F490664
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1138 | 471 | 2276 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10305925|Ga0207678_103059252 |
| Length | 311 |
| Sequence | MRGRSRFLTLWLVAGFVFFYGPIASMIVFSFNASRLATVWGGFSTKWYVALWGNRQVMDAALLSLQIAAISATIATALGTMAGIALARFGRFRGRLLLAGMVTAPLVMPEVITGLSLLLLFVALEDSFGWPSGRGAMTITIAHVTFCMAYVAVVVQSRLADMDASIEEAAADLGSRPWQVMVDITLPLLAPAMVSGWLLAFTLSLDDLVIATFTSGPGANTLPMLIFSKVRLGLTPDINALATIIILVVASFXXAIRASWLIQTPPSAGFGLTTTCHWSLRCVWSKVFFSCRGFMFCCLGNTHIWRKFAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 118 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 212 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 213 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 231 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 232 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 251 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 261 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 262 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 264 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 267 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 268 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 271 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 272 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 273 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 274 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 275 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 276 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 277 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 280 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 283 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 289 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 290 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 291 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 292 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 358 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 419 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 420 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 425 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 426 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 427 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 429 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 430 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 431 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 433 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 434 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 438 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 439 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 440 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 441 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 442 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 443 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 444 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 445 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 446 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 447 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 448 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 449 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 450 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 451 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 452 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 453 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 454 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 455 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 456 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 457 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 458 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 459 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 460 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 461 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 462 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 463 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 464 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 465 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 466 | 2941479691 | |||
| 467 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 468 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 469 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 470 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 471 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.75 |
| Metatranscriptomes | 0.26 |
| Isolates | 2.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.1 |
| Nodule | 0 |
| Rhizoplane | 2.72 |
| Rhizosphere | 83.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207678_10305925 | 3300026067 | Bacteria | 1366 |
| 2 | JGI25159J45721_1020272 | 3300002987 | Bacteria | 1286 |
| 3 | JGI25151J46595_10000130 | 3300003187 | Bacteria | 101649 |
| 4 | JGI25151J46595_10000312 | 3300003187 | Bacteria | 52924 |
| 5 | JGI25151J46595_10000436 | 3300003187 | Bacteria | 41270 |
| 6 | JGI25406J46586_10015918 | 3300003203 | Bacteria | 3154 |
| 7 | JGI25153J46596_10000132 | 3300003215 | Bacteria | 79600 |
| 8 | JGI25153J46596_10000426 | 3300003215 | Bacteria | 27425 |
| 9 | rootH2_10070126 | 3300003320 | Bacteria | 2716 |
| 10 | rootL2_10029180 | 3300003322 | Bacteria | 1700 |
| 11 | rootL2_10278328 | 3300003322 | Bacteria | 1426 |
| 12 | rootH1_10064332 | 3300003323 | Bacteria | 3050 |
| 13 | rootH1_10300231 | 3300003323 | Bacteria | 1397 |
| 14 | Ga0055527_1000005 | 3300003760 | Bacteria | 504776 |
| 15 | Ga0055542_1000006 | 3300003762 | Bacteria | 504776 |
| 16 | Ga0055529_1000013 | 3300003763 | Bacteria | 373267 |
| 17 | Ga0065704_10140248 | 3300005289 | Bacteria | 1525 |
| 18 | Ga0065712_10114830 | 3300005290 | Bacteria | 1760 |
| 19 | Ga0070683_100042785 | 3300005329 | Bacteria | 4172 |
| 20 | Ga0070690_100056392 | 3300005330 | Bacteria | 2519 |
| 21 | Ga0070666_10003820 | 3300005335 | Bacteria | 9140 |
| 22 | Ga0070666_10211953 | 3300005335 | Bacteria | 1364 |
| 23 | Ga0070666_10500410 | 3300005335 | Bacteria | 881 |
| 24 | Ga0070680_100004606 | 3300005336 | Bacteria | 10361 |
| 25 | Ga0070680_100091900 | 3300005336 | Bacteria | 2512 |
| 26 | Ga0070680_100134045 | 3300005336 | Bacteria | 2074 |
| 27 | Ga0068868_100015991 | 3300005338 | Bacteria | 5563 |
| 28 | Ga0068868_100522536 | 3300005338 | Bacteria | 1042 |
| 29 | Ga0070660_100052227 | 3300005339 | Bacteria | 3151 |
| 30 | Ga0070660_100360160 | 3300005339 | Bacteria | 1199 |
| 31 | Ga0070660_100451080 | 3300005339 | Bacteria | 1067 |
| 32 | Ga0070661_100000775 | 3300005344 | Bacteria | 23068 |
| 33 | Ga0070668_100037293 | 3300005347 | Bacteria | 3711 |
| 34 | Ga0070669_100005076 | 3300005353 | Bacteria | 9515 |
| 35 | Ga0070675_100014302 | 3300005354 | Bacteria | 6256 |
| 36 | Ga0070675_100035991 | 3300005354 | Bacteria | 4026 |
| 37 | Ga0070671_100022140 | 3300005355 | Bacteria | 5192 |
| 38 | Ga0070671_100069722 | 3300005355 | Bacteria | 2932 |
| 39 | Ga0070674_100107403 | 3300005356 | Bacteria | 2043 |
| 40 | Ga0070688_100021247 | 3300005365 | Bacteria | 3789 |
| 41 | Ga0070667_100018886 | 3300005367 | Bacteria | 5715 |
| 42 | Ga0070667_100027818 | 3300005367 | Bacteria | 4705 |
| 43 | Ga0070667_100041630 | 3300005367 | Bacteria | 3854 |
| 44 | Ga0070667_100061427 | 3300005367 | Bacteria | 3181 |
| 45 | Ga0070667_100210335 | 3300005367 | Bacteria | 1728 |
| 46 | Ga0070667_100433309 | 3300005367 | Bacteria | 1200 |
| 47 | Ga0070709_10085941 | 3300005434 | Bacteria | 2064 |
| 48 | Ga0070709_10091586 | 3300005434 | Bacteria | 2007 |
| 49 | Ga0070709_10259233 | 3300005434 | Bacteria | 1256 |
| 50 | Ga0070713_100035644 | 3300005436 | Bacteria | 4008 |
| 51 | Ga0070713_100036136 | 3300005436 | Bacteria | 3984 |
| 52 | Ga0070713_100049136 | 3300005436 | Bacteria | 3478 |
| 53 | Ga0070713_100167499 | 3300005436 | Bacteria | 1966 |
| 54 | Ga0070713_100515829 | 3300005436 | Bacteria | 1129 |
| 55 | Ga0070710_10006217 | 3300005437 | Bacteria | 5717 |
| 56 | Ga0070711_100054528 | 3300005439 | Bacteria | 2759 |
| 57 | Ga0070711_100121593 | 3300005439 | Bacteria | 1932 |
| 58 | Ga0070711_100259883 | 3300005439 | Bacteria | 1365 |
| 59 | Ga0070705_100141188 | 3300005440 | Bacteria | 1585 |
| 60 | Ga0070700_100052749 | 3300005441 | Bacteria | 2536 |
| 61 | Ga0070694_100448572 | 3300005444 | Bacteria | 1018 |
| 62 | Ga0070663_100065355 | 3300005455 | Bacteria | 2632 |
| 63 | Ga0070663_100149231 | 3300005455 | Bacteria | 1791 |
| 64 | Ga0070663_100253307 | 3300005455 | Bacteria | 1394 |
| 65 | Ga0070662_100003902 | 3300005457 | Bacteria | 9349 |
| 66 | Ga0070662_100538669 | 3300005457 | Bacteria | 977 |
| 67 | Ga0070681_10007653 | 3300005458 | Bacteria | 10563 |
| 68 | Ga0070681_10008934 | 3300005458 | Bacteria | 9851 |
| 69 | Ga0070681_10103019 | 3300005458 | Bacteria | 2799 |
| 70 | Ga0068867_100019954 | 3300005459 | Bacteria | 4776 |
| 71 | Ga0068867_100413626 | 3300005459 | Bacteria | 1140 |
| 72 | Ga0068867_100419531 | 3300005459 | Bacteria | 1133 |
| 73 | Ga0070698_100065367 | 3300005471 | Bacteria | 3662 |
| 74 | Ga0070679_100000523 | 3300005530 | Bacteria | 32664 |
| 75 | Ga0070679_100006850 | 3300005530 | Bacteria | 10628 |
| 76 | Ga0070679_100123644 | 3300005530 | Unclassified | 2571 |
| 77 | Ga0070679_100153710 | 3300005530 | Bacteria | 2277 |
| 78 | Ga0070679_100380104 | 3300005530 | Bacteria | 1359 |
| 79 | Ga0070684_100044457 | 3300005535 | Bacteria | 3842 |
| 80 | Ga0070684_100220864 | 3300005535 | Bacteria | 1729 |
| 81 | Ga0070684_100400697 | 3300005535 | Bacteria | 1265 |
| 82 | Ga0068853_100006497 | 3300005539 | Bacteria | 9301 |
| 83 | Ga0068853_100042108 | 3300005539 | Bacteria | 3903 |
| 84 | Ga0068853_100083513 | 3300005539 | Bacteria | 2798 |
| 85 | Ga0068853_100109331 | 3300005539 | Bacteria | 2454 |
| 86 | Ga0068853_100452398 | 3300005539 | Bacteria | 1208 |
| 87 | Ga0068853_100504721 | 3300005539 | Bacteria | 1142 |
| 88 | Ga0070672_100021778 | 3300005543 | Bacteria | 4694 |
| 89 | Ga0070672_100023391 | 3300005543 | Bacteria | 4554 |
| 90 | Ga0070686_100017327 | 3300005544 | Bacteria | 4208 |
| 91 | Ga0070695_100138237 | 3300005545 | Bacteria | 1686 |
| 92 | Ga0070693_100281698 | 3300005547 | Bacteria | 1113 |
| 93 | Ga0070665_100000543 | 3300005548 | Bacteria | 52995 |
| 94 | Ga0070665_100003944 | 3300005548 | Bacteria | 15661 |
| 95 | Ga0070665_100023201 | 3300005548 | Bacteria | 6249 |
| 96 | Ga0070665_100073814 | 3300005548 | Bacteria | 3417 |
| 97 | Ga0070665_100100197 | 3300005548 | Bacteria | 2901 |
| 98 | Ga0070665_100172965 | 3300005548 | Bacteria | 2161 |
| 99 | Ga0070665_100224231 | 3300005548 | Bacteria | 1880 |
| 100 | Ga0070665_100274053 | 3300005548 | Bacteria | 1689 |
| 101 | Ga0070665_100464757 | 3300005548 | Bacteria | 1275 |
| 102 | Ga0070704_100009353 | 3300005549 | Bacteria | 5917 |
| 103 | Ga0070704_100287057 | 3300005549 | Bacteria | 1366 |
| 104 | Ga0068855_100176374 | 3300005563 | Bacteria | 2418 |
| 105 | Ga0068855_100236507 | 3300005563 | Bacteria | 2043 |
| 106 | Ga0068855_100280539 | 3300005563 | Bacteria | 1850 |
| 107 | Ga0068855_100307806 | 3300005563 | Bacteria | 1753 |
| 108 | Ga0068855_100446602 | 3300005563 | Bacteria | 1412 |
| 109 | Ga0068857_100261616 | 3300005577 | Bacteria | 1588 |
| 110 | Ga0068857_100580528 | 3300005577 | Bacteria | 1058 |
| 111 | Ga0068854_100018789 | 3300005578 | Bacteria | 4646 |
| 112 | Ga0068854_100212093 | 3300005578 | Bacteria | 1528 |
| 113 | Ga0068856_100145714 | 3300005614 | Bacteria | 2376 |
| 114 | Ga0068856_100155933 | 3300005614 | Bacteria | 2293 |
| 115 | Ga0068852_100112335 | 3300005616 | Bacteria | 2479 |
| 116 | Ga0068852_100505074 | 3300005616 | Bacteria | 1204 |
| 117 | Ga0068859_100002193 | 3300005617 | Bacteria | 19831 |
| 118 | Ga0068859_100007416 | 3300005617 | Bacteria | 11134 |
| 119 | Ga0068859_100027568 | 3300005617 | Bacteria | 5698 |
| 120 | Ga0068859_100030044 | 3300005617 | Bacteria | 5452 |
| 121 | Ga0068859_100034471 | 3300005617 | Bacteria | 5080 |
| 122 | Ga0068859_100069694 | 3300005617 | Bacteria | 3552 |
| 123 | Ga0068859_100144102 | 3300005617 | Bacteria | 2456 |
| 124 | Ga0068864_100065782 | 3300005618 | Bacteria | 3145 |
| 125 | Ga0068864_100278302 | 3300005618 | Bacteria | 1561 |
| 126 | Ga0068861_100006751 | 3300005719 | Bacteria | 7842 |
| 127 | Ga0068861_100300486 | 3300005719 | Bacteria | 1390 |
| 128 | Ga0068851_10006113 | 3300005834 | Bacteria | 5494 |
| 129 | Ga0068870_10018568 | 3300005840 | Bacteria | 3360 |
| 130 | Ga0068863_100001099 | 3300005841 | Bacteria | 27025 |
| 131 | Ga0068863_100005032 | 3300005841 | Bacteria | 13033 |
| 132 | Ga0068863_100022625 | 3300005841 | Bacteria | 6002 |
| 133 | Ga0068863_100112958 | 3300005841 | Bacteria | 2587 |
| 134 | Ga0068863_100248581 | 3300005841 | Bacteria | 1717 |
| 135 | Ga0068863_100851104 | 3300005841 | Bacteria | 911 |
| 136 | Ga0068858_100001773 | 3300005842 | Bacteria | 22007 |
| 137 | Ga0068858_100001802 | 3300005842 | Bacteria | 21829 |
| 138 | Ga0068858_100002680 | 3300005842 | Bacteria | 17929 |
| 139 | Ga0068858_100007229 | 3300005842 | Bacteria | 10762 |
| 140 | Ga0068860_100005207 | 3300005843 | Bacteria | 13207 |
| 141 | Ga0068860_100010729 | 3300005843 | Bacteria | 9046 |
| 142 | Ga0068860_100029041 | 3300005843 | Bacteria | 5320 |
| 143 | Ga0068860_100079184 | 3300005843 | Bacteria | 3124 |
| 144 | Ga0068860_100087827 | 3300005843 | Bacteria | 2960 |
| 145 | Ga0068860_100118452 | 3300005843 | Bacteria | 2535 |
| 146 | Ga0068862_100074597 | 3300005844 | Bacteria | 2932 |
| 147 | Ga0068862_100166684 | 3300005844 | Bacteria | 1970 |
| 148 | Ga0068862_100190620 | 3300005844 | Bacteria | 1844 |
| 149 | Ga0068862_100395828 | 3300005844 | Bacteria | 1291 |
| 150 | Ga0081455_10022056 | 3300005937 | Bacteria | 5961 |
| 151 | Ga0081455_10286575 | 3300005937 | Bacteria | 1187 |
| 152 | Ga0081540_1011922 | 3300005983 | Bacteria | 5768 |
| 153 | Ga0081540_1039510 | 3300005983 | Bacteria | 2473 |
| 154 | Ga0081539_10000028 | 3300005985 | Bacteria | 328182 |
| 155 | Ga0081539_10000572 | 3300005985 | Bacteria | 76133 |
| 156 | Ga0070717_10008740 | 3300006028 | Bacteria | 7578 |
| 157 | Ga0070717_10505885 | 3300006028 | Bacteria | 1092 |
| 158 | Ga0075363_100167385 | 3300006048 | Bacteria | 1246 |
| 159 | Ga0075363_100191462 | 3300006048 | Bacteria | 1167 |
| 160 | Ga0070712_100043863 | 3300006175 | Bacteria | 3081 |
| 161 | Ga0070712_100049035 | 3300006175 | Bacteria | 2930 |
| 162 | Ga0070712_100317876 | 3300006175 | Bacteria | 1265 |
| 163 | Ga0070712_100332292 | 3300006175 | Bacteria | 1239 |
| 164 | Ga0075367_10048990 | 3300006178 | Bacteria | 2490 |
| 165 | Ga0075367_10125721 | 3300006178 | Bacteria | 1582 |
| 166 | Ga0097621_100323684 | 3300006237 | Bacteria | 1366 |
| 167 | Ga0097621_100676337 | 3300006237 | Bacteria | 949 |
| 168 | Ga0075370_10028886 | 3300006353 | Bacteria | 3085 |
| 169 | Ga0068871_100026906 | 3300006358 | Bacteria | 4493 |
| 170 | Ga0068871_100121433 | 3300006358 | Bacteria | 2207 |
| 171 | Ga0068871_100238794 | 3300006358 | Bacteria | 1579 |
| 172 | Ga0075428_100007872 | 3300006844 | Bacteria | 11817 |
| 173 | Ga0075428_100133315 | 3300006844 | Bacteria | 2701 |
| 174 | Ga0075428_100179632 | 3300006844 | Bacteria | 2291 |
| 175 | Ga0075430_100003646 | 3300006846 | Bacteria | 12922 |
| 176 | Ga0075430_100204848 | 3300006846 | Bacteria | 1637 |
| 177 | Ga0075430_100462388 | 3300006846 | Bacteria | 1047 |
| 178 | Ga0075431_100008804 | 3300006847 | Bacteria | 10112 |
| 179 | Ga0075431_100010293 | 3300006847 | Bacteria | 9398 |
| 180 | Ga0075431_100040109 | 3300006847 | Bacteria | 4824 |
| 181 | Ga0075431_100040688 | 3300006847 | Bacteria | 4790 |
| 182 | Ga0075431_100071130 | 3300006847 | Bacteria | 3589 |
| 183 | Ga0075431_100173057 | 3300006847 | Bacteria | 2218 |
| 184 | Ga0075431_100203659 | 3300006847 | Bacteria | 2024 |
| 185 | Ga0075433_10005192 | 3300006852 | Bacteria | 10202 |
| 186 | Ga0075434_100001680 | 3300006871 | Bacteria | 18905 |
| 187 | Ga0075434_100719378 | 3300006871 | Bacteria | 1016 |
| 188 | Ga0075429_100062955 | 3300006880 | Bacteria | 3232 |
| 189 | Ga0075429_100145387 | 3300006880 | Bacteria | 2075 |
| 190 | Ga0075429_100317192 | 3300006880 | Bacteria | 1364 |
| 191 | Ga0068865_100032871 | 3300006881 | Bacteria | 3470 |
| 192 | Ga0068865_100051043 | 3300006881 | Bacteria | 2861 |
| 193 | Ga0075436_100106071 | 3300006914 | Bacteria | 1960 |
| 194 | Ga0097620_100002193 | 3300006931 | Bacteria | 19831 |
| 195 | Ga0097620_100007416 | 3300006931 | Bacteria | 11134 |
| 196 | Ga0097620_100027568 | 3300006931 | Bacteria | 5698 |
| 197 | Ga0097620_100030045 | 3300006931 | Bacteria | 5452 |
| 198 | Ga0097620_100034472 | 3300006931 | Bacteria | 5080 |
| 199 | Ga0097620_100069696 | 3300006931 | Bacteria | 3552 |
| 200 | Ga0097620_100144103 | 3300006931 | Bacteria | 2456 |
| 201 | Ga0097620_100491412 | 3300006931 | Bacteria | 1322 |
| 202 | Ga0075435_100092318 | 3300007076 | Bacteria | 2500 |
| 203 | Ga0075435_100093142 | 3300007076 | Bacteria | 2489 |
| 204 | Ga0075435_100425553 | 3300007076 | Bacteria | 1144 |
| 205 | Ga0099795_10000022 | 3300007788 | Bacteria | 52585 |
| 206 | Ga0099795_10039386 | 3300007788 | Bacteria | 1673 |
| 207 | Ga0105244_10000485 | 3300009036 | Bacteria | 35910 |
| 208 | Ga0105240_10002127 | 3300009093 | Bacteria | 32338 |
| 209 | Ga0105240_10019489 | 3300009093 | Bacteria | 9062 |
| 210 | Ga0105240_10040891 | 3300009093 | Bacteria | 5924 |
| 211 | Ga0105240_10166139 | 3300009093 | Bacteria | 2617 |
| 212 | Ga0105240_10342568 | 3300009093 | Bacteria | 1698 |
| 213 | Ga0105240_10453705 | 3300009093 | Bacteria | 1434 |
| 214 | Ga0105240_10598508 | 3300009093 | Bacteria | 1214 |
| 215 | Ga0111539_10000539 | 3300009094 | Bacteria | 48163 |
| 216 | Ga0111539_10008011 | 3300009094 | Bacteria | 13478 |
| 217 | Ga0111539_10042495 | 3300009094 | Bacteria | 5458 |
| 218 | Ga0111539_10051848 | 3300009094 | Bacteria | 4885 |
| 219 | Ga0111539_10119806 | 3300009094 | Bacteria | 3083 |
| 220 | Ga0111539_10184014 | 3300009094 | Bacteria | 2440 |
| 221 | Ga0111539_10187293 | 3300009094 | Bacteria | 2416 |
| 222 | Ga0105245_10041273 | 3300009098 | Bacteria | 4113 |
| 223 | Ga0105245_10346510 | 3300009098 | Bacteria | 1470 |
| 224 | Ga0105247_10000300 | 3300009101 | Bacteria | 44647 |
| 225 | Ga0105247_10002560 | 3300009101 | Bacteria | 12335 |
| 226 | Ga0105247_10021799 | 3300009101 | Bacteria | 3854 |
| 227 | Ga0105247_10034970 | 3300009101 | Bacteria | 3060 |
| 228 | Ga0105247_10046950 | 3300009101 | Bacteria | 2652 |
| 229 | Ga0105247_10152903 | 3300009101 | Bacteria | 1522 |
| 230 | Ga0105247_10243378 | 3300009101 | Bacteria | 1226 |
| 231 | Ga0114129_10018202 | 3300009147 | Bacteria | 10002 |
| 232 | Ga0114129_10043590 | 3300009147 | Bacteria | 6312 |
| 233 | Ga0114129_10079019 | 3300009147 | Bacteria | 4574 |
| 234 | Ga0114129_10157357 | 3300009147 | Bacteria | 3106 |
| 235 | Ga0114129_10360628 | 3300009147 | Bacteria | 1923 |
| 236 | Ga0114129_10796081 | 3300009147 | Bacteria | 1206 |
| 237 | Ga0105243_10373640 | 3300009148 | Bacteria | 1316 |
| 238 | Ga0105241_10083942 | 3300009174 | Bacteria | 2500 |
| 239 | Ga0105242_10296324 | 3300009176 | Bacteria | 1474 |
| 240 | Ga0105242_10487791 | 3300009176 | Bacteria | 1169 |
| 241 | Ga0105248_10004437 | 3300009177 | Bacteria | 15538 |
| 242 | Ga0105248_10045977 | 3300009177 | Bacteria | 4894 |
| 243 | Ga0105248_10154022 | 3300009177 | Bacteria | 2593 |
| 244 | Ga0105248_10166119 | 3300009177 | Bacteria | 2488 |
| 245 | Ga0105248_10209038 | 3300009177 | Bacteria | 2199 |
| 246 | Ga0105248_10215252 | 3300009177 | Bacteria | 2164 |
| 247 | Ga0105248_10482361 | 3300009177 | Bacteria | 1397 |
| 248 | Ga0105237_10018777 | 3300009545 | Bacteria | 7150 |
| 249 | Ga0105237_10039226 | 3300009545 | Bacteria | 4781 |
| 250 | Ga0105237_10066928 | 3300009545 | Bacteria | 3587 |
| 251 | Ga0105237_10074516 | 3300009545 | Bacteria | 3386 |
| 252 | Ga0105237_10079543 | 3300009545 | Bacteria | 3268 |
| 253 | Ga0105237_10337908 | 3300009545 | Bacteria | 1510 |
| 254 | Ga0105237_10349702 | 3300009545 | Bacteria | 1482 |
| 255 | Ga0105238_10065070 | 3300009551 | Bacteria | 3647 |
| 256 | Ga0105238_10119147 | 3300009551 | Bacteria | 2620 |
| 257 | Ga0105238_10122845 | 3300009551 | Bacteria | 2576 |
| 258 | Ga0105238_10555519 | 3300009551 | Bacteria | 1153 |
| 259 | Ga0105249_10013186 | 3300009553 | Bacteria | 7294 |
| 260 | Ga0105249_10063863 | 3300009553 | Bacteria | 3383 |
| 261 | Ga0105249_10126799 | 3300009553 | Bacteria | 2431 |
| 262 | Ga0105249_10189268 | 3300009553 | Bacteria | 2008 |
| 263 | Ga0105249_10401251 | 3300009553 | Bacteria | 1401 |
| 264 | Ga0105030_100135 | 3300009987 | Bacteria | 5867 |
| 265 | Ga0099796_10000025 | 3300010159 | Bacteria | 37858 |
| 266 | Ga0099796_10047809 | 3300010159 | Bacteria | 1473 |
| 267 | Ga0105239_10005592 | 3300010375 | Bacteria | 14700 |
| 268 | Ga0105239_10052494 | 3300010375 | Bacteria | 4471 |
| 269 | Ga0105239_10127177 | 3300010375 | Bacteria | 2833 |
| 270 | Ga0157371_10214250 | 3300013102 | Bacteria | 1382 |
| 271 | Ga0157370_10001622 | 3300013104 | Bacteria | 27793 |
| 272 | Ga0157370_10052398 | 3300013104 | Bacteria | 3896 |
| 273 | Ga0157369_10091788 | 3300013105 | Bacteria | 3241 |
| 274 | Ga0157369_10358490 | 3300013105 | Bacteria | 1514 |
| 275 | Ga0157369_10392959 | 3300013105 | Bacteria | 1439 |
| 276 | Ga0157374_10057123 | 3300013296 | Bacteria | 3644 |
| 277 | Ga0157374_10266109 | 3300013296 | Bacteria | 1690 |
| 278 | Ga0157378_10192571 | 3300013297 | Bacteria | 1924 |
| 279 | Ga0163162_10068089 | 3300013306 | Bacteria | 3611 |
| 280 | Ga0163162_10243601 | 3300013306 | Bacteria | 1929 |
| 281 | Ga0163162_10496428 | 3300013306 | Bacteria | 1351 |
| 282 | Ga0157372_10058628 | 3300013307 | Bacteria | 4305 |
| 283 | Ga0157375_10052786 | 3300013308 | Bacteria | 3998 |
| 284 | Ga0157375_10333620 | 3300013308 | Bacteria | 1682 |
| 285 | Ga0157375_10719807 | 3300013308 | Bacteria | 1151 |
| 286 | Ga0157375_11020506 | 3300013308 | Bacteria | 966 |
| 287 | Ga0157514_109572 | 3300013874 | Bacteria | 1488 |
| 288 | Ga0163163_10008179 | 3300014325 | Bacteria | 9278 |
| 289 | Ga0163163_10010899 | 3300014325 | Bacteria | 8211 |
| 290 | Ga0163163_10032882 | 3300014325 | Bacteria | 5012 |
| 291 | Ga0163163_10033348 | 3300014325 | Bacteria | 4980 |
| 292 | Ga0163163_10054754 | 3300014325 | Bacteria | 3942 |
| 293 | Ga0163163_10164638 | 3300014325 | Bacteria | 2263 |
| 294 | Ga0163163_10241991 | 3300014325 | Bacteria | 1854 |
| 295 | Ga0163163_10549227 | 3300014325 | Bacteria | 1218 |
| 296 | Ga0163163_10886454 | 3300014325 | Bacteria | 955 |
| 297 | Ga0157380_10000110 | 3300014326 | Bacteria | 44612 |
| 298 | Ga0157380_10010381 | 3300014326 | Bacteria | 6699 |
| 299 | Ga0157380_10096919 | 3300014326 | Bacteria | 2446 |
| 300 | Ga0157380_10247030 | 3300014326 | Bacteria | 1613 |
| 301 | Ga0157380_10313909 | 3300014326 | Bacteria | 1450 |
| 302 | Ga0157380_10318476 | 3300014326 | Bacteria | 1441 |
| 303 | Ga0157377_10096682 | 3300014745 | Bacteria | 1752 |
| 304 | Ga0157377_10115359 | 3300014745 | Bacteria | 1620 |
| 305 | Ga0157379_10002677 | 3300014968 | Bacteria | 15005 |
| 306 | Ga0157379_10005225 | 3300014968 | Bacteria | 11148 |
| 307 | Ga0157379_10056900 | 3300014968 | Bacteria | 3494 |
| 308 | Ga0157379_10096564 | 3300014968 | Bacteria | 2652 |
| 309 | Ga0157379_10111786 | 3300014968 | Bacteria | 2454 |
| 310 | Ga0157379_10200864 | 3300014968 | Bacteria | 1803 |
| 311 | Ga0157379_10252200 | 3300014968 | Bacteria | 1602 |
| 312 | Ga0157379_10628382 | 3300014968 | Bacteria | 1004 |
| 313 | Ga0157376_10037280 | 3300014969 | Bacteria | 3945 |
| 314 | Ga0157376_10144989 | 3300014969 | Bacteria | 2135 |
| 315 | Ga0157376_10213577 | 3300014969 | Bacteria | 1783 |
| 316 | Ga0163161_10278323 | 3300017792 | Bacteria | 1312 |
| 317 | Ga0213872_10042800 | 3300021361 | Bacteria | 2064 |
| 318 | Ga0213872_10057513 | 3300021361 | Bacteria | 1761 |
| 319 | Ga0213875_10004869 | 3300021388 | Bacteria | 7287 |
| 320 | Ga0213875_10093453 | 3300021388 | Bacteria | 1403 |
| 321 | Ga0213871_10030523 | 3300021441 | Bacteria | 1403 |
| 322 | Ga0213871_10031699 | 3300021441 | Bacteria | 1382 |
| 323 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 324 | Ga0209147_100509 | 3300025229 | Bacteria | 22628 |
| 325 | Ga0209258_106134 | 3300025242 | Bacteria | 1923 |
| 326 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 327 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 328 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 329 | Ga0209130_1000167 | 3300025284 | Bacteria | 95517 |
| 330 | Ga0209130_1001359 | 3300025284 | Bacteria | 16509 |
| 331 | Ga0209676_1003691 | 3300025292 | Bacteria | 9150 |
| 332 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 333 | Ga0209025_1000152 | 3300025294 | Bacteria | 171558 |
| 334 | Ga0209758_1000169 | 3300025297 | Bacteria | 149782 |
| 335 | Ga0209758_1002944 | 3300025297 | Bacteria | 16373 |
| 336 | Ga0209758_1004047 | 3300025297 | Bacteria | 12635 |
| 337 | Ga0209050_1004720 | 3300025298 | Bacteria | 9028 |
| 338 | Ga0207426_1000239 | 3300025302 | Bacteria | 123307 |
| 339 | Ga0207426_1000333 | 3300025302 | Bacteria | 88786 |
| 340 | Ga0209051_1007044 | 3300025303 | Bacteria | 6221 |
| 341 | Ga0207656_10032714 | 3300025321 | Bacteria | 2161 |
| 342 | Ga0207655_1000060 | 3300025728 | Bacteria | 260572 |
| 343 | Ga0207713_1007835 | 3300025735 | Bacteria | 6230 |
| 344 | Ga0207710_10001255 | 3300025900 | Bacteria | 12843 |
| 345 | Ga0207710_10001815 | 3300025900 | Bacteria | 10295 |
| 346 | Ga0207710_10041557 | 3300025900 | Bacteria | 2039 |
| 347 | Ga0207680_10087713 | 3300025903 | Bacteria | 1971 |
| 348 | Ga0207680_10275492 | 3300025903 | Bacteria | 1168 |
| 349 | Ga0207647_10015135 | 3300025904 | Bacteria | 5300 |
| 350 | Ga0207647_10017113 | 3300025904 | Bacteria | 4935 |
| 351 | Ga0207699_10011068 | 3300025906 | Bacteria | 4545 |
| 352 | Ga0207645_10001223 | 3300025907 | Bacteria | 21174 |
| 353 | Ga0207643_10057011 | 3300025908 | Bacteria | 2223 |
| 354 | Ga0207705_10008147 | 3300025909 | Bacteria | 7674 |
| 355 | Ga0207705_10211283 | 3300025909 | Bacteria | 1472 |
| 356 | Ga0207654_10072903 | 3300025911 | Bacteria | 2045 |
| 357 | Ga0207707_10000753 | 3300025912 | Bacteria | 31898 |
| 358 | Ga0207707_10068485 | 3300025912 | Bacteria | 3092 |
| 359 | Ga0207707_10091549 | 3300025912 | Bacteria | 2658 |
| 360 | Ga0207707_10136893 | 3300025912 | Bacteria | 2141 |
| 361 | Ga0207695_10009529 | 3300025913 | Bacteria | 12008 |
| 362 | Ga0207695_10024867 | 3300025913 | Bacteria | 6721 |
| 363 | Ga0207695_10047805 | 3300025913 | Bacteria | 4523 |
| 364 | Ga0207695_10091079 | 3300025913 | Bacteria | 3064 |
| 365 | Ga0207695_10095476 | 3300025913 | Bacteria | 2977 |
| 366 | Ga0207695_10098191 | 3300025913 | Bacteria | 2928 |
| 367 | Ga0207695_10117564 | 3300025913 | Bacteria | 2631 |
| 368 | Ga0207695_10127044 | 3300025913 | Bacteria | 2511 |
| 369 | Ga0207695_10243725 | 3300025913 | Bacteria | 1698 |
| 370 | Ga0207695_10269834 | 3300025913 | Bacteria | 1597 |
| 371 | Ga0207695_10317224 | 3300025913 | Bacteria | 1448 |
| 372 | Ga0207671_10013339 | 3300025914 | Bacteria | 6549 |
| 373 | Ga0207671_10033612 | 3300025914 | Bacteria | 3814 |
| 374 | Ga0207671_10039105 | 3300025914 | Bacteria | 3514 |
| 375 | Ga0207671_10078427 | 3300025914 | Bacteria | 2474 |
| 376 | Ga0207671_10111889 | 3300025914 | Bacteria | 2078 |
| 377 | Ga0207671_10158215 | 3300025914 | Bacteria | 1753 |
| 378 | Ga0207693_10018817 | 3300025915 | Bacteria | 5496 |
| 379 | Ga0207693_10117336 | 3300025915 | Bacteria | 2089 |
| 380 | Ga0207693_10168011 | 3300025915 | Bacteria | 1727 |
| 381 | Ga0207693_10371332 | 3300025915 | Bacteria | 1119 |
| 382 | Ga0207663_10099392 | 3300025916 | Bacteria | 1950 |
| 383 | Ga0207663_10164144 | 3300025916 | Bacteria | 1571 |
| 384 | Ga0207663_10204893 | 3300025916 | Bacteria | 1425 |
| 385 | Ga0207663_10219841 | 3300025916 | Bacteria | 1381 |
| 386 | Ga0207660_10024249 | 3300025917 | Bacteria | 4105 |
| 387 | Ga0207660_10037930 | 3300025917 | Bacteria | 3361 |
| 388 | Ga0207660_10321609 | 3300025917 | Bacteria | 1235 |
| 389 | Ga0207657_10009568 | 3300025919 | Bacteria | 9729 |
| 390 | Ga0207657_10408995 | 3300025919 | Bacteria | 1067 |
| 391 | Ga0207649_10001165 | 3300025920 | Bacteria | 15847 |
| 392 | Ga0207649_10105728 | 3300025920 | Bacteria | 1871 |
| 393 | Ga0207652_10011550 | 3300025921 | Bacteria | 7121 |
| 394 | Ga0207652_10032150 | 3300025921 | Bacteria | 4408 |
| 395 | Ga0207646_10055232 | 3300025922 | Bacteria | 3551 |
| 396 | Ga0207681_10096522 | 3300025923 | Bacteria | 2122 |
| 397 | Ga0207681_10216990 | 3300025923 | Bacteria | 1478 |
| 398 | Ga0207681_10243985 | 3300025923 | Bacteria | 1399 |
| 399 | Ga0207694_10009564 | 3300025924 | Bacteria | 7314 |
| 400 | Ga0207694_10578677 | 3300025924 | Bacteria | 944 |
| 401 | Ga0207659_10015047 | 3300025926 | Bacteria | 5003 |
| 402 | Ga0207659_10023791 | 3300025926 | Bacteria | 4094 |
| 403 | Ga0207687_10017700 | 3300025927 | Bacteria | 4696 |
| 404 | Ga0207687_10242797 | 3300025927 | Bacteria | 1428 |
| 405 | Ga0207687_10480576 | 3300025927 | Bacteria | 1034 |
| 406 | Ga0207700_10067505 | 3300025928 | Bacteria | 2738 |
| 407 | Ga0207700_10078242 | 3300025928 | Bacteria | 2572 |
| 408 | Ga0207700_10238863 | 3300025928 | Bacteria | 1548 |
| 409 | Ga0207700_10443037 | 3300025928 | Bacteria | 1144 |
| 410 | Ga0207664_10043496 | 3300025929 | Bacteria | 3513 |
| 411 | Ga0207664_10197896 | 3300025929 | Bacteria | 1733 |
| 412 | Ga0207644_10001224 | 3300025931 | Bacteria | 16517 |
| 413 | Ga0207644_10008565 | 3300025931 | Bacteria | 6691 |
| 414 | Ga0207644_10020759 | 3300025931 | Bacteria | 4468 |
| 415 | Ga0207706_10003281 | 3300025933 | Bacteria | 15479 |
| 416 | Ga0207706_10004326 | 3300025933 | Bacteria | 13333 |
| 417 | Ga0207669_10062312 | 3300025937 | Bacteria | 2296 |
| 418 | Ga0207704_10016231 | 3300025938 | Bacteria | 3822 |
| 419 | Ga0207704_10057443 | 3300025938 | Bacteria | 2390 |
| 420 | Ga0207665_10077250 | 3300025939 | Bacteria | 2285 |
| 421 | Ga0207665_10182214 | 3300025939 | Bacteria | 1522 |
| 422 | Ga0207691_10001448 | 3300025940 | Bacteria | 23639 |
| 423 | Ga0207691_10018310 | 3300025940 | Bacteria | 6635 |
| 424 | Ga0207691_10290208 | 3300025940 | Bacteria | 1407 |
| 425 | Ga0207711_10077329 | 3300025941 | Bacteria | 2900 |
| 426 | Ga0207711_10106629 | 3300025941 | Bacteria | 2486 |
| 427 | Ga0207711_10191619 | 3300025941 | Bacteria | 1863 |
| 428 | Ga0207689_10145911 | 3300025942 | Bacteria | 1950 |
| 429 | Ga0207661_10110675 | 3300025944 | Bacteria | 2322 |
| 430 | Ga0207667_10004634 | 3300025949 | Bacteria | 16866 |
| 431 | Ga0207667_10006777 | 3300025949 | Bacteria | 13836 |
| 432 | Ga0207667_10179116 | 3300025949 | Bacteria | 2177 |
| 433 | Ga0207667_10291902 | 3300025949 | Bacteria | 1666 |
| 434 | Ga0207651_10154320 | 3300025960 | Bacteria | 1792 |
| 435 | Ga0207712_10059202 | 3300025961 | Bacteria | 2710 |
| 436 | Ga0207712_10464629 | 3300025961 | Bacteria | 1076 |
| 437 | Ga0207712_10736621 | 3300025961 | Bacteria | 863 |
| 438 | Ga0207668_10023557 | 3300025972 | Bacteria | 3960 |
| 439 | Ga0207640_10053272 | 3300025981 | Bacteria | 2640 |
| 440 | Ga0207640_10523179 | 3300025981 | Bacteria | 992 |
| 441 | Ga0207658_10013905 | 3300025986 | Bacteria | 5507 |
| 442 | Ga0207658_10017695 | 3300025986 | Bacteria | 4914 |
| 443 | Ga0207658_10046985 | 3300025986 | Bacteria | 3156 |
| 444 | Ga0207658_10349464 | 3300025986 | Bacteria | 1287 |
| 445 | Ga0207677_10336233 | 3300026023 | Bacteria | 1260 |
| 446 | Ga0207703_10000684 | 3300026035 | Bacteria | 33643 |
| 447 | Ga0207703_10028593 | 3300026035 | Bacteria | 4395 |
| 448 | Ga0207703_10073668 | 3300026035 | Bacteria | 2825 |
| 449 | Ga0207639_10004843 | 3300026041 | Bacteria | 9077 |
| 450 | Ga0207639_10006241 | 3300026041 | Bacteria | 8098 |
| 451 | Ga0207639_10182852 | 3300026041 | Bacteria | 1784 |
| 452 | Ga0207678_10032138 | 3300026067 | Bacteria | 4575 |
| 453 | Ga0207678_10033497 | 3300026067 | Bacteria | 4474 |
| 454 | Ga0207678_10085075 | 3300026067 | Bacteria | 2704 |
| 455 | Ga0207678_10124850 | 3300026067 | Bacteria | 2196 |
| 456 | Ga0207708_10026815 | 3300026075 | Bacteria | 4362 |
| 457 | Ga0207702_10070413 | 3300026078 | Bacteria | 3008 |
| 458 | Ga0207702_10204640 | 3300026078 | Bacteria | 1832 |
| 459 | Ga0207702_10647059 | 3300026078 | Bacteria | 1039 |
| 460 | Ga0207641_10000218 | 3300026088 | Bacteria | 74549 |
| 461 | Ga0207641_10000313 | 3300026088 | Bacteria | 60517 |
| 462 | Ga0207641_10005318 | 3300026088 | Bacteria | 10992 |
| 463 | Ga0207641_10009065 | 3300026088 | Bacteria | 8218 |
| 464 | Ga0207641_10031125 | 3300026088 | Bacteria | 4424 |
| 465 | Ga0207641_10282153 | 3300026088 | Bacteria | 1563 |
| 466 | Ga0207641_10439271 | 3300026088 | Bacteria | 1259 |
| 467 | Ga0207641_10508518 | 3300026088 | Bacteria | 1171 |
| 468 | Ga0207641_10651959 | 3300026088 | Bacteria | 1034 |
| 469 | Ga0207648_10003080 | 3300026089 | Bacteria | 17612 |
| 470 | Ga0207648_10004235 | 3300026089 | Bacteria | 14825 |
| 471 | Ga0207648_10187355 | 3300026089 | Bacteria | 1833 |
| 472 | Ga0207648_10376827 | 3300026089 | Bacteria | 1283 |
| 473 | Ga0207676_10104929 | 3300026095 | Bacteria | 2352 |
| 474 | Ga0207674_10047539 | 3300026116 | Bacteria | 4397 |
| 475 | Ga0207674_10195076 | 3300026116 | Bacteria | 1975 |
| 476 | Ga0207674_10344051 | 3300026116 | Bacteria | 1442 |
| 477 | Ga0207674_10442308 | 3300026116 | Bacteria | 1256 |
| 478 | Ga0207674_10456467 | 3300026116 | Bacteria | 1235 |
| 479 | Ga0207675_100006460 | 3300026118 | Bacteria | 11099 |
| 480 | Ga0207675_100013913 | 3300026118 | Bacteria | 7501 |
| 481 | Ga0207675_100575056 | 3300026118 | Bacteria | 1128 |
| 482 | Ga0207698_10112794 | 3300026142 | Bacteria | 2283 |
| 483 | Ga0209371_1000215 | 3300027312 | Bacteria | 78569 |
| 484 | Ga0209371_1001291 | 3300027312 | Bacteria | 17602 |
| 485 | Ga0209179_1000048 | 3300027512 | Bacteria | 23370 |
| 486 | Ga0209968_1024913 | 3300027526 | Bacteria | 983 |
| 487 | Ga0209982_1000774 | 3300027552 | Bacteria | 4117 |
| 488 | Ga0209970_1021752 | 3300027614 | Bacteria | 1087 |
| 489 | Ga0209970_1032790 | 3300027614 | Bacteria | 907 |
| 490 | Ga0210002_1000664 | 3300027617 | Bacteria | 4657 |
| 491 | Ga0210002_1002126 | 3300027617 | Bacteria | 2862 |
| 492 | Ga0209983_1000414 | 3300027665 | Bacteria | 9197 |
| 493 | Ga0209983_1007773 | 3300027665 | Bacteria | 2195 |
| 494 | Ga0209983_1017107 | 3300027665 | Bacteria | 1499 |
| 495 | Ga0209971_1000988 | 3300027682 | Bacteria | 7314 |
| 496 | Ga0209971_1022112 | 3300027682 | Bacteria | 1514 |
| 497 | Ga0209998_10002182 | 3300027717 | Bacteria | 4544 |
| 498 | Ga0209998_10002926 | 3300027717 | Bacteria | 3819 |
| 499 | Ga0209974_10037113 | 3300027876 | Bacteria | 1618 |
| 500 | Ga0207428_10025978 | 3300027907 | Bacteria | 4893 |
| 501 | Ga0207428_10028273 | 3300027907 | Bacteria | 4660 |
| 502 | Ga0207428_10065196 | 3300027907 | Bacteria | 2874 |
| 503 | Ga0207428_10076142 | 3300027907 | Bacteria | 2628 |
| 504 | Ga0207428_10254496 | 3300027907 | Bacteria | 1309 |
| 505 | Ga0268266_10001602 | 3300028379 | Bacteria | 26388 |
| 506 | Ga0268266_10003289 | 3300028379 | Bacteria | 16241 |
| 507 | Ga0268266_10024426 | 3300028379 | Bacteria | 5140 |
| 508 | Ga0268266_10041031 | 3300028379 | Bacteria | 3946 |
| 509 | Ga0268266_10069361 | 3300028379 | Bacteria | 3054 |
| 510 | Ga0268266_10081141 | 3300028379 | Bacteria | 2827 |
| 511 | Ga0268266_10112936 | 3300028379 | Bacteria | 2409 |
| 512 | Ga0268266_10248700 | 3300028379 | Bacteria | 1644 |
| 513 | Ga0268265_10004447 | 3300028380 | Bacteria | 9730 |
| 514 | Ga0268265_10066844 | 3300028380 | Bacteria | 2780 |
| 515 | Ga0268265_10099057 | 3300028380 | Bacteria | 2349 |
| 516 | Ga0268265_10476063 | 3300028380 | Bacteria | 1172 |
| 517 | Ga0268265_10544145 | 3300028380 | Bacteria | 1101 |
| 518 | Ga0268264_10000047 | 3300028381 | Bacteria | 349944 |
| 519 | Ga0268264_10000140 | 3300028381 | Bacteria | 171592 |
| 520 | Ga0268264_10004448 | 3300028381 | Bacteria | 11959 |
| 521 | Ga0268264_10012089 | 3300028381 | Bacteria | 7107 |
| 522 | Ga0268264_10024711 | 3300028381 | Bacteria | 4907 |
| 523 | Ga0268264_10044934 | 3300028381 | Bacteria | 3666 |
| 524 | Ga0268264_10089829 | 3300028381 | Bacteria | 2646 |
| 525 | Ga0307515_10018263 | 3300028794 | Bacteria | 12715 |
| 526 | Ga0265338_10091735 | 3300028800 | Bacteria | 2508 |
| 527 | Ga0265338_10270660 | 3300028800 | Bacteria | 1245 |
| 528 | Ga0268256_1000172 | 3300030500 | Bacteria | 78620 |
| 529 | Ga0268256_1001102 | 3300030500 | Bacteria | 17602 |
| 530 | Ga0307511_10028868 | 3300030521 | Bacteria | 5023 |
| 531 | Ga0265325_10028726 | 3300031241 | Bacteria | 2994 |
| 532 | Ga0265325_10033917 | 3300031241 | Bacteria | 2720 |
| 533 | Ga0265340_10017304 | 3300031247 | Bacteria | 3727 |
| 534 | Ga0265340_10068994 | 3300031247 | Bacteria | 1678 |
| 535 | Ga0265340_10097134 | 3300031247 | Bacteria | 1372 |
| 536 | Ga0265340_10119807 | 3300031247 | Bacteria | 1211 |
| 537 | Ga0265339_10123897 | 3300031249 | Bacteria | 1326 |
| 538 | Ga0265339_10126512 | 3300031249 | Bacteria | 1310 |
| 539 | Ga0265331_10027782 | 3300031250 | Bacteria | 2833 |
| 540 | Ga0265331_10108780 | 3300031250 | Bacteria | 1272 |
| 541 | Ga0307513_10049441 | 3300031456 | Bacteria | 4555 |
| 542 | Ga0307509_10001396 | 3300031507 | Bacteria | 40975 |
| 543 | Ga0307509_10002372 | 3300031507 | Bacteria | 30641 |
| 544 | Ga0307509_10148841 | 3300031507 | Bacteria | 2261 |
| 545 | Ga0307408_100016261 | 3300031548 | Bacteria | 4963 |
| 546 | Ga0307408_100017852 | 3300031548 | Bacteria | 4754 |
| 547 | Ga0307408_100022764 | 3300031548 | Bacteria | 4262 |
| 548 | Ga0307408_100101573 | 3300031548 | Bacteria | 2192 |
| 549 | Ga0307408_100445606 | 3300031548 | Bacteria | 1122 |
| 550 | Ga0265313_10027030 | 3300031595 | Bacteria | 3010 |
| 551 | Ga0265313_10033559 | 3300031595 | Bacteria | 2606 |
| 552 | Ga0265313_10037843 | 3300031595 | Bacteria | 2408 |
| 553 | Ga0307508_10211816 | 3300031616 | Bacteria | 1538 |
| 554 | Ga0307508_10227050 | 3300031616 | Bacteria | 1466 |
| 555 | Ga0307514_10145144 | 3300031649 | Bacteria | 1605 |
| 556 | Ga0316575_10017248 | 3300031665 | Bacteria | 2741 |
| 557 | Ga0316575_10027915 | 3300031665 | Bacteria | 2197 |
| 558 | Ga0316579_10022252 | 3300031691 | Bacteria | 2833 |
| 559 | Ga0265314_10093275 | 3300031711 | Bacteria | 1955 |
| 560 | Ga0265342_10035713 | 3300031712 | Bacteria | 3040 |
| 561 | Ga0265342_10077743 | 3300031712 | Bacteria | 1921 |
| 562 | Ga0316576_10005161 | 3300031727 | Bacteria | 7934 |
| 563 | Ga0316576_10017920 | 3300031727 | Bacteria | 4824 |
| 564 | Ga0316576_10117867 | 3300031727 | Bacteria | 1992 |
| 565 | Ga0316576_10205853 | 3300031727 | Bacteria | 1482 |
| 566 | Ga0316576_10362421 | 3300031727 | Bacteria | 1077 |
| 567 | Ga0316576_10399452 | 3300031727 | Bacteria | 1018 |
| 568 | Ga0316578_10005082 | 3300031728 | Bacteria | 6329 |
| 569 | Ga0316578_10016838 | 3300031728 | Bacteria | 3966 |
| 570 | Ga0316578_10018257 | 3300031728 | Bacteria | 3838 |
| 571 | Ga0316578_10041771 | 3300031728 | Bacteria | 2657 |
| 572 | Ga0316578_10042084 | 3300031728 | Bacteria | 2647 |
| 573 | Ga0316578_10099244 | 3300031728 | Bacteria | 1745 |
| 574 | Ga0316578_10249296 | 3300031728 | Bacteria | 1065 |
| 575 | Ga0307405_10261658 | 3300031731 | Bacteria | 1292 |
| 576 | Ga0307405_10449484 | 3300031731 | Bacteria | 1021 |
| 577 | Ga0316577_10009416 | 3300031733 | Bacteria | 5254 |
| 578 | Ga0316577_10042335 | 3300031733 | Bacteria | 2548 |
| 579 | Ga0316577_10083642 | 3300031733 | Bacteria | 1785 |
| 580 | Ga0307413_10115670 | 3300031824 | Bacteria | 1805 |
| 581 | Ga0307410_10037833 | 3300031852 | Bacteria | 3156 |
| 582 | Ga0307410_10116082 | 3300031852 | Bacteria | 1944 |
| 583 | Ga0307406_10147578 | 3300031901 | Bacteria | 1674 |
| 584 | Ga0307406_10191032 | 3300031901 | Bacteria | 1499 |
| 585 | Ga0307407_10091954 | 3300031903 | Bacteria | 1862 |
| 586 | Ga0307407_10134976 | 3300031903 | Bacteria | 1584 |
| 587 | Ga0307412_10000918 | 3300031911 | Bacteria | 16854 |
| 588 | Ga0307412_10259049 | 3300031911 | Bacteria | 1355 |
| 589 | Ga0307409_100213315 | 3300031995 | Bacteria | 1737 |
| 590 | Ga0307409_100291150 | 3300031995 | Bacteria | 1514 |
| 591 | Ga0307409_100334752 | 3300031995 | Bacteria | 1422 |
| 592 | Ga0307416_100003094 | 3300032002 | Bacteria | 9732 |
| 593 | Ga0307416_100042886 | 3300032002 | Bacteria | 3537 |
| 594 | Ga0307416_100052766 | 3300032002 | Bacteria | 3257 |
| 595 | Ga0307416_100138453 | 3300032002 | Bacteria | 2207 |
| 596 | Ga0307414_10136025 | 3300032004 | Bacteria | 1916 |
| 597 | Ga0307414_10182422 | 3300032004 | Bacteria | 1689 |
| 598 | Ga0307411_10002953 | 3300032005 | Bacteria | 7717 |
| 599 | Ga0307411_10438790 | 3300032005 | Bacteria | 1089 |
| 600 | Ga0307415_100001180 | 3300032126 | Bacteria | 12227 |
| 601 | Ga0307415_100001775 | 3300032126 | Bacteria | 10549 |
| 602 | Ga0316583_10042320 | 3300032133 | Bacteria | 1611 |
| 603 | Ga0316580_10012084 | 3300032139 | Bacteria | 2626 |
| 604 | Ga0316580_10018645 | 3300032139 | Bacteria | 2135 |
| 605 | Ga0316593_10026050 | 3300032168 | Bacteria | 1867 |
| 606 | Ga0307510_10000009 | 3300033180 | Bacteria | 409702 |
| 607 | Ga0316592_1031644 | 3300033524 | Bacteria | 1153 |
| 608 | Ga0316588_1019297 | 3300033528 | Bacteria | 1534 |
| 609 | Ga0373923_0026198 | 3300035111 | Bacteria | 2318 |
| 610 | Ga0373923_0113682 | 3300035111 | Bacteria | 1204 |
| 611 | Ga0373936_0002315 | 3300035113 | Bacteria | 7133 |
| 612 | Ga0373953_0003712 | 3300035117 | Bacteria | 4796 |
| 613 | Ga0373956_0042636 | 3300035119 | Bacteria | 2018 |
| 614 | Ga0373943_0042003 | 3300035170 | Bacteria | 2214 |
| 615 | Ga0373955_0011701 | 3300035172 | Bacteria | 4193 |
| 616 | Ga0316574_0002663 | 3300035398 | Bacteria | 9017 |
| 617 | Ga0316574_0007652 | 3300035398 | Bacteria | 5935 |
| 618 | Ga0316574_0014132 | 3300035398 | Bacteria | 4605 |
| 619 | Ga0316574_0025571 | 3300035398 | Bacteria | 3544 |
| 620 | Ga0316574_0028433 | 3300035398 | Bacteria | 3372 |
| 621 | Ga0316574_0033917 | 3300035398 | Bacteria | 3109 |
| 622 | Ga0316574_0037650 | 3300035398 | Bacteria | 2967 |
| 623 | Ga0316574_0052334 | 3300035398 | Bacteria | 2546 |
| 624 | Ga0316574_0052849 | 3300035398 | Bacteria | 2535 |
| 625 | Ga0316574_0116042 | 3300035398 | Bacteria | 1717 |
| 626 | Ga0316574_0134129 | 3300035398 | Bacteria | 1594 |
| 627 | Ga0316574_0293659 | 3300035398 | Bacteria | 1034 |
| 628 | Ga0373924_0129968 | 3300035410 | Bacteria | 1096 |
| 629 | Ga0373931_0261437 | 3300035691 | Bacteria | 1056 |
| 630 | Ga0373935_0026844 | 3300035692 | Bacteria | 3558 |
| 631 | Ga0373927_0009759 | 3300035695 | Bacteria | 6436 |
| 632 | Ga0373933_0003783 | 3300035724 | Bacteria | 8361 |
| 633 | Ga0373933_0005208 | 3300035724 | Bacteria | 7095 |
| 634 | Ga0373933_0012987 | 3300035724 | Bacteria | 4607 |
| 635 | Ga0373933_0103066 | 3300035724 | Bacteria | 1772 |
| 636 | Ga0373947_0060979 | 3300035725 | Bacteria | 2291 |
| 637 | Ga0373937_0001734 | 3300036401 | Bacteria | 18336 |
| 638 | Ga0373937_0012692 | 3300036401 | Bacteria | 7413 |
| 639 | Ga0373937_0018708 | 3300036401 | Bacteria | 6190 |
| 640 | Ga0373937_0031120 | 3300036401 | Bacteria | 4832 |
| 641 | Ga0373937_0034493 | 3300036401 | Bacteria | 4603 |
| 642 | Ga0316582_0012393 | 3300036647 | Bacteria | 4757 |
| 643 | Ga0316582_0055960 | 3300036647 | Bacteria | 2515 |
| 644 | Ga0316584_0004710 | 3300036712 | Bacteria | 9049 |
| 645 | Ga0316584_0015022 | 3300036712 | Bacteria | 5531 |
| 646 | Ga0316584_0032057 | 3300036712 | Bacteria | 3887 |
| 647 | Ga0316584_0044014 | 3300036712 | Bacteria | 3329 |
| 648 | Ga0373925_0090259 | 3300037068 | Bacteria | 2342 |
| 649 | Ga0373925_0493190 | 3300037068 | Bacteria | 1005 |
| 650 | Ga0395898_0020339 | 3300037466 | Bacteria | 6740 |
| 651 | Ga0316581_0013589 | 3300037588 | Bacteria | 2310 |
| 652 | Ga0436364_0509785 | 3300037853 | Bacteria | 8537 |
| 653 | Ga0436364_0676183 | 3300037853 | Bacteria | 1581 |
| 654 | Ga0436364_0745335 | 3300037853 | Bacteria | 1994 |
| 655 | Ga0436364_0924171 | 3300037853 | Bacteria | 5557 |
| 656 | Ga0436365_0404170 | 3300039437 | Bacteria | 1625 |
| 657 | Ga0436365_1466348 | 3300039437 | Bacteria | 3634 |
| 658 | Ga0436360_0392412 | 3300039438 | Bacteria | 4505 |
| 659 | Ga0436360_0567944 | 3300039438 | Bacteria | 1269 |
| 660 | Ga0436360_0638300 | 3300039438 | Bacteria | 1415 |
| 661 | Ga0436360_0708385 | 3300039438 | Bacteria | 1153 |
| 662 | Ga0436360_1050799 | 3300039438 | Bacteria | 1596 |
| 663 | Ga0436360_1274780 | 3300039438 | Bacteria | 4531 |
| 664 | Ga0436360_1301488 | 3300039438 | Bacteria | 1574 |
| 665 | Ga0436361_0262581 | 3300039447 | Bacteria | 4707 |
| 666 | Ga0436361_0328064 | 3300039447 | Bacteria | 5863 |
| 667 | Ga0436361_0896160 | 3300039447 | Bacteria | 4446 |
| 668 | Ga0436361_1206202 | 3300039447 | Bacteria | 1992 |
| 669 | Ga0436363_1126933 | 3300039450 | Bacteria | 1428 |
| 670 | Ga0436363_1135590 | 3300039450 | Bacteria | 989 |
| 671 | Ga0436362_0776327 | 3300039453 | Bacteria | 1612 |
| 672 | Ga0439438_061253 | 3300041405 | Bacteria | 942 |
| 673 | Ga0451795_1220757 | 3300041456 | Bacteria | 1035 |
| 674 | Ga0451833_1471124 | 3300041491 | Bacteria | 2158 |
| 675 | Ga0451855_1730903 | 3300041511 | Bacteria | 1097 |
| 676 | Ga0451853_0564721 | 3300041512 | Bacteria | 1952 |
| 677 | Ga0439431_0067067 | 3300041997 | Bacteria | 952 |
| 678 | Ga0439443_004650 | 3300042003 | Bacteria | 1799 |
| 679 | Ga0439456_025965 | 3300042013 | Bacteria | 1245 |
| 680 | Ga0450923_004500 | 3300042125 | Bacteria | 2191 |
| 681 | Ga0450923_006323 | 3300042125 | Bacteria | 1958 |
| 682 | Ga0450923_008008 | 3300042125 | Bacteria | 1806 |
| 683 | Ga0450894_001909 | 3300042131 | Bacteria | 2883 |
| 684 | Ga0450894_002729 | 3300042131 | Bacteria | 2338 |
| 685 | Ga0450895_000553 | 3300042132 | Bacteria | 2208 |
| 686 | Ga0450896_000078 | 3300042133 | Bacteria | 6552 |
| 687 | Ga0450896_007483 | 3300042133 | Bacteria | 1506 |
| 688 | Ga0450896_009427 | 3300042133 | Bacteria | 1359 |
| 689 | Ga0450899_004788 | 3300042135 | Bacteria | 1450 |
| 690 | Ga0450907_003204 | 3300042146 | Bacteria | 2954 |
| 691 | Ga0450910_004879 | 3300042147 | Bacteria | 1821 |
| 692 | Ga0439446_0000678 | 3300042156 | Bacteria | 7100 |
| 693 | Ga0439446_0004444 | 3300042156 | Bacteria | 3556 |
| 694 | Ga0439446_0016746 | 3300042156 | Bacteria | 2043 |
| 695 | Ga0450908_001318 | 3300042184 | Bacteria | 4814 |
| 696 | Ga0450908_001577 | 3300042184 | Bacteria | 4429 |
| 697 | Ga0450908_007495 | 3300042184 | Bacteria | 2057 |
| 698 | Ga0439434_0003968 | 3300042435 | Bacteria | 4318 |
| 699 | Ga0439434_0004234 | 3300042435 | Bacteria | 4192 |
| 700 | Ga0439434_0012069 | 3300042435 | Bacteria | 2555 |
| 701 | Ga0439434_0014278 | 3300042435 | Bacteria | 2362 |
| 702 | Ga0439434_0017233 | 3300042435 | Bacteria | 2161 |
| 703 | Ga0439435_0041453 | 3300042436 | Bacteria | 1290 |
| 704 | Ga0439444_0002496 | 3300042437 | Bacteria | 2519 |
| 705 | Ga0439444_0006939 | 3300042437 | Bacteria | 1725 |
| 706 | Ga0439464_0048652 | 3300042439 | Unclassified | 1222 |
| 707 | Ga0439460_0055323 | 3300042461 | Bacteria | 1199 |
| 708 | Ga0450918_010721 | 3300042531 | Bacteria | 1600 |
| 709 | Ga0466969_0002997 | 3300044656 | Bacteria | 8993 |
| 710 | Ga0466969_0003345 | 3300044656 | Bacteria | 8536 |
| 711 | Ga0466969_0019932 | 3300044656 | Bacteria | 3477 |
| 712 | Ga0466969_0036636 | 3300044656 | Bacteria | 2477 |
| 713 | Ga0466966_0004455 | 3300044684 | Bacteria | 9235 |
| 714 | Ga0466966_0064912 | 3300044684 | Bacteria | 2297 |
| 715 | Ga0466966_0082288 | 3300044684 | Bacteria | 2003 |
| 716 | Ga0466961_0001050 | 3300044693 | Bacteria | 17009 |
| 717 | Ga0466963_0219371 | 3300044694 | Bacteria | 1332 |
| 718 | Ga0466964_0025831 | 3300044706 | Bacteria | 2296 |
| 719 | Ga0466971_0009912 | 3300044719 | Bacteria | 4161 |
| 720 | Ga0466968_0174893 | 3300044735 | Bacteria | 996 |
| 721 | Ga0466970_0018159 | 3300044765 | Bacteria | 3639 |
| 722 | Ga0466970_0042029 | 3300044765 | Bacteria | 2430 |
| 723 | Ga0466957_0004657 | 3300044842 | Bacteria | 7664 |
| 724 | Ga0466959_0004232 | 3300045049 | Bacteria | 9573 |
| 725 | Ga0466959_0006382 | 3300045049 | Bacteria | 8164 |
| 726 | Ga0466959_0051682 | 3300045049 | Bacteria | 3012 |
| 727 | Ga0466959_0066819 | 3300045049 | Bacteria | 2607 |
| 728 | Ga0451576_0017273 | 3300045051 | Bacteria | 7939 |
| 729 | Ga0451576_0095535 | 3300045051 | Bacteria | 3091 |
| 730 | Ga0495592_0070764 | 3300046454 | Bacteria | 2540 |
| 731 | Ga0495592_0082570 | 3300046454 | Bacteria | 2322 |
| 732 | Ga0495603_0001283 | 3300046455 | Bacteria | 14634 |
| 733 | Ga0495629_0000490 | 3300046459 | Bacteria | 33122 |
| 734 | Ga0495629_0151636 | 3300046459 | Bacteria | 1611 |
| 735 | Ga0495638_0010078 | 3300046460 | Bacteria | 6587 |
| 736 | Ga0495638_0023670 | 3300046460 | Bacteria | 4013 |
| 737 | Ga0495638_0135754 | 3300046460 | Bacteria | 1441 |
| 738 | Ga0495641_0012212 | 3300046461 | Bacteria | 4821 |
| 739 | Ga0495651_0031101 | 3300046462 | Bacteria | 4163 |
| 740 | Ga0495580_0008705 | 3300046472 | Bacteria | 8047 |
| 741 | Ga0495580_0010876 | 3300046472 | Bacteria | 7064 |
| 742 | Ga0495582_0003939 | 3300046473 | Bacteria | 8341 |
| 743 | Ga0495582_0363647 | 3300046473 | Bacteria | 833 |
| 744 | Ga0495639_0005800 | 3300046475 | Bacteria | 5314 |
| 745 | Ga0495664_0000789 | 3300046477 | Bacteria | 16177 |
| 746 | Ga0495594_0004890 | 3300046499 | Bacteria | 6897 |
| 747 | Ga0495606_0090274 | 3300046507 | Bacteria | 1886 |
| 748 | Ga0495608_0013950 | 3300046511 | Bacteria | 5577 |
| 749 | Ga0495610_0006077 | 3300046512 | Bacteria | 8428 |
| 750 | Ga0495610_0065673 | 3300046512 | Bacteria | 1711 |
| 751 | Ga0495628_0133199 | 3300046516 | Bacteria | 1900 |
| 752 | Ga0495628_0138051 | 3300046516 | Bacteria | 1862 |
| 753 | Ga0495630_0149032 | 3300046517 | Unclassified | 1780 |
| 754 | Ga0495632_0060396 | 3300046519 | Bacteria | 1842 |
| 755 | Ga0495666_0020760 | 3300046526 | Bacteria | 3252 |
| 756 | Ga0495665_0051259 | 3300046531 | Bacteria | 2186 |
| 757 | Ga0495640_0069265 | 3300046533 | Bacteria | 2373 |
| 758 | Ga0495586_0012842 | 3300046535 | Bacteria | 4440 |
| 759 | Ga0495587_0020619 | 3300046536 | Bacteria | 4065 |
| 760 | Ga0495645_0185966 | 3300046543 | Bacteria | 1419 |
| 761 | Ga0495622_0004166 | 3300046557 | Bacteria | 6746 |
| 762 | Ga0495622_0084306 | 3300046557 | Bacteria | 1462 |
| 763 | Ga0495667_0013353 | 3300046559 | Bacteria | 5559 |
| 764 | Ga0495667_0042585 | 3300046559 | Bacteria | 3011 |
| 765 | Ga0495634_0006857 | 3300046642 | Bacteria | 8617 |
| 766 | Ga0495625_0016231 | 3300046660 | Bacteria | 5865 |
| 767 | Ga0495635_0019280 | 3300046663 | Bacteria | 4758 |
| 768 | Ga0495635_0197899 | 3300046663 | Bacteria | 1364 |
| 769 | Ga0495635_0268862 | 3300046663 | Bacteria | 1147 |
| 770 | Ga0495588_0015794 | 3300046674 | Bacteria | 3640 |
| 771 | Ga0495657_0031496 | 3300046675 | Bacteria | 3707 |
| 772 | Ga0495599_0011784 | 3300046678 | Bacteria | 5375 |
| 773 | Ga0495623_0025535 | 3300046679 | Bacteria | 3806 |
| 774 | Ga0495646_0006351 | 3300046680 | Bacteria | 7495 |
| 775 | Ga0495647_0009478 | 3300046681 | Bacteria | 3300 |
| 776 | Ga0495658_0041913 | 3300046683 | Bacteria | 2553 |
| 777 | Ga0495613_0008530 | 3300046689 | Bacteria | 7605 |
| 778 | Ga0495649_0152153 | 3300046694 | Bacteria | 1215 |
| 779 | Ga0495600_0055760 | 3300046809 | Bacteria | 2581 |
| 780 | Ga0495581_0000838 | 3300047315 | Bacteria | 16367 |
| 781 | Ga0495581_0334930 | 3300047315 | Bacteria | 883 |
| 782 | Ga0495604_0043627 | 3300047317 | Bacteria | 3510 |
| 783 | Ga0495604_0047733 | 3300047317 | Bacteria | 3334 |
| 784 | Ga0495674_0045561 | 3300047319 | Bacteria | 3894 |
| 785 | Ga0495676_0040521 | 3300047321 | Bacteria | 3843 |
| 786 | Ga0495680_0065698 | 3300047322 | Bacteria | 2778 |
| 787 | Ga0495680_0154836 | 3300047322 | Bacteria | 1668 |
| 788 | Ga0495687_033524 | 3300047443 | Bacteria | 2328 |
| 789 | Ga0495687_056745 | 3300047443 | Bacteria | 1632 |
| 790 | Ga0495675_0016707 | 3300047444 | Bacteria | 4641 |
| 791 | Ga0495684_0032940 | 3300047471 | Bacteria | 3979 |
| 792 | Ga0495684_0123713 | 3300047471 | Bacteria | 1947 |
| 793 | Ga0495593_0008079 | 3300047673 | Bacteria | 6121 |
| 794 | Ga0495602_0000230 | 3300048088 | Bacteria | 52313 |
| 795 | Ga0495602_0023230 | 3300048088 | Bacteria | 6048 |
| 796 | Ga0496100_0063978 | 3300048903 | Bacteria | 2433 |
| 797 | Ga0496100_0209269 | 3300048903 | Bacteria | 1426 |
| 798 | Ga0496100_0317085 | 3300048903 | Bacteria | 1170 |
| 799 | Ga0496101_0112452 | 3300048904 | Bacteria | 2051 |
| 800 | Ga0496101_0196100 | 3300048904 | Bacteria | 1560 |
| 801 | Ga0496102_0006952 | 3300048905 | Bacteria | 9655 |
| 802 | Ga0496102_0103364 | 3300048905 | Bacteria | 2649 |
| 803 | Ga0496102_0355179 | 3300048905 | Bacteria | 1380 |
| 804 | Ga0496102_0504506 | 3300048905 | Bacteria | 1132 |
| 805 | Ga0496102_0508558 | 3300048905 | Bacteria | 1127 |
| 806 | Ga0496103_0064031 | 3300048906 | Bacteria | 2291 |
| 807 | Ga0496103_0103374 | 3300048906 | Bacteria | 1805 |
| 808 | Ga0496104_0116842 | 3300048907 | Bacteria | 2560 |
| 809 | Ga0496105_0041734 | 3300048908 | Bacteria | 3781 |
| 810 | Ga0496105_0180782 | 3300048908 | Bacteria | 1727 |
| 811 | Ga0496106_0044529 | 3300048909 | Bacteria | 3331 |
| 812 | Ga0496106_0322834 | 3300048909 | Bacteria | 1239 |
| 813 | Ga0496107_0040341 | 3300048910 | Bacteria | 3351 |
| 814 | Ga0496108_0115259 | 3300048911 | Bacteria | 2301 |
| 815 | Ga0496109_0011659 | 3300048912 | Bacteria | 7559 |
| 816 | Ga0496109_0326771 | 3300048912 | Bacteria | 1448 |
| 817 | Ga0496109_0542097 | 3300048912 | Bacteria | 1098 |
| 818 | Ga0496110_0234677 | 3300048913 | Bacteria | 1669 |
| 819 | Ga0496110_0295157 | 3300048913 | Bacteria | 1476 |
| 820 | Ga0496111_0251369 | 3300048914 | Bacteria | 1312 |
| 821 | Ga0496112_0011589 | 3300048915 | Bacteria | 8060 |
| 822 | Ga0496112_0078126 | 3300048915 | Bacteria | 3273 |
| 823 | Ga0496113_0016702 | 3300048916 | Bacteria | 5075 |
| 824 | Ga0496113_0070019 | 3300048916 | Bacteria | 2665 |
| 825 | Ga0496116_0005644 | 3300048919 | Bacteria | 11518 |
| 826 | Ga0496116_0010899 | 3300048919 | Bacteria | 7574 |
| 827 | Ga0496116_0058508 | 3300048919 | Bacteria | 2512 |
| 828 | Ga0496116_0060114 | 3300048919 | Bacteria | 2466 |
| 829 | Ga0496116_0069692 | 3300048919 | Bacteria | 2235 |
| 830 | Ga0496117_0000024 | 3300048920 | Bacteria | 418750 |
| 831 | Ga0496117_0000151 | 3300048920 | Bacteria | 148304 |
| 832 | Ga0496117_0009752 | 3300048920 | Bacteria | 8860 |
| 833 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 834 | Ga0496118_0000016 | 3300048921 | Bacteria | 549586 |
| 835 | Ga0496118_0012449 | 3300048921 | Bacteria | 8164 |
| 836 | Ga0496118_0058135 | 3300048921 | Bacteria | 2892 |
| 837 | Ga0496118_0075382 | 3300048921 | Bacteria | 2406 |
| 838 | Ga0496119_0002124 | 3300048922 | Bacteria | 22306 |
| 839 | Ga0496119_0002302 | 3300048922 | Bacteria | 21116 |
| 840 | Ga0496119_0006967 | 3300048922 | Bacteria | 10310 |
| 841 | Ga0496119_0033719 | 3300048922 | Bacteria | 3388 |
| 842 | Ga0496119_0042107 | 3300048922 | Bacteria | 2899 |
| 843 | Ga0496119_0085815 | 3300048922 | Bacteria | 1801 |
| 844 | Ga0496120_0004180 | 3300048923 | Bacteria | 12366 |
| 845 | Ga0496120_0024323 | 3300048923 | Bacteria | 3778 |
| 846 | Ga0496121_0001243 | 3300048924 | Bacteria | 44207 |
| 847 | Ga0496121_0003216 | 3300048924 | Bacteria | 23498 |
| 848 | Ga0496121_0004468 | 3300048924 | Bacteria | 18789 |
| 849 | Ga0496121_0012476 | 3300048924 | Bacteria | 9256 |
| 850 | Ga0496121_0048466 | 3300048924 | Bacteria | 3614 |
| 851 | Ga0496121_0178453 | 3300048924 | Bacteria | 1535 |
| 852 | Ga0496121_0212988 | 3300048924 | Bacteria | 1367 |
| 853 | Ga0496122_0001381 | 3300048925 | Bacteria | 39387 |
| 854 | Ga0496122_0026283 | 3300048925 | Bacteria | 5023 |
| 855 | Ga0496122_0085209 | 3300048925 | Bacteria | 2181 |
| 856 | Ga0496123_0000411 | 3300048926 | Bacteria | 78453 |
| 857 | Ga0496123_0009295 | 3300048926 | Bacteria | 8871 |
| 858 | Ga0496123_0046633 | 3300048926 | Bacteria | 2937 |
| 859 | Ga0496124_0018504 | 3300048927 | Bacteria | 6521 |
| 860 | Ga0496124_0023398 | 3300048927 | Bacteria | 5639 |
| 861 | Ga0496124_0035173 | 3300048927 | Bacteria | 4385 |
| 862 | Ga0496124_0050643 | 3300048927 | Bacteria | 3537 |
| 863 | Ga0496124_0093302 | 3300048927 | Bacteria | 2450 |
| 864 | Ga0496124_0094739 | 3300048927 | Bacteria | 2427 |
| 865 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 866 | Ga0496125_0000759 | 3300048928 | Bacteria | 52858 |
| 867 | Ga0496125_0004038 | 3300048928 | Bacteria | 17205 |
| 868 | Ga0496125_0018493 | 3300048928 | Bacteria | 6618 |
| 869 | Ga0496125_0026580 | 3300048928 | Bacteria | 5269 |
| 870 | Ga0496125_0089405 | 3300048928 | Bacteria | 2316 |
| 871 | Ga0496126_0002263 | 3300048929 | Bacteria | 26552 |
| 872 | Ga0496126_0007137 | 3300048929 | Bacteria | 12300 |
| 873 | Ga0496126_0007197 | 3300048929 | Bacteria | 12245 |
| 874 | Ga0496126_0100825 | 3300048929 | Bacteria | 2526 |
| 875 | Ga0496126_0141282 | 3300048929 | Bacteria | 2072 |
| 876 | Ga0496126_0160733 | 3300048929 | Bacteria | 1919 |
| 877 | Ga0501031_0007394 | 3300049568 | Bacteria | 7155 |
| 878 | Ga0501031_0032142 | 3300049568 | Bacteria | 3422 |
| 879 | Ga0501031_0237618 | 3300049568 | Bacteria | 1185 |
| 880 | Ga0501032_0009798 | 3300049569 | Bacteria | 6930 |
| 881 | Ga0501032_0142906 | 3300049569 | Bacteria | 1576 |
| 882 | Ga0501032_0162978 | 3300049569 | Bacteria | 1464 |
| 883 | Ga0501033_0013025 | 3300049570 | Bacteria | 6342 |
| 884 | Ga0501033_0031947 | 3300049570 | Bacteria | 3952 |
| 885 | Ga0501033_0042219 | 3300049570 | Bacteria | 3401 |
| 886 | Ga0501034_0046397 | 3300049571 | Bacteria | 4390 |
| 887 | Ga0501034_0069339 | 3300049571 | Bacteria | 3537 |
| 888 | Ga0501034_0104026 | 3300049571 | Bacteria | 2833 |
| 889 | Ga0501034_0381963 | 3300049571 | Bacteria | 1333 |
| 890 | Ga0501034_0452822 | 3300049571 | Bacteria | 1201 |
| 891 | Ga0501034_0614967 | 3300049571 | Bacteria | 991 |
| 892 | Ga0501036_0005940 | 3300049572 | Bacteria | 9890 |
| 893 | Ga0501036_0011396 | 3300049572 | Bacteria | 7358 |
| 894 | Ga0501036_0055798 | 3300049572 | Bacteria | 3347 |
| 895 | Ga0501036_0203441 | 3300049572 | Bacteria | 1665 |
| 896 | Ga0501036_0228880 | 3300049572 | Bacteria | 1560 |
| 897 | Ga0501036_0549238 | 3300049572 | Bacteria | 960 |
| 898 | Ga0501037_0136019 | 3300049573 | Bacteria | 1760 |
| 899 | Ga0501037_0164579 | 3300049573 | Bacteria | 1580 |
| 900 | Ga0501038_0003978 | 3300049574 | Bacteria | 13728 |
| 901 | Ga0501038_0016537 | 3300049574 | Bacteria | 6687 |
| 902 | Ga0501039_0004768 | 3300049575 | Bacteria | 10273 |
| 903 | Ga0501039_0022208 | 3300049575 | Bacteria | 4871 |
| 904 | Ga0501039_0111822 | 3300049575 | Bacteria | 2135 |
| 905 | Ga0501039_0156225 | 3300049575 | Bacteria | 1792 |
| 906 | Ga0501039_0163526 | 3300049575 | Bacteria | 1750 |
| 907 | Ga0501039_0227798 | 3300049575 | Bacteria | 1465 |
| 908 | Ga0501039_0243079 | 3300049575 | Bacteria | 1415 |
| 909 | Ga0501040_0002910 | 3300049576 | Bacteria | 11068 |
| 910 | Ga0501040_0003703 | 3300049576 | Bacteria | 9907 |
| 911 | Ga0501040_0013219 | 3300049576 | Bacteria | 5428 |
| 912 | Ga0501040_0052937 | 3300049576 | Bacteria | 2779 |
| 913 | Ga0501040_0063824 | 3300049576 | Bacteria | 2535 |
| 914 | Ga0501041_0003207 | 3300049577 | Bacteria | 9402 |
| 915 | Ga0501041_0012828 | 3300049577 | Bacteria | 4965 |
| 916 | Ga0501041_0028170 | 3300049577 | Bacteria | 3388 |
| 917 | Ga0501041_0054412 | 3300049577 | Bacteria | 2441 |
| 918 | Ga0501041_0063869 | 3300049577 | Bacteria | 2254 |
| 919 | Ga0501041_0188152 | 3300049577 | Bacteria | 1293 |
| 920 | Ga0501042_0004113 | 3300049578 | Bacteria | 9244 |
| 921 | Ga0501042_0034453 | 3300049578 | Bacteria | 3591 |
| 922 | Ga0501042_0336441 | 3300049578 | Bacteria | 1091 |
| 923 | Ga0501042_0414320 | 3300049578 | Bacteria | 976 |
| 924 | Ga0501043_0052903 | 3300049579 | Bacteria | 3189 |
| 925 | Ga0501046_0006343 | 3300049580 | Bacteria | 10483 |
| 926 | Ga0501046_0006557 | 3300049580 | Bacteria | 10291 |
| 927 | Ga0501046_0045310 | 3300049580 | Bacteria | 3495 |
| 928 | Ga0501046_0104778 | 3300049580 | Bacteria | 2167 |
| 929 | Ga0501046_0259384 | 3300049580 | Bacteria | 1277 |
| 930 | Ga0501047_0208082 | 3300049581 | Bacteria | 1816 |
| 931 | Ga0501048_0009506 | 3300049582 | Bacteria | 7297 |
| 932 | Ga0501048_0018079 | 3300049582 | Bacteria | 5188 |
| 933 | Ga0501048_0033976 | 3300049582 | Bacteria | 3682 |
| 934 | Ga0501048_0133298 | 3300049582 | Bacteria | 1756 |
| 935 | Ga0501048_0145338 | 3300049582 | Bacteria | 1677 |
| 936 | Ga0501048_0146861 | 3300049582 | Bacteria | 1668 |
| 937 | Ga0501048_0223769 | 3300049582 | Bacteria | 1335 |
| 938 | Ga0501067_0022940 | 3300049583 | Bacteria | 3456 |
| 939 | Ga0501067_0046289 | 3300049583 | Bacteria | 2414 |
| 940 | Ga0501068_0029402 | 3300049584 | Bacteria | 3253 |
| 941 | Ga0501068_0129211 | 3300049584 | Bacteria | 1579 |
| 942 | Ga0501070_0000446 | 3300049586 | Bacteria | 37561 |
| 943 | Ga0501070_0101758 | 3300049586 | Bacteria | 2376 |
| 944 | Ga0501071_0013254 | 3300049587 | Bacteria | 5617 |
| 945 | Ga0501071_0022554 | 3300049587 | Bacteria | 4389 |
| 946 | Ga0501071_0101123 | 3300049587 | Bacteria | 2125 |
| 947 | Ga0501072_0001734 | 3300049588 | Bacteria | 16263 |
| 948 | Ga0501072_0006537 | 3300049588 | Bacteria | 8880 |
| 949 | Ga0501072_0049910 | 3300049588 | Bacteria | 3294 |
| 950 | Ga0501072_0087339 | 3300049588 | Bacteria | 2475 |
| 951 | Ga0501072_0139668 | 3300049588 | Bacteria | 1931 |
| 952 | Ga0501073_0009718 | 3300049589 | Bacteria | 7084 |
| 953 | Ga0501073_0009857 | 3300049589 | Bacteria | 7028 |
| 954 | Ga0501073_0014697 | 3300049589 | Bacteria | 5687 |
| 955 | Ga0501073_0040143 | 3300049589 | Bacteria | 3314 |
| 956 | Ga0501073_0092776 | 3300049589 | Bacteria | 2098 |
| 957 | Ga0501073_0114580 | 3300049589 | Bacteria | 1869 |
| 958 | Ga0501074_0024862 | 3300049590 | Bacteria | 4351 |
| 959 | Ga0501074_0032787 | 3300049590 | Bacteria | 3763 |
| 960 | Ga0501074_0063689 | 3300049590 | Bacteria | 2656 |
| 961 | Ga0501074_0116847 | 3300049590 | Bacteria | 1908 |
| 962 | Ga0501074_0159872 | 3300049590 | Bacteria | 1609 |
| 963 | Ga0501075_0000282 | 3300049591 | Bacteria | 28099 |
| 964 | Ga0501075_0003838 | 3300049591 | Bacteria | 10118 |
| 965 | Ga0501075_0011522 | 3300049591 | Bacteria | 6258 |
| 966 | Ga0501075_0015902 | 3300049591 | Bacteria | 5411 |
| 967 | Ga0501075_0052844 | 3300049591 | Bacteria | 3055 |
| 968 | Ga0501075_0247864 | 3300049591 | Bacteria | 1358 |
| 969 | Ga0501075_0314420 | 3300049591 | Bacteria | 1193 |
| 970 | Ga0501076_0000955 | 3300049592 | Bacteria | 18891 |
| 971 | Ga0501076_0002461 | 3300049592 | Bacteria | 12726 |
| 972 | Ga0501076_0020250 | 3300049592 | Bacteria | 5090 |
| 973 | Ga0501076_0027639 | 3300049592 | Bacteria | 4399 |
| 974 | Ga0501076_0039830 | 3300049592 | Bacteria | 3690 |
| 975 | Ga0501076_0050402 | 3300049592 | Bacteria | 3293 |
| 976 | Ga0501076_0346084 | 3300049592 | Bacteria | 1220 |
| 977 | Ga0501076_0445338 | 3300049592 | Bacteria | 1066 |
| 978 | Ga0501076_0447718 | 3300049592 | Bacteria | 1063 |
| 979 | Ga0501077_0006923 | 3300049593 | Bacteria | 6980 |
| 980 | Ga0501077_0007715 | 3300049593 | Bacteria | 6642 |
| 981 | Ga0501077_0024697 | 3300049593 | Bacteria | 3816 |
| 982 | Ga0501077_0039617 | 3300049593 | Bacteria | 3002 |
| 983 | Ga0501252_000719 | 3300049682 | Bacteria | 2722 |
| 984 | Ga0501079_0001340 | 3300049741 | Bacteria | 17314 |
| 985 | Ga0501079_0002370 | 3300049741 | Bacteria | 13690 |
| 986 | Ga0501079_0024982 | 3300049741 | Bacteria | 4583 |
| 987 | Ga0501079_0215105 | 3300049741 | Bacteria | 1501 |
| 988 | Ga0501079_0229806 | 3300049741 | Bacteria | 1449 |
| 989 | Ga0501079_0350794 | 3300049741 | Bacteria | 1156 |
| 990 | Ga0501080_0001574 | 3300049742 | Bacteria | 19318 |
| 991 | Ga0501080_0002465 | 3300049742 | Bacteria | 16197 |
| 992 | Ga0501080_0016499 | 3300049742 | Bacteria | 6822 |
| 993 | Ga0501080_0055485 | 3300049742 | Bacteria | 3690 |
| 994 | Ga0501080_0076684 | 3300049742 | Bacteria | 3108 |
| 995 | Ga0501080_0542777 | 3300049742 | Bacteria | 1036 |
| 996 | Ga0501080_0632172 | 3300049742 | Bacteria | 948 |
| 997 | Ga0501081_0000147 | 3300049743 | Bacteria | 32041 |
| 998 | Ga0501081_0000552 | 3300049743 | Bacteria | 21253 |
| 999 | Ga0501081_0002949 | 3300049743 | Bacteria | 10798 |
| 1000 | Ga0501081_0011022 | 3300049743 | Bacteria | 5911 |
| 1001 | Ga0501081_0028375 | 3300049743 | Bacteria | 3777 |
| 1002 | Ga0501081_0081301 | 3300049743 | Bacteria | 2269 |
| 1003 | Ga0501081_0086496 | 3300049743 | Bacteria | 2201 |
| 1004 | Ga0501081_0274222 | 3300049743 | Bacteria | 1234 |
| 1005 | Ga0501083_0016930 | 3300049744 | Bacteria | 5092 |
| 1006 | Ga0501083_0118144 | 3300049744 | Bacteria | 1740 |
| 1007 | Ga0501035_0036281 | 3300049822 | Bacteria | 4469 |
| 1008 | Ga0501035_0095305 | 3300049822 | Bacteria | 2616 |
| 1009 | Ga0501044_0106227 | 3300049823 | Bacteria | 2820 |
| 1010 | Ga0501044_0169055 | 3300049823 | Bacteria | 2159 |
| 1011 | Ga0501044_0381748 | 3300049823 | Bacteria | 1324 |
| 1012 | Ga0501045_0000401 | 3300049824 | Bacteria | 26284 |
| 1013 | Ga0501045_0004402 | 3300049824 | Bacteria | 9717 |
| 1014 | Ga0501045_0124199 | 3300049824 | Bacteria | 1917 |
| 1015 | Ga0501045_0135301 | 3300049824 | Bacteria | 1832 |
| 1016 | Ga0501045_0143311 | 3300049824 | Bacteria | 1777 |
| 1017 | nmdc:mga00v17_31397_c1 | 3300050491 | Bacteria | 3132 |
| 1018 | nmdc:mga0k408_139525_c1 | 3300050493 | Bacteria | 1441 |
| 1019 | nmdc:mga04h51_53784_c1 | 3300050495 | Bacteria | 1359 |
| 1020 | nmdc:mga05p37_150028_c1 | 3300050507 | Bacteria | 2852 |
| 1021 | nmdc:mga05p37_248800_c1 | 3300050507 | Bacteria | 2133 |
| 1022 | nmdc:mga05p37_416528_c1 | 3300050507 | Bacteria | 1564 |
| 1023 | nmdc:mga05p37_98508_c1 | 3300050507 | Bacteria | 3601 |
| 1024 | nmdc:mga09592_242121_c1 | 3300050508 | Bacteria | 1563 |
| 1025 | nmdc:mga0qj67_275984_c1 | 3300050509 | Bacteria | 1363 |
| 1026 | nmdc:mga0qj67_38204_c1 | 3300050509 | Bacteria | 3766 |
| 1027 | nmdc:mga06r32_228616_c1 | 3300050510 | Bacteria | 1848 |
| 1028 | nmdc:mga06r32_32508_c1 | 3300050510 | Bacteria | 4910 |
| 1029 | nmdc:mga06r32_33913_c1 | 3300050510 | Bacteria | 4811 |
| 1030 | nmdc:mga06r32_355355_c1 | 3300050510 | Bacteria | 1450 |
| 1031 | nmdc:mga06r32_40748_c1 | 3300050510 | Bacteria | 4410 |
| 1032 | nmdc:mga06r32_438315_c1 | 3300050510 | Bacteria | 1287 |
| 1033 | nmdc:mga06r32_441986_c1 | 3300050510 | Bacteria | 1281 |
| 1034 | nmdc:mga08y16_213141_c1 | 3300050511 | Bacteria | 2000 |
| 1035 | nmdc:mga08y16_229475_c1 | 3300050511 | Bacteria | 1920 |
| 1036 | nmdc:mga08y16_230019_c1 | 3300050511 | Bacteria | 1918 |
| 1037 | nmdc:mga08y16_293748_c1 | 3300050511 | Bacteria | 1675 |
| 1038 | nmdc:mga08y16_35895_c1 | 3300050511 | Bacteria | 5207 |
| 1039 | nmdc:mga08y16_5377_c2 | 3300050511 | Bacteria | 8083 |
| 1040 | nmdc:mga0n895_1121_c1 | 3300050512 | Bacteria | 19562 |
| 1041 | nmdc:mga0n895_188290_c1 | 3300050512 | Bacteria | 2095 |
| 1042 | nmdc:mga0n895_231741_c1 | 3300050512 | Bacteria | 1874 |
| 1043 | nmdc:mga0n895_260567_c1 | 3300050512 | Bacteria | 1759 |
| 1044 | nmdc:mga0rr50_66501_c1 | 3300050513 | Bacteria | 2735 |
| 1045 | nmdc:mga0rr50_80020_c1 | 3300050513 | Bacteria | 2518 |
| 1046 | nmdc:mga08x19_14319_c1 | 3300050514 | Bacteria | 4811 |
| 1047 | nmdc:mga0a205_110653_c1 | 3300050515 | Bacteria | 2646 |
| 1048 | nmdc:mga0a205_2501_c1 | 3300050515 | Bacteria | 16205 |
| 1049 | nmdc:mga0a205_574656_c1 | 3300050515 | Bacteria | 981 |
| 1050 | nmdc:mga0sz30_185927_c1 | 3300050516 | Bacteria | 922 |
| 1051 | Ga0495601_0008393 | 3300053077 | Bacteria | 6100 |
| 1052 | Ga0495612_0001142 | 3300053078 | Bacteria | 10900 |
| 1053 | Ga0495612_0143477 | 3300053078 | Bacteria | 1037 |
| 1054 | Ga0495595_0007709 | 3300053084 | Bacteria | 4410 |
| 1055 | Ga0495619_0011851 | 3300053085 | Bacteria | 5491 |
| 1056 | Ga0495619_0050966 | 3300053085 | Bacteria | 2734 |
| 1057 | Ga0495619_0405238 | 3300053085 | Bacteria | 941 |
| 1058 | Ga0500646_0070609 | 3300053090 | Bacteria | 1047 |
| 1059 | Ga0500583_0015825 | 3300053092 | Bacteria | 2996 |
| 1060 | Ga0500583_0054104 | 3300053092 | Bacteria | 1873 |
| 1061 | Ga0500641_0003000 | 3300053096 | Bacteria | 5976 |
| 1062 | Ga0500650_0000025 | 3300053098 | Bacteria | 60928 |
| 1063 | Ga0500555_002546 | 3300053103 | Bacteria | 5256 |
| 1064 | Ga0500556_0001581 | 3300053104 | Bacteria | 9146 |
| 1065 | Ga0500562_018905 | 3300053108 | Bacteria | 1780 |
| 1066 | Ga0500591_070332 | 3300053115 | Bacteria | 1587 |
| 1067 | Ga0500617_039365 | 3300053124 | Bacteria | 2117 |
| 1068 | Ga0500618_020687 | 3300053125 | Bacteria | 1610 |
| 1069 | Ga0500559_0031324 | 3300053136 | Bacteria | 2281 |
| 1070 | Ga0500559_0108184 | 3300053136 | Bacteria | 1286 |
| 1071 | Ga0500573_0069269 | 3300053140 | Bacteria | 2013 |
| 1072 | Ga0500588_0018376 | 3300053146 | Bacteria | 1840 |
| 1073 | Ga0500616_0000073 | 3300053153 | Bacteria | 231290 |
| 1074 | Ga0500616_0034535 | 3300053153 | Bacteria | 2754 |
| 1075 | Ga0500616_0047796 | 3300053153 | Bacteria | 2271 |
| 1076 | Ga0500616_0101867 | 3300053153 | Bacteria | 1402 |
| 1077 | Ga0500622_0007236 | 3300053156 | Bacteria | 6320 |
| 1078 | Ga0500634_0000026 | 3300053161 | Bacteria | 81353 |
| 1079 | Ga0500639_083294 | 3300053163 | Bacteria | 1608 |
| 1080 | Ga0501084_0002063 | 3300054114 | Bacteria | 16034 |
| 1081 | Ga0501084_0003463 | 3300054114 | Bacteria | 12814 |
| 1082 | Ga0501084_0011958 | 3300054114 | Bacteria | 7187 |
| 1083 | Ga0501084_0013640 | 3300054114 | Bacteria | 6726 |
| 1084 | Ga0501084_0014584 | 3300054114 | Bacteria | 6516 |
| 1085 | Ga0501084_0119333 | 3300054114 | Bacteria | 2217 |
| 1086 | Ga0501084_0157325 | 3300054114 | Bacteria | 1917 |
| 1087 | Ga0501084_0209771 | 3300054114 | Bacteria | 1644 |
| 1088 | Ga0501084_0463514 | 3300054114 | Bacteria | 1071 |
| 1089 | Ga0501082_0002075 | 3300060353 | Bacteria | 17636 |
| 1090 | Ga0501082_0004888 | 3300060353 | Bacteria | 11690 |
| 1091 | Ga0501082_0012280 | 3300060353 | Bacteria | 7360 |
| 1092 | Ga0501082_0013531 | 3300060353 | Bacteria | 7010 |
| 1093 | Ga0501082_0032198 | 3300060353 | Bacteria | 4521 |
| 1094 | Ga0501082_0039470 | 3300060353 | Bacteria | 4072 |
| 1095 | Ga0501082_0052077 | 3300060353 | Bacteria | 3528 |
| 1096 | Ga0501082_0103899 | 3300060353 | Bacteria | 2458 |
| 1097 | Ga0501082_0308386 | 3300060353 | Bacteria | 1378 |
| 1098 | Ga0501082_0309888 | 3300060353 | Bacteria | 1375 |
| 1099 | Ga0501082_0422603 | 3300060353 | Bacteria | 1164 |
| 1100 | Ga0466962_0007564 | 3300061719 | Bacteria | 5212 |
| 1101 | Ga0530510_0012468 | 3300061734 | Bacteria | 5971 |
| 1102 | Ga0530510_0021387 | 3300061734 | Bacteria | 4602 |
| 1103 | Ga0530510_0046245 | 3300061734 | Bacteria | 3144 |
| 1104 | Ga0530510_0248105 | 3300061734 | Bacteria | 1326 |
| 1105 | 2512035213 | 2511231221 | Bacteria | 6846400 |
| 1106 | 2524612077 | 2524023250 | Bacteria | 5457705 |
| 1107 | 2585828224 | 2585427591 | Bacteria | 5482980 |
| 1108 | 2585833912 | 2585427592 | Bacteria | 5370892 |
| 1109 | 2599101100 | 2597490356 | Bacteria | 7030811 |
| 1110 | 2599906106 | 2599185292 | Bacteria | 6290804 |
| 1111 | 2643861890 | 2643221569 | Bacteria | 6064337 |
| 1112 | 2643979946 | 2643221594 | Bacteria | 5811388 |
| 1113 | 2644122541 | 2643221621 | Bacteria | 6212786 |
| 1114 | 2644165078 | 2643221629 | Bacteria | 5850260 |
| 1115 | 2644345653 | 2643221662 | Bacteria | 5851492 |
| 1116 | 2729908184 | 2728369276 | Bacteria | 5610032 |
| 1117 | 2809031607 | 2808606395 | Bacteria | 6020352 |
| 1118 | 2821445913 | 2821443989 | Bacteria | 7658172 |
| 1119 | 2842775765 | 2842775625 | Bacteria | 5587290 |
| 1120 | 2844533393 | 2844533157 | Bacteria | 7517899 |
| 1121 | 2844537943 | 2844533157 | Bacteria | 7517899 |
| 1122 | 2846034770 | 2846033681 | Bacteria | 4377894 |
| 1123 | 2846041159 | 2846037992 | Bacteria | 4526407 |
| 1124 | 2846954180 | 2846952575 | Bacteria | 6587527 |
| 1125 | 2848859655 | 2848858292 | Bacteria | 7391279 |
| 1126 | 2857540863 | 2857537821 | Bacteria | 5248181 |
| 1127 | 2858956415 | 2858950400 | Bacteria | 6783797 |
| 1128 | 2898797260 | 2898795034 | Bacteria | 4294459 |
| 1129 | 2904478359 | 2904474040 | Bacteria | 5504324 |
| 1130 | 2919154614 | 2919150387 | Bacteria | 5500879 |
| 1131 | 2927148051 | 2927143783 | Bacteria | 5504251 |
| 1132 | 2928163577 | 2928157003 | Bacteria | 7522202 |
| 1133 | 2941485815 | |||
| 1134 | 2981996527 | 2981990288 | Bacteria | 7590678 |
| 1135 | 2998346693 | 2998344455 | Bacteria | 4222996 |
| 1136 | 3000407782 | 3000405567 | Bacteria | 3779330 |
| 1137 | 8018847185 | 8018845410 | Bacteria | 8933938 |
| 1138 | 8054009098 | 8054002106 | Bacteria | 7987183 |
| 1139 | Ga0207678_10305925 | |||
| 1140 | JGI25159J45721_1020272 | |||
| 1141 | JGI25151J46595_10000130 | |||
| 1142 | JGI25151J46595_10000312 | |||
| 1143 | JGI25151J46595_10000436 | |||
| 1144 | JGI25406J46586_10015918 | |||
| 1145 | JGI25153J46596_10000132 | |||
| 1146 | JGI25153J46596_10000426 | |||
| 1147 | rootH2_10070126 | |||
| 1148 | rootL2_10029180 | |||
| 1149 | rootL2_10278328 | |||
| 1150 | rootH1_10064332 | |||
| 1151 | rootH1_10300231 | |||
| 1152 | Ga0055527_1000005 | |||
| 1153 | Ga0055542_1000006 | |||
| 1154 | Ga0055529_1000013 | |||
| 1155 | Ga0065704_10140248 | |||
| 1156 | Ga0065712_10114830 | |||
| 1157 | Ga0070683_100042785 | |||
| 1158 | Ga0070690_100056392 | |||
| 1159 | Ga0070666_10003820 | |||
| 1160 | Ga0070666_10211953 | |||
| 1161 | Ga0070666_10500410 | |||
| 1162 | Ga0070680_100004606 | |||
| 1163 | Ga0070680_100091900 | |||
| 1164 | Ga0070680_100134045 | |||
| 1165 | Ga0068868_100015991 | |||
| 1166 | Ga0068868_100522536 | |||
| 1167 | Ga0070660_100052227 | |||
| 1168 | Ga0070660_100360160 | |||
| 1169 | Ga0070660_100451080 | |||
| 1170 | Ga0070661_100000775 | |||
| 1171 | Ga0070668_100037293 | |||
| 1172 | Ga0070669_100005076 | |||
| 1173 | Ga0070675_100014302 | |||
| 1174 | Ga0070675_100035991 | |||
| 1175 | Ga0070671_100022140 | |||
| 1176 | Ga0070671_100069722 | |||
| 1177 | Ga0070674_100107403 | |||
| 1178 | Ga0070688_100021247 | |||
| 1179 | Ga0070667_100018886 | |||
| 1180 | Ga0070667_100027818 | |||
| 1181 | Ga0070667_100041630 | |||
| 1182 | Ga0070667_100061427 | |||
| 1183 | Ga0070667_100210335 | |||
| 1184 | Ga0070667_100433309 | |||
| 1185 | Ga0070709_10085941 | |||
| 1186 | Ga0070709_10091586 | |||
| 1187 | Ga0070709_10259233 | |||
| 1188 | Ga0070713_100035644 | |||
| 1189 | Ga0070713_100036136 | |||
| 1190 | Ga0070713_100049136 | |||
| 1191 | Ga0070713_100167499 | |||
| 1192 | Ga0070713_100515829 | |||
| 1193 | Ga0070710_10006217 | |||
| 1194 | Ga0070711_100054528 | |||
| 1195 | Ga0070711_100121593 | |||
| 1196 | Ga0070711_100259883 | |||
| 1197 | Ga0070705_100141188 | |||
| 1198 | Ga0070700_100052749 | |||
| 1199 | Ga0070694_100448572 | |||
| 1200 | Ga0070663_100065355 | |||
| 1201 | Ga0070663_100149231 | |||
| 1202 | Ga0070663_100253307 | |||
| 1203 | Ga0070662_100003902 | |||
| 1204 | Ga0070662_100538669 | |||
| 1205 | Ga0070681_10007653 | |||
| 1206 | Ga0070681_10008934 | |||
| 1207 | Ga0070681_10103019 | |||
| 1208 | Ga0068867_100019954 | |||
| 1209 | Ga0068867_100413626 | |||
| 1210 | Ga0068867_100419531 | |||
| 1211 | Ga0070698_100065367 | |||
| 1212 | Ga0070679_100000523 | |||
| 1213 | Ga0070679_100006850 | |||
| 1214 | Ga0070679_100123644 | |||
| 1215 | Ga0070679_100153710 | |||
| 1216 | Ga0070679_100380104 | |||
| 1217 | Ga0070684_100044457 | |||
| 1218 | Ga0070684_100220864 | |||
| 1219 | Ga0070684_100400697 | |||
| 1220 | Ga0068853_100006497 | |||
| 1221 | Ga0068853_100042108 | |||
| 1222 | Ga0068853_100083513 | |||
| 1223 | Ga0068853_100109331 | |||
| 1224 | Ga0068853_100452398 | |||
| 1225 | Ga0068853_100504721 | |||
| 1226 | Ga0070672_100021778 | |||
| 1227 | Ga0070672_100023391 | |||
| 1228 | Ga0070686_100017327 | |||
| 1229 | Ga0070695_100138237 | |||
| 1230 | Ga0070693_100281698 | |||
| 1231 | Ga0070665_100000543 | |||
| 1232 | Ga0070665_100003944 | |||
| 1233 | Ga0070665_100023201 | |||
| 1234 | Ga0070665_100073814 | |||
| 1235 | Ga0070665_100100197 | |||
| 1236 | Ga0070665_100172965 | |||
| 1237 | Ga0070665_100224231 | |||
| 1238 | Ga0070665_100274053 | |||
| 1239 | Ga0070665_100464757 | |||
| 1240 | Ga0070704_100009353 | |||
| 1241 | Ga0070704_100287057 | |||
| 1242 | Ga0068855_100176374 | |||
| 1243 | Ga0068855_100236507 | |||
| 1244 | Ga0068855_100280539 | |||
| 1245 | Ga0068855_100307806 | |||
| 1246 | Ga0068855_100446602 | |||
| 1247 | Ga0068857_100261616 | |||
| 1248 | Ga0068857_100580528 | |||
| 1249 | Ga0068854_100018789 | |||
| 1250 | Ga0068854_100212093 | |||
| 1251 | Ga0068856_100145714 | |||
| 1252 | Ga0068856_100155933 | |||
| 1253 | Ga0068852_100112335 | |||
| 1254 | Ga0068852_100505074 | |||
| 1255 | Ga0068859_100002193 | |||
| 1256 | Ga0068859_100007416 | |||
| 1257 | Ga0068859_100027568 | |||
| 1258 | Ga0068859_100030044 | |||
| 1259 | Ga0068859_100034471 | |||
| 1260 | Ga0068859_100069694 | |||
| 1261 | Ga0068859_100144102 | |||
| 1262 | Ga0068864_100065782 | |||
| 1263 | Ga0068864_100278302 | |||
| 1264 | Ga0068861_100006751 | |||
| 1265 | Ga0068861_100300486 | |||
| 1266 | Ga0068851_10006113 | |||
| 1267 | Ga0068870_10018568 | |||
| 1268 | Ga0068863_100001099 | |||
| 1269 | Ga0068863_100005032 | |||
| 1270 | Ga0068863_100022625 | |||
| 1271 | Ga0068863_100112958 | |||
| 1272 | Ga0068863_100248581 | |||
| 1273 | Ga0068863_100851104 | |||
| 1274 | Ga0068858_100001773 | |||
| 1275 | Ga0068858_100001802 | |||
| 1276 | Ga0068858_100002680 | |||
| 1277 | Ga0068858_100007229 | |||
| 1278 | Ga0068860_100005207 | |||
| 1279 | Ga0068860_100010729 | |||
| 1280 | Ga0068860_100029041 | |||
| 1281 | Ga0068860_100079184 | |||
| 1282 | Ga0068860_100087827 | |||
| 1283 | Ga0068860_100118452 | |||
| 1284 | Ga0068862_100074597 | |||
| 1285 | Ga0068862_100166684 | |||
| 1286 | Ga0068862_100190620 | |||
| 1287 | Ga0068862_100395828 | |||
| 1288 | Ga0081455_10022056 | |||
| 1289 | Ga0081455_10286575 | |||
| 1290 | Ga0081540_1011922 | |||
| 1291 | Ga0081540_1039510 | |||
| 1292 | Ga0081539_10000028 | |||
| 1293 | Ga0081539_10000572 | |||
| 1294 | Ga0070717_10008740 | |||
| 1295 | Ga0070717_10505885 | |||
| 1296 | Ga0075363_100167385 | |||
| 1297 | Ga0075363_100191462 | |||
| 1298 | Ga0070712_100043863 | |||
| 1299 | Ga0070712_100049035 | |||
| 1300 | Ga0070712_100317876 | |||
| 1301 | Ga0070712_100332292 | |||
| 1302 | Ga0075367_10048990 | |||
| 1303 | Ga0075367_10125721 | |||
| 1304 | Ga0097621_100323684 | |||
| 1305 | Ga0097621_100676337 | |||
| 1306 | Ga0075370_10028886 | |||
| 1307 | Ga0068871_100026906 | |||
| 1308 | Ga0068871_100121433 | |||
| 1309 | Ga0068871_100238794 | |||
| 1310 | Ga0075428_100007872 | |||
| 1311 | Ga0075428_100133315 | |||
| 1312 | Ga0075428_100179632 | |||
| 1313 | Ga0075430_100003646 | |||
| 1314 | Ga0075430_100204848 | |||
| 1315 | Ga0075430_100462388 | |||
| 1316 | Ga0075431_100008804 | |||
| 1317 | Ga0075431_100010293 | |||
| 1318 | Ga0075431_100040109 | |||
| 1319 | Ga0075431_100040688 | |||
| 1320 | Ga0075431_100071130 | |||
| 1321 | Ga0075431_100173057 | |||
| 1322 | Ga0075431_100203659 | |||
| 1323 | Ga0075433_10005192 | |||
| 1324 | Ga0075434_100001680 | |||
| 1325 | Ga0075434_100719378 | |||
| 1326 | Ga0075429_100062955 | |||
| 1327 | Ga0075429_100145387 | |||
| 1328 | Ga0075429_100317192 | |||
| 1329 | Ga0068865_100032871 | |||
| 1330 | Ga0068865_100051043 | |||
| 1331 | Ga0075436_100106071 | |||
| 1332 | Ga0097620_100002193 | |||
| 1333 | Ga0097620_100007416 | |||
| 1334 | Ga0097620_100027568 | |||
| 1335 | Ga0097620_100030045 | |||
| 1336 | Ga0097620_100034472 | |||
| 1337 | Ga0097620_100069696 | |||
| 1338 | Ga0097620_100144103 | |||
| 1339 | Ga0097620_100491412 | |||
| 1340 | Ga0075435_100092318 | |||
| 1341 | Ga0075435_100093142 | |||
| 1342 | Ga0075435_100425553 | |||
| 1343 | Ga0099795_10000022 | |||
| 1344 | Ga0099795_10039386 | |||
| 1345 | Ga0105244_10000485 | |||
| 1346 | Ga0105240_10002127 | |||
| 1347 | Ga0105240_10019489 | |||
| 1348 | Ga0105240_10040891 | |||
| 1349 | Ga0105240_10166139 | |||
| 1350 | Ga0105240_10342568 | |||
| 1351 | Ga0105240_10453705 | |||
| 1352 | Ga0105240_10598508 | |||
| 1353 | Ga0111539_10000539 | |||
| 1354 | Ga0111539_10008011 | |||
| 1355 | Ga0111539_10042495 | |||
| 1356 | Ga0111539_10051848 | |||
| 1357 | Ga0111539_10119806 | |||
| 1358 | Ga0111539_10184014 | |||
| 1359 | Ga0111539_10187293 | |||
| 1360 | Ga0105245_10041273 | |||
| 1361 | Ga0105245_10346510 | |||
| 1362 | Ga0105247_10000300 | |||
| 1363 | Ga0105247_10002560 | |||
| 1364 | Ga0105247_10021799 | |||
| 1365 | Ga0105247_10034970 | |||
| 1366 | Ga0105247_10046950 | |||
| 1367 | Ga0105247_10152903 | |||
| 1368 | Ga0105247_10243378 | |||
| 1369 | Ga0114129_10018202 | |||
| 1370 | Ga0114129_10043590 | |||
| 1371 | Ga0114129_10079019 | |||
| 1372 | Ga0114129_10157357 | |||
| 1373 | Ga0114129_10360628 | |||
| 1374 | Ga0114129_10796081 | |||
| 1375 | Ga0105243_10373640 | |||
| 1376 | Ga0105241_10083942 | |||
| 1377 | Ga0105242_10296324 | |||
| 1378 | Ga0105242_10487791 | |||
| 1379 | Ga0105248_10004437 | |||
| 1380 | Ga0105248_10045977 | |||
| 1381 | Ga0105248_10154022 | |||
| 1382 | Ga0105248_10166119 | |||
| 1383 | Ga0105248_10209038 | |||
| 1384 | Ga0105248_10215252 | |||
| 1385 | Ga0105248_10482361 | |||
| 1386 | Ga0105237_10018777 | |||
| 1387 | Ga0105237_10039226 | |||
| 1388 | Ga0105237_10066928 | |||
| 1389 | Ga0105237_10074516 | |||
| 1390 | Ga0105237_10079543 | |||
| 1391 | Ga0105237_10337908 | |||
| 1392 | Ga0105237_10349702 | |||
| 1393 | Ga0105238_10065070 | |||
| 1394 | Ga0105238_10119147 | |||
| 1395 | Ga0105238_10122845 | |||
| 1396 | Ga0105238_10555519 | |||
| 1397 | Ga0105249_10013186 | |||
| 1398 | Ga0105249_10063863 | |||
| 1399 | Ga0105249_10126799 | |||
| 1400 | Ga0105249_10189268 | |||
| 1401 | Ga0105249_10401251 | |||
| 1402 | Ga0105030_100135 | |||
| 1403 | Ga0099796_10000025 | |||
| 1404 | Ga0099796_10047809 | |||
| 1405 | Ga0105239_10005592 | |||
| 1406 | Ga0105239_10052494 | |||
| 1407 | Ga0105239_10127177 | |||
| 1408 | Ga0157371_10214250 | |||
| 1409 | Ga0157370_10001622 | |||
| 1410 | Ga0157370_10052398 | |||
| 1411 | Ga0157369_10091788 | |||
| 1412 | Ga0157369_10358490 | |||
| 1413 | Ga0157369_10392959 | |||
| 1414 | Ga0157374_10057123 | |||
| 1415 | Ga0157374_10266109 | |||
| 1416 | Ga0157378_10192571 | |||
| 1417 | Ga0163162_10068089 | |||
| 1418 | Ga0163162_10243601 | |||
| 1419 | Ga0163162_10496428 | |||
| 1420 | Ga0157372_10058628 | |||
| 1421 | Ga0157375_10052786 | |||
| 1422 | Ga0157375_10333620 | |||
| 1423 | Ga0157375_10719807 | |||
| 1424 | Ga0157375_11020506 | |||
| 1425 | Ga0157514_109572 | |||
| 1426 | Ga0163163_10008179 | |||
| 1427 | Ga0163163_10010899 | |||
| 1428 | Ga0163163_10032882 | |||
| 1429 | Ga0163163_10033348 | |||
| 1430 | Ga0163163_10054754 | |||
| 1431 | Ga0163163_10164638 | |||
| 1432 | Ga0163163_10241991 | |||
| 1433 | Ga0163163_10549227 | |||
| 1434 | Ga0163163_10886454 | |||
| 1435 | Ga0157380_10000110 | |||
| 1436 | Ga0157380_10010381 | |||
| 1437 | Ga0157380_10096919 | |||
| 1438 | Ga0157380_10247030 | |||
| 1439 | Ga0157380_10313909 | |||
| 1440 | Ga0157380_10318476 | |||
| 1441 | Ga0157377_10096682 | |||
| 1442 | Ga0157377_10115359 | |||
| 1443 | Ga0157379_10002677 | |||
| 1444 | Ga0157379_10005225 | |||
| 1445 | Ga0157379_10056900 | |||
| 1446 | Ga0157379_10096564 | |||
| 1447 | Ga0157379_10111786 | |||
| 1448 | Ga0157379_10200864 | |||
| 1449 | Ga0157379_10252200 | |||
| 1450 | Ga0157379_10628382 | |||
| 1451 | Ga0157376_10037280 | |||
| 1452 | Ga0157376_10144989 | |||
| 1453 | Ga0157376_10213577 | |||
| 1454 | Ga0163161_10278323 | |||
| 1455 | Ga0213872_10042800 | |||
| 1456 | Ga0213872_10057513 | |||
| 1457 | Ga0213875_10004869 | |||
| 1458 | Ga0213875_10093453 | |||
| 1459 | Ga0213871_10030523 | |||
| 1460 | Ga0213871_10031699 | |||
| 1461 | Ga0209672_100003 | |||
| 1462 | Ga0209147_100509 | |||
| 1463 | Ga0209258_106134 | |||
| 1464 | Ga0209148_1000004 | |||
| 1465 | Ga0209233_1000010 | |||
| 1466 | Ga0209455_1000022 | |||
| 1467 | Ga0209130_1000167 | |||
| 1468 | Ga0209130_1001359 | |||
| 1469 | Ga0209676_1003691 | |||
| 1470 | Ga0209025_1000077 | |||
| 1471 | Ga0209025_1000152 | |||
| 1472 | Ga0209758_1000169 | |||
| 1473 | Ga0209758_1002944 | |||
| 1474 | Ga0209758_1004047 | |||
| 1475 | Ga0209050_1004720 | |||
| 1476 | Ga0207426_1000239 | |||
| 1477 | Ga0207426_1000333 | |||
| 1478 | Ga0209051_1007044 | |||
| 1479 | Ga0207656_10032714 | |||
| 1480 | Ga0207655_1000060 | |||
| 1481 | Ga0207713_1007835 | |||
| 1482 | Ga0207710_10001255 | |||
| 1483 | Ga0207710_10001815 | |||
| 1484 | Ga0207710_10041557 | |||
| 1485 | Ga0207680_10087713 | |||
| 1486 | Ga0207680_10275492 | |||
| 1487 | Ga0207647_10015135 | |||
| 1488 | Ga0207647_10017113 | |||
| 1489 | Ga0207699_10011068 | |||
| 1490 | Ga0207645_10001223 | |||
| 1491 | Ga0207643_10057011 | |||
| 1492 | Ga0207705_10008147 | |||
| 1493 | Ga0207705_10211283 | |||
| 1494 | Ga0207654_10072903 | |||
| 1495 | Ga0207707_10000753 | |||
| 1496 | Ga0207707_10068485 | |||
| 1497 | Ga0207707_10091549 | |||
| 1498 | Ga0207707_10136893 | |||
| 1499 | Ga0207695_10009529 | |||
| 1500 | Ga0207695_10024867 | |||
| 1501 | Ga0207695_10047805 | |||
| 1502 | Ga0207695_10091079 | |||
| 1503 | Ga0207695_10095476 | |||
| 1504 | Ga0207695_10098191 | |||
| 1505 | Ga0207695_10117564 | |||
| 1506 | Ga0207695_10127044 | |||
| 1507 | Ga0207695_10243725 | |||
| 1508 | Ga0207695_10269834 | |||
| 1509 | Ga0207695_10317224 | |||
| 1510 | Ga0207671_10013339 | |||
| 1511 | Ga0207671_10033612 | |||
| 1512 | Ga0207671_10039105 | |||
| 1513 | Ga0207671_10078427 | |||
| 1514 | Ga0207671_10111889 | |||
| 1515 | Ga0207671_10158215 | |||
| 1516 | Ga0207693_10018817 | |||
| 1517 | Ga0207693_10117336 | |||
| 1518 | Ga0207693_10168011 | |||
| 1519 | Ga0207693_10371332 | |||
| 1520 | Ga0207663_10099392 | |||
| 1521 | Ga0207663_10164144 | |||
| 1522 | Ga0207663_10204893 | |||
| 1523 | Ga0207663_10219841 | |||
| 1524 | Ga0207660_10024249 | |||
| 1525 | Ga0207660_10037930 | |||
| 1526 | Ga0207660_10321609 | |||
| 1527 | Ga0207657_10009568 | |||
| 1528 | Ga0207657_10408995 | |||
| 1529 | Ga0207649_10001165 | |||
| 1530 | Ga0207649_10105728 | |||
| 1531 | Ga0207652_10011550 | |||
| 1532 | Ga0207652_10032150 | |||
| 1533 | Ga0207646_10055232 | |||
| 1534 | Ga0207681_10096522 | |||
| 1535 | Ga0207681_10216990 | |||
| 1536 | Ga0207681_10243985 | |||
| 1537 | Ga0207694_10009564 | |||
| 1538 | Ga0207694_10578677 | |||
| 1539 | Ga0207659_10015047 | |||
| 1540 | Ga0207659_10023791 | |||
| 1541 | Ga0207687_10017700 | |||
| 1542 | Ga0207687_10242797 | |||
| 1543 | Ga0207687_10480576 | |||
| 1544 | Ga0207700_10067505 | |||
| 1545 | Ga0207700_10078242 | |||
| 1546 | Ga0207700_10238863 | |||
| 1547 | Ga0207700_10443037 | |||
| 1548 | Ga0207664_10043496 | |||
| 1549 | Ga0207664_10197896 | |||
| 1550 | Ga0207644_10001224 | |||
| 1551 | Ga0207644_10008565 | |||
| 1552 | Ga0207644_10020759 | |||
| 1553 | Ga0207706_10003281 | |||
| 1554 | Ga0207706_10004326 | |||
| 1555 | Ga0207669_10062312 | |||
| 1556 | Ga0207704_10016231 | |||
| 1557 | Ga0207704_10057443 | |||
| 1558 | Ga0207665_10077250 | |||
| 1559 | Ga0207665_10182214 | |||
| 1560 | Ga0207691_10001448 | |||
| 1561 | Ga0207691_10018310 | |||
| 1562 | Ga0207691_10290208 | |||
| 1563 | Ga0207711_10077329 | |||
| 1564 | Ga0207711_10106629 | |||
| 1565 | Ga0207711_10191619 | |||
| 1566 | Ga0207689_10145911 | |||
| 1567 | Ga0207661_10110675 | |||
| 1568 | Ga0207667_10004634 | |||
| 1569 | Ga0207667_10006777 | |||
| 1570 | Ga0207667_10179116 | |||
| 1571 | Ga0207667_10291902 | |||
| 1572 | Ga0207651_10154320 | |||
| 1573 | Ga0207712_10059202 | |||
| 1574 | Ga0207712_10464629 | |||
| 1575 | Ga0207712_10736621 | |||
| 1576 | Ga0207668_10023557 | |||
| 1577 | Ga0207640_10053272 | |||
| 1578 | Ga0207640_10523179 | |||
| 1579 | Ga0207658_10013905 | |||
| 1580 | Ga0207658_10017695 | |||
| 1581 | Ga0207658_10046985 | |||
| 1582 | Ga0207658_10349464 | |||
| 1583 | Ga0207677_10336233 | |||
| 1584 | Ga0207703_10000684 | |||
| 1585 | Ga0207703_10028593 | |||
| 1586 | Ga0207703_10073668 | |||
| 1587 | Ga0207639_10004843 | |||
| 1588 | Ga0207639_10006241 | |||
| 1589 | Ga0207639_10182852 | |||
| 1590 | Ga0207678_10032138 | |||
| 1591 | Ga0207678_10033497 | |||
| 1592 | Ga0207678_10085075 | |||
| 1593 | Ga0207678_10124850 | |||
| 1594 | Ga0207708_10026815 | |||
| 1595 | Ga0207702_10070413 | |||
| 1596 | Ga0207702_10204640 | |||
| 1597 | Ga0207702_10647059 | |||
| 1598 | Ga0207641_10000218 | |||
| 1599 | Ga0207641_10000313 | |||
| 1600 | Ga0207641_10005318 | |||
| 1601 | Ga0207641_10009065 | |||
| 1602 | Ga0207641_10031125 | |||
| 1603 | Ga0207641_10282153 | |||
| 1604 | Ga0207641_10439271 | |||
| 1605 | Ga0207641_10508518 | |||
| 1606 | Ga0207641_10651959 | |||
| 1607 | Ga0207648_10003080 | |||
| 1608 | Ga0207648_10004235 | |||
| 1609 | Ga0207648_10187355 | |||
| 1610 | Ga0207648_10376827 | |||
| 1611 | Ga0207676_10104929 | |||
| 1612 | Ga0207674_10047539 | |||
| 1613 | Ga0207674_10195076 | |||
| 1614 | Ga0207674_10344051 | |||
| 1615 | Ga0207674_10442308 | |||
| 1616 | Ga0207674_10456467 | |||
| 1617 | Ga0207675_100006460 | |||
| 1618 | Ga0207675_100013913 | |||
| 1619 | Ga0207675_100575056 | |||
| 1620 | Ga0207698_10112794 | |||
| 1621 | Ga0209371_1000215 | |||
| 1622 | Ga0209371_1001291 | |||
| 1623 | Ga0209179_1000048 | |||
| 1624 | Ga0209968_1024913 | |||
| 1625 | Ga0209982_1000774 | |||
| 1626 | Ga0209970_1021752 | |||
| 1627 | Ga0209970_1032790 | |||
| 1628 | Ga0210002_1000664 | |||
| 1629 | Ga0210002_1002126 | |||
| 1630 | Ga0209983_1000414 | |||
| 1631 | Ga0209983_1007773 | |||
| 1632 | Ga0209983_1017107 | |||
| 1633 | Ga0209971_1000988 | |||
| 1634 | Ga0209971_1022112 | |||
| 1635 | Ga0209998_10002182 | |||
| 1636 | Ga0209998_10002926 | |||
| 1637 | Ga0209974_10037113 | |||
| 1638 | Ga0207428_10025978 | |||
| 1639 | Ga0207428_10028273 | |||
| 1640 | Ga0207428_10065196 | |||
| 1641 | Ga0207428_10076142 | |||
| 1642 | Ga0207428_10254496 | |||
| 1643 | Ga0268266_10001602 | |||
| 1644 | Ga0268266_10003289 | |||
| 1645 | Ga0268266_10024426 | |||
| 1646 | Ga0268266_10041031 | |||
| 1647 | Ga0268266_10069361 | |||
| 1648 | Ga0268266_10081141 | |||
| 1649 | Ga0268266_10112936 | |||
| 1650 | Ga0268266_10248700 | |||
| 1651 | Ga0268265_10004447 | |||
| 1652 | Ga0268265_10066844 | |||
| 1653 | Ga0268265_10099057 | |||
| 1654 | Ga0268265_10476063 | |||
| 1655 | Ga0268265_10544145 | |||
| 1656 | Ga0268264_10000047 | |||
| 1657 | Ga0268264_10000140 | |||
| 1658 | Ga0268264_10004448 | |||
| 1659 | Ga0268264_10012089 | |||
| 1660 | Ga0268264_10024711 | |||
| 1661 | Ga0268264_10044934 | |||
| 1662 | Ga0268264_10089829 | |||
| 1663 | Ga0307515_10018263 | |||
| 1664 | Ga0265338_10091735 | |||
| 1665 | Ga0265338_10270660 | |||
| 1666 | Ga0268256_1000172 | |||
| 1667 | Ga0268256_1001102 | |||
| 1668 | Ga0307511_10028868 | |||
| 1669 | Ga0265325_10028726 | |||
| 1670 | Ga0265325_10033917 | |||
| 1671 | Ga0265340_10017304 | |||
| 1672 | Ga0265340_10068994 | |||
| 1673 | Ga0265340_10097134 | |||
| 1674 | Ga0265340_10119807 | |||
| 1675 | Ga0265339_10123897 | |||
| 1676 | Ga0265339_10126512 | |||
| 1677 | Ga0265331_10027782 | |||
| 1678 | Ga0265331_10108780 | |||
| 1679 | Ga0307513_10049441 | |||
| 1680 | Ga0307509_10001396 | |||
| 1681 | Ga0307509_10002372 | |||
| 1682 | Ga0307509_10148841 | |||
| 1683 | Ga0307408_100016261 | |||
| 1684 | Ga0307408_100017852 | |||
| 1685 | Ga0307408_100022764 | |||
| 1686 | Ga0307408_100101573 | |||
| 1687 | Ga0307408_100445606 | |||
| 1688 | Ga0265313_10027030 | |||
| 1689 | Ga0265313_10033559 | |||
| 1690 | Ga0265313_10037843 | |||
| 1691 | Ga0307508_10211816 | |||
| 1692 | Ga0307508_10227050 | |||
| 1693 | Ga0307514_10145144 | |||
| 1694 | Ga0316575_10017248 | |||
| 1695 | Ga0316575_10027915 | |||
| 1696 | Ga0316579_10022252 | |||
| 1697 | Ga0265314_10093275 | |||
| 1698 | Ga0265342_10035713 | |||
| 1699 | Ga0265342_10077743 | |||
| 1700 | Ga0316576_10005161 | |||
| 1701 | Ga0316576_10017920 | |||
| 1702 | Ga0316576_10117867 | |||
| 1703 | Ga0316576_10205853 | |||
| 1704 | Ga0316576_10362421 | |||
| 1705 | Ga0316576_10399452 | |||
| 1706 | Ga0316578_10005082 | |||
| 1707 | Ga0316578_10016838 | |||
| 1708 | Ga0316578_10018257 | |||
| 1709 | Ga0316578_10041771 | |||
| 1710 | Ga0316578_10042084 | |||
| 1711 | Ga0316578_10099244 | |||
| 1712 | Ga0316578_10249296 | |||
| 1713 | Ga0307405_10261658 | |||
| 1714 | Ga0307405_10449484 | |||
| 1715 | Ga0316577_10009416 | |||
| 1716 | Ga0316577_10042335 | |||
| 1717 | Ga0316577_10083642 | |||
| 1718 | Ga0307413_10115670 | |||
| 1719 | Ga0307410_10037833 | |||
| 1720 | Ga0307410_10116082 | |||
| 1721 | Ga0307406_10147578 | |||
| 1722 | Ga0307406_10191032 | |||
| 1723 | Ga0307407_10091954 | |||
| 1724 | Ga0307407_10134976 | |||
| 1725 | Ga0307412_10000918 | |||
| 1726 | Ga0307412_10259049 | |||
| 1727 | Ga0307409_100213315 | |||
| 1728 | Ga0307409_100291150 | |||
| 1729 | Ga0307409_100334752 | |||
| 1730 | Ga0307416_100003094 | |||
| 1731 | Ga0307416_100042886 | |||
| 1732 | Ga0307416_100052766 | |||
| 1733 | Ga0307416_100138453 | |||
| 1734 | Ga0307414_10136025 | |||
| 1735 | Ga0307414_10182422 | |||
| 1736 | Ga0307411_10002953 | |||
| 1737 | Ga0307411_10438790 | |||
| 1738 | Ga0307415_100001180 | |||
| 1739 | Ga0307415_100001775 | |||
| 1740 | Ga0316583_10042320 | |||
| 1741 | Ga0316580_10012084 | |||
| 1742 | Ga0316580_10018645 | |||
| 1743 | Ga0316593_10026050 | |||
| 1744 | Ga0307510_10000009 | |||
| 1745 | Ga0316592_1031644 | |||
| 1746 | Ga0316588_1019297 | |||
| 1747 | Ga0373923_0026198 | |||
| 1748 | Ga0373923_0113682 | |||
| 1749 | Ga0373936_0002315 | |||
| 1750 | Ga0373953_0003712 | |||
| 1751 | Ga0373956_0042636 | |||
| 1752 | Ga0373943_0042003 | |||
| 1753 | Ga0373955_0011701 | |||
| 1754 | Ga0316574_0002663 | |||
| 1755 | Ga0316574_0007652 | |||
| 1756 | Ga0316574_0014132 | |||
| 1757 | Ga0316574_0025571 | |||
| 1758 | Ga0316574_0028433 | |||
| 1759 | Ga0316574_0033917 | |||
| 1760 | Ga0316574_0037650 | |||
| 1761 | Ga0316574_0052334 | |||
| 1762 | Ga0316574_0052849 | |||
| 1763 | Ga0316574_0116042 | |||
| 1764 | Ga0316574_0134129 | |||
| 1765 | Ga0316574_0293659 | |||
| 1766 | Ga0373924_0129968 | |||
| 1767 | Ga0373931_0261437 | |||
| 1768 | Ga0373935_0026844 | |||
| 1769 | Ga0373927_0009759 | |||
| 1770 | Ga0373933_0003783 | |||
| 1771 | Ga0373933_0005208 | |||
| 1772 | Ga0373933_0012987 | |||
| 1773 | Ga0373933_0103066 | |||
| 1774 | Ga0373947_0060979 | |||
| 1775 | Ga0373937_0001734 | |||
| 1776 | Ga0373937_0012692 | |||
| 1777 | Ga0373937_0018708 | |||
| 1778 | Ga0373937_0031120 | |||
| 1779 | Ga0373937_0034493 | |||
| 1780 | Ga0316582_0012393 | |||
| 1781 | Ga0316582_0055960 | |||
| 1782 | Ga0316584_0004710 | |||
| 1783 | Ga0316584_0015022 | |||
| 1784 | Ga0316584_0032057 | |||
| 1785 | Ga0316584_0044014 | |||
| 1786 | Ga0373925_0090259 | |||
| 1787 | Ga0373925_0493190 | |||
| 1788 | Ga0395898_0020339 | |||
| 1789 | Ga0316581_0013589 | |||
| 1790 | Ga0436364_0509785 | |||
| 1791 | Ga0436364_0676183 | |||
| 1792 | Ga0436364_0745335 | |||
| 1793 | Ga0436364_0924171 | |||
| 1794 | Ga0436365_0404170 | |||
| 1795 | Ga0436365_1466348 | |||
| 1796 | Ga0436360_0392412 | |||
| 1797 | Ga0436360_0567944 | |||
| 1798 | Ga0436360_0638300 | |||
| 1799 | Ga0436360_0708385 | |||
| 1800 | Ga0436360_1050799 | |||
| 1801 | Ga0436360_1274780 | |||
| 1802 | Ga0436360_1301488 | |||
| 1803 | Ga0436361_0262581 | |||
| 1804 | Ga0436361_0328064 | |||
| 1805 | Ga0436361_0896160 | |||
| 1806 | Ga0436361_1206202 | |||
| 1807 | Ga0436363_1126933 | |||
| 1808 | Ga0436363_1135590 | |||
| 1809 | Ga0436362_0776327 | |||
| 1810 | Ga0439438_061253 | |||
| 1811 | Ga0451795_1220757 | |||
| 1812 | Ga0451833_1471124 | |||
| 1813 | Ga0451855_1730903 | |||
| 1814 | Ga0451853_0564721 | |||
| 1815 | Ga0439431_0067067 | |||
| 1816 | Ga0439443_004650 | |||
| 1817 | Ga0439456_025965 | |||
| 1818 | Ga0450923_004500 | |||
| 1819 | Ga0450923_006323 | |||
| 1820 | Ga0450923_008008 | |||
| 1821 | Ga0450894_001909 | |||
| 1822 | Ga0450894_002729 | |||
| 1823 | Ga0450895_000553 | |||
| 1824 | Ga0450896_000078 | |||
| 1825 | Ga0450896_007483 | |||
| 1826 | Ga0450896_009427 | |||
| 1827 | Ga0450899_004788 | |||
| 1828 | Ga0450907_003204 | |||
| 1829 | Ga0450910_004879 | |||
| 1830 | Ga0439446_0000678 | |||
| 1831 | Ga0439446_0004444 | |||
| 1832 | Ga0439446_0016746 | |||
| 1833 | Ga0450908_001318 | |||
| 1834 | Ga0450908_001577 | |||
| 1835 | Ga0450908_007495 | |||
| 1836 | Ga0439434_0003968 | |||
| 1837 | Ga0439434_0004234 | |||
| 1838 | Ga0439434_0012069 | |||
| 1839 | Ga0439434_0014278 | |||
| 1840 | Ga0439434_0017233 | |||
| 1841 | Ga0439435_0041453 | |||
| 1842 | Ga0439444_0002496 | |||
| 1843 | Ga0439444_0006939 | |||
| 1844 | Ga0439464_0048652 | |||
| 1845 | Ga0439460_0055323 | |||
| 1846 | Ga0450918_010721 | |||
| 1847 | Ga0466969_0002997 | |||
| 1848 | Ga0466969_0003345 | |||
| 1849 | Ga0466969_0019932 | |||
| 1850 | Ga0466969_0036636 | |||
| 1851 | Ga0466966_0004455 | |||
| 1852 | Ga0466966_0064912 | |||
| 1853 | Ga0466966_0082288 | |||
| 1854 | Ga0466961_0001050 | |||
| 1855 | Ga0466963_0219371 | |||
| 1856 | Ga0466964_0025831 | |||
| 1857 | Ga0466971_0009912 | |||
| 1858 | Ga0466968_0174893 | |||
| 1859 | Ga0466970_0018159 | |||
| 1860 | Ga0466970_0042029 | |||
| 1861 | Ga0466957_0004657 | |||
| 1862 | Ga0466959_0004232 | |||
| 1863 | Ga0466959_0006382 | |||
| 1864 | Ga0466959_0051682 | |||
| 1865 | Ga0466959_0066819 | |||
| 1866 | Ga0451576_0017273 | |||
| 1867 | Ga0451576_0095535 | |||
| 1868 | Ga0495592_0070764 | |||
| 1869 | Ga0495592_0082570 | |||
| 1870 | Ga0495603_0001283 | |||
| 1871 | Ga0495629_0000490 | |||
| 1872 | Ga0495629_0151636 | |||
| 1873 | Ga0495638_0010078 | |||
| 1874 | Ga0495638_0023670 | |||
| 1875 | Ga0495638_0135754 | |||
| 1876 | Ga0495641_0012212 | |||
| 1877 | Ga0495651_0031101 | |||
| 1878 | Ga0495580_0008705 | |||
| 1879 | Ga0495580_0010876 | |||
| 1880 | Ga0495582_0003939 | |||
| 1881 | Ga0495582_0363647 | |||
| 1882 | Ga0495639_0005800 | |||
| 1883 | Ga0495664_0000789 | |||
| 1884 | Ga0495594_0004890 | |||
| 1885 | Ga0495606_0090274 | |||
| 1886 | Ga0495608_0013950 | |||
| 1887 | Ga0495610_0006077 | |||
| 1888 | Ga0495610_0065673 | |||
| 1889 | Ga0495628_0133199 | |||
| 1890 | Ga0495628_0138051 | |||
| 1891 | Ga0495630_0149032 | |||
| 1892 | Ga0495632_0060396 | |||
| 1893 | Ga0495666_0020760 | |||
| 1894 | Ga0495665_0051259 | |||
| 1895 | Ga0495640_0069265 | |||
| 1896 | Ga0495586_0012842 | |||
| 1897 | Ga0495587_0020619 | |||
| 1898 | Ga0495645_0185966 | |||
| 1899 | Ga0495622_0004166 | |||
| 1900 | Ga0495622_0084306 | |||
| 1901 | Ga0495667_0013353 | |||
| 1902 | Ga0495667_0042585 | |||
| 1903 | Ga0495634_0006857 | |||
| 1904 | Ga0495625_0016231 | |||
| 1905 | Ga0495635_0019280 | |||
| 1906 | Ga0495635_0197899 | |||
| 1907 | Ga0495635_0268862 | |||
| 1908 | Ga0495588_0015794 | |||
| 1909 | Ga0495657_0031496 | |||
| 1910 | Ga0495599_0011784 | |||
| 1911 | Ga0495623_0025535 | |||
| 1912 | Ga0495646_0006351 | |||
| 1913 | Ga0495647_0009478 | |||
| 1914 | Ga0495658_0041913 | |||
| 1915 | Ga0495613_0008530 | |||
| 1916 | Ga0495649_0152153 | |||
| 1917 | Ga0495600_0055760 | |||
| 1918 | Ga0495581_0000838 | |||
| 1919 | Ga0495581_0334930 | |||
| 1920 | Ga0495604_0043627 | |||
| 1921 | Ga0495604_0047733 | |||
| 1922 | Ga0495674_0045561 | |||
| 1923 | Ga0495676_0040521 | |||
| 1924 | Ga0495680_0065698 | |||
| 1925 | Ga0495680_0154836 | |||
| 1926 | Ga0495687_033524 | |||
| 1927 | Ga0495687_056745 | |||
| 1928 | Ga0495675_0016707 | |||
| 1929 | Ga0495684_0032940 | |||
| 1930 | Ga0495684_0123713 | |||
| 1931 | Ga0495593_0008079 | |||
| 1932 | Ga0495602_0000230 | |||
| 1933 | Ga0495602_0023230 | |||
| 1934 | Ga0496100_0063978 | |||
| 1935 | Ga0496100_0209269 | |||
| 1936 | Ga0496100_0317085 | |||
| 1937 | Ga0496101_0112452 | |||
| 1938 | Ga0496101_0196100 | |||
| 1939 | Ga0496102_0006952 | |||
| 1940 | Ga0496102_0103364 | |||
| 1941 | Ga0496102_0355179 | |||
| 1942 | Ga0496102_0504506 | |||
| 1943 | Ga0496102_0508558 | |||
| 1944 | Ga0496103_0064031 | |||
| 1945 | Ga0496103_0103374 | |||
| 1946 | Ga0496104_0116842 | |||
| 1947 | Ga0496105_0041734 | |||
| 1948 | Ga0496105_0180782 | |||
| 1949 | Ga0496106_0044529 | |||
| 1950 | Ga0496106_0322834 | |||
| 1951 | Ga0496107_0040341 | |||
| 1952 | Ga0496108_0115259 | |||
| 1953 | Ga0496109_0011659 | |||
| 1954 | Ga0496109_0326771 | |||
| 1955 | Ga0496109_0542097 | |||
| 1956 | Ga0496110_0234677 | |||
| 1957 | Ga0496110_0295157 | |||
| 1958 | Ga0496111_0251369 | |||
| 1959 | Ga0496112_0011589 | |||
| 1960 | Ga0496112_0078126 | |||
| 1961 | Ga0496113_0016702 | |||
| 1962 | Ga0496113_0070019 | |||
| 1963 | Ga0496116_0005644 | |||
| 1964 | Ga0496116_0010899 | |||
| 1965 | Ga0496116_0058508 | |||
| 1966 | Ga0496116_0060114 | |||
| 1967 | Ga0496116_0069692 | |||
| 1968 | Ga0496117_0000024 | |||
| 1969 | Ga0496117_0000151 | |||
| 1970 | Ga0496117_0009752 | |||
| 1971 | Ga0496118_0000014 | |||
| 1972 | Ga0496118_0000016 | |||
| 1973 | Ga0496118_0012449 | |||
| 1974 | Ga0496118_0058135 | |||
| 1975 | Ga0496118_0075382 | |||
| 1976 | Ga0496119_0002124 | |||
| 1977 | Ga0496119_0002302 | |||
| 1978 | Ga0496119_0006967 | |||
| 1979 | Ga0496119_0033719 | |||
| 1980 | Ga0496119_0042107 | |||
| 1981 | Ga0496119_0085815 | |||
| 1982 | Ga0496120_0004180 | |||
| 1983 | Ga0496120_0024323 | |||
| 1984 | Ga0496121_0001243 | |||
| 1985 | Ga0496121_0003216 | |||
| 1986 | Ga0496121_0004468 | |||
| 1987 | Ga0496121_0012476 | |||
| 1988 | Ga0496121_0048466 | |||
| 1989 | Ga0496121_0178453 | |||
| 1990 | Ga0496121_0212988 | |||
| 1991 | Ga0496122_0001381 | |||
| 1992 | Ga0496122_0026283 | |||
| 1993 | Ga0496122_0085209 | |||
| 1994 | Ga0496123_0000411 | |||
| 1995 | Ga0496123_0009295 | |||
| 1996 | Ga0496123_0046633 | |||
| 1997 | Ga0496124_0018504 | |||
| 1998 | Ga0496124_0023398 | |||
| 1999 | Ga0496124_0035173 | |||
| 2000 | Ga0496124_0050643 | |||
| 2001 | Ga0496124_0093302 | |||
| 2002 | Ga0496124_0094739 | |||
| 2003 | Ga0496125_0000011 | |||
| 2004 | Ga0496125_0000759 | |||
| 2005 | Ga0496125_0004038 | |||
| 2006 | Ga0496125_0018493 | |||
| 2007 | Ga0496125_0026580 | |||
| 2008 | Ga0496125_0089405 | |||
| 2009 | Ga0496126_0002263 | |||
| 2010 | Ga0496126_0007137 | |||
| 2011 | Ga0496126_0007197 | |||
| 2012 | Ga0496126_0100825 | |||
| 2013 | Ga0496126_0141282 | |||
| 2014 | Ga0496126_0160733 | |||
| 2015 | Ga0501031_0007394 | |||
| 2016 | Ga0501031_0032142 | |||
| 2017 | Ga0501031_0237618 | |||
| 2018 | Ga0501032_0009798 | |||
| 2019 | Ga0501032_0142906 | |||
| 2020 | Ga0501032_0162978 | |||
| 2021 | Ga0501033_0013025 | |||
| 2022 | Ga0501033_0031947 | |||
| 2023 | Ga0501033_0042219 | |||
| 2024 | Ga0501034_0046397 | |||
| 2025 | Ga0501034_0069339 | |||
| 2026 | Ga0501034_0104026 | |||
| 2027 | Ga0501034_0381963 | |||
| 2028 | Ga0501034_0452822 | |||
| 2029 | Ga0501034_0614967 | |||
| 2030 | Ga0501036_0005940 | |||
| 2031 | Ga0501036_0011396 | |||
| 2032 | Ga0501036_0055798 | |||
| 2033 | Ga0501036_0203441 | |||
| 2034 | Ga0501036_0228880 | |||
| 2035 | Ga0501036_0549238 | |||
| 2036 | Ga0501037_0136019 | |||
| 2037 | Ga0501037_0164579 | |||
| 2038 | Ga0501038_0003978 | |||
| 2039 | Ga0501038_0016537 | |||
| 2040 | Ga0501039_0004768 | |||
| 2041 | Ga0501039_0022208 | |||
| 2042 | Ga0501039_0111822 | |||
| 2043 | Ga0501039_0156225 | |||
| 2044 | Ga0501039_0163526 | |||
| 2045 | Ga0501039_0227798 | |||
| 2046 | Ga0501039_0243079 | |||
| 2047 | Ga0501040_0002910 | |||
| 2048 | Ga0501040_0003703 | |||
| 2049 | Ga0501040_0013219 | |||
| 2050 | Ga0501040_0052937 | |||
| 2051 | Ga0501040_0063824 | |||
| 2052 | Ga0501041_0003207 | |||
| 2053 | Ga0501041_0012828 | |||
| 2054 | Ga0501041_0028170 | |||
| 2055 | Ga0501041_0054412 | |||
| 2056 | Ga0501041_0063869 | |||
| 2057 | Ga0501041_0188152 | |||
| 2058 | Ga0501042_0004113 | |||
| 2059 | Ga0501042_0034453 | |||
| 2060 | Ga0501042_0336441 | |||
| 2061 | Ga0501042_0414320 | |||
| 2062 | Ga0501043_0052903 | |||
| 2063 | Ga0501046_0006343 | |||
| 2064 | Ga0501046_0006557 | |||
| 2065 | Ga0501046_0045310 | |||
| 2066 | Ga0501046_0104778 | |||
| 2067 | Ga0501046_0259384 | |||
| 2068 | Ga0501047_0208082 | |||
| 2069 | Ga0501048_0009506 | |||
| 2070 | Ga0501048_0018079 | |||
| 2071 | Ga0501048_0033976 | |||
| 2072 | Ga0501048_0133298 | |||
| 2073 | Ga0501048_0145338 | |||
| 2074 | Ga0501048_0146861 | |||
| 2075 | Ga0501048_0223769 | |||
| 2076 | Ga0501067_0022940 | |||
| 2077 | Ga0501067_0046289 | |||
| 2078 | Ga0501068_0029402 | |||
| 2079 | Ga0501068_0129211 | |||
| 2080 | Ga0501070_0000446 | |||
| 2081 | Ga0501070_0101758 | |||
| 2082 | Ga0501071_0013254 | |||
| 2083 | Ga0501071_0022554 | |||
| 2084 | Ga0501071_0101123 | |||
| 2085 | Ga0501072_0001734 | |||
| 2086 | Ga0501072_0006537 | |||
| 2087 | Ga0501072_0049910 | |||
| 2088 | Ga0501072_0087339 | |||
| 2089 | Ga0501072_0139668 | |||
| 2090 | Ga0501073_0009718 | |||
| 2091 | Ga0501073_0009857 | |||
| 2092 | Ga0501073_0014697 | |||
| 2093 | Ga0501073_0040143 | |||
| 2094 | Ga0501073_0092776 | |||
| 2095 | Ga0501073_0114580 | |||
| 2096 | Ga0501074_0024862 | |||
| 2097 | Ga0501074_0032787 | |||
| 2098 | Ga0501074_0063689 | |||
| 2099 | Ga0501074_0116847 | |||
| 2100 | Ga0501074_0159872 | |||
| 2101 | Ga0501075_0000282 | |||
| 2102 | Ga0501075_0003838 | |||
| 2103 | Ga0501075_0011522 | |||
| 2104 | Ga0501075_0015902 | |||
| 2105 | Ga0501075_0052844 | |||
| 2106 | Ga0501075_0247864 | |||
| 2107 | Ga0501075_0314420 | |||
| 2108 | Ga0501076_0000955 | |||
| 2109 | Ga0501076_0002461 | |||
| 2110 | Ga0501076_0020250 | |||
| 2111 | Ga0501076_0027639 | |||
| 2112 | Ga0501076_0039830 | |||
| 2113 | Ga0501076_0050402 | |||
| 2114 | Ga0501076_0346084 | |||
| 2115 | Ga0501076_0445338 | |||
| 2116 | Ga0501076_0447718 | |||
| 2117 | Ga0501077_0006923 | |||
| 2118 | Ga0501077_0007715 | |||
| 2119 | Ga0501077_0024697 | |||
| 2120 | Ga0501077_0039617 | |||
| 2121 | Ga0501252_000719 | |||
| 2122 | Ga0501079_0001340 | |||
| 2123 | Ga0501079_0002370 | |||
| 2124 | Ga0501079_0024982 | |||
| 2125 | Ga0501079_0215105 | |||
| 2126 | Ga0501079_0229806 | |||
| 2127 | Ga0501079_0350794 | |||
| 2128 | Ga0501080_0001574 | |||
| 2129 | Ga0501080_0002465 | |||
| 2130 | Ga0501080_0016499 | |||
| 2131 | Ga0501080_0055485 | |||
| 2132 | Ga0501080_0076684 | |||
| 2133 | Ga0501080_0542777 | |||
| 2134 | Ga0501080_0632172 | |||
| 2135 | Ga0501081_0000147 | |||
| 2136 | Ga0501081_0000552 | |||
| 2137 | Ga0501081_0002949 | |||
| 2138 | Ga0501081_0011022 | |||
| 2139 | Ga0501081_0028375 | |||
| 2140 | Ga0501081_0081301 | |||
| 2141 | Ga0501081_0086496 | |||
| 2142 | Ga0501081_0274222 | |||
| 2143 | Ga0501083_0016930 | |||
| 2144 | Ga0501083_0118144 | |||
| 2145 | Ga0501035_0036281 | |||
| 2146 | Ga0501035_0095305 | |||
| 2147 | Ga0501044_0106227 | |||
| 2148 | Ga0501044_0169055 | |||
| 2149 | Ga0501044_0381748 | |||
| 2150 | Ga0501045_0000401 | |||
| 2151 | Ga0501045_0004402 | |||
| 2152 | Ga0501045_0124199 | |||
| 2153 | Ga0501045_0135301 | |||
| 2154 | Ga0501045_0143311 | |||
| 2155 | nmdc:mga00v17_31397_c1 | |||
| 2156 | nmdc:mga0k408_139525_c1 | |||
| 2157 | nmdc:mga04h51_53784_c1 | |||
| 2158 | nmdc:mga05p37_150028_c1 | |||
| 2159 | nmdc:mga05p37_248800_c1 | |||
| 2160 | nmdc:mga05p37_416528_c1 | |||
| 2161 | nmdc:mga05p37_98508_c1 | |||
| 2162 | nmdc:mga09592_242121_c1 | |||
| 2163 | nmdc:mga0qj67_275984_c1 | |||
| 2164 | nmdc:mga0qj67_38204_c1 | |||
| 2165 | nmdc:mga06r32_228616_c1 | |||
| 2166 | nmdc:mga06r32_32508_c1 | |||
| 2167 | nmdc:mga06r32_33913_c1 | |||
| 2168 | nmdc:mga06r32_355355_c1 | |||
| 2169 | nmdc:mga06r32_40748_c1 | |||
| 2170 | nmdc:mga06r32_438315_c1 | |||
| 2171 | nmdc:mga06r32_441986_c1 | |||
| 2172 | nmdc:mga08y16_213141_c1 | |||
| 2173 | nmdc:mga08y16_229475_c1 | |||
| 2174 | nmdc:mga08y16_230019_c1 | |||
| 2175 | nmdc:mga08y16_293748_c1 | |||
| 2176 | nmdc:mga08y16_35895_c1 | |||
| 2177 | nmdc:mga08y16_5377_c2 | |||
| 2178 | nmdc:mga0n895_1121_c1 | |||
| 2179 | nmdc:mga0n895_188290_c1 | |||
| 2180 | nmdc:mga0n895_231741_c1 | |||
| 2181 | nmdc:mga0n895_260567_c1 | |||
| 2182 | nmdc:mga0rr50_66501_c1 | |||
| 2183 | nmdc:mga0rr50_80020_c1 | |||
| 2184 | nmdc:mga08x19_14319_c1 | |||
| 2185 | nmdc:mga0a205_110653_c1 | |||
| 2186 | nmdc:mga0a205_2501_c1 | |||
| 2187 | nmdc:mga0a205_574656_c1 | |||
| 2188 | nmdc:mga0sz30_185927_c1 | |||
| 2189 | Ga0495601_0008393 | |||
| 2190 | Ga0495612_0001142 | |||
| 2191 | Ga0495612_0143477 | |||
| 2192 | Ga0495595_0007709 | |||
| 2193 | Ga0495619_0011851 | |||
| 2194 | Ga0495619_0050966 | |||
| 2195 | Ga0495619_0405238 | |||
| 2196 | Ga0500646_0070609 | |||
| 2197 | Ga0500583_0015825 | |||
| 2198 | Ga0500583_0054104 | |||
| 2199 | Ga0500641_0003000 | |||
| 2200 | Ga0500650_0000025 | |||
| 2201 | Ga0500555_002546 | |||
| 2202 | Ga0500556_0001581 | |||
| 2203 | Ga0500562_018905 | |||
| 2204 | Ga0500591_070332 | |||
| 2205 | Ga0500617_039365 | |||
| 2206 | Ga0500618_020687 | |||
| 2207 | Ga0500559_0031324 | |||
| 2208 | Ga0500559_0108184 | |||
| 2209 | Ga0500573_0069269 | |||
| 2210 | Ga0500588_0018376 | |||
| 2211 | Ga0500616_0000073 | |||
| 2212 | Ga0500616_0034535 | |||
| 2213 | Ga0500616_0047796 | |||
| 2214 | Ga0500616_0101867 | |||
| 2215 | Ga0500622_0007236 | |||
| 2216 | Ga0500634_0000026 | |||
| 2217 | Ga0500639_083294 | |||
| 2218 | Ga0501084_0002063 | |||
| 2219 | Ga0501084_0003463 | |||
| 2220 | Ga0501084_0011958 | |||
| 2221 | Ga0501084_0013640 | |||
| 2222 | Ga0501084_0014584 | |||
| 2223 | Ga0501084_0119333 | |||
| 2224 | Ga0501084_0157325 | |||
| 2225 | Ga0501084_0209771 | |||
| 2226 | Ga0501084_0463514 | |||
| 2227 | Ga0501082_0002075 | |||
| 2228 | Ga0501082_0004888 | |||
| 2229 | Ga0501082_0012280 | |||
| 2230 | Ga0501082_0013531 | |||
| 2231 | Ga0501082_0032198 | |||
| 2232 | Ga0501082_0039470 | |||
| 2233 | Ga0501082_0052077 | |||
| 2234 | Ga0501082_0103899 | |||
| 2235 | Ga0501082_0308386 | |||
| 2236 | Ga0501082_0309888 | |||
| 2237 | Ga0501082_0422603 | |||
| 2238 | Ga0466962_0007564 | |||
| 2239 | Ga0530510_0012468 | |||
| 2240 | Ga0530510_0021387 | |||
| 2241 | Ga0530510_0046245 | |||
| 2242 | Ga0530510_0248105 | |||
| 2243 | 2512035213 | |||
| 2244 | 2524612077 | |||
| 2245 | 2585828224 | |||
| 2246 | 2585833912 | |||
| 2247 | 2599101100 | |||
| 2248 | 2599906106 | |||
| 2249 | 2643861890 | |||
| 2250 | 2643979946 | |||
| 2251 | 2644122541 | |||
| 2252 | 2644165078 | |||
| 2253 | 2644345653 | |||
| 2254 | 2729908184 | |||
| 2255 | 2809031607 | |||
| 2256 | 2821445913 | |||
| 2257 | 2842775765 | |||
| 2258 | 2844533393 | |||
| 2259 | 2844537943 | |||
| 2260 | 2846034770 | |||
| 2261 | 2846041159 | |||
| 2262 | 2846954180 | |||
| 2263 | 2848859655 | |||
| 2264 | 2857540863 | |||
| 2265 | 2858956415 | |||
| 2266 | 2898797260 | |||
| 2267 | 2904478359 | |||
| 2268 | 2919154614 | |||
| 2269 | 2927148051 | |||
| 2270 | 2928163577 | |||
| 2271 | 2941485815 | |||
| 2272 | 2981996527 | |||
| 2273 | 2998346693 | |||
| 2274 | 3000407782 | |||
| 2275 | 8018847185 | |||
| 2276 | 8054009098 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
75
263
0.82
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8637 | 7 | 245 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8421 | 8 | 244 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.8298 | 57 | 244 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.8153 | 6 | 244 |
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.8116 | 6 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFL1_11_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9807 | 9 | 244 | 1.10.3720.10 |
| af_P0AFK6_8_259_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9525 | 11 | 244 | 1.10.3720.10 |
| af_Q2G2A9_6_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9459 | 10 | 245 | 1.10.3720.10 |
| af_P0AFL1_11_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9265 | 9 | 244 | 1.10.3720.10 |
| af_P0AFR9_7_261_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9106 | 5 | 244 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0ZSD2-F1-model_v4 | Putrescine ABC transporter permease PotI | 0.9952 | 70 | 227 |
GO:0005886
GO:0055085 |
| AF-A0A6B8MDS5-F1-model_v4 | ABC transporter permease subunit | 0.9794 | 30 | 247 |
GO:0005886
GO:0055085 |
| AF-A0A3D0ZSD2-F1-model_v4 | Putrescine ABC transporter permease PotI | 0.9768 | 70 | 227 |
GO:0005886
GO:0055085 |
| AF-A0A2X3JMI3-F1-model_v4 | Putrescine ABC transporter membrane protein | 0.9764 | 3 | 248 |
GO:0005886
GO:0055085 |
| AF-A0A6P2JVI4-F1-model_v4 | deleted | 0.9764 | 9 | 244 |
|