454
437 Ga0157379_10266746 3300014968 Bacteria 1556
438 Ga0157376_10167870 3300014969 Bacteria 1995
439 Ga0213875_10012907 3300021388 Bacteria 4115
440 Ga0207697_10053432 3300025315 Bacteria 1673
441 Ga0207710_10133192 3300025900 Bacteria 1195
442 Ga0207688_10031185 3300025901 Bacteria 2942
443 Ga0207680_10227739 3300025903 Bacteria 1280
444 Ga0207699_10000111 3300025906 Bacteria 57717
445 Ga0207699_10000139 3300025906 Bacteria 48832
446 Ga0207699_10045062 3300025906 Bacteria 2572
447 Ga0207645_10000798 3300025907 Bacteria 26403
448 Ga0207643_10001465 3300025908 Bacteria 13545
449 Ga0207705_10070972 3300025909 Bacteria 2524
450 Ga0207684_10000115 3300025910 Bacteria 149762
451 Ga0207684_10018127 3300025910 Bacteria 6032
452 Ga0207684_10018826 3300025910 Bacteria 5907
453 Ga0207684_10036069 3300025910 Bacteria 4198
454 Ga0207684_10057491 3300025910 Bacteria 3300
455 Ga0207684_10103953 3300025910 Bacteria 2429
456 Ga0207684_10192582 3300025910 Bacteria 1759
457 Ga0207684_10208038 3300025910 Bacteria 1688
458 Ga0207684_10307359 3300025910 Bacteria 1367
459 Ga0207654_10004111 3300025911 Bacteria 7336
460 Ga0207654_10004933 3300025911 Bacteria 6752
461 Ga0207707_10000352 3300025912 Bacteria 48248
462 Ga0207707_10001028 3300025912 Bacteria 26771
463 Ga0207707_10053287 3300025912 Bacteria 3522
464 Ga0207707_10066466 3300025912 Bacteria 3140
465 Ga0207707_10282282 3300025912 Bacteria 1438
466 Ga0207695_10001015 3300025913 Bacteria 49447
467 Ga0207695_10021871 3300025913 Bacteria 7282
468 Ga0207695_10024708 3300025913 Bacteria 6748
469 Ga0207695_10247005 3300025913 Bacteria 1684
470 Ga0207671_10005738 3300025914 Bacteria 11316
471 Ga0207671_10092655 3300025914 Bacteria 2278
472 Ga0207693_10154458 3300025915 Bacteria 1805
473 Ga0207660_10000334 3300025917 Bacteria 30356
474 Ga0207660_10011747 3300025917 Bacteria 5710
475 Ga0207660_10018904 3300025917 Bacteria 4601
476 Ga0207660_10021029 3300025917 Bacteria 4385
477 Ga0207660_10162644 3300025917 Bacteria 1723
478 Ga0207660_10340969 3300025917 Bacteria 1200
479 Ga0207662_10114278 3300025918 Bacteria 1686
480 Ga0207662_10149262 3300025918 Bacteria 1486
481 Ga0207657_10002597 3300025919 Bacteria 19548
482 Ga0207657_10004228 3300025919 Bacteria 15213
483 Ga0207657_10007983 3300025919 Bacteria 10790
484 Ga0207649_10006035 3300025920 Bacteria 6576
485 Ga0207649_10045866 3300025920 Bacteria 2682
486 Ga0207652_10000466 3300025921 Bacteria 41482
487 Ga0207652_10005037 3300025921 Bacteria 10707
488 Ga0207652_10049521 3300025921 Bacteria 3596
489 Ga0207646_10000250 3300025922 Bacteria 73162
490 Ga0207646_10003851 3300025922 Bacteria 16662
491 Ga0207646_10014285 3300025922 Bacteria 7549
492 Ga0207646_10041645 3300025922 Bacteria 4128
493 Ga0207646_10076706 3300025922 Bacteria 2987
494 Ga0207646_10083956 3300025922 Bacteria 2849
495 Ga0207646_10087821 3300025922 Bacteria 2782
496 Ga0207646_10383495 3300025922 Bacteria 1270
497 Ga0207681_10000056 3300025923 Bacteria 106145
498 Ga0207681_10079595 3300025923 Bacteria 2309
499 Ga0207650_10000465 3300025925 Bacteria 34125
500 Ga0207650_10029853 3300025925 Bacteria 3922
501 Ga0207687_10002531 3300025927 Bacteria 12409
502 Ga0207687_10004210 3300025927 Bacteria 9621
503 Ga0207700_10000530 3300025928 Bacteria 22429
504 Ga0207700_10260813 3300025928 Bacteria 1484
505 Ga0207644_10020356 3300025931 Bacteria 4511
506 Ga0207644_10083270 3300025931 Bacteria 2368
507 Ga0207690_10006606 3300025932 Bacteria 6870
508 Ga0207706_10004728 3300025933 Bacteria 12750
509 Ga0207706_10024583 3300025933 Bacteria 5400
510 Ga0207706_10236555 3300025933 Bacteria 1597
511 Ga0207706_10510706 3300025933 Bacteria 1037
512 Ga0207686_10002382 3300025934 Bacteria 10257
513 Ga0207686_10013941 3300025934 Bacteria 4461
514 Ga0207709_10003271 3300025935 Bacteria 9720
515 Ga0207709_10042450 3300025935 Bacteria 2736
516 Ga0207709_10078057 3300025935 Bacteria 2125
517 Ga0207709_10311212 3300025935 Bacteria 1175
518 Ga0207670_10010707 3300025936 Bacteria 5293
519 Ga0207670_10212126 3300025936 Bacteria 1477
520 Ga0207669_10020836 3300025937 Bacteria 3447
521 Ga0207665_10000035 3300025939 Bacteria 87960
522 Ga0207665_10060437 3300025939 Bacteria 2566
523 Ga0207665_10060753 3300025939 Bacteria 2560
524 Ga0207691_10002614 3300025940 Bacteria 17587
525 Ga0207711_10206375 3300025941 Bacteria 1794
526 Ga0207711_10305392 3300025941 Bacteria 1468
527 Ga0207689_10010708 3300025942 Bacteria 7889
528 Ga0207689_10083925 3300025942 Bacteria 2619
529 Ga0207689_10174582 3300025942 Bacteria 1772
530 Ga0207679_10000878 3300025945 Bacteria 19200
531 Ga0207679_10007527 3300025945 Bacteria 6912
532 Ga0207679_10107174 3300025945 Bacteria 2198
533 Ga0207667_10000497 3300025949 Bacteria 51927
534 Ga0207667_10001501 3300025949 Bacteria 29287
535 Ga0207667_10009119 3300025949 Bacteria 11722
536 Ga0207667_10012054 3300025949 Bacteria 9997
537 Ga0207651_10125175 3300025960 Bacteria 1957
538 Ga0207712_10026594 3300025961 Bacteria 3857
539 Ga0207712_10133816 3300025961 Bacteria 1893
540 Ga0207640_10001632 3300025981 Bacteria 12012
541 Ga0207658_10098374 3300025986 Bacteria 2286
542 Ga0207658_10355906 3300025986 Bacteria 1276
543 Ga0207677_10091321 3300026023 Bacteria 2215
544 Ga0207703_10115038 3300026035 Bacteria 2301
545 Ga0207703_10175885 3300026035 Bacteria 1886
546 Ga0207703_10206938 3300026035 Bacteria 1747
547 Ga0207703_10365363 3300026035 Bacteria 1332
548 Ga0207639_10010031 3300026041 Bacteria 6547
549 Ga0207678_10013961 3300026067 Bacteria 7060
550 Ga0207678_10112641 3300026067 Bacteria 2321
551 Ga0207708_10078799 3300026075 Bacteria 2530
552 Ga0207708_10135745 3300026075 Bacteria 1927
553 Ga0207702_10005454 3300026078 Bacteria 11127
554 Ga0207702_10053472 3300026078 Bacteria 3418
555 Ga0207641_10005667 3300026088 Bacteria 10633
556 Ga0207641_10071505 3300026088 Bacteria 2984
557 Ga0207641_10094189 3300026088 Bacteria 2626
558 Ga0207648_10015946 3300026089 Bacteria 6885
559 Ga0207648_10052572 3300026089 Bacteria 3563
560 Ga0207648_10123435 3300026089 Bacteria 2277
561 Ga0207676_10023462 3300026095 Bacteria 4552
562 Ga0207676_10042934 3300026095 Bacteria 3478
563 Ga0207674_10004340 3300026116 Bacteria 17105
564 Ga0207674_10015196 3300026116 Bacteria 8472
565 Ga0207674_10130472 3300026116 Bacteria 2477
566 Ga0207675_100005709 3300026118 Bacteria 11909
567 Ga0207675_100057691 3300026118 Bacteria 3623
568 Ga0207675_100077492 3300026118 Bacteria 3114
569 Ga0207675_100324701 3300026118 Bacteria 1503
570 Ga0207675_100485250 3300026118 Bacteria 1229
571 Ga0207698_10000240 3300026142 Bacteria 33862
572 Ga0207698_10014900 3300026142 Bacteria 5188
573 Ga0207698_10348894 3300026142 Bacteria 1397
574 Ga0209967_1008406 3300027364 Bacteria 1421
575 Ga0209981_1000490 3300027378 Bacteria 5020
576 Ga0209996_1000338 3300027395 Bacteria 5808
577 Ga0210000_1003274 3300027462 Bacteria 2331
578 Ga0209995_1003064 3300027471 Bacteria 2654
579 Ga0209995_1003469 3300027471 Bacteria 2512
580 Ga0209968_1000579 3300027526 Bacteria 5659
581 Ga0209999_1000299 3300027543 Bacteria 7313
582 Ga0209999_1002950 3300027543 Bacteria 3017
583 Ga0209982_1002196 3300027552 Bacteria 2725
584 Ga0209983_1000034 3300027665 Bacteria 19527
585 Ga0209983_1000311 3300027665 Bacteria 10182
586 Ga0209983_1008657 3300027665 Bacteria 2077
587 Ga0209971_1000028 3300027682 Bacteria 53458
588 Ga0209966_1000073 3300027695 Bacteria 44067
589 Ga0209966_1004699 3300027695 Bacteria 2322
590 Ga0209998_10000001 3300027717 Bacteria 203589
591 Ga0209998_10002760 3300027717 Bacteria 3964
592 Ga0209998_10007482 3300027717 Bacteria 2266
593 Ga0209974_10000369 3300027876 Bacteria 14852
594 Ga0209974_10003339 3300027876 Bacteria 5797
595 Ga0207428_10000394 3300027907 Bacteria 54660
596 Ga0207428_10009358 3300027907 Bacteria 8789
597 Ga0207428_10038690 3300027907 Bacteria 3876
598 Ga0207428_10236072 3300027907 Bacteria 1367
599 Ga0268266_10003070 3300028379 Bacteria 17065
600 Ga0268266_10365160 3300028379 Bacteria 1359
601 Ga0268265_10000432 3300028380 Bacteria 44315
602 Ga0268265_10024098 3300028380 Bacteria 4300
603 Ga0268265_10056078 3300028380 Bacteria 2996
604 Ga0268265_10130634 3300028380 Bacteria 2086
605 Ga0268265_10145828 3300028380 Bacteria 1989
606 Ga0268265_10288897 3300028380 Bacteria 1471
607 Ga0268265_10415353 3300028380 Bacteria 1248
608 Ga0268264_10031393 3300028381 Bacteria 4356
609 Ga0268264_10109609 3300028381 Bacteria 2416
610 Ga0268264_10155527 3300028381 Bacteria 2054
611 Ga0268264_10252557 3300028381 Bacteria 1639
612 Ga0268264_10272964 3300028381 Bacteria 1580
613 Ga0268264_10585764 3300028381 Bacteria 1098
614 Ga0265338_10136374 3300028800 Bacteria 1928
615 Ga0265338_10222712 3300028800 Bacteria 1408
616 Ga0265330_10014715 3300031235 Bacteria 3629
617 Ga0265330_10021290 3300031235 Bacteria 2961
618 Ga0265332_10000481 3300031238 Bacteria 27648
619 Ga0265328_10006077 3300031239 Bacteria 5138
620 Ga0265329_10006179 3300031242 Bacteria 4773
621 Ga0265329_10021330 3300031242 Bacteria 2176
622 Ga0265340_10043902 3300031247 Bacteria 2189
623 Ga0265340_10080923 3300031247 Bacteria 1529
624 Ga0265340_10082345 3300031247 Bacteria 1513
625 Ga0265331_10000060 3300031250 Bacteria 170322
626 Ga0265327_10060750 3300031251 Bacteria 1931
627 Ga0265316_10000345 3300031344 Bacteria 52247
628 Ga0265316_10007021 3300031344 Bacteria 10673
629 Ga0265316_10014768 3300031344 Bacteria 6856
630 Ga0265316_10161723 3300031344 Bacteria 1673
631 Ga0307513_10003263 3300031456 Bacteria 22113
632 Ga0307408_100014736 3300031548 Bacteria 5197
633 Ga0307408_100070486 3300031548 Bacteria 2581
634 Ga0307408_100131550 3300031548 Bacteria 1953
635 Ga0316575_10007238 3300031665 Bacteria 4015
636 Ga0265314_10000614 3300031711 Bacteria 43873
637 Ga0265314_10001972 3300031711 Bacteria 21808
638 Ga0265314_10015835 3300031711 Bacteria 5971
639 Ga0265314_10045290 3300031711 Bacteria 3112
640 Ga0265342_10012902 3300031712 Bacteria 5635
641 Ga0265342_10097632 3300031712 Bacteria 1677
642 Ga0316576_10003001 3300031727 Bacteria 9796
643 Ga0316577_10034070 3300031733 Bacteria 2846
644 Ga0307410_10080577 3300031852 Bacteria 2284
645 Ga0307410_10305193 3300031852 Bacteria 1257
646 Ga0307407_10148631 3300031903 Bacteria 1520
647 Ga0307412_10197796 3300031911 Bacteria 1524
648 Ga0307409_100153494 3300031995 Bacteria 2003
649 Ga0307409_100424163 3300031995 Bacteria 1277
650 Ga0307416_100073791 3300032002 Bacteria 2847
651 Ga0307416_100150672 3300032002 Bacteria 2132
652 Ga0307416_100246980 3300032002 Bacteria 1734
653 Ga0307416_100260199 3300032002 Bacteria 1695
654 Ga0307415_100029417 3300032126 Bacteria 3511
655 Ga0373959_0024008 3300034820 Bacteria 1189
656 Ga0373929_0031139 3300035085 Bacteria 1141
657 Ga0373934_0008494 3300035086 Bacteria 3828
658 Ga0373934_0097135 3300035086 Bacteria 1190
659 Ga0373940_0054044 3300035088 Bacteria 1134
660 Ga0373951_0012488 3300035091 Bacteria 1910
661 Ga0373923_0179987 3300035111 Bacteria 971
662 Ga0373941_0069182 3300035115 Bacteria 1168
663 Ga0373945_0011856 3300035116 Bacteria 2888
664 Ga0373954_0008192 3300035118 Bacteria 4582
665 Ga0373954_0081302 3300035118 Bacteria 1548
666 Ga0373960_0007413 3300035121 Bacteria 2598
667 Ga0373955_0019020 3300035172 Bacteria 3425
668 Ga0373955_0062695 3300035172 Bacteria 2057
669 Ga0373961_0000199 3300035241 Bacteria 28196
670 Ga0373961_0046231 3300035241 Bacteria 1275
671 Ga0373935_0001203 3300035692 Bacteria 14256
672 Ga0373935_0017393 3300035692 Bacteria 4361
673 Ga0373933_0027491 3300035724 Bacteria 3276
674 Ga0373933_0182868 3300035724 Bacteria 1337
675 Ga0373947_0063466 3300035725 Bacteria 2250
676 Ga0373937_0005556 3300036401 Bacteria 10813
677 Ga0373937_0012914 3300036401 Bacteria 7357
678 Ga0373937_0016192 3300036401 Bacteria 6616
679 Ga0373937_0021254 3300036401 Bacteria 5823
680 Ga0316584_0008479 3300036712 Bacteria 7083
681 Ga0316584_0161953 3300036712 Bacteria 1662
682 Ga0373925_0006738 3300037068 Bacteria 8421
683 Ga0373925_0187694 3300037068 Bacteria 1639
684 Ga0395899_0013420 3300037312 Bacteria 6269
685 Ga0395900_0085973 3300037418 Bacteria 3232
686 Ga0395898_0011582 3300037466 Bacteria 9157
687 Ga0395898_0091150 3300037466 Bacteria 2933
688 Ga0395905_0004297 3300037471 Bacteria 14858
689 Ga0395905_0039261 3300037471 Bacteria 4441
690 Ga0395905_0464938 3300037471 Bacteria 1164
691 Ga0436364_0356041 3300037853 Bacteria 1908
692 Ga0436364_0833416 3300037853 Bacteria 7058
693 Ga0395901_0003440 3300038443 Bacteria 15953
694 Ga0242420_011442 3300038996 Bacteria 1489
695 Ga0400489_28503 3300039093 Bacteria 2003
696 Ga0451807_0493500 3300041486 Bacteria 1327
697 Ga0439433_0013261 3300041999 Bacteria 1809
698 Ga0439448_0001840 3300042005 Bacteria 5616
699 Ga0439456_035145 3300042013 Bacteria 1080
700 Ga0439458_0002296 3300042157 Bacteria 4694
701 Ga0439435_0009958 3300042436 Bacteria 2244
702 Ga0439459_0006519 3300042438 Bacteria 1946
703 Ga0439464_0001194 3300042439 Bacteria 6019
704 Ga0439460_0001203 3300042461 Bacteria 6099
705 Ga0451577_0015589 3300042876 Bacteria 7064
706 Ga0451577_0025265 3300042876 Bacteria 5391
707 Ga0451577_0031367 3300042876 Bacteria 4795
708 Ga0451577_0035839 3300042876 Bacteria 4469
709 Ga0451577_0127743 3300042876 Bacteria 2279
710 Ga0451577_0128231 3300042876 Bacteria 2274
711 Ga0451577_0265709 3300042876 Bacteria 1553
712 Ga0453683_0001474 3300044673 Bacteria 20207
713 Ga0453683_0003008 3300044673 Bacteria 12624
714 Ga0453683_0005950 3300044673 Bacteria 8409
715 Ga0453683_0008835 3300044673 Bacteria 6745
716 Ga0453683_0013136 3300044673 Bacteria 5414
717 Ga0453683_0033515 3300044673 Bacteria 3239
718 Ga0453683_0038563 3300044673 Bacteria 3004
719 Ga0466965_0004893 3300044683 Bacteria 5983
720 Ga0453684_0001052 3300044712 Bacteria 87915
721 Ga0453684_0032377 3300044712 Bacteria 7318
722 Ga0453684_0043747 3300044712 Bacteria 6011
723 Ga0453684_0059028 3300044712 Bacteria 4951
724 Ga0453684_0082341 3300044712 Bacteria 4009
725 Ga0453684_0367973 3300044712 Unclassified 1617
726 Ga0451576_0013826 3300045051 Bacteria 9017
727 Ga0451576_0026201 3300045051 Bacteria 6272
728 Ga0451576_0028871 3300045051 Bacteria 5941
729 Ga0451576_0029250 3300045051 Bacteria 5896
730 Ga0451576_0041797 3300045051 Bacteria 4844
731 Ga0451576_0078905 3300045051 Bacteria 3425
732 Ga0451576_0195499 3300045051 Bacteria 2112
733 Ga0451576_0254403 3300045051 Bacteria 1836
734 Ga0451576_0421375 3300045051 Bacteria 1400
735 Ga0495592_0075695 3300046454 Bacteria 2444
736 Ga0495629_0310045 3300046459 Bacteria 1080
737 Ga0495651_0137382 3300046462 Bacteria 1776
738 Ga0495580_0001974 3300046472 Bacteria 18020
739 Ga0495580_0010992 3300046472 Bacteria 7017
740 Ga0495580_0095154 3300046472 Bacteria 2072
741 Ga0495580_0157150 3300046472 Bacteria 1574
742 Ga0495580_0174647 3300046472 Bacteria 1484
743 Ga0495582_0010340 3300046473 Bacteria 5134
744 Ga0495582_0090441 3300046473 Bacteria 1706
745 Ga0495628_0054936 3300046516 Bacteria 3138
746 Ga0495628_0084085 3300046516 Bacteria 2470
747 Ga0495630_0268015 3300046517 Bacteria 1305
748 Ga0495666_0115589 3300046526 Bacteria 1259
749 Ga0495587_0063353 3300046536 Bacteria 2163
750 Ga0495667_0039791 3300046559 Bacteria 3124
751 Ga0495659_0013923 3300046664 Bacteria 2625
752 Ga0495599_0012572 3300046678 Bacteria 5221
753 Ga0495623_0209563 3300046679 Bacteria 1116
754 Ga0495680_0041043 3300047322 Bacteria 3681
755 Ga0495675_0184505 3300047444 Bacteria 1276
756 Ga0495684_0006590 3300047471 Bacteria 9008
757 Ga0495602_0014886 3300048088 Bacteria 7874
758 Ga0495602_0231516 3300048088 Bacteria 1388
759 Ga0495615_0001372 3300048090 Bacteria 3590
760 Ga0496102_0064043 3300048905 Bacteria 3367
761 Ga0496102_0359969 3300048905 Bacteria 1370
762 Ga0496102_0416494 3300048905 Bacteria 1262
763 Ga0496105_0337849 3300048908 Bacteria 1205
764 Ga0496106_0286933 3300048909 Bacteria 1319
765 Ga0496108_0000021 3300048911 Bacteria 215837
766 Ga0496109_0373117 3300048912 Bacteria 1348
767 Ga0496110_0105594 3300048913 Bacteria 2527
768 Ga0496112_0006853 3300048915 Bacteria 10046
769 Ga0496114_0000203 3300048917 Bacteria 43483
770 Ga0496114_0403811 3300048917 Bacteria 1210
771 Ga0496115_0136700 3300048918 Bacteria 2021
772 Ga0496116_0068580 3300048919 Bacteria 2259
773 Ga0501292_022475 3300049515 Bacteria 1026
774 Ga0501031_0009996 3300049568 Bacteria 6180
775 Ga0501031_0186729 3300049568 Bacteria 1354
776 Ga0501032_0000715 3300049569 Bacteria 27045
777 Ga0501032_0022020 3300049569 Bacteria 4424
778 Ga0501032_0112573 3300049569 Bacteria 1800
779 Ga0501033_0008980 3300049570 Bacteria 7718
780 Ga0501033_0034636 3300049570 Bacteria 3786
781 Ga0501036_0009735 3300049572 Bacteria 7915
782 Ga0501036_0012481 3300049572 Bacteria 7043
783 Ga0501036_0014895 3300049572 Bacteria 6487
784 Ga0501036_0035040 3300049572 Bacteria 4246
785 Ga0501036_0059976 3300049572 Bacteria 3223
786 Ga0501036_0139766 3300049572 Bacteria 2044
787 Ga0501036_0221331 3300049572 Unclassified 1589
788 Ga0501036_0336342 3300049572 Bacteria 1261
789 Ga0501037_0006094 3300049573 Bacteria 8814
790 Ga0501037_0017327 3300049573 Bacteria 5306
791 Ga0501037_0076544 3300049573 Bacteria 2429
792 Ga0501038_0000777 3300049574 Bacteria 28251
793 Ga0501038_0008351 3300049574 Bacteria 9526
794 Ga0501038_0034514 3300049574 Bacteria 4446
795 Ga0501038_0035789 3300049574 Bacteria 4358
796 Ga0501038_0104405 3300049574 Bacteria 2355
797 Ga0501038_0107795 3300049574 Bacteria 2311
798 Ga0501038_0123336 3300049574 Bacteria 2134
799 Ga0501038_0162845 3300049574 Bacteria 1811
800 Ga0501038_0177914 3300049574 Bacteria 1718
801 Ga0501039_0001226 3300049575 Bacteria 18831
802 Ga0501039_0006761 3300049575 Bacteria 8728
803 Ga0501039_0031295 3300049575 Bacteria 4101
804 Ga0501039_0091819 3300049575 Bacteria 2366
805 Ga0501039_0115936 3300049575 Bacteria 2097
806 Ga0501039_0122149 3300049575 Bacteria 2041
807 Ga0501039_0148096 3300049575 Bacteria 1845
808 Ga0501039_0201596 3300049575 Bacteria 1564
809 Ga0501039_0207785 3300049575 Bacteria 1539
810 Ga0501039_0255066 3300049575 Bacteria 1379
811 Ga0501040_0001715 3300049576 Bacteria 14046
812 Ga0501040_0002406 3300049576 Bacteria 12044
813 Ga0501040_0009020 3300049576 Bacteria 6487
814 Ga0501040_0019396 3300049576 Bacteria 4523
815 Ga0501040_0030326 3300049576 Bacteria 3653
816 Ga0501040_0061962 3300049576 Bacteria 2573
817 Ga0501040_0136357 3300049576 Bacteria 1728
818 Ga0501040_0159425 3300049576 Bacteria 1595
819 Ga0501040_0217366 3300049576 Bacteria 1359
820 Ga0501040_0274737 3300049576 Bacteria 1203
821 Ga0501041_0000102 3300049577 Bacteria 35437
822 Ga0501041_0000547 3300049577 Bacteria 19456
823 Ga0501041_0009513 3300049577 Bacteria 5729
824 Ga0501041_0013437 3300049577 Bacteria 4853
825 Ga0501041_0013503 3300049577 Bacteria 4843
826 Ga0501041_0048869 3300049577 Bacteria 2576
827 Ga0501041_0066915 3300049577 Bacteria 2202
828 Ga0501041_0066966 3300049577 Bacteria 2201
829 Ga0501041_0088655 3300049577 Bacteria 1910
830 Ga0501041_0129567 3300049577 Bacteria 1571
831 Ga0501041_0307501 3300049577 Bacteria 999
832 Ga0501042_0000777 3300049578 Bacteria 17428
833 Ga0501042_0001267 3300049578 Bacteria 14710
834 Ga0501042_0007483 3300049578 Bacteria 7156
835 Ga0501042_0007739 3300049578 Bacteria 7058
836 Ga0501042_0013603 3300049578 Bacteria 5541
837 Ga0501042_0178396 3300049578 Bacteria 1532
838 Ga0501042_0328028 3300049578 Bacteria 1106
839 Ga0501042_0332639 3300049578 Bacteria 1098
840 Ga0501042_0350367 3300049578 Bacteria 1068
841 Ga0501043_0027819 3300049579 Bacteria 4438
842 Ga0501043_0029257 3300049579 Bacteria 4327
843 Ga0501043_0084279 3300049579 Bacteria 2498
844 Ga0501043_0240312 3300049579 Bacteria 1397
845 Ga0501046_0000609 3300049580 Bacteria 35206
846 Ga0501046_0002061 3300049580 Bacteria 19077
847 Ga0501046_0016933 3300049580 Bacteria 6097
848 Ga0501046_0053831 3300049580 Bacteria 3168
849 Ga0501046_0074003 3300049580 Bacteria 2643
850 Ga0501046_0153752 3300049580 Bacteria 1735
851 Ga0501047_0033437 3300049581 Unclassified 4964
852 Ga0501047_0056714 3300049581 Bacteria 3789
853 Ga0501048_0009507 3300049582 Bacteria 7297
854 Ga0501048_0013053 3300049582 Bacteria 6168
855 Ga0501048_0021144 3300049582 Bacteria 4765
856 Ga0501048_0029246 3300049582 Bacteria 3998
857 Ga0501048_0129100 3300049582 Bacteria 1787
858 Ga0501067_0023263 3300049583 Bacteria 3433
859 Ga0501068_0019384 3300049584 Bacteria 3950
860 Ga0501068_0021026 3300049584 Bacteria 3808
861 Ga0501068_0030991 3300049584 Bacteria 3175
862 Ga0501068_0107978 3300049584 Bacteria 1729
863 Ga0501069_0013711 3300049585 Bacteria 4324
864 Ga0501070_0070558 3300049586 Bacteria 2893
865 Ga0501071_0000736 3300049587 Bacteria 17318
866 Ga0501071_0006665 3300049587 Bacteria 7504
867 Ga0501071_0008256 3300049587 Bacteria 6873
868 Ga0501071_0011626 3300049587 Bacteria 5942
869 Ga0501071_0037353 3300049587 Bacteria 3468
870 Ga0501071_0037678 3300049587 Bacteria 3453
871 Ga0501071_0068909 3300049587 Bacteria 2575
872 Ga0501071_0114476 3300049587 Bacteria 1995
873 Ga0501071_0123867 3300049587 Bacteria 1917
874 Ga0501071_0306199 3300049587 Bacteria 1205
875 Ga0501072_0002055 3300049588 Bacteria 14964
876 Ga0501072_0011453 3300049588 Bacteria 6780
877 Ga0501072_0026080 3300049588 Bacteria 4554
878 Ga0501072_0029867 3300049588 Bacteria 4259
879 Ga0501072_0108624 3300049588 Bacteria 2207
880 Ga0501072_0114142 3300049588 Bacteria 2151
881 Ga0501072_0120644 3300049588 Bacteria 2089
882 Ga0501072_0128583 3300049588 Bacteria 2018
883 Ga0501072_0184663 3300049588 Bacteria 1664
884 Ga0501072_0244993 3300049588 Bacteria 1428
885 Ga0501072_0272991 3300049588 Bacteria 1345
886 Ga0501073_0052224 3300049589 Bacteria 2862
887 Ga0501073_0201875 3300049589 Bacteria 1375
888 Ga0501073_0214015 3300049589 Bacteria 1332
889 Ga0501074_0005624 3300049590 Bacteria 9026
890 Ga0501074_0017390 3300049590 Bacteria 5216
891 Ga0501074_0022846 3300049590 Bacteria 4548
892 Ga0501074_0039666 3300049590 Bacteria 3410
893 Ga0501074_0117633 3300049590 Bacteria 1901
894 Ga0501074_0135113 3300049590 Bacteria 1764
895 Ga0501075_0000122 3300049591 Bacteria 37780
896 Ga0501075_0000396 3300049591 Bacteria 25290
897 Ga0501075_0001934 3300049591 Bacteria 13661
898 Ga0501075_0002981 3300049591 Bacteria 11324
899 Ga0501075_0009771 3300049591 Bacteria 6723
900 Ga0501075_0021216 3300049591 Bacteria 4734
901 Ga0501075_0022327 3300049591 Bacteria 4621
902 Ga0501075_0024727 3300049591 Bacteria 4409
903 Ga0501075_0026576 3300049591 Bacteria 4263
904 Ga0501075_0029861 3300049591 Bacteria 4033
905 Ga0501075_0034562 3300049591 Bacteria 3764
906 Ga0501075_0037335 3300049591 Bacteria 3629
907 Ga0501075_0090322 3300049591 Bacteria 2324
908 Ga0501075_0095222 3300049591 Bacteria 2259
909 Ga0501075_0114541 3300049591 Bacteria 2050
910 Ga0501075_0165895 3300049591 Bacteria 1685
911 Ga0501075_0171410 3300049591 Bacteria 1656
912 Ga0501075_0218668 3300049591 Bacteria 1453
913 Ga0501076_0000012 3300049592 Bacteria 113396
914 Ga0501076_0001680 3300049592 Bacteria 14960
915 Ga0501076_0013412 3300049592 Bacteria 6145
916 Ga0501076_0015372 3300049592 Bacteria 5783
917 Ga0501076_0017411 3300049592 Bacteria 5461
918 Ga0501076_0027487 3300049592 Bacteria 4411
919 Ga0501076_0027519 3300049592 Bacteria 4408
920 Ga0501076_0035572 3300049592 Bacteria 3896
921 Ga0501076_0039578 3300049592 Bacteria 3701
922 Ga0501076_0084900 3300049592 Bacteria 2543
923 Ga0501076_0090478 3300049592 Bacteria 2461
924 Ga0501076_0096741 3300049592 Bacteria 2378
925 Ga0501076_0102630 3300049592 Bacteria 2306
926 Ga0501076_0370695 3300049592 Bacteria 1176
927 Ga0501077_0000286 3300049593 Bacteria 30007
928 Ga0501077_0000535 3300049593 Bacteria 23056
929 Ga0501077_0009289 3300049593 Bacteria 6103
930 Ga0501077_0013064 3300049593 Bacteria 5203
931 Ga0501077_0023252 3300049593 Bacteria 3929
932 Ga0501077_0034569 3300049593 Bacteria 3217
933 Ga0501077_0045440 3300049593 Bacteria 2790
934 Ga0501077_0107000 3300049593 Bacteria 1772
935 Ga0501077_0131868 3300049593 Bacteria 1584
936 Ga0501077_0228813 3300049593 Bacteria 1182
937 Ga0501077_0265357 3300049593 Bacteria 1092
938 Ga0501079_0000134 3300049741 Bacteria 40016
939 Ga0501079_0001185 3300049741 Bacteria 18261
940 Ga0501079_0009499 3300049741 Bacteria 7373
941 Ga0501079_0028153 3300049741 Bacteria 4311
942 Ga0501079_0041859 3300049741 Bacteria 3537
943 Ga0501079_0050199 3300049741 Bacteria 3221
944 Ga0501079_0054168 3300049741 Bacteria 3094
945 Ga0501079_0062677 3300049741 Bacteria 2868
946 Ga0501079_0090959 3300049741 Bacteria 2364
947 Ga0501079_0093911 3300049741 Bacteria 2324
948 Ga0501079_0115618 3300049741 Bacteria 2085
949 Ga0501079_0422537 3300049741 Unclassified 1046
950 Ga0501080_0000292 3300049742 Bacteria 38028
951 Ga0501080_0042240 3300049742 Bacteria 4247
952 Ga0501080_0064352 3300049742 Bacteria 3411
953 Ga0501080_0071315 3300049742 Bacteria 3231
954 Ga0501080_0138599 3300049742 Bacteria 2250
955 Ga0501080_0191102 3300049742 Bacteria 1881
956 Ga0501080_0205704 3300049742 Bacteria 1805
957 Ga0501080_0302254 3300049742 Unclassified 1451
958 Ga0501081_0001499 3300049743 Bacteria 14316
959 Ga0501081_0002476 3300049743 Bacteria 11636
960 Ga0501081_0003182 3300049743 Bacteria 10436
961 Ga0501081_0003765 3300049743 Bacteria 9712
962 Ga0501081_0006424 3300049743 Bacteria 7628
963 Ga0501081_0008697 3300049743 Bacteria 6598
964 Ga0501081_0022284 3300049743 Bacteria 4236
965 Ga0501081_0023006 3300049743 Bacteria 4173
966 Ga0501081_0040032 3300049743 Bacteria 3208
967 Ga0501081_0049117 3300049743 Bacteria 2904
968 Ga0501081_0065546 3300049743 Bacteria 2525
969 Ga0501081_0096799 3300049743 Bacteria 2082
970 Ga0501081_0135375 3300049743 Bacteria 1763
971 Ga0501081_0176142 3300049743 Bacteria 1546
972 Ga0501081_0193443 3300049743 Bacteria 1474
973 Ga0501081_0259273 3300049743 Bacteria 1270
974 Ga0501083_0015479 3300049744 Bacteria 5342
975 Ga0501083_0028126 3300049744 Bacteria 3877
976 Ga0501083_0098044 3300049744 Bacteria 1934
977 Ga0501083_0098763 3300049744 Bacteria 1926
978 Ga0501083_0128277 3300049744 Bacteria 1662
979 Ga0501035_0006607 3300049822 Bacteria 10855
980 Ga0501035_0008587 3300049822 Bacteria 9508
981 Ga0501035_0022542 3300049822 Bacteria 5784
982 Ga0501035_0048808 3300049822 Bacteria 3795
983 Ga0501035_0358583 3300049822 Bacteria 1219
984 Ga0501044_0009573 3300049823 Bacteria 10548
985 Ga0501044_0065207 3300049823 Bacteria 3715
986 Ga0501044_0072920 3300049823 Bacteria 3490
987 Ga0501045_0002290 3300049824 Bacteria 12977
988 Ga0501045_0013299 3300049824 Bacteria 5810
989 Ga0501045_0024946 3300049824 Bacteria 4295
990 Ga0501045_0025790 3300049824 Bacteria 4226
991 Ga0501045_0071396 3300049824 Bacteria 2555
992 Ga0501045_0084316 3300049824 Bacteria 2344
993 Ga0501045_0094825 3300049824 Bacteria 2207
994 Ga0501045_0099300 3300049824 Bacteria 2154
995 Ga0501045_0114239 3300049824 Bacteria 2002
996 Ga0501045_0334744 3300049824 Bacteria 1126
997 nmdc:mga05p37_106059_c1 3300050507 Bacteria 3456
998 nmdc:mga05p37_14582_c1 3300050507 Bacteria 9438
999 nmdc:mga05p37_175872_c1 3300050507 Bacteria 2608
1000 nmdc:mga05p37_2021_c1 3300050507 Bacteria 19081
1001 nmdc:mga05p37_21565_c1 3300050507 Bacteria 7806
1002 nmdc:mga05p37_26457_c1 3300050507 Bacteria 7057
1003 nmdc:mga05p37_28205_c1 3300050507 Bacteria 6844
1004 nmdc:mga05p37_285082_c1 3300050507 Bacteria 1968
1005 nmdc:mga05p37_29805_c1 3300050507 Bacteria 6658
1006 nmdc:mga05p37_353481_c1 3300050507 Bacteria 1730
1007 nmdc:mga05p37_37629_c1 3300050507 Bacteria 5933
1008 nmdc:mga05p37_4063_c1 3300050507 Bacteria 17103
1009 nmdc:mga05p37_490438_c1 3300050507 Bacteria 1413
1010 nmdc:mga05p37_50376_c1 3300050507 Bacteria 5121
1011 nmdc:mga05p37_568149_c1 3300050507 Bacteria 1287
1012 nmdc:mga09592_111472_c1 3300050508 Bacteria 2347
1013 nmdc:mga09592_181430_c1 3300050508 Bacteria 1821
1014 nmdc:mga09592_27631_c1 3300050508 Bacteria 4709
1015 nmdc:mga09592_364253_c1 3300050508 Bacteria 1251
1016 nmdc:mga09592_52126_c1 3300050508 Bacteria 3453
1017 nmdc:mga09592_58939_c1 3300050508 Bacteria 3246
1018 nmdc:mga0qj67_122974_c1 3300050509 Bacteria 2099
1019 nmdc:mga0qj67_147915_c1 3300050509 Bacteria 1905
1020 nmdc:mga0qj67_198385_c1 3300050509 Bacteria 1631
1021 nmdc:mga0qj67_20713_c1 3300050509 Bacteria 5037
1022 nmdc:mga0qj67_253446_c1 3300050509 Bacteria 1428
1023 nmdc:mga0qj67_343_c1 3300050509 Bacteria 32121
1024 nmdc:mga0qj67_798_c1 3300050509 Bacteria 21472
1025 nmdc:mga06r32_105200_c1 3300050510 Bacteria 2772
1026 nmdc:mga06r32_12642_c1 3300050510 Bacteria 7628
1027 nmdc:mga06r32_14068_c1 3300050510 Bacteria 7257
1028 nmdc:mga06r32_144949_c1 3300050510 Bacteria 2352
1029 nmdc:mga06r32_150179_c1 3300050510 Bacteria 2308
1030 nmdc:mga06r32_20307_c1 3300050510 Bacteria 6114
1031 nmdc:mga06r32_27649_c1 3300050510 Bacteria 5302
1032 nmdc:mga06r32_28995_c1 3300050510 Bacteria 5183
1033 nmdc:mga06r32_313473_c1 3300050510 Bacteria 1554
1034 nmdc:mga06r32_37633_c1 3300050510 Bacteria 4577
1035 nmdc:mga06r32_4631_c1 3300050510 Bacteria 12337
1036 nmdc:mga06r32_53714_c1 3300050510 Bacteria 3860
1037 nmdc:mga06r32_65554_c1 3300050510 Bacteria 3503
1038 nmdc:mga06r32_91676_c1 3300050510 Bacteria 2970
1039 nmdc:mga08y16_1222_c1 3300050511 Bacteria 25420
1040 nmdc:mga08y16_1417_c1 3300050511 Bacteria 24061
1041 nmdc:mga08y16_9313_c1 3300050511 Bacteria 10300
1042 nmdc:mga0n895_109551_c1 3300050512 Bacteria 2777
1043 nmdc:mga0n895_115061_c1 3300050512 Bacteria 2708
1044 nmdc:mga0n895_11638_c1 3300050512 Bacteria 7859
1045 nmdc:mga0n895_120247_c1 3300050512 Bacteria 2648
1046 nmdc:mga0n895_136637_c1 3300050512 Bacteria 2478
1047 nmdc:mga0n895_138314_c1 3300050512 Bacteria 2463
1048 nmdc:mga0n895_172739_c1 3300050512 Bacteria 2193
1049 nmdc:mga0n895_173444_c1 3300050512 Bacteria 2188
1050 nmdc:mga0n895_203426_c1 3300050512 Bacteria 2011
1051 nmdc:mga0n895_299104_c1 3300050512 Bacteria 1631
1052 nmdc:mga0n895_38771_c1 3300050512 Bacteria 4618
1053 nmdc:mga0n895_407561_c1 3300050512 Bacteria 1375
1054 nmdc:mga0n895_41651_c1 3300050512 Bacteria 4466
1055 nmdc:mga0n895_77063_c1 3300050512 Bacteria 3316
1056 nmdc:mga0n895_8039_c1 3300050512 Bacteria 9100
1057 nmdc:mga0rr50_15651_c1 3300050513 Bacteria 5012
1058 nmdc:mga0rr50_183699_c1 3300050513 Bacteria 1711
1059 nmdc:mga0rr50_23145_c1 3300050513 Bacteria 4277
1060 nmdc:mga0rr50_26389_c1 3300050513 Bacteria 4052
1061 nmdc:mga0rr50_33149_c1 3300050513 Bacteria 3688
1062 nmdc:mga0rr50_45365_c1 3300050513 Bacteria 3230
1063 nmdc:mga0rr50_497169_c1 3300050513 Bacteria 1037
1064 nmdc:mga0rr50_71346_c1 3300050513 Bacteria 2650
1065 nmdc:mga0rr50_75534_c1 3300050513 Bacteria 2583
1066 nmdc:mga0rr50_958_c1 3300050513 Bacteria 15640
1067 nmdc:mga08x19_141788_c1 3300050514 Bacteria 1623
1068 nmdc:mga08x19_15357_c1 3300050514 Bacteria 4659
1069 nmdc:mga08x19_169_c1 3300050514 Bacteria 54149
1070 nmdc:mga08x19_23933_c1 3300050514 Bacteria 3791
1071 nmdc:mga08x19_256860_c1 3300050514 Bacteria 1207
1072 nmdc:mga08x19_47050_c1 3300050514 Bacteria 1851
1073 nmdc:mga08x19_7471_c1 3300050514 Bacteria 6491
1074 nmdc:mga0a205_12060_c1 3300050515 Bacteria 7985
1075 nmdc:mga0a205_123616_c1 3300050515 Bacteria 2487
1076 nmdc:mga0a205_158102_c1 3300050515 Bacteria 2164
1077 nmdc:mga0a205_167521_c1 3300050515 Bacteria 2093
1078 nmdc:mga0a205_24042_c1 3300050515 Bacteria 5786
1079 nmdc:mga0a205_27057_c1 3300050515 Bacteria 5475
1080 nmdc:mga0a205_2861_c1 3300050515 Bacteria 15274
1081 nmdc:mga0a205_33548_c1 3300050515 Bacteria 4921
1082 nmdc:mga0a205_33951_c1 3300050515 Bacteria 4893
1083 nmdc:mga0a205_4319_c1 3300050515 Bacteria 12739
1084 nmdc:mga0a205_467345_c1 3300050515 Bacteria 1120
1085 nmdc:mga0a205_47974_c1 3300050515 Bacteria 4122
1086 nmdc:mga0a205_49115_c1 3300050515 Bacteria 4072
1087 nmdc:mga0a205_54303_c1 3300050515 Bacteria 3868
1088 nmdc:mga0a205_64006_c1 3300050515 Bacteria 3552
1089 nmdc:mga0a205_68685_c1 3300050515 Bacteria 3422
1090 Ga0495655_0039196 3300053083 Bacteria 1200
1091 Ga0500643_001116 3300053087 Bacteria 16061
1092 Ga0500616_0002615 3300053153 Bacteria 14700
1093 Ga0501084_0001169 3300054114 Bacteria 20453
1094 Ga0501084_0001730 3300054114 Bacteria 17322
1095 Ga0501084_0010389 3300054114 Bacteria 7697
1096 Ga0501084_0012647 3300054114 Bacteria 6993
1097 Ga0501084_0019381 3300054114 Bacteria 5667
1098 Ga0501084_0026174 3300054114 Bacteria 4866
1099 Ga0501084_0035718 3300054114 Bacteria 4155
1100 Ga0501084_0036762 3300054114 Bacteria 4092
1101 Ga0501084_0040118 3300054114 Bacteria 3916
1102 Ga0501084_0084376 3300054114 Bacteria 2667
1103 Ga0501084_0088966 3300054114 Bacteria 2592
1104 Ga0501084_0298951 3300054114 Bacteria 1359
1105 Ga0590071_012403 3300059421 Bacteria 1996
1106 Ga0501082_0000931 3300060353 Bacteria 25889
1107 Ga0501082_0001240 3300060353 Bacteria 22445
1108 Ga0501082_0002631 3300060353 Bacteria 15690
1109 Ga0501082_0008973 3300060353 Bacteria 8632
1110 Ga0501082_0009410 3300060353 Bacteria 8414
1111 Ga0501082_0011314 3300060353 Bacteria 7669
1112 Ga0501082_0016940 3300060353 Bacteria 6274
1113 Ga0501082_0026089 3300060353 Bacteria 5037
1114 Ga0501082_0028186 3300060353 Bacteria 4839
1115 Ga0501082_0039563 3300060353 Bacteria 4067
1116 Ga0501082_0109702 3300060353 Bacteria 2389
1117 Ga0501082_0135157 3300060353 Bacteria 2139
1118 Ga0501082_0168629 3300060353 Bacteria 1903
1119 Ga0501082_0419362 3300060353 Bacteria 1169
1120 Ga0501082_0449872 3300060353 Bacteria 1125
1121 Ga0530510_0000015 3300061734 Bacteria 104554
1122 Ga0530510_0001748 3300061734 Bacteria 14807
1123 Ga0530510_0012716 3300061734 Bacteria 5916
1124 Ga0530510_0014668 3300061734 Bacteria 5532
1125 Ga0530510_0014748 3300061734 Bacteria 5518
1126 Ga0530510_0020766 3300061734 Bacteria 4671
1127 Ga0530510_0024091 3300061734 Bacteria 4342
1128 Ga0530510_0037914 3300061734 Bacteria 3477
1129 Ga0530510_0041545 3300061734 Bacteria 3320
1130 Ga0530510_0063269 3300061734 Bacteria 2679
1131 Ga0530510_0087001 3300061734 Bacteria 2277
1132 Ga0530510_0106010 3300061734 Bacteria 2057
1133 Ga0530510_0113530 3300061734 Bacteria 1985
1134 Ga0530510_0119452 3300061734 Bacteria 1934
1135 Ga0530510_0134848 3300061734 Bacteria 1817
1136 Ga0530510_0153733 3300061734 Bacteria 1700
1137 Ga0530510_0211240 3300061734 Bacteria 1442
1138 Ga0530510_0285620 3300061734 Bacteria 1233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0009289 Ga0501077_0009289_14_802 255
2 3300026118 Ga0207675_100485250 Ga0207675_1004852502 280
3 3300044673 Ga0453683_0038563 Ga0453683_0038563_86_997 289
4 3300045051 Ga0451576_0421375 Ga0451576_0421375_342_1253 289
5 3300006847 Ga0075431_100293953 Ga0075431_1002939532 290
6 3300006880 Ga0075429_100065317 Ga0075429_1000653172 290
7 3300048905 Ga0496102_0416494 Ga0496102_0416494_352_1245 290
8 3300049515 Ga0501292_022475 Ga0501292_022475_123_1013 290
9 3300049569 Ga0501032_0022020 Ga0501032_0022020_35_928 290
10 3300049572 Ga0501036_0035040 Ga0501036_0035040_925_1806 290
11 3300049574 Ga0501038_0177914 Ga0501038_0177914_453_1334 290
12 3300049575 Ga0501039_0148096 Ga0501039_0148096_467_1348 290
13 3300049576 Ga0501040_0030326 Ga0501040_0030326_2584_3465 290
14 3300049577 Ga0501041_0129567 Ga0501041_0129567_428_1309 290
15 3300049577 Ga0501041_0307501 Ga0501041_0307501_23_916 290
16 3300049587 Ga0501071_0114476 Ga0501071_0114476_365_1246 290
17 3300049590 Ga0501074_0039666 Ga0501074_0039666_1495_2376 290
18 3300049591 Ga0501075_0002981 Ga0501075_0002981_9342_10223 290
19 3300049592 Ga0501076_0039578 Ga0501076_0039578_991_1872 290
20 3300049741 Ga0501079_0028153 Ga0501079_0028153_2587_3468 290
21 3300049742 Ga0501080_0138599 Ga0501080_0138599_120_1001 290
22 3300049824 Ga0501045_0013299 Ga0501045_0013299_4614_5495 290
23 3300054114 Ga0501084_0010389 Ga0501084_0010389_991_1872 290
24 3300060353 Ga0501082_0028186 Ga0501082_0028186_3513_4394 290
25 3300061734 Ga0530510_0106010 Ga0530510_0106010_920_1801 290
26 3300046473 Ga0495582_0090441 Ga0495582_0090441_312_1193 291
27 3300049576 Ga0501040_0159425 Ga0501040_0159425_309_1232 293
28 3300050512 nmdc:mga0n895_109551_c1 nmdc:mga0n895_109551_c1_1602_2531 293
29 3300009147 Ga0114129_10407235 Ga0114129_104072352 294
30 3300042013 Ga0439456_035145 Ga0439456_035145_40_966 294
31 3300049572 Ga0501036_0221331 Ga0501036_0221331_20_946 294
32 3300049575 Ga0501039_0255066 Ga0501039_0255066_232_1158 294
33 3300049577 Ga0501041_0013437 Ga0501041_0013437_48_974 294
34 3300049578 Ga0501042_0007483 Ga0501042_0007483_10_900 294
35 3300049578 Ga0501042_0013603 Ga0501042_0013603_4585_5511 294
36 3300049591 Ga0501075_0009771 Ga0501075_0009771_88_1014 294
37 3300049592 Ga0501076_0013412 Ga0501076_0013412_116_1042 294
38 3300049593 Ga0501077_0228813 Ga0501077_0228813_277_1170 294
39 3300049741 Ga0501079_0422537 Ga0501079_0422537_11_937 294
40 3300049742 Ga0501080_0302254 Ga0501080_0302254_469_1395 294
41 3300049743 Ga0501081_0002476 Ga0501081_0002476_5891_6817 294
42 3300049824 Ga0501045_0084316 Ga0501045_0084316_1370_2296 294
43 3300050507 nmdc:mga05p37_568149_c1 nmdc:mga05p37_568149_c1_316_1245 294
44 3300050512 nmdc:mga0n895_138314_c1 nmdc:mga0n895_138314_c1_217_1146 294
45 3300054114 Ga0501084_0019381 Ga0501084_0019381_4717_5643 294
46 3300061734 Ga0530510_0020766 Ga0530510_0020766_3113_4039 294
47 3300049743 Ga0501081_0259273 Ga0501081_0259273_14_910 295
48 3300027717 Ga0209998_10007482 Ga0209998_100074822 296
49 3300049741 Ga0501079_0050199 Ga0501079_0050199_1903_2829 298
50 3300035111 Ga0373923_0179987 Ga0373923_0179987_46_960 299
51 3300042436 Ga0439435_0009958 Ga0439435_0009958_539_1444 299
52 3300049824 Ga0501045_0334744 Ga0501045_0334744_201_1115 302
53 3300050507 nmdc:mga05p37_4063_c1 nmdc:mga05p37_4063_c1_10941_11855 302
54 3300039093 Ga0400489_28503 Ga0400489_28503_58_990 304
55 3300041999 Ga0439433_0013261 Ga0439433_0013261_30_953 304
56 3300049743 Ga0501081_0065546 Ga0501081_0065546_479_1402 304
57 3300003349 JGI26129J50193_1000897 JGI26129J50193_10008972 305
58 3300005336 Ga0070680_100371114 Ga0070680_1003711141 305
59 3300005341 Ga0070691_10142517 Ga0070691_101425172 305
60 3300005345 Ga0070692_10001115 Ga0070692_100011156 305
61 3300005355 Ga0070671_100216448 Ga0070671_1002164483 305
62 3300005438 Ga0070701_10069613 Ga0070701_100696131 305
63 3300005440 Ga0070705_100035395 Ga0070705_1000353953 305
64 3300005444 Ga0070694_100008838 Ga0070694_1000088385 305
65 3300005445 Ga0070708_100227743 Ga0070708_1002277432 305
66 3300005457 Ga0070662_100203761 Ga0070662_1002037612 305
67 3300005467 Ga0070706_100117748 Ga0070706_1001177482 305
68 3300005467 Ga0070706_100193516 Ga0070706_1001935162 305
69 3300005468 Ga0070707_100002097 Ga0070707_10000209719 305
70 3300005468 Ga0070707_100032582 Ga0070707_1000325826 305
71 3300005518 Ga0070699_100061434 Ga0070699_1000614342 305
72 3300005536 Ga0070697_100070721 Ga0070697_1000707211 305
73 3300005545 Ga0070695_100003891 Ga0070695_1000038916 305
74 3300005546 Ga0070696_100012836 Ga0070696_1000128364 305
75 3300005546 Ga0070696_100332285 Ga0070696_1003322852 305
76 3300005549 Ga0070704_100046308 Ga0070704_1000463081 305
77 3300005617 Ga0068859_100577471 Ga0068859_1005774711 305
78 3300005843 Ga0068860_100265987 Ga0068860_1002659872 305
79 3300005843 Ga0068860_100368764 Ga0068860_1003687642 305
80 3300005843 Ga0068860_100450465 Ga0068860_1004504652 305
81 3300005937 Ga0081455_10022220 Ga0081455_100222204 305
82 3300005981 Ga0081538_10015371 Ga0081538_100153712 305
83 3300005983 Ga0081540_1005034 Ga0081540_10050346 305
84 3300006175 Ga0070712_100006589 Ga0070712_1000065897 305
85 3300006844 Ga0075428_100087024 Ga0075428_1000870242 305
86 3300006847 Ga0075431_100023868 Ga0075431_1000238685 305
87 3300006847 Ga0075431_100252229 Ga0075431_1002522292 305
88 3300006871 Ga0075434_100361835 Ga0075434_1003618352 305
89 3300006914 Ga0075436_100041000 Ga0075436_1000410004 305
90 3300006931 Ga0097620_100577506 Ga0097620_1005775061 305
91 3300007076 Ga0075435_100000661 Ga0075435_10000066116 305
92 3300009094 Ga0111539_10036648 Ga0111539_100366483 305
93 3300009147 Ga0114129_10470198 Ga0114129_104701982 305
94 3300009148 Ga0105243_10007774 Ga0105243_100077746 305
95 3300009176 Ga0105242_10016052 Ga0105242_100160522 305
96 3300009177 Ga0105248_10398239 Ga0105248_103982392 305
97 3300009553 Ga0105249_10185970 Ga0105249_101859702 305
98 3300013307 Ga0157372_10072881 Ga0157372_100728812 305
99 3300013307 Ga0157372_10246811 Ga0157372_102468113 305
100 3300025910 Ga0207684_10208038 Ga0207684_102080382 305
101 3300025917 Ga0207660_10162644 Ga0207660_101626442 305
102 3300025922 Ga0207646_10014285 Ga0207646_100142858 305
103 3300025922 Ga0207646_10383495 Ga0207646_103834952 305
104 3300025933 Ga0207706_10236555 Ga0207706_102365552 305
105 3300025934 Ga0207686_10013941 Ga0207686_100139413 305
106 3300025935 Ga0207709_10003271 Ga0207709_100032713 305
107 3300027364 Ga0209967_1008406 Ga0209967_10084061 305
108 3300027378 Ga0209981_1000490 Ga0209981_10004902 305
109 3300027395 Ga0209996_1000338 Ga0209996_10003382 305
110 3300027462 Ga0210000_1003274 Ga0210000_10032742 305
111 3300027471 Ga0209995_1003064 Ga0209995_10030642 305
112 3300027526 Ga0209968_1000579 Ga0209968_10005792 305
113 3300027543 Ga0209999_1000299 Ga0209999_10002995 305
114 3300027552 Ga0209982_1002196 Ga0209982_10021962 305
115 3300027665 Ga0209983_1000034 Ga0209983_100003410 305
116 3300027682 Ga0209971_1000028 Ga0209971_100002811 305
117 3300027695 Ga0209966_1000073 Ga0209966_10000733 305
118 3300027695 Ga0209966_1004699 Ga0209966_10046992 305
119 3300027717 Ga0209998_10000001 Ga0209998_10000001151 305
120 3300027876 Ga0209974_10000369 Ga0209974_1000036910 305
121 3300027907 Ga0207428_10000394 Ga0207428_100003944 305
122 3300028380 Ga0268265_10024098 Ga0268265_100240985 305
123 3300028380 Ga0268265_10130634 Ga0268265_101306342 305
124 3300028380 Ga0268265_10288897 Ga0268265_102888972 305
125 3300028381 Ga0268264_10155527 Ga0268264_101555272 305
126 3300031235 Ga0265330_10014715 Ga0265330_100147154 305
127 3300031235 Ga0265330_10021290 Ga0265330_100212902 305
128 3300031238 Ga0265332_10000481 Ga0265332_1000048114 305
129 3300031239 Ga0265328_10006077 Ga0265328_100060774 305
130 3300031242 Ga0265329_10006179 Ga0265329_100061793 305
131 3300031242 Ga0265329_10021330 Ga0265329_100213303 305
132 3300031250 Ga0265331_10000060 Ga0265331_1000006079 305
133 3300031251 Ga0265327_10060750 Ga0265327_100607503 305
134 3300031344 Ga0265316_10000345 Ga0265316_1000034520 305
135 3300031344 Ga0265316_10161723 Ga0265316_101617232 305
136 3300031711 Ga0265314_10000614 Ga0265314_1000061427 305
137 3300031711 Ga0265314_10015835 Ga0265314_100158356 305
138 3300031711 Ga0265314_10045290 Ga0265314_100452902 305
139 3300031712 Ga0265342_10097632 Ga0265342_100976323 305
140 3300042439 Ga0439464_0001194 Ga0439464_0001194_4527_5459 305
141 3300042461 Ga0439460_0001203 Ga0439460_0001203_2321_3253 305
142 3300042876 Ga0451577_0025265 Ga0451577_0025265_2722_3651 305
143 3300042876 Ga0451577_0035839 Ga0451577_0035839_3048_3980 305
144 3300044673 Ga0453683_0005950 Ga0453683_0005950_6998_7927 305
145 3300044712 Ga0453684_0032377 Ga0453684_0032377_2522_3451 305
146 3300044712 Ga0453684_0367973 Ga0453684_0367973_437_1363 305
147 3300045051 Ga0451576_0026201 Ga0451576_0026201_3928_4860 305
148 3300045051 Ga0451576_0028871 Ga0451576_0028871_2064_2996 305
149 3300045051 Ga0451576_0041797 Ga0451576_0041797_2885_3817 305
150 3300045051 Ga0451576_0078905 Ga0451576_0078905_1585_2514 305
151 3300049575 Ga0501039_0091819 Ga0501039_0091819_1008_1940 305
152 3300049576 Ga0501040_0009020 Ga0501040_0009020_5144_6076 305
153 3300049577 Ga0501041_0066915 Ga0501041_0066915_427_1359 305
154 3300049578 Ga0501042_0007739 Ga0501042_0007739_3606_4538 305
155 3300049578 Ga0501042_0328028 Ga0501042_0328028_136_1083 305
156 3300049579 Ga0501043_0240312 Ga0501043_0240312_286_1218 305
157 3300049580 Ga0501046_0002061 Ga0501046_0002061_2979_3911 305
158 3300049581 Ga0501047_0056714 Ga0501047_0056714_391_1323 305
159 3300049587 Ga0501071_0011626 Ga0501071_0011626_4191_5138 305
160 3300049588 Ga0501072_0011453 Ga0501072_0011453_5183_6115 305
161 3300049588 Ga0501072_0114142 Ga0501072_0114142_1102_2049 305
162 3300049588 Ga0501072_0120644 Ga0501072_0120644_561_1490 305
163 3300049589 Ga0501073_0201875 Ga0501073_0201875_188_1120 305
164 3300049591 Ga0501075_0037335 Ga0501075_0037335_2182_3129 305
165 3300049592 Ga0501076_0035572 Ga0501076_0035572_1644_2591 305
166 3300049741 Ga0501079_0001185 Ga0501079_0001185_14038_14970 305
167 3300049741 Ga0501079_0062677 Ga0501079_0062677_1522_2469 305
168 3300049742 Ga0501080_0042240 Ga0501080_0042240_2548_3495 305
169 3300049742 Ga0501080_0191102 Ga0501080_0191102_704_1636 305
170 3300049743 Ga0501081_0135375 Ga0501081_0135375_624_1556 305
171 3300050510 nmdc:mga06r32_105200_c1 nmdc:mga06r32_105200_c1_1770_2702 305
172 3300050510 nmdc:mga06r32_14068_c1 nmdc:mga06r32_14068_c1_2665_3594 305
173 3300050511 nmdc:mga08y16_1417_c1 nmdc:mga08y16_1417_c1_3438_4367 305
174 3300050512 nmdc:mga0n895_136637_c1 nmdc:mga0n895_136637_c1_945_1874 305
175 3300050512 nmdc:mga0n895_38771_c1 nmdc:mga0n895_38771_c1_294_1223 305
176 3300050513 nmdc:mga0rr50_15651_c1 nmdc:mga0rr50_15651_c1_2842_3771 305
177 3300050514 nmdc:mga08x19_7471_c1 nmdc:mga08x19_7471_c1_3973_4902 305
178 3300050515 nmdc:mga0a205_12060_c1 nmdc:mga0a205_12060_c1_4257_5186 305
179 3300050515 nmdc:mga0a205_24042_c1 nmdc:mga0a205_24042_c1_914_1843 305
180 3300054114 Ga0501084_0026174 Ga0501084_0026174_1049_1981 305
181 3300054114 Ga0501084_0035718 Ga0501084_0035718_2837_3784 305
182 3300060353 Ga0501082_0008973 Ga0501082_0008973_198_1130 305
183 3300061734 Ga0530510_0014748 Ga0530510_0014748_2009_2956 305
184 3300061734 Ga0530510_0037914 Ga0530510_0037914_1220_2152 305
185 3300003911 JGI25405J52794_10033467 JGI25405J52794_100334671 306
186 3300004799 Ga0058863_11887003 Ga0058863_118870031 306
187 3300005290 Ga0065712_10000707 Ga0065712_100007079 306
188 3300005290 Ga0065712_10005792 Ga0065712_100057923 306
189 3300005293 Ga0065715_10001398 Ga0065715_1000139811 306
190 3300005293 Ga0065715_10011721 Ga0065715_100117211 306
191 3300005295 Ga0065707_10000713 Ga0065707_1000071315 306
192 3300005295 Ga0065707_10082751 Ga0065707_100827513 306
193 3300005295 Ga0065707_10089547 Ga0065707_100895473 306
194 3300005295 Ga0065707_10094966 Ga0065707_100949663 306
195 3300005327 Ga0070658_10029362 Ga0070658_100293623 306
196 3300005328 Ga0070676_10001402 Ga0070676_100014026 306
197 3300005328 Ga0070676_10016980 Ga0070676_100169802 306
198 3300005329 Ga0070683_100028060 Ga0070683_1000280604 306
199 3300005329 Ga0070683_100069593 Ga0070683_1000695933 306
200 3300005329 Ga0070683_100088864 Ga0070683_1000888643 306
201 3300005329 Ga0070683_100305246 Ga0070683_1003052461 306
202 3300005330 Ga0070690_100008064 Ga0070690_1000080645 306
203 3300005330 Ga0070690_100310252 Ga0070690_1003102521 306
204 3300005330 Ga0070690_100355761 Ga0070690_1003557611 306
205 3300005331 Ga0070670_100043773 Ga0070670_1000437733 306
206 3300005335 Ga0070666_10003391 Ga0070666_100033912 306
207 3300005335 Ga0070666_10018770 Ga0070666_100187704 306
208 3300005335 Ga0070666_10031219 Ga0070666_100312194 306
209 3300005336 Ga0070680_100002409 Ga0070680_1000024098 306
210 3300005336 Ga0070680_100017315 Ga0070680_1000173154 306
211 3300005336 Ga0070680_100036951 Ga0070680_1000369513 306
212 3300005336 Ga0070680_100374286 Ga0070680_1003742861 306
213 3300005337 Ga0070682_100000179 Ga0070682_10000017933 306
214 3300005338 Ga0068868_100461650 Ga0068868_1004616501 306
215 3300005339 Ga0070660_100000476 Ga0070660_10000047610 306
216 3300005339 Ga0070660_100007316 Ga0070660_1000073166 306
217 3300005339 Ga0070660_100167676 Ga0070660_1001676762 306
218 3300005340 Ga0070689_100007429 Ga0070689_1000074293 306
219 3300005340 Ga0070689_100106789 Ga0070689_1001067891 306
220 3300005340 Ga0070689_100265329 Ga0070689_1002653291 306
221 3300005341 Ga0070691_10018678 Ga0070691_100186782 306
222 3300005343 Ga0070687_100038573 Ga0070687_1000385732 306
223 3300005344 Ga0070661_100000876 Ga0070661_1000008768 306
224 3300005344 Ga0070661_100005120 Ga0070661_1000051206 306
225 3300005345 Ga0070692_10000828 Ga0070692_100008288 306
226 3300005347 Ga0070668_100414852 Ga0070668_1004148521 306
227 3300005353 Ga0070669_100000641 Ga0070669_1000006413 306
228 3300005353 Ga0070669_100050119 Ga0070669_1000501192 306
229 3300005354 Ga0070675_100045618 Ga0070675_1000456184 306
230 3300005354 Ga0070675_100197762 Ga0070675_1001977622 306
231 3300005355 Ga0070671_100031225 Ga0070671_1000312255 306
232 3300005355 Ga0070671_100066615 Ga0070671_1000666152 306
233 3300005355 Ga0070671_100146541 Ga0070671_1001465412 306
234 3300005366 Ga0070659_100000848 Ga0070659_10000084816 306
235 3300005367 Ga0070667_100074041 Ga0070667_1000740412 306
236 3300005367 Ga0070667_100112122 Ga0070667_1001121222 306
237 3300005367 Ga0070667_100117293 Ga0070667_1001172932 306
238 3300005406 Ga0070703_10001139 Ga0070703_100011391 306
239 3300005434 Ga0070709_10000256 Ga0070709_1000025624 306
240 3300005435 Ga0070714_100443168 Ga0070714_1004431682 306
241 3300005436 Ga0070713_100041800 Ga0070713_1000418002 306
242 3300005436 Ga0070713_100144079 Ga0070713_1001440791 306
243 3300005436 Ga0070713_100384275 Ga0070713_1003842752 306
244 3300005440 Ga0070705_100000333 Ga0070705_10000033310 306
245 3300005440 Ga0070705_100089937 Ga0070705_1000899372 306
246 3300005440 Ga0070705_100197270 Ga0070705_1001972701 306
247 3300005441 Ga0070700_100034373 Ga0070700_1000343732 306
248 3300005445 Ga0070708_100016164 Ga0070708_1000161642 306
249 3300005445 Ga0070708_100019387 Ga0070708_1000193872 306
250 3300005445 Ga0070708_100020543 Ga0070708_1000205434 306
251 3300005445 Ga0070708_100037768 Ga0070708_1000377683 306
252 3300005445 Ga0070708_100055342 Ga0070708_1000553422 306
253 3300005445 Ga0070708_100068820 Ga0070708_1000688203 306
254 3300005445 Ga0070708_100173286 Ga0070708_1001732861 306
255 3300005445 Ga0070708_100181406 Ga0070708_1001814062 306
256 3300005445 Ga0070708_100203934 Ga0070708_1002039342 306
257 3300005445 Ga0070708_100404105 Ga0070708_1004041052 306
258 3300005455 Ga0070663_100001828 Ga0070663_10000182810 306
259 3300005456 Ga0070678_100019662 Ga0070678_1000196622 306
260 3300005457 Ga0070662_100027185 Ga0070662_1000271854 306
261 3300005457 Ga0070662_100105584 Ga0070662_1001055842 306
262 3300005458 Ga0070681_10004124 Ga0070681_100041246 306
263 3300005458 Ga0070681_10008880 Ga0070681_100088801 306
264 3300005458 Ga0070681_10024651 Ga0070681_100246512 306
265 3300005458 Ga0070681_10037004 Ga0070681_100370044 306
266 3300005458 Ga0070681_10102051 Ga0070681_101020512 306
267 3300005459 Ga0068867_100000455 Ga0068867_10000045510 306
268 3300005459 Ga0068867_100217042 Ga0068867_1002170422 306
269 3300005459 Ga0068867_100305131 Ga0068867_1003051312 306
270 3300005459 Ga0068867_100308118 Ga0068867_1003081181 306
271 3300005466 Ga0070685_10029077 Ga0070685_100290772 306
272 3300005467 Ga0070706_100005118 Ga0070706_1000051188 306
273 3300005467 Ga0070706_100006898 Ga0070706_1000068982 306
274 3300005467 Ga0070706_100031118 Ga0070706_1000311183 306
275 3300005467 Ga0070706_100035655 Ga0070706_1000356553 306
276 3300005467 Ga0070706_100039517 Ga0070706_1000395173 306
277 3300005467 Ga0070706_100074452 Ga0070706_1000744522 306
278 3300005467 Ga0070706_100096858 Ga0070706_1000968582 306
279 3300005467 Ga0070706_100122324 Ga0070706_1001223244 306
280 3300005467 Ga0070706_100314499 Ga0070706_1003144991 306
281 3300005467 Ga0070706_100315313 Ga0070706_1003153131 306
282 3300005468 Ga0070707_100000653 Ga0070707_1000006535 306
283 3300005468 Ga0070707_100017934 Ga0070707_1000179343 306
284 3300005468 Ga0070707_100077609 Ga0070707_1000776091 306
285 3300005468 Ga0070707_100104809 Ga0070707_1001048093 306
286 3300005468 Ga0070707_100285545 Ga0070707_1002855452 306
287 3300005471 Ga0070698_100000691 Ga0070698_10000069116 306
288 3300005471 Ga0070698_100011480 Ga0070698_1000114802 306
289 3300005471 Ga0070698_100038889 Ga0070698_1000388895 306
290 3300005471 Ga0070698_100240398 Ga0070698_1002403982 306
291 3300005518 Ga0070699_100003274 Ga0070699_1000032746 306
292 3300005518 Ga0070699_100013457 Ga0070699_1000134577 306
293 3300005518 Ga0070699_100013570 Ga0070699_1000135703 306
294 3300005518 Ga0070699_100031353 Ga0070699_1000313534 306
295 3300005518 Ga0070699_100054916 Ga0070699_1000549163 306
296 3300005518 Ga0070699_100095975 Ga0070699_1000959752 306
297 3300005518 Ga0070699_100395099 Ga0070699_1003950992 306
298 3300005530 Ga0070679_100001099 Ga0070679_10000109924 306
299 3300005530 Ga0070679_100007477 Ga0070679_1000074776 306
300 3300005530 Ga0070679_100014328 Ga0070679_1000143289 306
301 3300005530 Ga0070679_100121171 Ga0070679_1001211712 306
302 3300005535 Ga0070684_100009497 Ga0070684_1000094977 306
303 3300005535 Ga0070684_100110579 Ga0070684_1001105792 306
304 3300005535 Ga0070684_100132871 Ga0070684_1001328712 306
305 3300005535 Ga0070684_100195652 Ga0070684_1001956522 306
306 3300005536 Ga0070697_100004541 Ga0070697_1000045412 306
307 3300005536 Ga0070697_100007610 Ga0070697_1000076101 306
308 3300005536 Ga0070697_100066285 Ga0070697_1000662852 306
309 3300005536 Ga0070697_100101330 Ga0070697_1001013302 306
310 3300005536 Ga0070697_100131245 Ga0070697_1001312453 306
311 3300005536 Ga0070697_100155279 Ga0070697_1001552792 306
312 3300005539 Ga0068853_100008897 Ga0068853_1000088973 306
313 3300005539 Ga0068853_100097293 Ga0068853_1000972932 306
314 3300005545 Ga0070695_100001052 Ga0070695_10000105211 306
315 3300005545 Ga0070695_100008030 Ga0070695_1000080302 306
316 3300005545 Ga0070695_100017709 Ga0070695_1000177092 306
317 3300005545 Ga0070695_100052278 Ga0070695_1000522782 306
318 3300005545 Ga0070695_100092848 Ga0070695_1000928482 306
319 3300005546 Ga0070696_100004495 Ga0070696_1000044958 306
320 3300005546 Ga0070696_100007274 Ga0070696_1000072748 306
321 3300005546 Ga0070696_100074212 Ga0070696_1000742123 306
322 3300005546 Ga0070696_100211147 Ga0070696_1002111472 306
323 3300005546 Ga0070696_100264456 Ga0070696_1002644561 306
324 3300005547 Ga0070693_100000190 Ga0070693_1000001904 306
325 3300005548 Ga0070665_100000247 Ga0070665_10000024725 306
326 3300005548 Ga0070665_100432172 Ga0070665_1004321721 306
327 3300005548 Ga0070665_100466113 Ga0070665_1004661131 306
328 3300005549 Ga0070704_100001272 Ga0070704_1000012724 306
329 3300005549 Ga0070704_100089574 Ga0070704_1000895742 306
330 3300005549 Ga0070704_100345852 Ga0070704_1003458522 306
331 3300005549 Ga0070704_100348875 Ga0070704_1003488751 306
332 3300005563 Ga0068855_100000225 Ga0068855_10000022554 306
333 3300005563 Ga0068855_100006191 Ga0068855_10000619111 306
334 3300005563 Ga0068855_100083607 Ga0068855_1000836072 306
335 3300005564 Ga0070664_100003468 Ga0070664_10000346814 306
336 3300005614 Ga0068856_100001169 Ga0068856_10000116910 306
337 3300005614 Ga0068856_100003133 Ga0068856_1000031333 306
338 3300005614 Ga0068856_100010362 Ga0068856_1000103623 306
339 3300005614 Ga0068856_100027461 Ga0068856_1000274613 306
340 3300005614 Ga0068856_100101802 Ga0068856_1001018022 306
341 3300005615 Ga0070702_100029783 Ga0070702_1000297833 306
342 3300005615 Ga0070702_100071577 Ga0070702_1000715773 306
343 3300005616 Ga0068852_100000413 Ga0068852_10000041316 306
344 3300005616 Ga0068852_100025761 Ga0068852_1000257615 306
345 3300005616 Ga0068852_100350186 Ga0068852_1003501862 306
346 3300005617 Ga0068859_100000040 Ga0068859_10000004028 306
347 3300005617 Ga0068859_100001393 Ga0068859_10000139310 306
348 3300005617 Ga0068859_100057283 Ga0068859_1000572832 306
349 3300005617 Ga0068859_100070757 Ga0068859_1000707572 306
350 3300005617 Ga0068859_100169904 Ga0068859_1001699044 306
351 3300005617 Ga0068859_100223356 Ga0068859_1002233562 306
352 3300005617 Ga0068859_100289936 Ga0068859_1002899362 306
353 3300005617 Ga0068859_100292052 Ga0068859_1002920522 306
354 3300005617 Ga0068859_100308486 Ga0068859_1003084862 306
355 3300005617 Ga0068859_100531489 Ga0068859_1005314892 306
356 3300005618 Ga0068864_100531738 Ga0068864_1005317382 306
357 3300005719 Ga0068861_100045835 Ga0068861_1000458353 306
358 3300005719 Ga0068861_100148342 Ga0068861_1001483422 306
359 3300005719 Ga0068861_100158189 Ga0068861_1001581892 306
360 3300005719 Ga0068861_100229488 Ga0068861_1002294882 306
361 3300005840 Ga0068870_10000139 Ga0068870_1000013917 306
362 3300005841 Ga0068863_100047062 Ga0068863_1000470623 306
363 3300005841 Ga0068863_100096023 Ga0068863_1000960233 306
364 3300005841 Ga0068863_100140124 Ga0068863_1001401243 306
365 3300005842 Ga0068858_100010945 Ga0068858_1000109455 306
366 3300005842 Ga0068858_100043981 Ga0068858_1000439811 306
367 3300005842 Ga0068858_100059717 Ga0068858_1000597171 306
368 3300005842 Ga0068858_100107201 Ga0068858_1001072012 306
369 3300005842 Ga0068858_100320310 Ga0068858_1003203101 306
370 3300005843 Ga0068860_100001109 Ga0068860_10000110918 306
371 3300005843 Ga0068860_100010447 Ga0068860_1000104479 306
372 3300005843 Ga0068860_100279833 Ga0068860_1002798331 306
373 3300005844 Ga0068862_100035340 Ga0068862_1000353403 306
374 3300005844 Ga0068862_100062980 Ga0068862_1000629803 306
375 3300005844 Ga0068862_100498227 Ga0068862_1004982272 306
376 3300005844 Ga0068862_100524242 Ga0068862_1005242422 306
377 3300005937 Ga0081455_10000554 Ga0081455_1000055437 306
378 3300005937 Ga0081455_10037696 Ga0081455_100376962 306
379 3300005983 Ga0081540_1036669 Ga0081540_10366692 306
380 3300006163 Ga0070715_10082589 Ga0070715_100825892 306
381 3300006173 Ga0070716_100002537 Ga0070716_1000025374 306
382 3300006173 Ga0070716_100066561 Ga0070716_1000665611 306
383 3300006237 Ga0097621_100084723 Ga0097621_1000847232 306
384 3300006237 Ga0097621_100136102 Ga0097621_1001361022 306
385 3300006358 Ga0068871_100217642 Ga0068871_1002176422 306
386 3300006844 Ga0075428_100001380 Ga0075428_1000013809 306
387 3300006844 Ga0075428_100001775 Ga0075428_1000017751 306
388 3300006844 Ga0075428_100031347 Ga0075428_1000313472 306
389 3300006844 Ga0075428_100048964 Ga0075428_1000489643 306
390 3300006844 Ga0075428_100138750 Ga0075428_1001387501 306
391 3300006844 Ga0075428_100195545 Ga0075428_1001955452 306
392 3300006844 Ga0075428_100207019 Ga0075428_1002070192 306
393 3300006844 Ga0075428_100227269 Ga0075428_1002272692 306
394 3300006844 Ga0075428_100438246 Ga0075428_1004382462 306
395 3300006844 Ga0075428_100517344 Ga0075428_1005173442 306
396 3300006846 Ga0075430_100000019 Ga0075430_10000001931 306
397 3300006846 Ga0075430_100000487 Ga0075430_1000004877 306
398 3300006846 Ga0075430_100046733 Ga0075430_1000467332 306
399 3300006846 Ga0075430_100109251 Ga0075430_1001092512 306
400 3300006846 Ga0075430_100133731 Ga0075430_1001337312 306
401 3300006846 Ga0075430_100134568 Ga0075430_1001345682 306
402 3300006846 Ga0075430_100153228 Ga0075430_1001532282 306
403 3300006846 Ga0075430_100182788 Ga0075430_1001827882 306
404 3300006846 Ga0075430_100285977 Ga0075430_1002859772 306
405 3300006846 Ga0075430_100382099 Ga0075430_1003820991 306
406 3300006847 Ga0075431_100000797 Ga0075431_1000007975 306
407 3300006847 Ga0075431_100002180 Ga0075431_10000218013 306
408 3300006847 Ga0075431_100002672 Ga0075431_10000267217 306
409 3300006847 Ga0075431_100008469 Ga0075431_1000084698 306
410 3300006847 Ga0075431_100018042 Ga0075431_1000180422 306
411 3300006847 Ga0075431_100040569 Ga0075431_1000405694 306
412 3300006847 Ga0075431_100220308 Ga0075431_1002203082 306
413 3300006847 Ga0075431_100264455 Ga0075431_1002644552 306
414 3300006847 Ga0075431_100346866 Ga0075431_1003468662 306
415 3300006847 Ga0075431_100356520 Ga0075431_1003565201 306
416 3300006852 Ga0075433_10006565 Ga0075433_100065659 306
417 3300006852 Ga0075433_10007354 Ga0075433_100073549 306
418 3300006852 Ga0075433_10015834 Ga0075433_100158342 306
419 3300006852 Ga0075433_10020929 Ga0075433_100209292 306
420 3300006852 Ga0075433_10023410 Ga0075433_100234105 306
421 3300006852 Ga0075433_10033083 Ga0075433_100330832 306
422 3300006852 Ga0075433_10040066 Ga0075433_100400662 306
423 3300006852 Ga0075433_10041933 Ga0075433_100419332 306
424 3300006852 Ga0075433_10051693 Ga0075433_100516932 306
425 3300006852 Ga0075433_10079744 Ga0075433_100797443 306
426 3300006852 Ga0075433_10127899 Ga0075433_101278993 306
427 3300006852 Ga0075433_10154287 Ga0075433_101542872 306
428 3300006852 Ga0075433_10326631 Ga0075433_103266312 306
429 3300006871 Ga0075434_100006864 Ga0075434_1000068647 306
430 3300006871 Ga0075434_100015414 Ga0075434_1000154145 306
431 3300006871 Ga0075434_100022146 Ga0075434_1000221462 306
432 3300006871 Ga0075434_100038924 Ga0075434_1000389244 306
433 3300006871 Ga0075434_100056389 Ga0075434_1000563893 306
434 3300006871 Ga0075434_100073504 Ga0075434_1000735043 306
435 3300006871 Ga0075434_100093326 Ga0075434_1000933263 306
436 3300006871 Ga0075434_100131081 Ga0075434_1001310812 306
437 3300006871 Ga0075434_100213320 Ga0075434_1002133202 306
438 3300006871 Ga0075434_100331832 Ga0075434_1003318322 306
439 3300006871 Ga0075434_100337841 Ga0075434_1003378412 306
440 3300006880 Ga0075429_100030148 Ga0075429_1000301482 306
441 3300006880 Ga0075429_100030538 Ga0075429_1000305382 306
442 3300006880 Ga0075429_100153039 Ga0075429_1001530392 306
443 3300006880 Ga0075429_100200546 Ga0075429_1002005462 306
444 3300006881 Ga0068865_100130061 Ga0068865_1001300612 306
445 3300006914 Ga0075436_100000484 Ga0075436_10000048412 306
446 3300006914 Ga0075436_100001157 Ga0075436_1000011573 306
447 3300006914 Ga0075436_100013617 Ga0075436_1000136175 306
448 3300006914 Ga0075436_100055140 Ga0075436_1000551403 306
449 3300006914 Ga0075436_100186358 Ga0075436_1001863582 306
450 3300006931 Ga0097620_100000040 Ga0097620_10000004028 306
451 3300006931 Ga0097620_100001393 Ga0097620_10000139313 306
452 3300006931 Ga0097620_100057277 Ga0097620_1000572772 306
453 3300006931 Ga0097620_100070757 Ga0097620_1000707572 306
454 3300006931 Ga0097620_100169913 Ga0097620_1001699134 306
455 3300006931 Ga0097620_100223378 Ga0097620_1002233782 306
456 3300006931 Ga0097620_100289938 Ga0097620_1002899382 306
457 3300006931 Ga0097620_100292036 Ga0097620_1002920362 306
458 3300006931 Ga0097620_100308455 Ga0097620_1003084552 306
459 3300006931 Ga0097620_100531502 Ga0097620_1005315022 306
460 3300007076 Ga0075435_100000861 Ga0075435_1000008615 306
461 3300007076 Ga0075435_100015397 Ga0075435_1000153977 306
462 3300007076 Ga0075435_100021364 Ga0075435_1000213642 306
463 3300007076 Ga0075435_100034254 Ga0075435_1000342542 306
464 3300007076 Ga0075435_100045285 Ga0075435_1000452851 306
465 3300007076 Ga0075435_100057445 Ga0075435_1000574454 306
466 3300007076 Ga0075435_100243996 Ga0075435_1002439963 306
467 3300007076 Ga0075435_100259714 Ga0075435_1002597142 306
468 3300007265 Ga0099794_10007435 Ga0099794_100074353 306
469 3300007265 Ga0099794_10015411 Ga0099794_100154111 306
470 3300009093 Ga0105240_10001893 Ga0105240_1000189310 306
471 3300009093 Ga0105240_10003511 Ga0105240_1000351115 306
472 3300009093 Ga0105240_10481763 Ga0105240_104817631 306
473 3300009094 Ga0111539_10151663 Ga0111539_101516631 306
474 3300009094 Ga0111539_10577173 Ga0111539_105771732 306
475 3300009098 Ga0105245_10020323 Ga0105245_100203233 306
476 3300009098 Ga0105245_10215441 Ga0105245_102154412 306
477 3300009098 Ga0105245_10223820 Ga0105245_102238202 306
478 3300009101 Ga0105247_10048807 Ga0105247_100488073 306
479 3300009147 Ga0114129_10000115 Ga0114129_1000011558 306
480 3300009147 Ga0114129_10000606 Ga0114129_1000060610 306
481 3300009147 Ga0114129_10000989 Ga0114129_1000098920 306
482 3300009147 Ga0114129_10001447 Ga0114129_1000144727 306
483 3300009147 Ga0114129_10004337 Ga0114129_1000433720 306
484 3300009147 Ga0114129_10007160 Ga0114129_1000716018 306
485 3300009147 Ga0114129_10009875 Ga0114129_100098756 306
486 3300009147 Ga0114129_10012822 Ga0114129_100128229 306
487 3300009147 Ga0114129_10037834 Ga0114129_100378344 306
488 3300009147 Ga0114129_10038521 Ga0114129_100385213 306
489 3300009147 Ga0114129_10043328 Ga0114129_100433283 306
490 3300009147 Ga0114129_10058310 Ga0114129_100583105 306
491 3300009147 Ga0114129_10195563 Ga0114129_101955632 306
492 3300009147 Ga0114129_10201748 Ga0114129_102017482 306
493 3300009147 Ga0114129_10209918 Ga0114129_102099182 306
494 3300009147 Ga0114129_10370493 Ga0114129_103704932 306
495 3300009147 Ga0114129_10426875 Ga0114129_104268752 306
496 3300009147 Ga0114129_10545854 Ga0114129_105458542 306
497 3300009147 Ga0114129_10645445 Ga0114129_106454451 306
498 3300009148 Ga0105243_10062699 Ga0105243_100626993 306
499 3300009148 Ga0105243_10077839 Ga0105243_100778392 306
500 3300009148 Ga0105243_10078043 Ga0105243_100780433 306
501 3300009148 Ga0105243_10103999 Ga0105243_101039992 306
502 3300009148 Ga0105243_10193126 Ga0105243_101931263 306
503 3300009174 Ga0105241_10001038 Ga0105241_100010386 306
504 3300009174 Ga0105241_10005578 Ga0105241_100055784 306
505 3300009174 Ga0105241_10008056 Ga0105241_100080567 306
506 3300009174 Ga0105241_10039118 Ga0105241_100391182 306
507 3300009174 Ga0105241_10409047 Ga0105241_104090471 306
508 3300009176 Ga0105242_10001218 Ga0105242_100012184 306
509 3300009176 Ga0105242_10013788 Ga0105242_100137884 306
510 3300009176 Ga0105242_10020833 Ga0105242_100208331 306
511 3300009176 Ga0105242_10140548 Ga0105242_101405482 306
512 3300009176 Ga0105242_10250940 Ga0105242_102509402 306
513 3300009177 Ga0105248_10236579 Ga0105248_102365792 306
514 3300009177 Ga0105248_10606946 Ga0105248_106069461 306
515 3300009545 Ga0105237_10113157 Ga0105237_101131572 306
516 3300009545 Ga0105237_10132541 Ga0105237_101325413 306
517 3300009545 Ga0105237_10137593 Ga0105237_101375932 306
518 3300009545 Ga0105237_10163938 Ga0105237_101639382 306
519 3300009551 Ga0105238_10004145 Ga0105238_100041453 306
520 3300009551 Ga0105238_10230465 Ga0105238_102304651 306
521 3300009553 Ga0105249_10064030 Ga0105249_100640303 306
522 3300009553 Ga0105249_10068385 Ga0105249_100683852 306
523 3300009553 Ga0105249_10271515 Ga0105249_102715151 306
524 3300010375 Ga0105239_10007108 Ga0105239_100071084 306
525 3300010375 Ga0105239_10055844 Ga0105239_100558442 306
526 3300010375 Ga0105239_10087398 Ga0105239_100873984 306
527 3300010375 Ga0105239_10087761 Ga0105239_100877613 306
528 3300010375 Ga0105239_10339550 Ga0105239_103395502 306
529 3300010375 Ga0105239_10447288 Ga0105239_104472882 306
530 3300010375 Ga0105239_10524203 Ga0105239_105242032 306
531 3300010375 Ga0105239_10849962 Ga0105239_108499621 306
532 3300011119 Ga0105246_10001112 Ga0105246_100011124 306
533 3300011119 Ga0105246_10016830 Ga0105246_100168303 306
534 3300011119 Ga0105246_10088990 Ga0105246_100889902 306
535 3300011119 Ga0105246_10117252 Ga0105246_101172522 306
536 3300011119 Ga0105246_10305830 Ga0105246_103058302 306
537 3300013100 Ga0157373_10000388 Ga0157373_100003888 306
538 3300013102 Ga0157371_10296601 Ga0157371_102966011 306
539 3300013104 Ga0157370_10000198 Ga0157370_1000019815 306
540 3300013104 Ga0157370_10000818 Ga0157370_100008182 306
541 3300013104 Ga0157370_10046261 Ga0157370_100462613 306
542 3300013104 Ga0157370_10249868 Ga0157370_102498681 306
543 3300013104 Ga0157370_10368484 Ga0157370_103684841 306
544 3300013105 Ga0157369_10001245 Ga0157369_1000124518 306
545 3300013105 Ga0157369_10001661 Ga0157369_100016613 306
546 3300013105 Ga0157369_10030573 Ga0157369_100305734 306
547 3300013105 Ga0157369_10031785 Ga0157369_100317851 306
548 3300013296 Ga0157374_10368231 Ga0157374_103682312 306
549 3300013296 Ga0157374_10495130 Ga0157374_104951302 306
550 3300013297 Ga0157378_10152659 Ga0157378_101526592 306
551 3300013306 Ga0163162_10015647 Ga0163162_100156477 306
552 3300013306 Ga0163162_10036341 Ga0163162_100363411 306
553 3300013306 Ga0163162_10121502 Ga0163162_101215022 306
554 3300013306 Ga0163162_10406344 Ga0163162_104063442 306
555 3300013306 Ga0163162_10512014 Ga0163162_105120141 306
556 3300013307 Ga0157372_10000105 Ga0157372_1000010555 306
557 3300013307 Ga0157372_10001637 Ga0157372_1000163715 306
558 3300013307 Ga0157372_10011528 Ga0157372_100115283 306
559 3300013307 Ga0157372_10024982 Ga0157372_100249827 306
560 3300013308 Ga0157375_10004925 Ga0157375_100049259 306
561 3300013308 Ga0157375_10067766 Ga0157375_100677661 306
562 3300014325 Ga0163163_10046665 Ga0163163_100466653 306
563 3300014325 Ga0163163_10079414 Ga0163163_100794142 306
564 3300014325 Ga0163163_10128371 Ga0163163_101283713 306
565 3300014325 Ga0163163_10230416 Ga0163163_102304162 306
566 3300014326 Ga0157380_10314060 Ga0157380_103140602 306
567 3300014326 Ga0157380_10435084 Ga0157380_104350841 306
568 3300014745 Ga0157377_10118760 Ga0157377_101187601 306
569 3300014968 Ga0157379_10000880 Ga0157379_100008804 306
570 3300014968 Ga0157379_10045052 Ga0157379_100450522 306
571 3300014968 Ga0157379_10111783 Ga0157379_101117832 306
572 3300014968 Ga0157379_10266746 Ga0157379_102667462 306
573 3300014969 Ga0157376_10167870 Ga0157376_101678702 306
574 3300021388 Ga0213875_10012907 Ga0213875_100129073 306
575 3300025315 Ga0207697_10053432 Ga0207697_100534322 306
576 3300025900 Ga0207710_10133192 Ga0207710_101331921 306
577 3300025901 Ga0207688_10031185 Ga0207688_100311851 306
578 3300025903 Ga0207680_10227739 Ga0207680_102277391 306
579 3300025906 Ga0207699_10000111 Ga0207699_1000011131 306
580 3300025906 Ga0207699_10045062 Ga0207699_100450622 306
581 3300025907 Ga0207645_10000798 Ga0207645_1000079823 306
582 3300025908 Ga0207643_10001465 Ga0207643_100014656 306
583 3300025909 Ga0207705_10070972 Ga0207705_100709723 306
584 3300025910 Ga0207684_10000115 Ga0207684_1000011513 306
585 3300025910 Ga0207684_10018127 Ga0207684_100181277 306
586 3300025910 Ga0207684_10018826 Ga0207684_100188264 306
587 3300025910 Ga0207684_10036069 Ga0207684_100360694 306
588 3300025910 Ga0207684_10057491 Ga0207684_100574913 306
589 3300025910 Ga0207684_10103953 Ga0207684_101039532 306
590 3300025910 Ga0207684_10192582 Ga0207684_101925821 306
591 3300025910 Ga0207684_10307359 Ga0207684_103073592 306
592 3300025911 Ga0207654_10004111 Ga0207654_100041114 306
593 3300025911 Ga0207654_10004933 Ga0207654_100049336 306
594 3300025912 Ga0207707_10000352 Ga0207707_100003525 306
595 3300025912 Ga0207707_10001028 Ga0207707_100010285 306
596 3300025912 Ga0207707_10053287 Ga0207707_100532872 306
597 3300025912 Ga0207707_10066466 Ga0207707_100664662 306
598 3300025912 Ga0207707_10282282 Ga0207707_102822821 306
599 3300025913 Ga0207695_10001015 Ga0207695_1000101530 306
600 3300025913 Ga0207695_10021871 Ga0207695_100218715 306
601 3300025913 Ga0207695_10024708 Ga0207695_100247082 306
602 3300025913 Ga0207695_10247005 Ga0207695_102470052 306
603 3300025914 Ga0207671_10005738 Ga0207671_100057387 306
604 3300025914 Ga0207671_10092655 Ga0207671_100926552 306
605 3300025915 Ga0207693_10154458 Ga0207693_101544582 306
606 3300025917 Ga0207660_10000334 Ga0207660_1000033415 306
607 3300025917 Ga0207660_10011747 Ga0207660_100117472 306
608 3300025917 Ga0207660_10018904 Ga0207660_100189044 306
609 3300025917 Ga0207660_10021029 Ga0207660_100210293 306
610 3300025917 Ga0207660_10340969 Ga0207660_103409691 306
611 3300025918 Ga0207662_10114278 Ga0207662_101142782 306
612 3300025918 Ga0207662_10149262 Ga0207662_101492622 306
613 3300025919 Ga0207657_10002597 Ga0207657_100025978 306
614 3300025919 Ga0207657_10004228 Ga0207657_1000422812 306
615 3300025919 Ga0207657_10007983 Ga0207657_100079835 306
616 3300025920 Ga0207649_10006035 Ga0207649_100060356 306
617 3300025920 Ga0207649_10045866 Ga0207649_100458662 306
618 3300025921 Ga0207652_10000466 Ga0207652_1000046617 306
619 3300025921 Ga0207652_10005037 Ga0207652_100050374 306
620 3300025921 Ga0207652_10049521 Ga0207652_100495212 306
621 3300025922 Ga0207646_10000250 Ga0207646_1000025036 306
622 3300025922 Ga0207646_10003851 Ga0207646_100038516 306
623 3300025922 Ga0207646_10041645 Ga0207646_100416452 306
624 3300025922 Ga0207646_10076706 Ga0207646_100767062 306
625 3300025922 Ga0207646_10083956 Ga0207646_100839562 306
626 3300025922 Ga0207646_10087821 Ga0207646_100878212 306
627 3300025923 Ga0207681_10000056 Ga0207681_1000005620 306
628 3300025923 Ga0207681_10079595 Ga0207681_100795952 306
629 3300025925 Ga0207650_10000465 Ga0207650_1000046525 306
630 3300025925 Ga0207650_10029853 Ga0207650_100298533 306
631 3300025927 Ga0207687_10002531 Ga0207687_100025316 306
632 3300025927 Ga0207687_10004210 Ga0207687_100042107 306
633 3300025928 Ga0207700_10260813 Ga0207700_102608132 306
634 3300025931 Ga0207644_10020356 Ga0207644_100203564 306
635 3300025931 Ga0207644_10083270 Ga0207644_100832702 306
636 3300025932 Ga0207690_10006606 Ga0207690_100066064 306
637 3300025933 Ga0207706_10004728 Ga0207706_100047289 306
638 3300025933 Ga0207706_10024583 Ga0207706_100245832 306
639 3300025933 Ga0207706_10510706 Ga0207706_105107061 306
640 3300025934 Ga0207686_10002382 Ga0207686_100023822 306
641 3300025935 Ga0207709_10042450 Ga0207709_100424502 306
642 3300025935 Ga0207709_10078057 Ga0207709_100780572 306
643 3300025935 Ga0207709_10311212 Ga0207709_103112122 306
644 3300025936 Ga0207670_10010707 Ga0207670_100107073 306
645 3300025936 Ga0207670_10212126 Ga0207670_102121262 306
646 3300025937 Ga0207669_10020836 Ga0207669_100208362 306
647 3300025939 Ga0207665_10000035 Ga0207665_100000357 306
648 3300025939 Ga0207665_10060437 Ga0207665_100604372 306
649 3300025939 Ga0207665_10060753 Ga0207665_100607532 306
650 3300025940 Ga0207691_10002614 Ga0207691_1000261411 306
651 3300025941 Ga0207711_10206375 Ga0207711_102063751 306
652 3300025941 Ga0207711_10305392 Ga0207711_103053922 306
653 3300025942 Ga0207689_10010708 Ga0207689_100107082 306
654 3300025942 Ga0207689_10083925 Ga0207689_100839252 306
655 3300025942 Ga0207689_10174582 Ga0207689_101745822 306
656 3300025945 Ga0207679_10000878 Ga0207679_100008783 306
657 3300025945 Ga0207679_10007527 Ga0207679_100075276 306
658 3300025945 Ga0207679_10107174 Ga0207679_101071741 306
659 3300025949 Ga0207667_10000497 Ga0207667_1000049717 306
660 3300025949 Ga0207667_10001501 Ga0207667_1000150112 306
661 3300025949 Ga0207667_10009119 Ga0207667_100091197 306
662 3300025949 Ga0207667_10012054 Ga0207667_100120544 306
663 3300025960 Ga0207651_10125175 Ga0207651_101251752 306
664 3300025961 Ga0207712_10026594 Ga0207712_100265943 306
665 3300025961 Ga0207712_10133816 Ga0207712_101338162 306
666 3300025981 Ga0207640_10001632 Ga0207640_100016324 306
667 3300025986 Ga0207658_10098374 Ga0207658_100983742 306
668 3300025986 Ga0207658_10355906 Ga0207658_103559062 306
669 3300026023 Ga0207677_10091321 Ga0207677_100913212 306
670 3300026035 Ga0207703_10115038 Ga0207703_101150382 306
671 3300026035 Ga0207703_10175885 Ga0207703_101758852 306
672 3300026035 Ga0207703_10206938 Ga0207703_102069381 306
673 3300026035 Ga0207703_10365363 Ga0207703_103653632 306
674 3300026041 Ga0207639_10010031 Ga0207639_100100313 306
675 3300026067 Ga0207678_10013961 Ga0207678_100139617 306
676 3300026067 Ga0207678_10112641 Ga0207678_101126412 306
677 3300026075 Ga0207708_10078799 Ga0207708_100787991 306
678 3300026075 Ga0207708_10135745 Ga0207708_101357451 306
679 3300026078 Ga0207702_10005454 Ga0207702_100054544 306
680 3300026078 Ga0207702_10053472 Ga0207702_100534723 306
681 3300026088 Ga0207641_10005667 Ga0207641_100056675 306
682 3300026088 Ga0207641_10071505 Ga0207641_100715053 306
683 3300026088 Ga0207641_10094189 Ga0207641_100941892 306
684 3300026089 Ga0207648_10015946 Ga0207648_100159466 306
685 3300026089 Ga0207648_10052572 Ga0207648_100525722 306
686 3300026089 Ga0207648_10123435 Ga0207648_101234352 306
687 3300026095 Ga0207676_10023462 Ga0207676_100234623 306
688 3300026095 Ga0207676_10042934 Ga0207676_100429343 306
689 3300026116 Ga0207674_10004340 Ga0207674_1000434013 306
690 3300026116 Ga0207674_10015196 Ga0207674_100151968 306
691 3300026116 Ga0207674_10130472 Ga0207674_101304722 306
692 3300026118 Ga0207675_100005709 Ga0207675_10000570915 306
693 3300026118 Ga0207675_100057691 Ga0207675_1000576912 306
694 3300026118 Ga0207675_100077492 Ga0207675_1000774923 306
695 3300026118 Ga0207675_100324701 Ga0207675_1003247012 306
696 3300026142 Ga0207698_10000240 Ga0207698_1000024015 306
697 3300026142 Ga0207698_10014900 Ga0207698_100149002 306
698 3300026142 Ga0207698_10348894 Ga0207698_103488942 306
699 3300027471 Ga0209995_1003469 Ga0209995_10034692 306
700 3300027543 Ga0209999_1002950 Ga0209999_10029502 306
701 3300027665 Ga0209983_1000311 Ga0209983_10003118 306
702 3300027665 Ga0209983_1008657 Ga0209983_10086572 306
703 3300027717 Ga0209998_10002760 Ga0209998_100027603 306
704 3300027876 Ga0209974_10003339 Ga0209974_100033396 306
705 3300027907 Ga0207428_10009358 Ga0207428_1000935810 306
706 3300027907 Ga0207428_10038690 Ga0207428_100386902 306
707 3300027907 Ga0207428_10236072 Ga0207428_102360722 306
708 3300028379 Ga0268266_10003070 Ga0268266_100030704 306
709 3300028379 Ga0268266_10365160 Ga0268266_103651602 306
710 3300028380 Ga0268265_10000432 Ga0268265_1000043225 306
711 3300028380 Ga0268265_10056078 Ga0268265_100560784 306
712 3300028380 Ga0268265_10145828 Ga0268265_101458282 306
713 3300028380 Ga0268265_10415353 Ga0268265_104153532 306
714 3300028381 Ga0268264_10031393 Ga0268264_100313932 306
715 3300028381 Ga0268264_10109609 Ga0268264_101096092 306
716 3300028381 Ga0268264_10252557 Ga0268264_102525571 306
717 3300028381 Ga0268264_10272964 Ga0268264_102729642 306
718 3300028381 Ga0268264_10585764 Ga0268264_105857641 306
719 3300028800 Ga0265338_10136374 Ga0265338_101363742 306
720 3300028800 Ga0265338_10222712 Ga0265338_102227122 306
721 3300031247 Ga0265340_10043902 Ga0265340_100439022 306
722 3300031247 Ga0265340_10080923 Ga0265340_100809231 306
723 3300031247 Ga0265340_10082345 Ga0265340_100823452 306
724 3300031344 Ga0265316_10007021 Ga0265316_100070213 306
725 3300031344 Ga0265316_10014768 Ga0265316_100147682 306
726 3300031456 Ga0307513_10003263 Ga0307513_1000326315 306
727 3300031548 Ga0307408_100014736 Ga0307408_1000147363 306
728 3300031548 Ga0307408_100070486 Ga0307408_1000704862 306
729 3300031548 Ga0307408_100131550 Ga0307408_1001315501 306
730 3300031665 Ga0316575_10007238 Ga0316575_100072383 306
731 3300031711 Ga0265314_10001972 Ga0265314_100019722 306
732 3300031712 Ga0265342_10012902 Ga0265342_100129023 306
733 3300031727 Ga0316576_10003001 Ga0316576_100030014 306
734 3300031733 Ga0316577_10034070 Ga0316577_100340704 306
735 3300031852 Ga0307410_10080577 Ga0307410_100805772 306
736 3300031852 Ga0307410_10305193 Ga0307410_103051932 306
737 3300031903 Ga0307407_10148631 Ga0307407_101486312 306
738 3300031911 Ga0307412_10197796 Ga0307412_101977962 306
739 3300031995 Ga0307409_100153494 Ga0307409_1001534942 306
740 3300031995 Ga0307409_100424163 Ga0307409_1004241632 306
741 3300032002 Ga0307416_100073791 Ga0307416_1000737912 306
742 3300032002 Ga0307416_100150672 Ga0307416_1001506721 306
743 3300032002 Ga0307416_100246980 Ga0307416_1002469802 306
744 3300032002 Ga0307416_100260199 Ga0307416_1002601992 306
745 3300032126 Ga0307415_100029417 Ga0307415_1000294173 306
746 3300034820 Ga0373959_0024008 Ga0373959_0024008_18_992 306
747 3300035085 Ga0373929_0031139 Ga0373929_0031139_96_1070 306
748 3300035086 Ga0373934_0008494 Ga0373934_0008494_1813_2745 306
749 3300035086 Ga0373934_0097135 Ga0373934_0097135_129_1055 306
750 3300035088 Ga0373940_0054044 Ga0373940_0054044_53_1027 306
751 3300035091 Ga0373951_0012488 Ga0373951_0012488_872_1846 306
752 3300035115 Ga0373941_0069182 Ga0373941_0069182_73_1005 306
753 3300035116 Ga0373945_0011856 Ga0373945_0011856_986_1930 306
754 3300035118 Ga0373954_0008192 Ga0373954_0008192_820_1752 306
755 3300035118 Ga0373954_0081302 Ga0373954_0081302_551_1483 306
756 3300035121 Ga0373960_0007413 Ga0373960_0007413_766_1740 306
757 3300035172 Ga0373955_0019020 Ga0373955_0019020_401_1333 306
758 3300035172 Ga0373955_0062695 Ga0373955_0062695_682_1614 306
759 3300035241 Ga0373961_0000199 Ga0373961_0000199_12020_12949 306
760 3300035241 Ga0373961_0046231 Ga0373961_0046231_297_1262 306
761 3300035692 Ga0373935_0001203 Ga0373935_0001203_2444_3373 306
762 3300035692 Ga0373935_0017393 Ga0373935_0017393_1886_2830 306
763 3300035724 Ga0373933_0027491 Ga0373933_0027491_2066_2998 306
764 3300035724 Ga0373933_0182868 Ga0373933_0182868_245_1177 306
765 3300035725 Ga0373947_0063466 Ga0373947_0063466_305_1249 306
766 3300036401 Ga0373937_0005556 Ga0373937_0005556_9063_9995 306
767 3300036401 Ga0373937_0012914 Ga0373937_0012914_2318_3253 306
768 3300036401 Ga0373937_0016192 Ga0373937_0016192_4764_5708 306
769 3300036401 Ga0373937_0021254 Ga0373937_0021254_1951_2883 306
770 3300036712 Ga0316584_0008479 Ga0316584_0008479_5718_6659 306
771 3300036712 Ga0316584_0161953 Ga0316584_0161953_450_1376 306
772 3300037068 Ga0373925_0006738 Ga0373925_0006738_293_1249 306
773 3300037068 Ga0373925_0187694 Ga0373925_0187694_448_1380 306
774 3300037312 Ga0395899_0013420 Ga0395899_0013420_276_1241 306
775 3300037418 Ga0395900_0085973 Ga0395900_0085973_1317_2282 306
776 3300037466 Ga0395898_0011582 Ga0395898_0011582_1420_2385 306
777 3300037466 Ga0395898_0091150 Ga0395898_0091150_706_1659 306
778 3300037471 Ga0395905_0004297 Ga0395905_0004297_28_963 306
779 3300037471 Ga0395905_0039261 Ga0395905_0039261_1993_2958 306
780 3300037471 Ga0395905_0464938 Ga0395905_0464938_61_1002 306
781 3300037853 Ga0436364_0356041 Ga0436364_0356041_792_1739 306
782 3300037853 Ga0436364_0833416 Ga0436364_0833416_4797_5738 306
783 3300038443 Ga0395901_0003440 Ga0395901_0003440_1460_2425 306
784 3300038996 Ga0242420_011442 Ga0242420_011442_141_1073 306
785 3300041486 Ga0451807_0493500 Ga0451807_0493500_19_948 306
786 3300042005 Ga0439448_0001840 Ga0439448_0001840_895_1869 306
787 3300042157 Ga0439458_0002296 Ga0439458_0002296_2857_3831 306
788 3300042438 Ga0439459_0006519 Ga0439459_0006519_179_1144 306
789 3300042876 Ga0451577_0015589 Ga0451577_0015589_2839_3768 306
790 3300042876 Ga0451577_0031367 Ga0451577_0031367_15_980 306
791 3300042876 Ga0451577_0127743 Ga0451577_0127743_752_1684 306
792 3300042876 Ga0451577_0128231 Ga0451577_0128231_912_1886 306
793 3300042876 Ga0451577_0265709 Ga0451577_0265709_341_1267 306
794 3300044673 Ga0453683_0001474 Ga0453683_0001474_15330_16259 306
795 3300044673 Ga0453683_0003008 Ga0453683_0003008_4085_5014 306
796 3300044673 Ga0453683_0008835 Ga0453683_0008835_883_1809 306
797 3300044673 Ga0453683_0013136 Ga0453683_0013136_3034_4008 306
798 3300044673 Ga0453683_0033515 Ga0453683_0033515_1898_2836 306
799 3300044683 Ga0466965_0004893 Ga0466965_0004893_1950_2879 306
800 3300044712 Ga0453684_0001052 Ga0453684_0001052_77441_78391 306
801 3300044712 Ga0453684_0043747 Ga0453684_0043747_1625_2551 306
802 3300044712 Ga0453684_0059028 Ga0453684_0059028_1670_2599 306
803 3300044712 Ga0453684_0082341 Ga0453684_0082341_1705_2679 306
804 3300045051 Ga0451576_0013826 Ga0451576_0013826_6292_7305 306
805 3300045051 Ga0451576_0029250 Ga0451576_0029250_1480_2454 306
806 3300045051 Ga0451576_0195499 Ga0451576_0195499_533_1477 306
807 3300045051 Ga0451576_0254403 Ga0451576_0254403_554_1480 306
808 3300046454 Ga0495592_0075695 Ga0495592_0075695_812_1744 306
809 3300046459 Ga0495629_0310045 Ga0495629_0310045_110_1036 306
810 3300046462 Ga0495651_0137382 Ga0495651_0137382_67_999 306
811 3300046472 Ga0495580_0001974 Ga0495580_0001974_15065_16021 306
812 3300046472 Ga0495580_0010992 Ga0495580_0010992_285_1211 306
813 3300046472 Ga0495580_0095154 Ga0495580_0095154_627_1553 306
814 3300046472 Ga0495580_0157150 Ga0495580_0157150_319_1260 306
815 3300046472 Ga0495580_0174647 Ga0495580_0174647_217_1161 306
816 3300046473 Ga0495582_0010340 Ga0495582_0010340_3524_4453 306
817 3300046516 Ga0495628_0054936 Ga0495628_0054936_2029_3018 306
818 3300046516 Ga0495628_0084085 Ga0495628_0084085_1396_2328 306
819 3300046517 Ga0495630_0268015 Ga0495630_0268015_313_1257 306
820 3300046526 Ga0495666_0115589 Ga0495666_0115589_301_1245 306
821 3300046536 Ga0495587_0063353 Ga0495587_0063353_759_1691 306
822 3300046559 Ga0495667_0039791 Ga0495667_0039791_1661_2593 306
823 3300046664 Ga0495659_0013923 Ga0495659_0013923_1213_2142 306
824 3300046678 Ga0495599_0012572 Ga0495599_0012572_1517_2449 306
825 3300046679 Ga0495623_0209563 Ga0495623_0209563_36_968 306
826 3300047322 Ga0495680_0041043 Ga0495680_0041043_931_1863 306
827 3300047444 Ga0495675_0184505 Ga0495675_0184505_39_971 306
828 3300047471 Ga0495684_0006590 Ga0495684_0006590_6604_7536 306
829 3300048088 Ga0495602_0014886 Ga0495602_0014886_26_958 306
830 3300048088 Ga0495602_0231516 Ga0495602_0231516_326_1252 306
831 3300048090 Ga0495615_0001372 Ga0495615_0001372_2603_3532 306
832 3300048905 Ga0496102_0064043 Ga0496102_0064043_465_1439 306
833 3300048905 Ga0496102_0359969 Ga0496102_0359969_160_1107 306
834 3300048908 Ga0496105_0337849 Ga0496105_0337849_95_1027 306
835 3300048909 Ga0496106_0286933 Ga0496106_0286933_353_1297 306
836 3300048911 Ga0496108_0000021 Ga0496108_0000021_160941_161870 306
837 3300048912 Ga0496109_0373117 Ga0496109_0373117_97_1071 306
838 3300048913 Ga0496110_0105594 Ga0496110_0105594_929_1858 306
839 3300048915 Ga0496112_0006853 Ga0496112_0006853_937_1881 306
840 3300048917 Ga0496114_0000203 Ga0496114_0000203_27983_28912 306
841 3300048917 Ga0496114_0403811 Ga0496114_0403811_15_941 306
842 3300048918 Ga0496115_0136700 Ga0496115_0136700_817_1749 306
843 3300048919 Ga0496116_0068580 Ga0496116_0068580_961_1899 306
844 3300049568 Ga0501031_0009996 Ga0501031_0009996_5141_6085 306
845 3300049568 Ga0501031_0186729 Ga0501031_0186729_76_1008 306
846 3300049569 Ga0501032_0000715 Ga0501032_0000715_2379_3317 306
847 3300049569 Ga0501032_0112573 Ga0501032_0112573_738_1667 306
848 3300049570 Ga0501033_0008980 Ga0501033_0008980_3013_3942 306
849 3300049570 Ga0501033_0034636 Ga0501033_0034636_1242_2186 306
850 3300049572 Ga0501036_0009735 Ga0501036_0009735_1322_2266 306
851 3300049572 Ga0501036_0012481 Ga0501036_0012481_5014_5943 306
852 3300049572 Ga0501036_0014895 Ga0501036_0014895_5324_6253 306
853 3300049572 Ga0501036_0059976 Ga0501036_0059976_800_1729 306
854 3300049572 Ga0501036_0139766 Ga0501036_0139766_242_1174 306
855 3300049572 Ga0501036_0336342 Ga0501036_0336342_50_979 306
856 3300049573 Ga0501037_0017327 Ga0501037_0017327_2154_3098 306
857 3300049573 Ga0501037_0076544 Ga0501037_0076544_1202_2146 306
858 3300049574 Ga0501038_0000777 Ga0501038_0000777_3759_4688 306
859 3300049574 Ga0501038_0008351 Ga0501038_0008351_400_1344 306
860 3300049574 Ga0501038_0034514 Ga0501038_0034514_2031_2975 306
861 3300049574 Ga0501038_0035789 Ga0501038_0035789_2111_3040 306
862 3300049574 Ga0501038_0104405 Ga0501038_0104405_708_1643 306
863 3300049574 Ga0501038_0123336 Ga0501038_0123336_374_1303 306
864 3300049574 Ga0501038_0162845 Ga0501038_0162845_14_952 306
865 3300049575 Ga0501039_0001226 Ga0501039_0001226_4948_5877 306
866 3300049575 Ga0501039_0006761 Ga0501039_0006761_569_1498 306
867 3300049575 Ga0501039_0031295 Ga0501039_0031295_376_1320 306
868 3300049575 Ga0501039_0115936 Ga0501039_0115936_884_1819 306
869 3300049575 Ga0501039_0122149 Ga0501039_0122149_194_1138 306
870 3300049575 Ga0501039_0201596 Ga0501039_0201596_370_1299 306
871 3300049575 Ga0501039_0207785 Ga0501039_0207785_24_956 306
872 3300049576 Ga0501040_0001715 Ga0501040_0001715_7660_8589 306
873 3300049576 Ga0501040_0002406 Ga0501040_0002406_400_1344 306
874 3300049576 Ga0501040_0019396 Ga0501040_0019396_59_988 306
875 3300049576 Ga0501040_0061962 Ga0501040_0061962_616_1545 306
876 3300049576 Ga0501040_0136357 Ga0501040_0136357_30_971 306
877 3300049576 Ga0501040_0217366 Ga0501040_0217366_361_1293 306
878 3300049576 Ga0501040_0274737 Ga0501040_0274737_19_960 306
879 3300049577 Ga0501041_0000102 Ga0501041_0000102_10275_11204 306
880 3300049577 Ga0501041_0000547 Ga0501041_0000547_2899_3843 306
881 3300049577 Ga0501041_0009513 Ga0501041_0009513_4353_5285 306
882 3300049577 Ga0501041_0013503 Ga0501041_0013503_666_1595 306
883 3300049577 Ga0501041_0048869 Ga0501041_0048869_314_1246 306
884 3300049577 Ga0501041_0066966 Ga0501041_0066966_56_985 306
885 3300049577 Ga0501041_0088655 Ga0501041_0088655_249_1193 306
886 3300049578 Ga0501042_0000777 Ga0501042_0000777_7945_8874 306
887 3300049578 Ga0501042_0001267 Ga0501042_0001267_399_1343 306
888 3300049578 Ga0501042_0178396 Ga0501042_0178396_199_1128 306
889 3300049578 Ga0501042_0332639 Ga0501042_0332639_116_1057 306
890 3300049578 Ga0501042_0350367 Ga0501042_0350367_72_1001 306
891 3300049579 Ga0501043_0027819 Ga0501043_0027819_558_1502 306
892 3300049579 Ga0501043_0029257 Ga0501043_0029257_134_1063 306
893 3300049579 Ga0501043_0084279 Ga0501043_0084279_302_1246 306
894 3300049580 Ga0501046_0000609 Ga0501046_0000609_12832_13761 306
895 3300049580 Ga0501046_0016933 Ga0501046_0016933_3463_4398 306
896 3300049580 Ga0501046_0053831 Ga0501046_0053831_2202_3134 306
897 3300049580 Ga0501046_0074003 Ga0501046_0074003_885_1814 306
898 3300049580 Ga0501046_0153752 Ga0501046_0153752_649_1581 306
899 3300049582 Ga0501048_0009507 Ga0501048_0009507_5592_6521 306
900 3300049582 Ga0501048_0013053 Ga0501048_0013053_4491_5435 306
901 3300049582 Ga0501048_0021144 Ga0501048_0021144_257_1189 306
902 3300049582 Ga0501048_0029246 Ga0501048_0029246_297_1241 306
903 3300049582 Ga0501048_0129100 Ga0501048_0129100_821_1750 306
904 3300049583 Ga0501067_0023263 Ga0501067_0023263_1600_2529 306
905 3300049584 Ga0501068_0019384 Ga0501068_0019384_273_1202 306
906 3300049584 Ga0501068_0021026 Ga0501068_0021026_1309_2253 306
907 3300049584 Ga0501068_0030991 Ga0501068_0030991_2145_3074 306
908 3300049584 Ga0501068_0107978 Ga0501068_0107978_260_1192 306
909 3300049585 Ga0501069_0013711 Ga0501069_0013711_2110_3054 306
910 3300049586 Ga0501070_0070558 Ga0501070_0070558_1139_2068 306
911 3300049587 Ga0501071_0000736 Ga0501071_0000736_9898_10827 306
912 3300049587 Ga0501071_0006665 Ga0501071_0006665_43_972 306
913 3300049587 Ga0501071_0008256 Ga0501071_0008256_5257_6201 306
914 3300049587 Ga0501071_0037353 Ga0501071_0037353_1305_2249 306
915 3300049587 Ga0501071_0037678 Ga0501071_0037678_2139_3083 306
916 3300049587 Ga0501071_0068909 Ga0501071_0068909_1147_2079 306
917 3300049587 Ga0501071_0123867 Ga0501071_0123867_691_1620 306
918 3300049587 Ga0501071_0306199 Ga0501071_0306199_223_1152 306
919 3300049588 Ga0501072_0002055 Ga0501072_0002055_7004_7933 306
920 3300049588 Ga0501072_0026080 Ga0501072_0026080_90_1016 306
921 3300049588 Ga0501072_0029867 Ga0501072_0029867_399_1343 306
922 3300049588 Ga0501072_0108624 Ga0501072_0108624_452_1396 306
923 3300049588 Ga0501072_0128583 Ga0501072_0128583_405_1334 306
924 3300049588 Ga0501072_0184663 Ga0501072_0184663_268_1209 306
925 3300049588 Ga0501072_0244993 Ga0501072_0244993_95_1048 306
926 3300049588 Ga0501072_0272991 Ga0501072_0272991_381_1334 306
927 3300049589 Ga0501073_0052224 Ga0501073_0052224_724_1668 306
928 3300049589 Ga0501073_0214015 Ga0501073_0214015_367_1299 306
929 3300049590 Ga0501074_0005624 Ga0501074_0005624_6379_7308 306
930 3300049590 Ga0501074_0017390 Ga0501074_0017390_691_1635 306
931 3300049590 Ga0501074_0022846 Ga0501074_0022846_3547_4479 306
932 3300049590 Ga0501074_0117633 Ga0501074_0117633_164_1093 306
933 3300049590 Ga0501074_0135113 Ga0501074_0135113_607_1536 306
934 3300049591 Ga0501075_0000122 Ga0501075_0000122_16810_17739 306
935 3300049591 Ga0501075_0000396 Ga0501075_0000396_6605_7534 306
936 3300049591 Ga0501075_0001934 Ga0501075_0001934_9580_10524 306
937 3300049591 Ga0501075_0021216 Ga0501075_0021216_244_1170 306
938 3300049591 Ga0501075_0022327 Ga0501075_0022327_2944_3873 306
939 3300049591 Ga0501075_0024727 Ga0501075_0024727_1335_2270 306
940 3300049591 Ga0501075_0026576 Ga0501075_0026576_1328_2281 306
941 3300049591 Ga0501075_0029861 Ga0501075_0029861_780_1715 306
942 3300049591 Ga0501075_0034562 Ga0501075_0034562_1266_2210 306
943 3300049591 Ga0501075_0090322 Ga0501075_0090322_510_1451 306
944 3300049591 Ga0501075_0095222 Ga0501075_0095222_611_1543 306
945 3300049591 Ga0501075_0114541 Ga0501075_0114541_69_1013 306
946 3300049591 Ga0501075_0165895 Ga0501075_0165895_390_1322 306
947 3300049591 Ga0501075_0171410 Ga0501075_0171410_454_1383 306
948 3300049591 Ga0501075_0218668 Ga0501075_0218668_484_1425 306
949 3300049592 Ga0501076_0000012 Ga0501076_0000012_49434_50363 306
950 3300049592 Ga0501076_0001680 Ga0501076_0001680_7155_8084 306
951 3300049592 Ga0501076_0015372 Ga0501076_0015372_154_1089 306
952 3300049592 Ga0501076_0017411 Ga0501076_0017411_1825_2769 306
953 3300049592 Ga0501076_0027487 Ga0501076_0027487_3428_4357 306
954 3300049592 Ga0501076_0027519 Ga0501076_0027519_3194_4138 306
955 3300049592 Ga0501076_0084900 Ga0501076_0084900_932_1864 306
956 3300049592 Ga0501076_0090478 Ga0501076_0090478_803_1732 306
957 3300049592 Ga0501076_0096741 Ga0501076_0096741_128_1063 306
958 3300049592 Ga0501076_0102630 Ga0501076_0102630_102_1046 306
959 3300049592 Ga0501076_0370695 Ga0501076_0370695_194_1138 306
960 3300049593 Ga0501077_0000286 Ga0501077_0000286_15823_16752 306
961 3300049593 Ga0501077_0000535 Ga0501077_0000535_20664_21593 306
962 3300049593 Ga0501077_0013064 Ga0501077_0013064_1011_1946 306
963 3300049593 Ga0501077_0023252 Ga0501077_0023252_14_946 306
964 3300049593 Ga0501077_0034569 Ga0501077_0034569_659_1603 306
965 3300049593 Ga0501077_0045440 Ga0501077_0045440_340_1269 306
966 3300049593 Ga0501077_0107000 Ga0501077_0107000_653_1579 306
967 3300049593 Ga0501077_0131868 Ga0501077_0131868_146_1075 306
968 3300049593 Ga0501077_0265357 Ga0501077_0265357_52_984 306
969 3300049741 Ga0501079_0000134 Ga0501079_0000134_13230_14159 306
970 3300049741 Ga0501079_0009499 Ga0501079_0009499_301_1245 306
971 3300049741 Ga0501079_0041859 Ga0501079_0041859_2020_2949 306
972 3300049741 Ga0501079_0054168 Ga0501079_0054168_1935_2879 306
973 3300049741 Ga0501079_0090959 Ga0501079_0090959_1354_2286 306
974 3300049741 Ga0501079_0093911 Ga0501079_0093911_1355_2284 306
975 3300049741 Ga0501079_0115618 Ga0501079_0115618_33_962 306
976 3300049742 Ga0501080_0000292 Ga0501080_0000292_24260_25189 306
977 3300049742 Ga0501080_0064352 Ga0501080_0064352_1333_2277 306
978 3300049742 Ga0501080_0071315 Ga0501080_0071315_1986_2915 306
979 3300049742 Ga0501080_0205704 Ga0501080_0205704_284_1213 306
980 3300049743 Ga0501081_0001499 Ga0501081_0001499_6511_7440 306
981 3300049743 Ga0501081_0003182 Ga0501081_0003182_474_1409 306
982 3300049743 Ga0501081_0003765 Ga0501081_0003765_2332_3276 306
983 3300049743 Ga0501081_0006424 Ga0501081_0006424_6096_7025 306
984 3300049743 Ga0501081_0008697 Ga0501081_0008697_4691_5620 306
985 3300049743 Ga0501081_0022284 Ga0501081_0022284_399_1343 306
986 3300049743 Ga0501081_0023006 Ga0501081_0023006_2819_3751 306
987 3300049743 Ga0501081_0040032 Ga0501081_0040032_904_1848 306
988 3300049743 Ga0501081_0049117 Ga0501081_0049117_1104_2033 306
989 3300049743 Ga0501081_0096799 Ga0501081_0096799_834_1766 306
990 3300049743 Ga0501081_0176142 Ga0501081_0176142_16_954 306
991 3300049743 Ga0501081_0193443 Ga0501081_0193443_95_1039 306
992 3300049744 Ga0501083_0015479 Ga0501083_0015479_1428_2372 306
993 3300049744 Ga0501083_0028126 Ga0501083_0028126_2651_3595 306
994 3300049744 Ga0501083_0098044 Ga0501083_0098044_155_1084 306
995 3300049744 Ga0501083_0098763 Ga0501083_0098763_179_1111 306
996 3300049744 Ga0501083_0128277 Ga0501083_0128277_143_1072 306
997 3300049822 Ga0501035_0006607 Ga0501035_0006607_5466_6395 306
998 3300049822 Ga0501035_0008587 Ga0501035_0008587_7497_8441 306
999 3300049822 Ga0501035_0022542 Ga0501035_0022542_1342_2286 306
1000 3300049822 Ga0501035_0048808 Ga0501035_0048808_2350_3282 306
1001 3300049822 Ga0501035_0358583 Ga0501035_0358583_247_1176 306
1002 3300049823 Ga0501044_0065207 Ga0501044_0065207_163_1107 306
1003 3300049823 Ga0501044_0072920 Ga0501044_0072920_1236_2180 306
1004 3300049824 Ga0501045_0002290 Ga0501045_0002290_4652_5581 306
1005 3300049824 Ga0501045_0024946 Ga0501045_0024946_2264_3208 306
1006 3300049824 Ga0501045_0025790 Ga0501045_0025790_388_1332 306
1007 3300049824 Ga0501045_0071396 Ga0501045_0071396_1333_2262 306
1008 3300049824 Ga0501045_0094825 Ga0501045_0094825_431_1357 306
1009 3300049824 Ga0501045_0099300 Ga0501045_0099300_445_1374 306
1010 3300049824 Ga0501045_0114239 Ga0501045_0114239_377_1312 306
1011 3300050507 nmdc:mga05p37_106059_c1 nmdc:mga05p37_106059_c1_2424_3350 306
1012 3300050507 nmdc:mga05p37_14582_c1 nmdc:mga05p37_14582_c1_2953_3888 306
1013 3300050507 nmdc:mga05p37_175872_c1 nmdc:mga05p37_175872_c1_70_1035 306
1014 3300050507 nmdc:mga05p37_2021_c1 nmdc:mga05p37_2021_c1_6874_7818 306
1015 3300050507 nmdc:mga05p37_21565_c1 nmdc:mga05p37_21565_c1_3821_4795 306
1016 3300050507 nmdc:mga05p37_26457_c1 nmdc:mga05p37_26457_c1_4472_5437 306
1017 3300050507 nmdc:mga05p37_28205_c1 nmdc:mga05p37_28205_c1_5810_6742 306
1018 3300050507 nmdc:mga05p37_285082_c1 nmdc:mga05p37_285082_c1_338_1270 306
1019 3300050507 nmdc:mga05p37_29805_c1 nmdc:mga05p37_29805_c1_3646_4572 306
1020 3300050507 nmdc:mga05p37_353481_c1 nmdc:mga05p37_353481_c1_352_1296 306
1021 3300050507 nmdc:mga05p37_37629_c1 nmdc:mga05p37_37629_c1_2867_3832 306
1022 3300050507 nmdc:mga05p37_490438_c1 nmdc:mga05p37_490438_c1_55_1029 306
1023 3300050507 nmdc:mga05p37_50376_c1 nmdc:mga05p37_50376_c1_2503_3447 306
1024 3300050508 nmdc:mga09592_111472_c1 nmdc:mga09592_111472_c1_1368_2312 306
1025 3300050508 nmdc:mga09592_181430_c1 nmdc:mga09592_181430_c1_490_1434 306
1026 3300050508 nmdc:mga09592_27631_c1 nmdc:mga09592_27631_c1_3289_4221 306
1027 3300050508 nmdc:mga09592_364253_c1 nmdc:mga09592_364253_c1_101_1045 306
1028 3300050508 nmdc:mga09592_52126_c1 nmdc:mga09592_52126_c1_1119_2051 306
1029 3300050508 nmdc:mga09592_58939_c1 nmdc:mga09592_58939_c1_2297_3226 306
1030 3300050509 nmdc:mga0qj67_122974_c1 nmdc:mga0qj67_122974_c1_994_1923 306
1031 3300050509 nmdc:mga0qj67_147915_c1 nmdc:mga0qj67_147915_c1_397_1329 306
1032 3300050509 nmdc:mga0qj67_198385_c1 nmdc:mga0qj67_198385_c1_584_1516 306
1033 3300050509 nmdc:mga0qj67_20713_c1 nmdc:mga0qj67_20713_c1_3789_4754 306
1034 3300050509 nmdc:mga0qj67_253446_c1 nmdc:mga0qj67_253446_c1_255_1199 306
1035 3300050509 nmdc:mga0qj67_343_c1 nmdc:mga0qj67_343_c1_19313_20248 306
1036 3300050509 nmdc:mga0qj67_798_c1 nmdc:mga0qj67_798_c1_11488_12453 306
1037 3300050510 nmdc:mga06r32_12642_c1 nmdc:mga06r32_12642_c1_5250_6185 306
1038 3300050510 nmdc:mga06r32_144949_c1 nmdc:mga06r32_144949_c1_1118_2047 306
1039 3300050510 nmdc:mga06r32_150179_c1 nmdc:mga06r32_150179_c1_1152_2096 306
1040 3300050510 nmdc:mga06r32_20307_c1 nmdc:mga06r32_20307_c1_1796_2728 306
1041 3300050510 nmdc:mga06r32_27649_c1 nmdc:mga06r32_27649_c1_1818_2783 306
1042 3300050510 nmdc:mga06r32_28995_c1 nmdc:mga06r32_28995_c1_1060_2004 306
1043 3300050510 nmdc:mga06r32_313473_c1 nmdc:mga06r32_313473_c1_579_1508 306
1044 3300050510 nmdc:mga06r32_37633_c1 nmdc:mga06r32_37633_c1_2573_3505 306
1045 3300050510 nmdc:mga06r32_4631_c1 nmdc:mga06r32_4631_c1_7200_8132 306
1046 3300050510 nmdc:mga06r32_53714_c1 nmdc:mga06r32_53714_c1_780_1709 306
1047 3300050510 nmdc:mga06r32_65554_c1 nmdc:mga06r32_65554_c1_990_1931 306
1048 3300050510 nmdc:mga06r32_91676_c1 nmdc:mga06r32_91676_c1_472_1437 306
1049 3300050511 nmdc:mga08y16_1222_c1 nmdc:mga08y16_1222_c1_1510_2442 306
1050 3300050511 nmdc:mga08y16_9313_c1 nmdc:mga08y16_9313_c1_7597_8541 306
1051 3300050512 nmdc:mga0n895_115061_c1 nmdc:mga0n895_115061_c1_331_1305 306
1052 3300050512 nmdc:mga0n895_11638_c1 nmdc:mga0n895_11638_c1_4872_5798 306
1053 3300050512 nmdc:mga0n895_120247_c1 nmdc:mga0n895_120247_c1_312_1256 306
1054 3300050512 nmdc:mga0n895_172739_c1 nmdc:mga0n895_172739_c1_883_1827 306
1055 3300050512 nmdc:mga0n895_173444_c1 nmdc:mga0n895_173444_c1_19_951 306
1056 3300050512 nmdc:mga0n895_203426_c1 nmdc:mga0n895_203426_c1_286_1230 306
1057 3300050512 nmdc:mga0n895_299104_c1 nmdc:mga0n895_299104_c1_657_1586 306
1058 3300050512 nmdc:mga0n895_407561_c1 nmdc:mga0n895_407561_c1_411_1340 306
1059 3300050512 nmdc:mga0n895_41651_c1 nmdc:mga0n895_41651_c1_1468_2403 306
1060 3300050512 nmdc:mga0n895_77063_c1 nmdc:mga0n895_77063_c1_231_1157 306
1061 3300050512 nmdc:mga0n895_8039_c1 nmdc:mga0n895_8039_c1_2923_3867 306
1062 3300050513 nmdc:mga0rr50_183699_c1 nmdc:mga0rr50_183699_c1_631_1596 306
1063 3300050513 nmdc:mga0rr50_23145_c1 nmdc:mga0rr50_23145_c1_2159_3091 306
1064 3300050513 nmdc:mga0rr50_26389_c1 nmdc:mga0rr50_26389_c1_1389_2333 306
1065 3300050513 nmdc:mga0rr50_33149_c1 nmdc:mga0rr50_33149_c1_2574_3548 306
1066 3300050513 nmdc:mga0rr50_45365_c1 nmdc:mga0rr50_45365_c1_1855_2799 306
1067 3300050513 nmdc:mga0rr50_497169_c1 nmdc:mga0rr50_497169_c1_26_955 306
1068 3300050513 nmdc:mga0rr50_71346_c1 nmdc:mga0rr50_71346_c1_847_1782 306
1069 3300050513 nmdc:mga0rr50_75534_c1 nmdc:mga0rr50_75534_c1_1219_2148 306
1070 3300050513 nmdc:mga0rr50_958_c1 nmdc:mga0rr50_958_c1_11810_12736 306
1071 3300050514 nmdc:mga08x19_141788_c1 nmdc:mga08x19_141788_c1_79_1023 306
1072 3300050514 nmdc:mga08x19_15357_c1 nmdc:mga08x19_15357_c1_446_1378 306
1073 3300050514 nmdc:mga08x19_169_c1 nmdc:mga08x19_169_c1_16244_17173 306
1074 3300050514 nmdc:mga08x19_23933_c1 nmdc:mga08x19_23933_c1_1521_2465 306
1075 3300050514 nmdc:mga08x19_256860_c1 nmdc:mga08x19_256860_c1_27_971 306
1076 3300050514 nmdc:mga08x19_47050_c1 nmdc:mga08x19_47050_c1_859_1833 306
1077 3300050515 nmdc:mga0a205_123616_c1 nmdc:mga0a205_123616_c1_643_1587 306
1078 3300050515 nmdc:mga0a205_158102_c1 nmdc:mga0a205_158102_c1_577_1506 306
1079 3300050515 nmdc:mga0a205_167521_c1 nmdc:mga0a205_167521_c1_645_1577 306
1080 3300050515 nmdc:mga0a205_27057_c1 nmdc:mga0a205_27057_c1_1553_2497 306
1081 3300050515 nmdc:mga0a205_2861_c1 nmdc:mga0a205_2861_c1_12678_13604 306
1082 3300050515 nmdc:mga0a205_33548_c1 nmdc:mga0a205_33548_c1_1151_2116 306
1083 3300050515 nmdc:mga0a205_33951_c1 nmdc:mga0a205_33951_c1_316_1260 306
1084 3300050515 nmdc:mga0a205_4319_c1 nmdc:mga0a205_4319_c1_4413_5342 306
1085 3300050515 nmdc:mga0a205_467345_c1 nmdc:mga0a205_467345_c1_48_977 306
1086 3300050515 nmdc:mga0a205_47974_c1 nmdc:mga0a205_47974_c1_1690_2664 306
1087 3300050515 nmdc:mga0a205_49115_c1 nmdc:mga0a205_49115_c1_2551_3516 306
1088 3300050515 nmdc:mga0a205_54303_c1 nmdc:mga0a205_54303_c1_32_1006 306
1089 3300050515 nmdc:mga0a205_64006_c1 nmdc:mga0a205_64006_c1_1727_2662 306
1090 3300050515 nmdc:mga0a205_68685_c1 nmdc:mga0a205_68685_c1_1005_1937 306
1091 3300053083 Ga0495655_0039196 Ga0495655_0039196_98_1027 306
1092 3300053087 Ga0500643_001116 Ga0500643_001116_9839_10783 306
1093 3300053153 Ga0500616_0002615 Ga0500616_0002615_3735_4667 306
1094 3300054114 Ga0501084_0001169 Ga0501084_0001169_6202_7131 306
1095 3300054114 Ga0501084_0001730 Ga0501084_0001730_13984_14913 306
1096 3300054114 Ga0501084_0012647 Ga0501084_0012647_206_1138 306
1097 3300054114 Ga0501084_0036762 Ga0501084_0036762_1211_2140 306
1098 3300054114 Ga0501084_0040118 Ga0501084_0040118_484_1428 306
1099 3300054114 Ga0501084_0084376 Ga0501084_0084376_826_1758 306
1100 3300054114 Ga0501084_0088966 Ga0501084_0088966_1388_2320 306
1101 3300054114 Ga0501084_0298951 Ga0501084_0298951_399_1343 306
1102 3300059421 Ga0590071_012403 Ga0590071_012403_462_1397 306
1103 3300060353 Ga0501082_0000931 Ga0501082_0000931_16066_17010 306
1104 3300060353 Ga0501082_0001240 Ga0501082_0001240_19879_20808 306
1105 3300060353 Ga0501082_0002631 Ga0501082_0002631_7397_8326 306
1106 3300060353 Ga0501082_0009410 Ga0501082_0009410_1389_2318 306
1107 3300060353 Ga0501082_0011314 Ga0501082_0011314_5338_6273 306
1108 3300060353 Ga0501082_0016940 Ga0501082_0016940_896_1825 306
1109 3300060353 Ga0501082_0026089 Ga0501082_0026089_3864_4793 306
1110 3300060353 Ga0501082_0039563 Ga0501082_0039563_10_954 306
1111 3300060353 Ga0501082_0109702 Ga0501082_0109702_1119_2045 306
1112 3300060353 Ga0501082_0135157 Ga0501082_0135157_108_1052 306
1113 3300060353 Ga0501082_0168629 Ga0501082_0168629_866_1798 306
1114 3300060353 Ga0501082_0419362 Ga0501082_0419362_97_1038 306
1115 3300060353 Ga0501082_0449872 Ga0501082_0449872_93_1025 306
1116 3300061734 Ga0530510_0000015 Ga0530510_0000015_80034_80963 306
1117 3300061734 Ga0530510_0001748 Ga0530510_0001748_7677_8606 306
1118 3300061734 Ga0530510_0012716 Ga0530510_0012716_2791_3726 306
1119 3300061734 Ga0530510_0014668 Ga0530510_0014668_4239_5171 306
1120 3300061734 Ga0530510_0024091 Ga0530510_0024091_3120_4049 306
1121 3300061734 Ga0530510_0041545 Ga0530510_0041545_1490_2422 306
1122 3300061734 Ga0530510_0063269 Ga0530510_0063269_659_1585 306
1123 3300061734 Ga0530510_0087001 Ga0530510_0087001_196_1140 306
1124 3300061734 Ga0530510_0113530 Ga0530510_0113530_435_1364 306
1125 3300061734 Ga0530510_0119452 Ga0530510_0119452_291_1220 306
1126 3300061734 Ga0530510_0134848 Ga0530510_0134848_397_1341 306
1127 3300061734 Ga0530510_0153733 Ga0530510_0153733_471_1424 306
1128 3300061734 Ga0530510_0211240 Ga0530510_0211240_112_1047 306
1129 3300061734 Ga0530510_0285620 Ga0530510_0285620_42_986 306
1130 3300003323 rootH1_10203824 rootH1_102038242 308
1131 3300005436 Ga0070713_100004492 Ga0070713_1000044928 308
1132 3300006173 Ga0070716_100021204 Ga0070716_1000212043 308
1133 3300025906 Ga0207699_10000139 Ga0207699_1000013933 308
1134 3300025928 Ga0207700_10000530 Ga0207700_1000053021 308
1135 3300049573 Ga0501037_0006094 Ga0501037_0006094_3022_3948 308
1136 3300049574 Ga0501038_0107795 Ga0501038_0107795_574_1500 308
1137 3300049581 Ga0501047_0033437 Ga0501047_0033437_2896_3822 308
1138 3300049823 Ga0501044_0009573 Ga0501044_0009573_8123_9049 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00056

Ldh_1_N

lactate/malate dehydrogenase, NAD binding domain

60

199

0.98

PF02866

Ldh_1_C

lactate/malate dehydrogenase, alpha/beta C-terminal domain

202

363

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ur5-assembly1.cif.gz_A-2 stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface 0.9896 2 305
1guz-assembly1.cif.gz_C structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9896 4 304
1guz-assembly1.cif.gz_D structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9881 4 304
1guy-assembly1.cif.gz_A-2 structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9881 1 304
1guz-assembly1.cif.gz_B structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9874 4 304
ID Description Score Start End Superfamily
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9906 1 144 3.40.50.720
1guyA02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9862 145 304 3.90.110.10
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 1 144 3.40.50.720
2hjrJ02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9817 145 307 3.90.110.10
2d4aA02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9743 145 304 3.90.110.10
ID Description Score Start End GO Terms
AF-A0A317ZFS9-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 1.001 225 307 GO:0004459
GO:0006089
GO:0006090
GO:0030060
AF-A0A7W1UG31-F1-model_v4 NAD(P)-binding domain-containing protein 1 2 79 GO:0004459
GO:0006089
GO:0006090
AF-A0A7C8DRS0-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9981 195 307 GO:0004459
GO:0006089
GO:0006090
GO:0030060
AF-T1BA13-F1-model_v4 Malate dehydrogenase, NAD-dependent 0.9971 100 275 GO:0004459
GO:0006089
GO:0006090
AF-A0A533XZ99-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9963 1 298 GO:0004459
GO:0006089
GO:0006090
GO:0006099
GO:0030060

Feature Viewer

pLDDT pTM Quality
95.54 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map