F490666

General Info

Members Datasets Scaffolds Average Seq Length
1138 407 2277 210

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000750|Ga0395905_0000750_18342_19109
Length 255
Sequence MPPISGLTRKSHSGCSTLSSNHFFLLCKPAIAAGFFISVAATRYGKMRAMKNIVILISGRGSNMQAIVRAAQAEQWPCRIAAVISNRADAEGLMFAAEHGIATEVVVSKEFPSRDAFDAALRLAIDRFAPDLVVLAGFMRILTPGFVEHYAGRMLNIHPSLLPSFPGLATHRQALAAGVKVHGATVHFVTAELDHGPIVAQAAVPVLPGDTEHSLAERVLVQEHVIYPRAVRWFVEGRLSIDNGLVHVNEAAPSA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
229 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
235 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
239 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
264 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
342 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
343 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
344 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
376 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
380 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
381 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
382 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
383 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
384 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
395 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
398 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
399 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
403 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
404 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
405 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
406 2818991436 Collimonas arenae 515 Isolate Unclassified
407 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.53
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.78
Nodule 0.7
Rhizoplane 2.9
Rhizosphere 77.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0000750 3300037471 Bacteria 42802
2 JGI24740J21852_10000527 3300001979 Bacteria 16316
3 JGI24739J22299_10030478 3300001989 Bacteria 1870
4 JGI24737J22298_10012956 3300001990 Bacteria 2717
5 JGI24735J21928_10009274 3300002067 Bacteria 3165
6 JGI25155J39150_1000288 3300002704 Bacteria 17886
7 JGI25156J39149_1000695 3300002705 Bacteria 18063
8 JGI25156J39149_1002511 3300002705 Bacteria 6539
9 JGI25156J39149_1007991 3300002705 Bacteria 2711
10 JGI25154J39366_1000350 3300002738 Bacteria 26241
11 JGI25154J39366_1000571 3300002738 Bacteria 18063
12 JGI25154J39366_1001471 3300002738 Bacteria 8319
13 JGI25154J39366_1003202 3300002738 Bacteria 3600
14 JGI25154J39366_1003796 3300002738 Bacteria 2980
15 JGI25158J39367_1001641 3300002739 Bacteria 3856
16 JGI25157J39369_1000018 3300002741 Bacteria 177410
17 JGI25157J39369_1000773 3300002741 Bacteria 16575
18 JGI25150J39212_1012636 3300002774 Bacteria 1489
19 JGI25159J45721_1005067 3300002987 Bacteria 4197
20 JGI25151J46595_10035406 3300003187 Bacteria 1896
21 JGI25151J46595_10055552 3300003187 Bacteria 1304
22 JGI25165J46597_1000001 3300003214 Bacteria 1111887
23 JGI25153J46596_10017617 3300003215 Bacteria 2807
24 rootH2_10128398 3300003320 Bacteria 1100
25 rootL2_10017918 3300003322 Bacteria 1501
26 rootH1_10042583 3300003316 Bacteria 4075
27 rootH1_10042583 3300003323 Bacteria 1921
28 rootH1_10042585 3300003323 Bacteria 1207
29 rootH1_10186258 3300003323 Bacteria 1704
30 JGI25160J50197_1002021 3300003354 Bacteria 9671
31 JGI25161J50226_1001870 3300003374 Bacteria 5878
32 Ga0007409J51694_1041494 3300003575 Bacteria 3994
33 Ga0055538_1000001 3300003751 Bacteria 1111887
34 Ga0055539_1000001 3300003752 Bacteria 1111887
35 Ga0055539_1000146 3300003752 Bacteria 70677
36 Ga0055539_1000240 3300003752 Bacteria 36494
37 Ga0055539_1001263 3300003752 Bacteria 5036
38 Ga0055533_1000003 3300003756 Bacteria 1111887
39 Ga0055533_1000103 3300003756 Bacteria 107860
40 Ga0055533_1000150 3300003756 Bacteria 70677
41 Ga0055533_1001052 3300003756 Bacteria 7936
42 Ga0055532_1000005 3300003758 Bacteria 458107
43 Ga0055525_1000003 3300003759 Bacteria 962094
44 Ga0055525_1000198 3300003759 Bacteria 70677
45 Ga0055525_1001499 3300003759 Bacteria 4023
46 Ga0055535_1002863 3300003761 Bacteria 5417
47 Ga0055542_1002038 3300003762 Bacteria 7643
48 Ga0055526_1000161 3300003771 Bacteria 59705
49 Ga0055526_1000827 3300003771 Bacteria 23107
50 Ga0055526_1003727 3300003771 Bacteria 9515
51 Ga0055537_1000111 3300003773 Bacteria 61884
52 Ga0055524_1000015 3300003775 Bacteria 246493
53 Ga0055524_1002005 3300003775 Bacteria 10873
54 Ga0055524_1002542 3300003775 Bacteria 9325
55 Ga0055524_1005899 3300003775 Bacteria 5397
56 Ga0055524_1017165 3300003775 Bacteria 2563
57 Ga0055536_1000252 3300003781 Bacteria 42499
58 Ga0055534_1000268 3300003784 Bacteria 35791
59 Ga0055534_1002782 3300003784 Bacteria 5845
60 Ga0055534_1004596 3300003784 Bacteria 3938
61 Ga0055528_1000178 3300003790 Bacteria 53709
62 Ga0055530_10001043 3300003791 Bacteria 22076
63 Ga0055530_10028903 3300003791 Bacteria 1489
64 Ga0055540_1000001 3300003792 Bacteria 466834
65 Ga0055531_10002737 3300003794 Bacteria 11585
66 Ga0055531_10007375 3300003794 Bacteria 6022
67 Ga0055531_10021621 3300003794 Bacteria 2487
68 Ga0055541_1000001 3300003841 Bacteria 1111887
69 Ga0055541_1000098 3300003841 Bacteria 70677
70 Ga0055541_1000789 3300003841 Bacteria 7895
71 Ga0065165_1000286 3300005262 Bacteria 85993
72 Ga0065165_1058816 3300005262 Bacteria 1060
73 Ga0070658_10081833 3300005327 Bacteria 2653
74 Ga0070658_10086907 3300005327 Bacteria 2573
75 Ga0070658_10440175 3300005327 Bacteria 1122
76 Ga0070658_10646273 3300005327 Bacteria 918
77 Ga0070690_100031128 3300005330 Bacteria 3321
78 Ga0070670_100273775 3300005331 Bacteria 1473
79 Ga0070670_100295403 3300005331 Bacteria 1416
80 Ga0070677_10023109 3300005333 Bacteria 2299
81 Ga0068869_100037044 3300005334 Bacteria 3466
82 Ga0070666_10019648 3300005335 Bacteria 4365
83 Ga0068868_100195124 3300005338 Bacteria 1685
84 Ga0070660_100227965 3300005339 Bacteria 1515
85 Ga0070689_100346171 3300005340 Bacteria 1246
86 Ga0070661_100023457 3300005344 Bacteria 4422
87 Ga0070668_100059448 3300005347 Bacteria 2958
88 Ga0070669_100004469 3300005353 Bacteria 10075
89 Ga0070675_100066570 3300005354 Bacteria 2980
90 Ga0070675_100501698 3300005354 Bacteria 1093
91 Ga0070671_100031566 3300005355 Bacteria 4377
92 Ga0070671_100187716 3300005355 Bacteria 1751
93 Ga0070674_100028072 3300005356 Bacteria 3693
94 Ga0070673_100028417 3300005364 Bacteria 4159
95 Ga0070659_100003171 3300005366 Bacteria 11710
96 Ga0070659_100004714 3300005366 Bacteria 9733
97 Ga0070659_100174856 3300005366 Bacteria 1760
98 Ga0070667_100002718 3300005367 Bacteria 15313
99 Ga0070667_100246137 3300005367 Bacteria 1597
100 Ga0070701_10066089 3300005438 Bacteria 1921
101 Ga0070663_100023240 3300005455 Bacteria 4153
102 Ga0070663_100384565 3300005455 Bacteria 1144
103 Ga0070678_100130407 3300005456 Bacteria 1996
104 Ga0070662_100016597 3300005457 Bacteria 4947
105 Ga0068867_100027789 3300005459 Bacteria 4069
106 Ga0068867_100122049 3300005459 Bacteria 2015
107 Ga0068867_100800152 3300005459 Bacteria 841
108 Ga0070684_100508873 3300005535 Bacteria 1116
109 Ga0068853_100072486 3300005539 Bacteria 3001
110 Ga0068853_100551899 3300005539 Bacteria 1091
111 Ga0070672_100036953 3300005543 Bacteria 3724
112 Ga0070686_100065917 3300005544 Bacteria 2354
113 Ga0068855_100127299 3300005563 Bacteria 2911
114 Ga0068855_100430825 3300005563 Bacteria 1442
115 Ga0068857_100007953 3300005577 Bacteria 9152
116 Ga0068854_100004599 3300005578 Bacteria 8706
117 Ga0068856_100008259 3300005614 Bacteria 10149
118 Ga0068856_100056975 3300005614 Bacteria 3858
119 Ga0068856_100257418 3300005614 Bacteria 1760
120 Ga0068852_100102675 3300005616 Bacteria 2584
121 Ga0068852_100147709 3300005616 Bacteria 2182
122 Ga0068852_100186438 3300005616 Bacteria 1954
123 Ga0068852_100955562 3300005616 Bacteria 875
124 Ga0068864_100301443 3300005618 Bacteria 1500
125 Ga0068864_100560238 3300005618 Bacteria 1106
126 Ga0068866_10010619 3300005718 Bacteria 3954
127 Ga0068866_10309096 3300005718 Bacteria 990
128 Ga0068861_100016063 3300005719 Bacteria 5287
129 Ga0068861_100158841 3300005719 Bacteria 1863
130 Ga0068863_100019781 3300005841 Bacteria 6439
131 Ga0068863_100473095 3300005841 Bacteria 1231
132 Ga0068858_100017353 3300005842 Bacteria 6752
133 Ga0068860_100565456 3300005843 Bacteria 1140
134 Ga0075363_100043109 3300006048 Bacteria 2386
135 Ga0075366_10099523 3300006195 Bacteria 1744
136 Ga0075366_10197495 3300006195 Bacteria 1223
137 Ga0075370_10002946 3300006353 Bacteria 7999
138 Ga0075370_10271119 3300006353 Bacteria 1007
139 Ga0068871_100073893 3300006358 Bacteria 2812
140 Ga0068865_100114600 3300006881 Bacteria 1994
141 Ga0068865_100269843 3300006881 Bacteria 1350
142 Ga0099824_1036213 3300006942 Bacteria 1447
143 Ga0099823_1017932 3300006944 Bacteria 6859
144 Ga0079104_1000309 3300006946 Bacteria 61858
145 Ga0099826_10000018 3300006948 Bacteria 198330
146 Ga0105251_10002082 3300009011 Bacteria 16156
147 Ga0105251_10005601 3300009011 Bacteria 8174
148 Ga0105251_10013210 3300009011 Bacteria 4629
149 Ga0105251_10024566 3300009011 Bacteria 3093
150 Ga0105251_10049399 3300009011 Bacteria 2013
151 Ga0105244_10001133 3300009036 Bacteria 22165
152 Ga0105244_10002953 3300009036 Bacteria 12532
153 Ga0105244_10007523 3300009036 Bacteria 6913
154 Ga0105244_10061761 3300009036 Bacteria 1885
155 Ga0105240_10012100 3300009093 Bacteria 11952
156 Ga0105240_10017206 3300009093 Bacteria 9753
157 Ga0105240_10024629 3300009093 Bacteria 7928
158 Ga0105245_10262933 3300009098 Bacteria 1680
159 Ga0105243_10052625 3300009148 Bacteria 3226
160 Ga0105243_10054161 3300009148 Bacteria 3184
161 Ga0105241_10019955 3300009174 Bacteria 4947
162 Ga0105241_10186928 3300009174 Bacteria 1722
163 Ga0105242_10007036 3300009176 Bacteria 8688
164 Ga0105248_10078637 3300009177 Bacteria 3708
165 Ga0105237_10499422 3300009545 Bacteria 1223
166 Ga0105237_10755773 3300009545 Bacteria 979
167 Ga0105238_10030398 3300009551 Bacteria 5498
168 Ga0105238_10055566 3300009551 Bacteria 3974
169 Ga0105238_10061774 3300009551 Bacteria 3749
170 Ga0105249_10007528 3300009553 Bacteria 9500
171 Ga0105246_10099856 3300011119 Bacteria 2111
172 Ga0157373_10045986 3300013100 Bacteria 3115
173 Ga0157371_10000001 3300013102 Bacteria 1162285
174 Ga0157371_10207645 3300013102 Bacteria 1405
175 Ga0157370_10366078 3300013104 Bacteria 1328
176 Ga0157370_10764917 3300013104 Bacteria 880
177 Ga0157369_10169148 3300013105 Bacteria 2304
178 Ga0157369_10236802 3300013105 Bacteria 1907
179 Ga0157369_10383864 3300013105 Bacteria 1458
180 Ga0157374_10036965 3300013296 Bacteria 4477
181 Ga0157374_10132950 3300013296 Bacteria 2409
182 Ga0157378_10248522 3300013297 Bacteria 1702
183 Ga0163162_10040965 3300013306 Bacteria 4633
184 Ga0163162_10728762 3300013306 Bacteria 1112
185 Ga0157372_10361837 3300013307 Bacteria 1690
186 Ga0157372_10731731 3300013307 Bacteria 1150
187 Ga0157375_10008692 3300013308 Bacteria 8901
188 Ga0157375_10173565 3300013308 Bacteria 2304
189 Ga0157380_10051165 3300014326 Bacteria 3266
190 Ga0157380_10241647 3300014326 Bacteria 1628
191 Ga0182008_10003842 3300014497 Bacteria 8925
192 Ga0182008_10027616 3300014497 Bacteria 2873
193 Ga0157377_10228313 3300014745 Bacteria 1195
194 Ga0157376_10226589 3300014969 Bacteria 1734
195 Ga0157376_10345560 3300014969 Bacteria 1422
196 Ga0182006_1009422 3300015261 Bacteria 4374
197 Ga0182007_10004447 3300015262 Bacteria 6350
198 Ga0182007_10010110 3300015262 Bacteria 3748
199 Ga0182007_10081906 3300015262 Bacteria 1059
200 Ga0182007_10095791 3300015262 Bacteria 980
201 Ga0182005_1000158 3300015265 Bacteria 47201
202 Ga0213872_10000002 3300021361 Bacteria 554092
203 Ga0213872_10002809 3300021361 Bacteria 9960
204 Ga0213872_10019803 3300021361 Bacteria 3098
205 Ga0213872_10038157 3300021361 Bacteria 2193
206 Ga0213872_10046973 3300021361 Bacteria 1964
207 Ga0213872_10052963 3300021361 Bacteria 1841
208 Ga0213872_10141970 3300021361 Bacteria 1053
209 Ga0209435_100160 3300025206 Bacteria 21645
210 Ga0209435_100473 3300025206 Bacteria 7971
211 Ga0209435_109601 3300025206 Bacteria 1055
212 Ga0209436_100751 3300025208 Bacteria 13429
213 Ga0209784_100004 3300025224 Bacteria 1378156
214 Ga0209784_100365 3300025224 Bacteria 21497
215 Ga0209566_100004 3300025225 Bacteria 1531866
216 Ga0209566_100955 3300025225 Bacteria 13033
217 Ga0209674_100003 3300025226 Bacteria 2196646
218 Ga0209674_100006 3300025226 Bacteria 1531866
219 Ga0209674_100184 3300025226 Bacteria 68529
220 Ga0209147_100011 3300025229 Bacteria 702140
221 Ga0209563_100009 3300025230 Bacteria 1378156
222 Ga0209563_100010 3300025230 Bacteria 1337457
223 Ga0207427_101086 3300025231 Bacteria 11117
224 Ga0209437_100004 3300025233 Bacteria 1378156
225 Ga0209437_100259 3300025233 Bacteria 82489
226 Ga0209258_100525 3300025242 Bacteria 36665
227 Ga0209258_100580 3300025242 Bacteria 30726
228 Ga0209646_1000035 3300025246 Bacteria 363209
229 Ga0209646_1000067 3300025246 Bacteria 241595
230 Ga0209646_1000403 3300025246 Bacteria 25548
231 Ga0209646_1000503 3300025246 Bacteria 18211
232 Ga0209026_1000033 3300025250 Bacteria 318512
233 Ga0209026_1000760 3300025250 Bacteria 18093
234 Ga0209026_1000967 3300025250 Bacteria 14329
235 Ga0209026_1002757 3300025250 Bacteria 6282
236 Ga0209677_100005 3300025253 Bacteria 1378156
237 Ga0209677_100068 3300025253 Bacteria 146135
238 Ga0209677_100760 3300025253 Bacteria 16357
239 Ga0209677_102322 3300025253 Bacteria 7314
240 Ga0209677_102920 3300025253 Bacteria 5982
241 Ga0209148_1000293 3300025254 Bacteria 74776
242 Ga0209148_1005971 3300025254 Bacteria 2703
243 Ga0209759_1000024 3300025256 Bacteria 318512
244 Ga0209759_1000253 3300025256 Bacteria 79223
245 Ga0209759_1001054 3300025256 Bacteria 18214
246 Ga0209129_1000093 3300025258 Bacteria 173163
247 Ga0209233_1000005 3300025261 Bacteria 1531866
248 Ga0209565_1000009 3300025263 Bacteria 751701
249 Ga0209565_1000946 3300025263 Bacteria 15214
250 Ga0209565_1001578 3300025263 Bacteria 9718
251 Ga0209565_1002746 3300025263 Bacteria 6109
252 Ga0209565_1012113 3300025263 Bacteria 2071
253 Ga0209673_1000036 3300025273 Bacteria 323162
254 Ga0209673_1006646 3300025273 Bacteria 5523
255 Ga0209130_1001278 3300025284 Bacteria 17422
256 Ga0209130_1001458 3300025284 Bacteria 15552
257 Ga0209675_1000013 3300025291 Bacteria 448220
258 Ga0209675_1000100 3300025291 Bacteria 128565
259 Ga0209675_1000945 3300025291 Bacteria 18462
260 Ga0209675_1007213 3300025291 Bacteria 4304
261 Ga0209675_1009393 3300025291 Bacteria 3461
262 Ga0209676_1000012 3300025292 Bacteria 841431
263 Ga0209025_1001877 3300025294 Bacteria 24578
264 Ga0209025_1004210 3300025294 Bacteria 12682
265 Ga0209564_1000122 3300025295 Bacteria 203709
266 Ga0209564_1003837 3300025295 Bacteria 9718
267 Ga0209564_1003839 3300025295 Bacteria 9717
268 Ga0209564_1004073 3300025295 Bacteria 9216
269 Ga0209050_1000145 3300025298 Bacteria 168151
270 Ga0209050_1007847 3300025298 Bacteria 5863
271 Ga0209050_1012221 3300025298 Bacteria 3962
272 Ga0209256_1000005 3300025299 Bacteria 1315082
273 Ga0209256_1000061 3300025299 Bacteria 260890
274 Ga0209256_1000106 3300025299 Bacteria 187258
275 Ga0209256_1000269 3300025299 Bacteria 91493
276 Ga0209256_1000676 3300025299 Bacteria 46097
277 Ga0209256_1002862 3300025299 Bacteria 13132
278 Ga0209256_1007013 3300025299 Bacteria 5721
279 Ga0207426_1002626 3300025302 Bacteria 11130
280 Ga0209051_1000018 3300025303 Bacteria 527061
281 Ga0209051_1004528 3300025303 Bacteria 8521
282 Ga0209051_1005475 3300025303 Bacteria 7404
283 Ga0209051_1016272 3300025303 Bacteria 3376
284 Ga0209257_1000010 3300025304 Bacteria 1158682
285 Ga0209257_1000084 3300025304 Bacteria 291502
286 Ga0209257_1004271 3300025304 Bacteria 11259
287 Ga0207697_10031970 3300025315 Bacteria 2153
288 Ga0207656_10276333 3300025321 Bacteria 827
289 Ga0207655_1001288 3300025728 Bacteria 23781
290 Ga0207713_1000135 3300025735 Bacteria 112173
291 Ga0207713_1008988 3300025735 Bacteria 5683
292 Ga0207713_1055329 3300025735 Bacteria 1549
293 Ga0207682_10006644 3300025893 Bacteria 4648
294 Ga0207682_10039046 3300025893 Bacteria 1928
295 Ga0207642_10016456 3300025899 Bacteria 2786
296 Ga0207680_10018874 3300025903 Bacteria 3677
297 Ga0207647_10035754 3300025904 Bacteria 3163
298 Ga0207645_10029160 3300025907 Bacteria 3558
299 Ga0207645_10414350 3300025907 Bacteria 907
300 Ga0207643_10097419 3300025908 Bacteria 1721
301 Ga0207705_10106102 3300025909 Bacteria 2071
302 Ga0207705_10191215 3300025909 Bacteria 1548
303 Ga0207654_10289787 3300025911 Bacteria 1110
304 Ga0207695_10009547 3300025913 Bacteria 11996
305 Ga0207695_10010175 3300025913 Bacteria 11536
306 Ga0207695_10032918 3300025913 Bacteria 5665
307 Ga0207695_10079069 3300025913 Bacteria 3334
308 Ga0207671_10033303 3300025914 Bacteria 3833
309 Ga0207662_10002597 3300025918 Bacteria 9105
310 Ga0207657_10149395 3300025919 Bacteria 1904
311 Ga0207649_10252355 3300025920 Bacteria 1271
312 Ga0207681_10008770 3300025923 Bacteria 6176
313 Ga0207681_10184195 3300025923 Bacteria 1593
314 Ga0207694_10059333 3300025924 Bacteria 2975
315 Ga0207650_10350312 3300025925 Bacteria 1215
316 Ga0207659_10032977 3300025926 Bacteria 3559
317 Ga0207659_10038293 3300025926 Bacteria 3334
318 Ga0207687_10034805 3300025927 Bacteria 3423
319 Ga0207644_10048134 3300025931 Bacteria 3046
320 Ga0207690_10004058 3300025932 Bacteria 8649
321 Ga0207690_10507350 3300025932 Bacteria 976
322 Ga0207706_10015322 3300025933 Bacteria 6930
323 Ga0207706_10144106 3300025933 Bacteria 2096
324 Ga0207709_10002721 3300025935 Bacteria 10914
325 Ga0207670_10369958 3300025936 Bacteria 1139
326 Ga0207669_10006656 3300025937 Bacteria 5296
327 Ga0207691_10048281 3300025940 Bacteria 3904
328 Ga0207691_10093888 3300025940 Bacteria 2685
329 Ga0207691_10096426 3300025940 Bacteria 2644
330 Ga0207689_10011506 3300025942 Bacteria 7583
331 Ga0207689_10039908 3300025942 Bacteria 3886
332 Ga0207661_10052657 3300025944 Bacteria 3253
333 Ga0207667_10021476 3300025949 Bacteria 7152
334 Ga0207712_10009755 3300025961 Bacteria 6084
335 Ga0207668_10046072 3300025972 Bacteria 2977
336 Ga0207640_10079351 3300025981 Bacteria 2237
337 Ga0207640_10096861 3300025981 Bacteria 2058
338 Ga0207658_10013291 3300025986 Bacteria 5622
339 Ga0207677_10040223 3300026023 Bacteria 3080
340 Ga0207703_10005816 3300026035 Bacteria 9879
341 Ga0207678_10076301 3300026067 Bacteria 2871
342 Ga0207678_10422419 3300026067 Bacteria 1156
343 Ga0207678_10488071 3300026067 Bacteria 1073
344 Ga0207702_10001261 3300026078 Bacteria 25509
345 Ga0207702_10058186 3300026078 Bacteria 3288
346 Ga0207641_10005241 3300026088 Bacteria 11086
347 Ga0207648_10047299 3300026089 Bacteria 3772
348 Ga0207648_10225905 3300026089 Bacteria 1665
349 Ga0207648_10356977 3300026089 Bacteria 1318
350 Ga0207674_10057723 3300026116 Bacteria 3935
351 Ga0207675_100002925 3300026118 Bacteria 16801
352 Ga0207675_100111936 3300026118 Bacteria 2576
353 Ga0207683_10041387 3300026121 Bacteria 4024
354 Ga0207683_10377001 3300026121 Bacteria 1304
355 Ga0207698_10008917 3300026142 Bacteria 6359
356 Ga0207698_10121456 3300026142 Bacteria 2212
357 Ga0209281_1000103 3300027111 Bacteria 221425
358 Ga0209968_1001095 3300027526 Bacteria 4135
359 Ga0209282_1000002 3300027666 Bacteria 1067825
360 Ga0209282_1000052 3300027666 Bacteria 104317
361 Ga0209966_1000003 3300027695 Bacteria 111077
362 Ga0268266_10176480 3300028379 Bacteria 1943
363 Ga0268264_10001986 3300028381 Bacteria 18405
364 Ga0307515_10000708 3300028794 Bacteria 76903
365 Ga0307515_10013083 3300028794 Bacteria 15535
366 Ga0307515_10470144 3300028794 Bacteria 870
367 Ga0307511_10076838 3300030521 Bacteria 2383
368 Ga0307512_10056000 3300030522 Bacteria 3102
369 Ga0265328_10005685 3300031239 Bacteria 5326
370 Ga0265327_10000479 3300031251 Bacteria 70467
371 Ga0265327_10031415 3300031251 Bacteria 2984
372 Ga0307509_10073712 3300031507 Bacteria 3554
373 Ga0307508_10000169 3300031616 Bacteria 78769
374 Ga0307514_10085435 3300031649 Bacteria 2319
375 Ga0316576_10077095 3300031727 Bacteria 2468
376 Ga0307516_10008972 3300031730 Bacteria 11204
377 Ga0307516_10009988 3300031730 Bacteria 10508
378 Ga0307413_10273545 3300031824 Bacteria 1266
379 Ga0307518_10127414 3300031838 Bacteria 1794
380 Ga0307410_10247607 3300031852 Bacteria 1384
381 Ga0307409_100226671 3300031995 Bacteria 1691
382 Ga0307409_100280086 3300031995 Bacteria 1541
383 Ga0307416_100005407 3300032002 Bacteria 7838
384 Ga0307416_101791783 3300032002 Bacteria 718
385 Ga0307414_10094204 3300032004 Bacteria 2234
386 Ga0307507_10021968 3300033179 Bacteria 7077
387 Ga0316574_0086518 3300035398 Bacteria 1995
388 Ga0373924_0027378 3300035410 Bacteria 2266
389 Ga0373933_0320756 3300035724 Bacteria 1005
390 Ga0373937_0089551 3300036401 Bacteria 2849
391 Ga0373937_0468785 3300036401 Bacteria 1196
392 Ga0395899_0001064 3300037312 Bacteria 24780
393 Ga0395899_0002813 3300037312 Bacteria 14019
394 Ga0395899_0003608 3300037312 Bacteria 12242
395 Ga0395900_0000131 3300037418 Bacteria 125554
396 Ga0395900_0005698 3300037418 Bacteria 13021
397 Ga0395900_0283273 3300037418 Bacteria 1648
398 Ga0395898_0001532 3300037466 Bacteria 31823
399 Ga0395898_0097883 3300037466 Bacteria 2817
400 Ga0395905_0017710 3300037471 Bacteria 6763
401 Ga0395905_0025730 3300037471 Bacteria 5549
402 Ga0395905_0028213 3300037471 Bacteria 5291
403 Ga0395905_0063403 3300037471 Bacteria 3458
404 Ga0395905_0208288 3300037471 Bacteria 1832
405 Ga0395901_0000002 3300038443 Bacteria 761045
406 Ga0395901_0001718 3300038443 Bacteria 22613
407 Ga0395901_0136559 3300038443 Bacteria 2577
408 Ga0395901_1173314 3300038443 Bacteria 735
409 Ga0436361_0144599 3300039447 Bacteria 904
410 Ga0436361_0338967 3300039447 Bacteria 4771
411 Ga0436361_0600769 3300039447 Bacteria 3349
412 Ga0436361_0846070 3300039447 Bacteria 4410
413 Ga0439461_0030468 3300041410 Bacteria 1122
414 Ga0439465_0120827 3300041413 Bacteria 918
415 Ga0451789_0491830 3300041443 Bacteria 1054
416 Ga0451795_0419335 3300041456 Bacteria 1283
417 Ga0451802_0970336 3300041460 Bacteria 1525
418 Ga0451835_0864634 3300041492 Bacteria 979
419 Ga0451839_0718016 3300041496 Bacteria 862
420 Ga0451849_0077297 3300041505 Bacteria 878
421 Ga0451851_0770517 3300041507 Bacteria 1466
422 Ga0451843_0223084 3300041509 Bacteria 989
423 Ga0439431_0031742 3300041997 Bacteria 1314
424 Ga0439450_007594 3300042008 Bacteria 1993
425 Ga0450906_010415 3300042145 Bacteria 1759
426 Ga0439446_0014983 3300042156 Bacteria 2146
427 Ga0439434_0039325 3300042435 Bacteria 1451
428 Ga0439460_0095082 3300042461 Bacteria 951
429 Ga0450918_001746 3300042531 Bacteria 4228
430 Ga0451577_0091368 3300042876 Bacteria 2717
431 Ga0451577_0751880 3300042876 Bacteria 882
432 Ga0466969_0058160 3300044656 Bacteria 1882
433 Ga0466972_0000088 3300044658 Bacteria 84167
434 Ga0466972_0022575 3300044658 Bacteria 3132
435 Ga0466978_0109275 3300044671 Bacteria 1714
436 Ga0466965_0000666 3300044683 Bacteria 12609
437 Ga0466965_0002051 3300044683 Bacteria 8434
438 Ga0466966_0000687 3300044684 Bacteria 21520
439 Ga0466966_0006128 3300044684 Bacteria 7946
440 Ga0466966_0089471 3300044684 Bacteria 1912
441 Ga0466961_0001458 3300044693 Bacteria 14699
442 Ga0466961_0007342 3300044693 Bacteria 7013
443 Ga0466961_0018736 3300044693 Bacteria 4453
444 Ga0466963_0027945 3300044694 Bacteria 3616
445 Ga0466963_0047308 3300044694 Bacteria 2839
446 Ga0466964_0002548 3300044706 Bacteria 6493
447 Ga0466964_0002848 3300044706 Bacteria 6238
448 Ga0466964_0025767 3300044706 Bacteria 2298
449 Ga0466964_0040051 3300044706 Bacteria 1890
450 Ga0466964_0056879 3300044706 Bacteria 1618
451 Ga0466964_0113758 3300044706 Bacteria 1210
452 Ga0453684_0023234 3300044712 Bacteria 9147
453 Ga0466971_0005142 3300044719 Bacteria 5665
454 Ga0466971_0007302 3300044719 Bacteria 4811
455 Ga0466971_0017715 3300044719 Bacteria 3154
456 Ga0466971_0052756 3300044719 Bacteria 1832
457 Ga0466968_0063481 3300044735 Bacteria 1596
458 Ga0466970_0007806 3300044765 Bacteria 5370
459 Ga0466970_0028412 3300044765 Bacteria 2938
460 Ga0466970_0031025 3300044765 Bacteria 2821
461 Ga0466957_0047867 3300044842 Bacteria 2598
462 Ga0466957_0164008 3300044842 Bacteria 1444
463 Ga0466957_0192226 3300044842 Bacteria 1337
464 Ga0466960_0026488 3300044901 Bacteria 2634
465 Ga0466959_0000287 3300045049 Bacteria 30550
466 Ga0466959_0009422 3300045049 Bacteria 6947
467 Ga0466959_0052023 3300045049 Bacteria 3001
468 Ga0466959_0081458 3300045049 Bacteria 2332
469 Ga0451576_0074320 3300045051 Bacteria 3537
470 Ga0451576_0194483 3300045051 Bacteria 2118
471 Ga0466958_0011505 3300045836 Bacteria 4983
472 Ga0466958_0587412 3300045836 Bacteria 724
473 Ga0466967_0024766 3300045976 Bacteria 4939
474 Ga0466967_0090776 3300045976 Bacteria 2775
475 Ga0466967_0141742 3300045976 Bacteria 2239
476 Ga0495617_000002 3300046452 Bacteria 710121
477 Ga0495617_041726 3300046452 Bacteria 1533
478 Ga0495617_085942 3300046452 Bacteria 1028
479 Ga0495627_000207 3300046453 Bacteria 63763
480 Ga0495627_042518 3300046453 Bacteria 1392
481 Ga0495627_046735 3300046453 Bacteria 1314
482 Ga0495592_0030409 3300046454 Bacteria 4085
483 Ga0495592_0100052 3300046454 Bacteria 2067
484 Ga0495603_0106430 3300046455 Bacteria 1636
485 Ga0495603_0364263 3300046455 Bacteria 829
486 Ga0495590_0000025 3300046457 Bacteria 165221
487 Ga0495590_0018282 3300046457 Bacteria 2510
488 Ga0495590_0021071 3300046457 Bacteria 2312
489 Ga0495590_0054003 3300046457 Bacteria 1403
490 Ga0495591_002755 3300046458 Bacteria 9489
491 Ga0495629_0000878 3300046459 Bacteria 24225
492 Ga0495629_0005319 3300046459 Bacteria 9625
493 Ga0495638_0013390 3300046460 Bacteria 5585
494 Ga0495638_0016484 3300046460 Bacteria 4948
495 Ga0495638_0035516 3300046460 Bacteria 3177
496 Ga0495638_0073932 3300046460 Bacteria 2079
497 Ga0495638_0244567 3300046460 Bacteria 992
498 Ga0495651_0100121 3300046462 Bacteria 2159
499 Ga0495651_0134207 3300046462 Bacteria 1803
500 Ga0495651_0351245 3300046462 Bacteria 974
501 Ga0495653_0005181 3300046463 Bacteria 10598
502 Ga0495653_0007366 3300046463 Bacteria 9015
503 Ga0495653_0061355 3300046463 Bacteria 2845
504 Ga0495653_0105341 3300046463 Bacteria 2036
505 Ga0495653_0132732 3300046463 Bacteria 1760
506 Ga0495650_0000015 3300046471 Bacteria 557595
507 Ga0495650_0005573 3300046471 Bacteria 8121
508 Ga0495650_0006345 3300046471 Bacteria 7391
509 Ga0495650_0007195 3300046471 Bacteria 6744
510 Ga0495650_0008662 3300046471 Bacteria 5893
511 Ga0495650_0009150 3300046471 Bacteria 5673
512 Ga0495580_0016442 3300046472 Bacteria 5551
513 Ga0495580_0020600 3300046472 Bacteria 4878
514 Ga0495580_0023359 3300046472 Bacteria 4542
515 Ga0495580_0050910 3300046472 Bacteria 2928
516 Ga0495580_0115644 3300046472 Bacteria 1863
517 Ga0495580_0699376 3300046472 Bacteria 663
518 Ga0495582_0002333 3300046473 Bacteria 10632
519 Ga0495582_0027681 3300046473 Bacteria 3109
520 Ga0495582_0044024 3300046473 Bacteria 2458
521 Ga0495605_0001284 3300046474 Bacteria 16646
522 Ga0495605_0003031 3300046474 Bacteria 10141
523 Ga0495605_0012486 3300046474 Bacteria 4711
524 Ga0495605_0025196 3300046474 Bacteria 3101
525 Ga0495605_0026070 3300046474 Bacteria 3040
526 Ga0495605_0240640 3300046474 Bacteria 777
527 Ga0495662_0386912 3300046476 Bacteria 687
528 Ga0495664_0019005 3300046477 Bacteria 3946
529 Ga0495664_0495309 3300046477 Bacteria 730
530 Ga0495584_0000070 3300046491 Bacteria 73237
531 Ga0495584_0000560 3300046491 Bacteria 25087
532 Ga0495584_0004898 3300046491 Bacteria 7146
533 Ga0495584_0005783 3300046491 Bacteria 6521
534 Ga0495584_0007322 3300046491 Bacteria 5754
535 Ga0495584_0009129 3300046491 Bacteria 5119
536 Ga0495584_0288096 3300046491 Bacteria 834
537 Ga0495585_0000006 3300046492 Bacteria 320556
538 Ga0495585_0006233 3300046492 Bacteria 7430
539 Ga0495585_0006865 3300046492 Bacteria 7017
540 Ga0495585_0010286 3300046492 Bacteria 5578
541 Ga0495585_0010483 3300046492 Bacteria 5512
542 Ga0495585_0013461 3300046492 Bacteria 4786
543 Ga0495585_0026665 3300046492 Bacteria 3300
544 Ga0495585_0030854 3300046492 Bacteria 3047
545 Ga0495585_0032874 3300046492 Bacteria 2937
546 Ga0495585_0034744 3300046492 Bacteria 2850
547 Ga0495585_0059514 3300046492 Bacteria 2104
548 Ga0495585_0068952 3300046492 Bacteria 1930
549 Ga0495585_0154537 3300046492 Bacteria 1194
550 Ga0495585_0193122 3300046492 Bacteria 1040
551 Ga0495594_0003640 3300046499 Bacteria 7930
552 Ga0495594_0005742 3300046499 Bacteria 6374
553 Ga0495594_0013918 3300046499 Bacteria 4209
554 Ga0495594_0030537 3300046499 Bacteria 2917
555 Ga0495594_0069416 3300046499 Bacteria 1957
556 Ga0495596_0000240 3300046500 Bacteria 37159
557 Ga0495596_0001004 3300046500 Bacteria 16768
558 Ga0495596_0001839 3300046500 Bacteria 11778
559 Ga0495596_0008211 3300046500 Bacteria 4655
560 Ga0495596_0008902 3300046500 Bacteria 4440
561 Ga0495596_0009505 3300046500 Bacteria 4274
562 Ga0495596_0011786 3300046500 Bacteria 3754
563 Ga0495596_0012683 3300046500 Bacteria 3598
564 Ga0495596_0031054 3300046500 Bacteria 2136
565 Ga0495596_0033692 3300046500 Bacteria 2038
566 Ga0495596_0041071 3300046500 Bacteria 1824
567 Ga0495596_0070668 3300046500 Bacteria 1356
568 Ga0495596_0196268 3300046500 Bacteria 784
569 Ga0495607_0002594 3300046501 Bacteria 14550
570 Ga0495607_0004085 3300046501 Bacteria 10913
571 Ga0495607_0005057 3300046501 Bacteria 9558
572 Ga0495607_0009947 3300046501 Bacteria 6404
573 Ga0495607_0014386 3300046501 Bacteria 5152
574 Ga0495607_0017453 3300046501 Bacteria 4607
575 Ga0495607_0031280 3300046501 Bacteria 3259
576 Ga0495607_0046605 3300046501 Bacteria 2544
577 Ga0495607_0068424 3300046501 Bacteria 1991
578 Ga0495607_0106432 3300046501 Bacteria 1493
579 Ga0495607_0117837 3300046501 Bacteria 1398
580 Ga0495607_0307808 3300046501 Bacteria 743
581 Ga0495583_0000056 3300046506 Bacteria 200858
582 Ga0495583_0000159 3300046506 Bacteria 113627
583 Ga0495583_0000372 3300046506 Bacteria 69750
584 Ga0495583_0000382 3300046506 Bacteria 68388
585 Ga0495583_0000864 3300046506 Bacteria 36820
586 Ga0495583_0002345 3300046506 Bacteria 16395
587 Ga0495583_0004885 3300046506 Bacteria 9353
588 Ga0495583_0023202 3300046506 Bacteria 3144
589 Ga0495583_0056880 3300046506 Bacteria 1761
590 Ga0495583_0101613 3300046506 Bacteria 1226
591 Ga0495583_0167063 3300046506 Bacteria 905
592 Ga0495583_0209989 3300046506 Bacteria 789
593 Ga0495606_0002998 3300046507 Bacteria 18539
594 Ga0495606_0004210 3300046507 Bacteria 14562
595 Ga0495606_0013849 3300046507 Bacteria 6332
596 Ga0495606_0038316 3300046507 Bacteria 3244
597 Ga0495606_0039674 3300046507 Bacteria 3169
598 Ga0495606_0041103 3300046507 Bacteria 3102
599 Ga0495606_0133232 3300046507 Bacteria 1475
600 Ga0495606_0133665 3300046507 Bacteria 1472
601 Ga0495606_0306052 3300046507 Bacteria 859
602 Ga0495608_0072156 3300046511 Bacteria 2252
603 Ga0495610_0004511 3300046512 Bacteria 10257
604 Ga0495610_0006028 3300046512 Bacteria 8463
605 Ga0495610_0020472 3300046512 Bacteria 3673
606 Ga0495610_0035172 3300046512 Bacteria 2574
607 Ga0495616_0000057 3300046513 Bacteria 100806
608 Ga0495616_0003140 3300046513 Bacteria 10676
609 Ga0495616_0004533 3300046513 Bacteria 8746
610 Ga0495616_0010511 3300046513 Bacteria 5355
611 Ga0495616_0015188 3300046513 Bacteria 4284
612 Ga0495616_0015417 3300046513 Bacteria 4251
613 Ga0495616_0015591 3300046513 Bacteria 4222
614 Ga0495616_0028366 3300046513 Bacteria 2964
615 Ga0495616_0031036 3300046513 Bacteria 2802
616 Ga0495616_0101666 3300046513 Bacteria 1347
617 Ga0495620_0030549 3300046515 Bacteria 2479
618 Ga0495620_0041244 3300046515 Bacteria 2026
619 Ga0495620_0049470 3300046515 Bacteria 1798
620 Ga0495620_0049791 3300046515 Bacteria 1790
621 Ga0495628_0029302 3300046516 Bacteria 4464
622 Ga0495628_0079729 3300046516 Bacteria 2545
623 Ga0495630_0044173 3300046517 Bacteria 3329
624 Ga0495630_0058357 3300046517 Bacteria 2893
625 Ga0495631_0002820 3300046518 Bacteria 9652
626 Ga0495631_0003219 3300046518 Bacteria 8985
627 Ga0495631_0005293 3300046518 Bacteria 6776
628 Ga0495631_0012520 3300046518 Bacteria 4139
629 Ga0495631_0014987 3300046518 Bacteria 3727
630 Ga0495631_0015637 3300046518 Bacteria 3630
631 Ga0495631_0015837 3300046518 Bacteria 3604
632 Ga0495631_0016374 3300046518 Bacteria 3536
633 Ga0495631_0021138 3300046518 Bacteria 3032
634 Ga0495631_0030586 3300046518 Bacteria 2441
635 Ga0495631_0045981 3300046518 Bacteria 1920
636 Ga0495631_0144685 3300046518 Bacteria 1020
637 Ga0495631_0181164 3300046518 Bacteria 902
638 Ga0495632_0000129 3300046519 Bacteria 77134
639 Ga0495632_0000296 3300046519 Bacteria 48157
640 Ga0495632_0000375 3300046519 Bacteria 42575
641 Ga0495632_0008199 3300046519 Bacteria 6452
642 Ga0495632_0022106 3300046519 Bacteria 3415
643 Ga0495632_0022797 3300046519 Bacteria 3351
644 Ga0495632_0025075 3300046519 Bacteria 3158
645 Ga0495632_0026117 3300046519 Bacteria 3078
646 Ga0495637_0000126 3300046520 Bacteria 57018
647 Ga0495637_0023626 3300046520 Bacteria 2790
648 Ga0495637_0070124 3300046520 Bacteria 1416
649 Ga0495643_0000415 3300046522 Bacteria 55824
650 Ga0495643_0011985 3300046522 Bacteria 5248
651 Ga0495643_0026575 3300046522 Bacteria 3264
652 Ga0495643_0031662 3300046522 Bacteria 2942
653 Ga0495643_0048513 3300046522 Bacteria 2294
654 Ga0495643_0095437 3300046522 Bacteria 1529
655 Ga0495643_0125066 3300046522 Bacteria 1295
656 Ga0495643_0313931 3300046522 Bacteria 710
657 Ga0495644_0000389 3300046523 Bacteria 19747
658 Ga0495644_0001948 3300046523 Bacteria 8291
659 Ga0495644_0003401 3300046523 Bacteria 6293
660 Ga0495644_0003438 3300046523 Bacteria 6265
661 Ga0495644_0007023 3300046523 Bacteria 4355
662 Ga0495644_0007542 3300046523 Bacteria 4194
663 Ga0495644_0009481 3300046523 Bacteria 3752
664 Ga0495644_0013643 3300046523 Bacteria 3117
665 Ga0495648_0000708 3300046524 Bacteria 35539
666 Ga0495648_0001488 3300046524 Bacteria 22912
667 Ga0495648_0007168 3300046524 Bacteria 8955
668 Ga0495648_0011619 3300046524 Bacteria 6616
669 Ga0495648_0036925 3300046524 Bacteria 3144
670 Ga0495648_0038209 3300046524 Bacteria 3074
671 Ga0495648_0048317 3300046524 Bacteria 2620
672 Ga0495648_0085064 3300046524 Bacteria 1788
673 Ga0495648_0165099 3300046524 Bacteria 1140
674 Ga0495648_0215620 3300046524 Bacteria 950
675 Ga0495663_0002556 3300046525 Bacteria 5436
676 Ga0495663_0017672 3300046525 Bacteria 2026
677 Ga0495663_0086948 3300046525 Bacteria 1014
678 Ga0495666_0000318 3300046526 Bacteria 20936
679 Ga0495666_0000556 3300046526 Bacteria 16645
680 Ga0495666_0008615 3300046526 Bacteria 5110
681 Ga0495666_0018785 3300046526 Bacteria 3434
682 Ga0495666_0039750 3300046526 Bacteria 2282
683 Ga0495666_0046494 3300046526 Bacteria 2092
684 Ga0495642_0000613 3300046528 Bacteria 17935
685 Ga0495642_0004874 3300046528 Bacteria 5186
686 Ga0495642_0007226 3300046528 Bacteria 4262
687 Ga0495642_0009239 3300046528 Bacteria 3774
688 Ga0495642_0011089 3300046528 Bacteria 3456
689 Ga0495642_0012989 3300046528 Bacteria 3215
690 Ga0495642_0016483 3300046528 Bacteria 2880
691 Ga0495642_0041624 3300046528 Bacteria 1869
692 Ga0495642_0066401 3300046528 Bacteria 1503
693 Ga0495642_0069897 3300046528 Bacteria 1467
694 Ga0495652_0001577 3300046529 Bacteria 24927
695 Ga0495654_0000381 3300046530 Bacteria 38197
696 Ga0495654_0004611 3300046530 Bacteria 8134
697 Ga0495654_0018761 3300046530 Bacteria 3621
698 Ga0495654_0028918 3300046530 Bacteria 2830
699 Ga0495654_0107634 3300046530 Bacteria 1275
700 Ga0495654_0198012 3300046530 Bacteria 861
701 Ga0495665_0020210 3300046531 Bacteria 3578
702 Ga0495665_0049520 3300046531 Bacteria 2227
703 Ga0495665_0060088 3300046531 Bacteria 2006
704 Ga0495640_0017736 3300046533 Bacteria 5297
705 Ga0495586_0009827 3300046535 Bacteria 5093
706 Ga0495586_0012802 3300046535 Bacteria 4445
707 Ga0495586_0024342 3300046535 Bacteria 3236
708 Ga0495586_0152531 3300046535 Bacteria 1300
709 Ga0495587_0243573 3300046536 Bacteria 1012
710 Ga0495609_0001536 3300046538 Bacteria 15150
711 Ga0495609_0003404 3300046538 Bacteria 9126
712 Ga0495609_0003442 3300046538 Bacteria 9060
713 Ga0495609_0004070 3300046538 Bacteria 8147
714 Ga0495609_0004682 3300046538 Bacteria 7411
715 Ga0495609_0015930 3300046538 Bacteria 3509
716 Ga0495609_0016433 3300046538 Bacteria 3448
717 Ga0495609_0021815 3300046538 Bacteria 2954
718 Ga0495609_0029412 3300046538 Bacteria 2502
719 Ga0495609_0033768 3300046538 Bacteria 2321
720 Ga0495609_0048047 3300046538 Bacteria 1908
721 Ga0495609_0065495 3300046538 Bacteria 1601
722 Ga0495609_0099802 3300046538 Bacteria 1258
723 Ga0495621_0003776 3300046539 Bacteria 4199
724 Ga0495597_0001388 3300046542 Bacteria 17478
725 Ga0495597_0002423 3300046542 Bacteria 11849
726 Ga0495597_0003311 3300046542 Bacteria 9513
727 Ga0495597_0005681 3300046542 Bacteria 6565
728 Ga0495597_0009715 3300046542 Bacteria 4739
729 Ga0495597_0010710 3300046542 Bacteria 4471
730 Ga0495597_0035088 3300046542 Bacteria 2264
731 Ga0495597_0038705 3300046542 Bacteria 2137
732 Ga0495597_0171388 3300046542 Bacteria 881
733 Ga0495597_0219965 3300046542 Bacteria 754
734 Ga0495645_0037487 3300046543 Bacteria 3534
735 Ga0495645_0211290 3300046543 Bacteria 1310
736 Ga0495645_0392211 3300046543 Bacteria 886
737 Ga0495622_0000064 3300046557 Bacteria 93789
738 Ga0495622_0000570 3300046557 Bacteria 22156
739 Ga0495622_0006368 3300046557 Bacteria 5479
740 Ga0495622_0032190 3300046557 Bacteria 2448
741 Ga0495622_0054258 3300046557 Bacteria 1860
742 Ga0495622_0102906 3300046557 Bacteria 1308
743 Ga0495633_0003338 3300046558 Bacteria 10778
744 Ga0495633_0004954 3300046558 Bacteria 8314
745 Ga0495633_0008291 3300046558 Bacteria 5875
746 Ga0495633_0032773 3300046558 Bacteria 2508
747 Ga0495633_0034346 3300046558 Bacteria 2440
748 Ga0495633_0060270 3300046558 Bacteria 1778
749 Ga0495633_0065743 3300046558 Bacteria 1694
750 Ga0495633_0079803 3300046558 Bacteria 1523
751 Ga0495633_0115881 3300046558 Bacteria 1241
752 Ga0495633_0260102 3300046558 Bacteria 791
753 Ga0495656_0002704 3300046615 Bacteria 5923
754 Ga0495656_0017670 3300046615 Bacteria 2724
755 Ga0495656_0040418 3300046615 Bacteria 1943
756 Ga0495656_0044093 3300046615 Bacteria 1876
757 Ga0495656_0073514 3300046615 Bacteria 1525
758 Ga0495656_0300791 3300046615 Bacteria 822
759 Ga0495656_0386048 3300046615 Bacteria 730
760 Ga0495668_0000025 3300046616 Bacteria 304546
761 Ga0495668_0000544 3300046616 Bacteria 46835
762 Ga0495668_0000578 3300046616 Bacteria 44611
763 Ga0495668_0003733 3300046616 Bacteria 11198
764 Ga0495668_0021923 3300046616 Bacteria 3655
765 Ga0495668_0029684 3300046616 Bacteria 3088
766 Ga0495668_0034704 3300046616 Bacteria 2828
767 Ga0495668_0045031 3300046616 Bacteria 2452
768 Ga0495668_0055234 3300046616 Bacteria 2193
769 Ga0495668_0066242 3300046616 Bacteria 1987
770 Ga0495634_0053681 3300046642 Bacteria 2699
771 Ga0495634_0369017 3300046642 Bacteria 857
772 Ga0495611_0000946 3300046648 Bacteria 15555
773 Ga0495611_0003308 3300046648 Bacteria 7123
774 Ga0495611_0011108 3300046648 Bacteria 3814
775 Ga0495611_0012399 3300046648 Bacteria 3624
776 Ga0495611_0025380 3300046648 Bacteria 2582
777 Ga0495611_0030378 3300046648 Bacteria 2375
778 Ga0495611_0033374 3300046648 Bacteria 2270
779 Ga0495611_0101818 3300046648 Bacteria 1334
780 Ga0495611_0125987 3300046648 Bacteria 1194
781 Ga0495625_0004296 3300046660 Bacteria 13552
782 Ga0495625_0004306 3300046660 Bacteria 13526
783 Ga0495625_0026121 3300046660 Bacteria 4416
784 Ga0495625_0029610 3300046660 Bacteria 4091
785 Ga0495625_0040181 3300046660 Bacteria 3414
786 Ga0495625_0051408 3300046660 Bacteria 2954
787 Ga0495625_0052327 3300046660 Bacteria 2925
788 Ga0495625_0129530 3300046660 Bacteria 1710
789 Ga0495625_0155060 3300046660 Bacteria 1537
790 Ga0495625_0179307 3300046660 Bacteria 1410
791 Ga0495625_0249643 3300046660 Bacteria 1152
792 Ga0495635_0001292 3300046663 Bacteria 16730
793 Ga0495635_0015435 3300046663 Bacteria 5341
794 Ga0495635_0121076 3300046663 Bacteria 1785
795 Ga0495635_0246513 3300046663 Bacteria 1205
796 Ga0495659_0000526 3300046664 Bacteria 14120
797 Ga0495659_0000919 3300046664 Bacteria 10459
798 Ga0495659_0008635 3300046664 Bacteria 3243
799 Ga0495659_0013224 3300046664 Bacteria 2686
800 Ga0495659_0316897 3300046664 Bacteria 661
801 Ga0495661_0002258 3300046665 Bacteria 14917
802 Ga0495661_0004930 3300046665 Bacteria 9550
803 Ga0495661_0009057 3300046665 Bacteria 6849
804 Ga0495661_0016750 3300046665 Bacteria 4849
805 Ga0495661_0023263 3300046665 Bacteria 4022
806 Ga0495661_0024203 3300046665 Bacteria 3931
807 Ga0495661_0038868 3300046665 Bacteria 2961
808 Ga0495661_0051612 3300046665 Bacteria 2482
809 Ga0495661_0063697 3300046665 Bacteria 2178
810 Ga0495661_0088267 3300046665 Bacteria 1770
811 Ga0495661_0100596 3300046665 Bacteria 1627
812 Ga0495661_0103250 3300046665 Bacteria 1600
813 Ga0495661_0110688 3300046665 Bacteria 1531
814 Ga0495661_0168146 3300046665 Bacteria 1171
815 Ga0495661_0175233 3300046665 Bacteria 1140
816 Ga0495661_0218012 3300046665 Bacteria 990
817 Ga0495661_0316595 3300046665 Bacteria 776
818 Ga0495588_0003376 3300046674 Bacteria 6937
819 Ga0495588_0024317 3300046674 Bacteria 3008
820 Ga0495588_0036417 3300046674 Bacteria 2496
821 Ga0495588_0046183 3300046674 Bacteria 2233
822 Ga0495588_0096087 3300046674 Bacteria 1554
823 Ga0495588_0166293 3300046674 Bacteria 1166
824 Ga0495588_0189117 3300046674 Bacteria 1087
825 Ga0495599_0008525 3300046678 Bacteria 6237
826 Ga0495599_0175798 3300046678 Bacteria 1320
827 Ga0495623_0002848 3300046679 Bacteria 11409
828 Ga0495623_0091236 3300046679 Bacteria 1869
829 Ga0495623_0172788 3300046679 Bacteria 1261
830 Ga0495646_0001272 3300046680 Bacteria 14827
831 Ga0495646_0008984 3300046680 Bacteria 6344
832 Ga0495646_0119223 3300046680 Bacteria 1494
833 Ga0495646_0126911 3300046680 Bacteria 1439
834 Ga0495658_0229075 3300046683 Bacteria 1165
835 Ga0495669_0000092 3300046684 Bacteria 59765
836 Ga0495669_0000583 3300046684 Bacteria 16207
837 Ga0495669_0002000 3300046684 Bacteria 8364
838 Ga0495669_0014388 3300046684 Bacteria 3382
839 Ga0495669_0018903 3300046684 Bacteria 2968
840 Ga0495669_0053696 3300046684 Bacteria 1812
841 Ga0495669_0062837 3300046684 Bacteria 1683
842 Ga0495669_0097430 3300046684 Bacteria 1363
843 Ga0495613_0033961 3300046689 Bacteria 3789
844 Ga0495613_0108969 3300046689 Bacteria 1997
845 Ga0495613_0143776 3300046689 Bacteria 1703
846 Ga0495624_0004719 3300046690 Bacteria 9913
847 Ga0495624_0013356 3300046690 Bacteria 5600
848 Ga0495624_0018817 3300046690 Bacteria 4616
849 Ga0495624_0021868 3300046690 Bacteria 4236
850 Ga0495670_0001955 3300046691 Bacteria 10140
851 Ga0495670_0003903 3300046691 Bacteria 7323
852 Ga0495670_0023024 3300046691 Bacteria 3075
853 Ga0495670_0041036 3300046691 Bacteria 2308
854 Ga0495670_0053575 3300046691 Bacteria 2020
855 Ga0495670_0065194 3300046691 Bacteria 1835
856 Ga0495670_0097054 3300046691 Bacteria 1514
857 Ga0495670_0106660 3300046691 Bacteria 1447
858 Ga0495670_0110917 3300046691 Bacteria 1419
859 Ga0495670_0116948 3300046691 Bacteria 1383
860 Ga0495670_0263036 3300046691 Bacteria 921
861 Ga0495671_0002518 3300046692 Bacteria 11533
862 Ga0495671_0009131 3300046692 Bacteria 5552
863 Ga0495671_0011096 3300046692 Bacteria 4972
864 Ga0495671_0029990 3300046692 Bacteria 2788
865 Ga0495671_0035806 3300046692 Bacteria 2519
866 Ga0495671_0056700 3300046692 Bacteria 1939
867 Ga0495671_0101401 3300046692 Bacteria 1407
868 Ga0495671_0138840 3300046692 Bacteria 1184
869 Ga0495649_0001463 3300046694 Bacteria 17755
870 Ga0495649_0003126 3300046694 Bacteria 11347
871 Ga0495649_0005200 3300046694 Bacteria 8334
872 Ga0495649_0006435 3300046694 Bacteria 7310
873 Ga0495649_0006781 3300046694 Bacteria 7093
874 Ga0495649_0009242 3300046694 Bacteria 5871
875 Ga0495649_0015381 3300046694 Bacteria 4357
876 Ga0495649_0029688 3300046694 Bacteria 3022
877 Ga0495649_0063457 3300046694 Bacteria 1984
878 Ga0495649_0118121 3300046694 Bacteria 1403
879 Ga0495649_0122041 3300046694 Bacteria 1377
880 Ga0495649_0152974 3300046694 Bacteria 1211
881 Ga0495649_0194707 3300046694 Bacteria 1054
882 Ga0495649_0304778 3300046694 Bacteria 810
883 Ga0495649_0319066 3300046694 Bacteria 789
884 Ga0495589_0000032 3300046794 Bacteria 167736
885 Ga0495589_0002314 3300046794 Bacteria 10704
886 Ga0495589_0004788 3300046794 Bacteria 7194
887 Ga0495589_0005625 3300046794 Bacteria 6611
888 Ga0495589_0013093 3300046794 Bacteria 4283
889 Ga0495589_0014852 3300046794 Bacteria 4006
890 Ga0495589_0024976 3300046794 Bacteria 3034
891 Ga0495589_0050404 3300046794 Bacteria 2059
892 Ga0495589_0090532 3300046794 Bacteria 1485
893 Ga0495589_0103208 3300046794 Bacteria 1378
894 Ga0495589_0115136 3300046794 Bacteria 1296
895 Ga0495589_0146367 3300046794 Bacteria 1129
896 Ga0495600_0000474 3300046809 Bacteria 20802
897 Ga0495600_0002069 3300046809 Bacteria 11320
898 Ga0495660_0009441 3300046810 Bacteria 5688
899 Ga0495660_0010483 3300046810 Bacteria 5390
900 Ga0495660_0011814 3300046810 Bacteria 5062
901 Ga0495660_0013996 3300046810 Bacteria 4651
902 Ga0495660_0025613 3300046810 Bacteria 3349
903 Ga0495660_0042266 3300046810 Bacteria 2519
904 Ga0495660_0071539 3300046810 Bacteria 1839
905 Ga0495581_0008394 3300047315 Bacteria 5987
906 Ga0495581_0015215 3300047315 Bacteria 4465
907 Ga0495581_0015668 3300047315 Bacteria 4399
908 Ga0495604_0020165 3300047317 Bacteria 5327
909 Ga0495604_0030329 3300047317 Bacteria 4295
910 Ga0495604_0038987 3300047317 Bacteria 3735
911 Ga0495604_0047559 3300047317 Bacteria 3340
912 Ga0495604_0051135 3300047317 Bacteria 3205
913 Ga0495636_0001913 3300047318 Bacteria 7964
914 Ga0495636_0002620 3300047318 Bacteria 6925
915 Ga0495636_0028437 3300047318 Bacteria 2280
916 Ga0495636_0042381 3300047318 Bacteria 1891
917 Ga0495636_0051765 3300047318 Bacteria 1722
918 Ga0495674_0004291 3300047319 Bacteria 13716
919 Ga0495674_0008961 3300047319 Bacteria 9507
920 Ga0495674_0359082 3300047319 Bacteria 1181
921 Ga0495674_0400908 3300047319 Bacteria 1107
922 Ga0495672_0000041 3300047320 Bacteria 267545
923 Ga0495672_0004140 3300047320 Bacteria 12054
924 Ga0495672_0006589 3300047320 Bacteria 8943
925 Ga0495672_0042796 3300047320 Bacteria 2728
926 Ga0495672_0052973 3300047320 Bacteria 2380
927 Ga0495672_0156877 3300047320 Bacteria 1174
928 Ga0495672_0289083 3300047320 Bacteria 780
929 Ga0495676_0000235 3300047321 Bacteria 44374
930 Ga0495676_0025419 3300047321 Bacteria 5113
931 Ga0495676_0045906 3300047321 Bacteria 3551
932 Ga0495676_0122523 3300047321 Bacteria 1889
933 Ga0495680_0042503 3300047322 Bacteria 3605
934 Ga0495683_0001361 3300047323 Bacteria 16273
935 Ga0495683_0003295 3300047323 Bacteria 9440
936 Ga0495683_0004350 3300047323 Bacteria 8069
937 Ga0495683_0016473 3300047323 Bacteria 3838
938 Ga0495683_0030886 3300047323 Bacteria 2731
939 Ga0495683_0034026 3300047323 Bacteria 2592
940 Ga0495683_0045537 3300047323 Bacteria 2204
941 Ga0495683_0070388 3300047323 Bacteria 1717
942 Ga0495683_0114245 3300047323 Bacteria 1286
943 Ga0495683_0229991 3300047323 Bacteria 823
944 Ga0495687_000127 3300047443 Bacteria 117520
945 Ga0495687_000143 3300047443 Bacteria 108306
946 Ga0495687_001108 3300047443 Bacteria 26234
947 Ga0495687_004036 3300047443 Bacteria 10188
948 Ga0495687_008098 3300047443 Bacteria 6072
949 Ga0495687_034999 3300047443 Bacteria 2263
950 Ga0495687_036591 3300047443 Bacteria 2195
951 Ga0495675_0081573 3300047444 Bacteria 2036
952 Ga0495675_0532871 3300047444 Bacteria 671
953 Ga0495677_0003200 3300047445 Bacteria 6384
954 Ga0495677_0005113 3300047445 Bacteria 4995
955 Ga0495677_0006278 3300047445 Bacteria 4490
956 Ga0495677_0007859 3300047445 Bacteria 3969
957 Ga0495677_0009153 3300047445 Bacteria 3659
958 Ga0495677_0024912 3300047445 Bacteria 2170
959 Ga0495677_0026448 3300047445 Bacteria 2105
960 Ga0495677_0049226 3300047445 Bacteria 1548
961 Ga0495677_0054027 3300047445 Bacteria 1481
962 Ga0495677_0076995 3300047445 Bacteria 1247
963 Ga0495677_0081048 3300047445 Bacteria 1216
964 Ga0495679_000037 3300047446 Bacteria 158099
965 Ga0495679_005470 3300047446 Bacteria 5628
966 Ga0495679_021280 3300047446 Bacteria 2243
967 Ga0495679_033196 3300047446 Bacteria 1650
968 Ga0495685_000113 3300047447 Bacteria 28884
969 Ga0495685_001114 3300047447 Bacteria 8216
970 Ga0495685_008745 3300047447 Bacteria 3372
971 Ga0495685_014165 3300047447 Bacteria 2708
972 Ga0495685_015742 3300047447 Bacteria 2582
973 Ga0495685_024327 3300047447 Bacteria 2084
974 Ga0495673_0006800 3300047469 Bacteria 6678
975 Ga0495673_0040844 3300047469 Bacteria 2091
976 Ga0495673_0047964 3300047469 Bacteria 1885
977 Ga0495681_0000694 3300047470 Bacteria 25709
978 Ga0495681_0001600 3300047470 Bacteria 16834
979 Ga0495681_0002505 3300047470 Bacteria 13086
980 Ga0495681_0004999 3300047470 Bacteria 8943
981 Ga0495681_0019417 3300047470 Bacteria 3712
982 Ga0495681_0019747 3300047470 Bacteria 3670
983 Ga0495681_0023569 3300047470 Bacteria 3267
984 Ga0495681_0028377 3300047470 Bacteria 2880
985 Ga0495681_0066454 3300047470 Bacteria 1645
986 Ga0495681_0075090 3300047470 Bacteria 1522
987 Ga0495686_0000288 3300047472 Bacteria 88523
988 Ga0495686_0000656 3300047472 Bacteria 47216
989 Ga0495686_0002328 3300047472 Bacteria 18154
990 Ga0495686_0007355 3300047472 Bacteria 8260
991 Ga0495686_0053453 3300047472 Bacteria 2531
992 Ga0495686_0060892 3300047472 Bacteria 2345
993 Ga0495593_0012820 3300047673 Bacteria 4788
994 Ga0495593_0012935 3300047673 Bacteria 4765
995 Ga0495593_0032542 3300047673 Bacteria 2842
996 Ga0495593_0048888 3300047673 Bacteria 2246
997 Ga0495602_0006574 3300048088 Bacteria 12184
998 Ga0495602_0022460 3300048088 Bacteria 6174
999 Ga0495602_0062779 3300048088 Bacteria 3222
1000 Ga0495602_0210740 3300048088 Bacteria 1475
1001 Ga0495614_0006362 3300048089 Bacteria 5305
1002 Ga0495614_0006654 3300048089 Bacteria 5174
1003 Ga0495614_0094288 3300048089 Bacteria 1304
1004 Ga0495626_0002049 3300048091 Bacteria 14744
1005 Ga0495626_0010705 3300048091 Bacteria 4878
1006 Ga0495626_0017842 3300048091 Bacteria 3579
1007 Ga0495626_0020742 3300048091 Bacteria 3270
1008 Ga0495626_0021140 3300048091 Bacteria 3232
1009 Ga0495626_0022862 3300048091 Bacteria 3085
1010 Ga0495626_0031484 3300048091 Bacteria 2552
1011 Ga0495626_0033862 3300048091 Bacteria 2446
1012 Ga0495626_0038091 3300048091 Bacteria 2281
1013 Ga0495626_0040299 3300048091 Bacteria 2207
1014 Ga0495626_0059781 3300048091 Bacteria 1738
1015 Ga0495626_0065980 3300048091 Bacteria 1637
1016 Ga0495626_0074515 3300048091 Bacteria 1518
1017 Ga0495626_0109953 3300048091 Bacteria 1194
1018 Ga0495626_0144554 3300048091 Bacteria 1006
1019 Ga0495626_0163969 3300048091 Bacteria 930
1020 Ga0496100_0016601 3300048903 Bacteria 4327
1021 Ga0496100_0171134 3300048903 Bacteria 1564
1022 Ga0496100_0458653 3300048903 Bacteria 978
1023 Ga0496100_0482716 3300048903 Bacteria 953
1024 Ga0496101_0030388 3300048904 Bacteria 3787
1025 Ga0496102_0000931 3300048905 Bacteria 27579
1026 Ga0496102_0401793 3300048905 Bacteria 1288
1027 Ga0496103_0022931 3300048906 Bacteria 3762
1028 Ga0496103_0056910 3300048906 Bacteria 2427
1029 Ga0496103_0529000 3300048906 Bacteria 753
1030 Ga0496104_0338360 3300048907 Bacteria 1418
1031 Ga0496105_0087572 3300048908 Bacteria 2573
1032 Ga0496107_0055316 3300048910 Bacteria 2866
1033 Ga0496109_0009606 3300048912 Bacteria 8249
1034 Ga0496109_0115613 3300048912 Bacteria 2496
1035 Ga0496110_0029094 3300048913 Bacteria 4750
1036 Ga0496110_0045736 3300048913 Bacteria 3827
1037 Ga0496110_0047706 3300048913 Bacteria 3752
1038 Ga0496110_0261305 3300048913 Bacteria 1576
1039 Ga0496110_0715854 3300048913 Bacteria 903
1040 Ga0496111_0014930 3300048914 Bacteria 5319
1041 Ga0496111_0342997 3300048914 Bacteria 1106
1042 Ga0496113_0008457 3300048916 Bacteria 6707
1043 Ga0496114_0439153 3300048917 Bacteria 1156
1044 Ga0496115_0018367 3300048918 Bacteria 5367
1045 Ga0496115_0020248 3300048918 Bacteria 5130
1046 Ga0496115_0055871 3300048918 Bacteria 3172
1047 Ga0496115_0220001 3300048918 Bacteria 1567
1048 Ga0496115_0238318 3300048918 Bacteria 1500
1049 Ga0496115_0276349 3300048918 Bacteria 1379
1050 Ga0496116_0014132 3300048919 Bacteria 6391
1051 Ga0496116_0026637 3300048919 Bacteria 4223
1052 Ga0496116_0033774 3300048919 Bacteria 3623
1053 Ga0496117_0028920 3300048920 Bacteria 4282
1054 Ga0496117_0114372 3300048920 Bacteria 1673
1055 Ga0496117_0121972 3300048920 Bacteria 1599
1056 Ga0496118_0002886 3300048921 Bacteria 22384
1057 Ga0496118_0040010 3300048921 Bacteria 3733
1058 Ga0496118_0060865 3300048921 Bacteria 2800
1059 Ga0496121_0014458 3300048924 Bacteria 8371
1060 Ga0496121_0084985 3300048924 Bacteria 2492
1061 Ga0496121_0197583 3300048924 Bacteria 1436
1062 Ga0496122_0000261 3300048925 Bacteria 118793
1063 Ga0496122_0000445 3300048925 Bacteria 86566
1064 Ga0496122_0011752 3300048925 Bacteria 8821
1065 Ga0496123_0000218 3300048926 Bacteria 116615
1066 Ga0496123_0001568 3300048926 Bacteria 31272
1067 Ga0496123_0007592 3300048926 Bacteria 10163
1068 Ga0496124_0015077 3300048927 Bacteria 7431
1069 Ga0496124_0015517 3300048927 Bacteria 7294
1070 Ga0496124_0046689 3300048927 Bacteria 3707
1071 Ga0496124_0097419 3300048927 Bacteria 2388
1072 Ga0496124_0151501 3300048927 Bacteria 1818
1073 Ga0496124_0237922 3300048927 Bacteria 1356
1074 Ga0496124_0351417 3300048927 Bacteria 1043
1075 Ga0496124_0429036 3300048927 Bacteria 908
1076 Ga0496125_0000256 3300048928 Bacteria 109696
1077 Ga0496125_0002859 3300048928 Bacteria 21722
1078 Ga0496125_0067915 3300048928 Bacteria 2806
1079 Ga0496126_0034799 3300048929 Bacteria 4726
1080 Ga0496126_0054778 3300048929 Bacteria 3611
1081 Ga0496126_0111802 3300048929 Bacteria 2379
1082 Ga0501306_002557 3300049127 Bacteria 1880
1083 Ga0501310_001443 3300049130 Bacteria 2171
1084 Ga0495678_000042 3300049459 Bacteria 174125
1085 Ga0495678_000316 3300049459 Bacteria 51625
1086 Ga0495678_003135 3300049459 Bacteria 10459
1087 Ga0495678_003427 3300049459 Bacteria 9828
1088 Ga0495678_003924 3300049459 Bacteria 8918
1089 Ga0495678_004684 3300049459 Bacteria 7829
1090 Ga0495678_006389 3300049459 Bacteria 6281
1091 Ga0495678_007748 3300049459 Bacteria 5531
1092 Ga0495678_009881 3300049459 Bacteria 4678
1093 Ga0495678_025595 3300049459 Bacteria 2532
1094 Ga0495678_033817 3300049459 Bacteria 2108
1095 Ga0495682_0000107 3300049460 Bacteria 73486
1096 Ga0495682_0033786 3300049460 Bacteria 1887
1097 Ga0495682_0038533 3300049460 Bacteria 1756
1098 Ga0495682_0084729 3300049460 Bacteria 1139
1099 Ga0495682_0094804 3300049460 Bacteria 1071
1100 Ga0501039_0066319 3300049575 Bacteria 2802
1101 Ga0501070_0147283 3300049586 Bacteria 1943
1102 Ga0501198_000102 3300049649 Bacteria 16377
1103 Ga0501222_000008 3300049662 Bacteria 120904
1104 Ga0501227_039267 3300049665 Bacteria 1164
1105 Ga0501249_003963 3300049679 Bacteria 2997
1106 Ga0501269_000210 3300049766 Bacteria 17330
1107 Ga0501279_000208 3300049775 Bacteria 8130
1108 Ga0501279_004406 3300049775 Bacteria 1847
1109 Ga0501279_036368 3300049775 Bacteria 744
1110 nmdc:mga03683_277888_c1 3300050489 Bacteria 782
1111 nmdc:mga0k408_132531_c1 3300050493 Bacteria 1480
1112 nmdc:mga0k408_177614_c1 3300050493 Bacteria 1270
1113 nmdc:mga0k408_196874_c1 3300050493 Bacteria 1203
1114 nmdc:mga0k408_22887_c1 3300050493 Bacteria 1916
1115 nmdc:mga0k408_487922_c1 3300050493 Bacteria 731
1116 nmdc:mga0k408_59835_c1 3300050493 Bacteria 2214
1117 nmdc:mga07m45_5487_c1 3300050496 Bacteria 6318
1118 nmdc:mga08x19_12730_c1 3300050514 Bacteria 5072
1119 Ga0495601_0030324 3300053077 Bacteria 3357
1120 Ga0495601_0239427 3300053077 Bacteria 1185
1121 Ga0500635_0000083 3300053080 Bacteria 61980
1122 Ga0495595_0136294 3300053084 Bacteria 1202
1123 Ga0500651_0112998 3300053093 Bacteria 1656
1124 Ga0500595_003047 3300053119 Bacteria 7965
1125 Ga0500619_000742 3300053154 Bacteria 5568
1126 Ga0500634_0108608 3300053161 Bacteria 1374
1127 Ga0500637_0152420 3300053178 Bacteria 1335
1128 Ga0500587_000079 3300053739 Bacteria 8123
1129 Ga0500661_006935 3300055283 Bacteria 2102
1130 Ga0587091_002909 3300059511 Bacteria 2096
1131 Ga0587062_001995 3300059639 Bacteria 1881
1132 Ga0587111_0003612 3300060346 Bacteria 2220
1133 Ga0466962_0002972 3300061719 Bacteria 8086
1134 Ga0466962_0003937 3300061719 Bacteria 7106
1135 2511248376 2511231003 Bacteria 5606035
1136 2550693536 2548876994 Bacteria 4904866
1137 2644030407 2643221603 Bacteria 6147767
1138 2819542751 2818991436 Bacteria 5376622
1139 2819594530 2818991445 Bacteria 4955017
1140 Ga0395905_0000750
1141 JGI24740J21852_10000527
1142 JGI24739J22299_10030478
1143 JGI24737J22298_10012956
1144 JGI24735J21928_10009274
1145 JGI25155J39150_1000288
1146 JGI25156J39149_1000695
1147 JGI25156J39149_1002511
1148 JGI25156J39149_1007991
1149 JGI25154J39366_1000350
1150 JGI25154J39366_1000571
1151 JGI25154J39366_1001471
1152 JGI25154J39366_1003202
1153 JGI25154J39366_1003796
1154 JGI25158J39367_1001641
1155 JGI25157J39369_1000018
1156 JGI25157J39369_1000773
1157 JGI25150J39212_1012636
1158 JGI25159J45721_1005067
1159 JGI25151J46595_10035406
1160 JGI25151J46595_10055552
1161 JGI25165J46597_1000001
1162 JGI25153J46596_10017617
1163 rootH2_10128398
1164 rootL2_10017918
1165 rootH1_10042583
1166 rootH1_10042585
1167 rootH1_10186258
1168 JGI25160J50197_1002021
1169 JGI25161J50226_1001870
1170 Ga0007409J51694_1041494
1171 Ga0055538_1000001
1172 Ga0055539_1000001
1173 Ga0055539_1000146
1174 Ga0055539_1000240
1175 Ga0055539_1001263
1176 Ga0055533_1000003
1177 Ga0055533_1000103
1178 Ga0055533_1000150
1179 Ga0055533_1001052
1180 Ga0055532_1000005
1181 Ga0055525_1000003
1182 Ga0055525_1000198
1183 Ga0055525_1001499
1184 Ga0055535_1002863
1185 Ga0055542_1002038
1186 Ga0055526_1000161
1187 Ga0055526_1000827
1188 Ga0055526_1003727
1189 Ga0055537_1000111
1190 Ga0055524_1000015
1191 Ga0055524_1002005
1192 Ga0055524_1002542
1193 Ga0055524_1005899
1194 Ga0055524_1017165
1195 Ga0055536_1000252
1196 Ga0055534_1000268
1197 Ga0055534_1002782
1198 Ga0055534_1004596
1199 Ga0055528_1000178
1200 Ga0055530_10001043
1201 Ga0055530_10028903
1202 Ga0055540_1000001
1203 Ga0055531_10002737
1204 Ga0055531_10007375
1205 Ga0055531_10021621
1206 Ga0055541_1000001
1207 Ga0055541_1000098
1208 Ga0055541_1000789
1209 Ga0065165_1000286
1210 Ga0065165_1058816
1211 Ga0070658_10081833
1212 Ga0070658_10086907
1213 Ga0070658_10440175
1214 Ga0070658_10646273
1215 Ga0070690_100031128
1216 Ga0070670_100273775
1217 Ga0070670_100295403
1218 Ga0070677_10023109
1219 Ga0068869_100037044
1220 Ga0070666_10019648
1221 Ga0068868_100195124
1222 Ga0070660_100227965
1223 Ga0070689_100346171
1224 Ga0070661_100023457
1225 Ga0070668_100059448
1226 Ga0070669_100004469
1227 Ga0070675_100066570
1228 Ga0070675_100501698
1229 Ga0070671_100031566
1230 Ga0070671_100187716
1231 Ga0070674_100028072
1232 Ga0070673_100028417
1233 Ga0070659_100003171
1234 Ga0070659_100004714
1235 Ga0070659_100174856
1236 Ga0070667_100002718
1237 Ga0070667_100246137
1238 Ga0070701_10066089
1239 Ga0070663_100023240
1240 Ga0070663_100384565
1241 Ga0070678_100130407
1242 Ga0070662_100016597
1243 Ga0068867_100027789
1244 Ga0068867_100122049
1245 Ga0068867_100800152
1246 Ga0070684_100508873
1247 Ga0068853_100072486
1248 Ga0068853_100551899
1249 Ga0070672_100036953
1250 Ga0070686_100065917
1251 Ga0068855_100127299
1252 Ga0068855_100430825
1253 Ga0068857_100007953
1254 Ga0068854_100004599
1255 Ga0068856_100008259
1256 Ga0068856_100056975
1257 Ga0068856_100257418
1258 Ga0068852_100102675
1259 Ga0068852_100147709
1260 Ga0068852_100186438
1261 Ga0068852_100955562
1262 Ga0068864_100301443
1263 Ga0068864_100560238
1264 Ga0068866_10010619
1265 Ga0068866_10309096
1266 Ga0068861_100016063
1267 Ga0068861_100158841
1268 Ga0068863_100019781
1269 Ga0068863_100473095
1270 Ga0068858_100017353
1271 Ga0068860_100565456
1272 Ga0075363_100043109
1273 Ga0075366_10099523
1274 Ga0075366_10197495
1275 Ga0075370_10002946
1276 Ga0075370_10271119
1277 Ga0068871_100073893
1278 Ga0068865_100114600
1279 Ga0068865_100269843
1280 Ga0099824_1036213
1281 Ga0099823_1017932
1282 Ga0079104_1000309
1283 Ga0099826_10000018
1284 Ga0105251_10002082
1285 Ga0105251_10005601
1286 Ga0105251_10013210
1287 Ga0105251_10024566
1288 Ga0105251_10049399
1289 Ga0105244_10001133
1290 Ga0105244_10002953
1291 Ga0105244_10007523
1292 Ga0105244_10061761
1293 Ga0105240_10012100
1294 Ga0105240_10017206
1295 Ga0105240_10024629
1296 Ga0105245_10262933
1297 Ga0105243_10052625
1298 Ga0105243_10054161
1299 Ga0105241_10019955
1300 Ga0105241_10186928
1301 Ga0105242_10007036
1302 Ga0105248_10078637
1303 Ga0105237_10499422
1304 Ga0105237_10755773
1305 Ga0105238_10030398
1306 Ga0105238_10055566
1307 Ga0105238_10061774
1308 Ga0105249_10007528
1309 Ga0105246_10099856
1310 Ga0157373_10045986
1311 Ga0157371_10000001
1312 Ga0157371_10207645
1313 Ga0157370_10366078
1314 Ga0157370_10764917
1315 Ga0157369_10169148
1316 Ga0157369_10236802
1317 Ga0157369_10383864
1318 Ga0157374_10036965
1319 Ga0157374_10132950
1320 Ga0157378_10248522
1321 Ga0163162_10040965
1322 Ga0163162_10728762
1323 Ga0157372_10361837
1324 Ga0157372_10731731
1325 Ga0157375_10008692
1326 Ga0157375_10173565
1327 Ga0157380_10051165
1328 Ga0157380_10241647
1329 Ga0182008_10003842
1330 Ga0182008_10027616
1331 Ga0157377_10228313
1332 Ga0157376_10226589
1333 Ga0157376_10345560
1334 Ga0182006_1009422
1335 Ga0182007_10004447
1336 Ga0182007_10010110
1337 Ga0182007_10081906
1338 Ga0182007_10095791
1339 Ga0182005_1000158
1340 Ga0213872_10000002
1341 Ga0213872_10002809
1342 Ga0213872_10019803
1343 Ga0213872_10038157
1344 Ga0213872_10046973
1345 Ga0213872_10052963
1346 Ga0213872_10141970
1347 Ga0209435_100160
1348 Ga0209435_100473
1349 Ga0209435_109601
1350 Ga0209436_100751
1351 Ga0209784_100004
1352 Ga0209784_100365
1353 Ga0209566_100004
1354 Ga0209566_100955
1355 Ga0209674_100003
1356 Ga0209674_100006
1357 Ga0209674_100184
1358 Ga0209147_100011
1359 Ga0209563_100009
1360 Ga0209563_100010
1361 Ga0207427_101086
1362 Ga0209437_100004
1363 Ga0209437_100259
1364 Ga0209258_100525
1365 Ga0209258_100580
1366 Ga0209646_1000035
1367 Ga0209646_1000067
1368 Ga0209646_1000403
1369 Ga0209646_1000503
1370 Ga0209026_1000033
1371 Ga0209026_1000760
1372 Ga0209026_1000967
1373 Ga0209026_1002757
1374 Ga0209677_100005
1375 Ga0209677_100068
1376 Ga0209677_100760
1377 Ga0209677_102322
1378 Ga0209677_102920
1379 Ga0209148_1000293
1380 Ga0209148_1005971
1381 Ga0209759_1000024
1382 Ga0209759_1000253
1383 Ga0209759_1001054
1384 Ga0209129_1000093
1385 Ga0209233_1000005
1386 Ga0209565_1000009
1387 Ga0209565_1000946
1388 Ga0209565_1001578
1389 Ga0209565_1002746
1390 Ga0209565_1012113
1391 Ga0209673_1000036
1392 Ga0209673_1006646
1393 Ga0209130_1001278
1394 Ga0209130_1001458
1395 Ga0209675_1000013
1396 Ga0209675_1000100
1397 Ga0209675_1000945
1398 Ga0209675_1007213
1399 Ga0209675_1009393
1400 Ga0209676_1000012
1401 Ga0209025_1001877
1402 Ga0209025_1004210
1403 Ga0209564_1000122
1404 Ga0209564_1003837
1405 Ga0209564_1003839
1406 Ga0209564_1004073
1407 Ga0209050_1000145
1408 Ga0209050_1007847
1409 Ga0209050_1012221
1410 Ga0209256_1000005
1411 Ga0209256_1000061
1412 Ga0209256_1000106
1413 Ga0209256_1000269
1414 Ga0209256_1000676
1415 Ga0209256_1002862
1416 Ga0209256_1007013
1417 Ga0207426_1002626
1418 Ga0209051_1000018
1419 Ga0209051_1004528
1420 Ga0209051_1005475
1421 Ga0209051_1016272
1422 Ga0209257_1000010
1423 Ga0209257_1000084
1424 Ga0209257_1004271
1425 Ga0207697_10031970
1426 Ga0207656_10276333
1427 Ga0207655_1001288
1428 Ga0207713_1000135
1429 Ga0207713_1008988
1430 Ga0207713_1055329
1431 Ga0207682_10006644
1432 Ga0207682_10039046
1433 Ga0207642_10016456
1434 Ga0207680_10018874
1435 Ga0207647_10035754
1436 Ga0207645_10029160
1437 Ga0207645_10414350
1438 Ga0207643_10097419
1439 Ga0207705_10106102
1440 Ga0207705_10191215
1441 Ga0207654_10289787
1442 Ga0207695_10009547
1443 Ga0207695_10010175
1444 Ga0207695_10032918
1445 Ga0207695_10079069
1446 Ga0207671_10033303
1447 Ga0207662_10002597
1448 Ga0207657_10149395
1449 Ga0207649_10252355
1450 Ga0207681_10008770
1451 Ga0207681_10184195
1452 Ga0207694_10059333
1453 Ga0207650_10350312
1454 Ga0207659_10032977
1455 Ga0207659_10038293
1456 Ga0207687_10034805
1457 Ga0207644_10048134
1458 Ga0207690_10004058
1459 Ga0207690_10507350
1460 Ga0207706_10015322
1461 Ga0207706_10144106
1462 Ga0207709_10002721
1463 Ga0207670_10369958
1464 Ga0207669_10006656
1465 Ga0207691_10048281
1466 Ga0207691_10093888
1467 Ga0207691_10096426
1468 Ga0207689_10011506
1469 Ga0207689_10039908
1470 Ga0207661_10052657
1471 Ga0207667_10021476
1472 Ga0207712_10009755
1473 Ga0207668_10046072
1474 Ga0207640_10079351
1475 Ga0207640_10096861
1476 Ga0207658_10013291
1477 Ga0207677_10040223
1478 Ga0207703_10005816
1479 Ga0207678_10076301
1480 Ga0207678_10422419
1481 Ga0207678_10488071
1482 Ga0207702_10001261
1483 Ga0207702_10058186
1484 Ga0207641_10005241
1485 Ga0207648_10047299
1486 Ga0207648_10225905
1487 Ga0207648_10356977
1488 Ga0207674_10057723
1489 Ga0207675_100002925
1490 Ga0207675_100111936
1491 Ga0207683_10041387
1492 Ga0207683_10377001
1493 Ga0207698_10008917
1494 Ga0207698_10121456
1495 Ga0209281_1000103
1496 Ga0209968_1001095
1497 Ga0209282_1000002
1498 Ga0209282_1000052
1499 Ga0209966_1000003
1500 Ga0268266_10176480
1501 Ga0268264_10001986
1502 Ga0307515_10000708
1503 Ga0307515_10013083
1504 Ga0307515_10470144
1505 Ga0307511_10076838
1506 Ga0307512_10056000
1507 Ga0265328_10005685
1508 Ga0265327_10000479
1509 Ga0265327_10031415
1510 Ga0307509_10073712
1511 Ga0307508_10000169
1512 Ga0307514_10085435
1513 Ga0316576_10077095
1514 Ga0307516_10008972
1515 Ga0307516_10009988
1516 Ga0307413_10273545
1517 Ga0307518_10127414
1518 Ga0307410_10247607
1519 Ga0307409_100226671
1520 Ga0307409_100280086
1521 Ga0307416_100005407
1522 Ga0307416_101791783
1523 Ga0307414_10094204
1524 Ga0307507_10021968
1525 Ga0316574_0086518
1526 Ga0373924_0027378
1527 Ga0373933_0320756
1528 Ga0373937_0089551
1529 Ga0373937_0468785
1530 Ga0395899_0001064
1531 Ga0395899_0002813
1532 Ga0395899_0003608
1533 Ga0395900_0000131
1534 Ga0395900_0005698
1535 Ga0395900_0283273
1536 Ga0395898_0001532
1537 Ga0395898_0097883
1538 Ga0395905_0017710
1539 Ga0395905_0025730
1540 Ga0395905_0028213
1541 Ga0395905_0063403
1542 Ga0395905_0208288
1543 Ga0395901_0000002
1544 Ga0395901_0001718
1545 Ga0395901_0136559
1546 Ga0395901_1173314
1547 Ga0436361_0144599
1548 Ga0436361_0338967
1549 Ga0436361_0600769
1550 Ga0436361_0846070
1551 Ga0439461_0030468
1552 Ga0439465_0120827
1553 Ga0451789_0491830
1554 Ga0451795_0419335
1555 Ga0451802_0970336
1556 Ga0451835_0864634
1557 Ga0451839_0718016
1558 Ga0451849_0077297
1559 Ga0451851_0770517
1560 Ga0451843_0223084
1561 Ga0439431_0031742
1562 Ga0439450_007594
1563 Ga0450906_010415
1564 Ga0439446_0014983
1565 Ga0439434_0039325
1566 Ga0439460_0095082
1567 Ga0450918_001746
1568 Ga0451577_0091368
1569 Ga0451577_0751880
1570 Ga0466969_0058160
1571 Ga0466972_0000088
1572 Ga0466972_0022575
1573 Ga0466978_0109275
1574 Ga0466965_0000666
1575 Ga0466965_0002051
1576 Ga0466966_0000687
1577 Ga0466966_0006128
1578 Ga0466966_0089471
1579 Ga0466961_0001458
1580 Ga0466961_0007342
1581 Ga0466961_0018736
1582 Ga0466963_0027945
1583 Ga0466963_0047308
1584 Ga0466964_0002548
1585 Ga0466964_0002848
1586 Ga0466964_0025767
1587 Ga0466964_0040051
1588 Ga0466964_0056879
1589 Ga0466964_0113758
1590 Ga0453684_0023234
1591 Ga0466971_0005142
1592 Ga0466971_0007302
1593 Ga0466971_0017715
1594 Ga0466971_0052756
1595 Ga0466968_0063481
1596 Ga0466970_0007806
1597 Ga0466970_0028412
1598 Ga0466970_0031025
1599 Ga0466957_0047867
1600 Ga0466957_0164008
1601 Ga0466957_0192226
1602 Ga0466960_0026488
1603 Ga0466959_0000287
1604 Ga0466959_0009422
1605 Ga0466959_0052023
1606 Ga0466959_0081458
1607 Ga0451576_0074320
1608 Ga0451576_0194483
1609 Ga0466958_0011505
1610 Ga0466958_0587412
1611 Ga0466967_0024766
1612 Ga0466967_0090776
1613 Ga0466967_0141742
1614 Ga0495617_000002
1615 Ga0495617_041726
1616 Ga0495617_085942
1617 Ga0495627_000207
1618 Ga0495627_042518
1619 Ga0495627_046735
1620 Ga0495592_0030409
1621 Ga0495592_0100052
1622 Ga0495603_0106430
1623 Ga0495603_0364263
1624 Ga0495590_0000025
1625 Ga0495590_0018282
1626 Ga0495590_0021071
1627 Ga0495590_0054003
1628 Ga0495591_002755
1629 Ga0495629_0000878
1630 Ga0495629_0005319
1631 Ga0495638_0013390
1632 Ga0495638_0016484
1633 Ga0495638_0035516
1634 Ga0495638_0073932
1635 Ga0495638_0244567
1636 Ga0495651_0100121
1637 Ga0495651_0134207
1638 Ga0495651_0351245
1639 Ga0495653_0005181
1640 Ga0495653_0007366
1641 Ga0495653_0061355
1642 Ga0495653_0105341
1643 Ga0495653_0132732
1644 Ga0495650_0000015
1645 Ga0495650_0005573
1646 Ga0495650_0006345
1647 Ga0495650_0007195
1648 Ga0495650_0008662
1649 Ga0495650_0009150
1650 Ga0495580_0016442
1651 Ga0495580_0020600
1652 Ga0495580_0023359
1653 Ga0495580_0050910
1654 Ga0495580_0115644
1655 Ga0495580_0699376
1656 Ga0495582_0002333
1657 Ga0495582_0027681
1658 Ga0495582_0044024
1659 Ga0495605_0001284
1660 Ga0495605_0003031
1661 Ga0495605_0012486
1662 Ga0495605_0025196
1663 Ga0495605_0026070
1664 Ga0495605_0240640
1665 Ga0495662_0386912
1666 Ga0495664_0019005
1667 Ga0495664_0495309
1668 Ga0495584_0000070
1669 Ga0495584_0000560
1670 Ga0495584_0004898
1671 Ga0495584_0005783
1672 Ga0495584_0007322
1673 Ga0495584_0009129
1674 Ga0495584_0288096
1675 Ga0495585_0000006
1676 Ga0495585_0006233
1677 Ga0495585_0006865
1678 Ga0495585_0010286
1679 Ga0495585_0010483
1680 Ga0495585_0013461
1681 Ga0495585_0026665
1682 Ga0495585_0030854
1683 Ga0495585_0032874
1684 Ga0495585_0034744
1685 Ga0495585_0059514
1686 Ga0495585_0068952
1687 Ga0495585_0154537
1688 Ga0495585_0193122
1689 Ga0495594_0003640
1690 Ga0495594_0005742
1691 Ga0495594_0013918
1692 Ga0495594_0030537
1693 Ga0495594_0069416
1694 Ga0495596_0000240
1695 Ga0495596_0001004
1696 Ga0495596_0001839
1697 Ga0495596_0008211
1698 Ga0495596_0008902
1699 Ga0495596_0009505
1700 Ga0495596_0011786
1701 Ga0495596_0012683
1702 Ga0495596_0031054
1703 Ga0495596_0033692
1704 Ga0495596_0041071
1705 Ga0495596_0070668
1706 Ga0495596_0196268
1707 Ga0495607_0002594
1708 Ga0495607_0004085
1709 Ga0495607_0005057
1710 Ga0495607_0009947
1711 Ga0495607_0014386
1712 Ga0495607_0017453
1713 Ga0495607_0031280
1714 Ga0495607_0046605
1715 Ga0495607_0068424
1716 Ga0495607_0106432
1717 Ga0495607_0117837
1718 Ga0495607_0307808
1719 Ga0495583_0000056
1720 Ga0495583_0000159
1721 Ga0495583_0000372
1722 Ga0495583_0000382
1723 Ga0495583_0000864
1724 Ga0495583_0002345
1725 Ga0495583_0004885
1726 Ga0495583_0023202
1727 Ga0495583_0056880
1728 Ga0495583_0101613
1729 Ga0495583_0167063
1730 Ga0495583_0209989
1731 Ga0495606_0002998
1732 Ga0495606_0004210
1733 Ga0495606_0013849
1734 Ga0495606_0038316
1735 Ga0495606_0039674
1736 Ga0495606_0041103
1737 Ga0495606_0133232
1738 Ga0495606_0133665
1739 Ga0495606_0306052
1740 Ga0495608_0072156
1741 Ga0495610_0004511
1742 Ga0495610_0006028
1743 Ga0495610_0020472
1744 Ga0495610_0035172
1745 Ga0495616_0000057
1746 Ga0495616_0003140
1747 Ga0495616_0004533
1748 Ga0495616_0010511
1749 Ga0495616_0015188
1750 Ga0495616_0015417
1751 Ga0495616_0015591
1752 Ga0495616_0028366
1753 Ga0495616_0031036
1754 Ga0495616_0101666
1755 Ga0495620_0030549
1756 Ga0495620_0041244
1757 Ga0495620_0049470
1758 Ga0495620_0049791
1759 Ga0495628_0029302
1760 Ga0495628_0079729
1761 Ga0495630_0044173
1762 Ga0495630_0058357
1763 Ga0495631_0002820
1764 Ga0495631_0003219
1765 Ga0495631_0005293
1766 Ga0495631_0012520
1767 Ga0495631_0014987
1768 Ga0495631_0015637
1769 Ga0495631_0015837
1770 Ga0495631_0016374
1771 Ga0495631_0021138
1772 Ga0495631_0030586
1773 Ga0495631_0045981
1774 Ga0495631_0144685
1775 Ga0495631_0181164
1776 Ga0495632_0000129
1777 Ga0495632_0000296
1778 Ga0495632_0000375
1779 Ga0495632_0008199
1780 Ga0495632_0022106
1781 Ga0495632_0022797
1782 Ga0495632_0025075
1783 Ga0495632_0026117
1784 Ga0495637_0000126
1785 Ga0495637_0023626
1786 Ga0495637_0070124
1787 Ga0495643_0000415
1788 Ga0495643_0011985
1789 Ga0495643_0026575
1790 Ga0495643_0031662
1791 Ga0495643_0048513
1792 Ga0495643_0095437
1793 Ga0495643_0125066
1794 Ga0495643_0313931
1795 Ga0495644_0000389
1796 Ga0495644_0001948
1797 Ga0495644_0003401
1798 Ga0495644_0003438
1799 Ga0495644_0007023
1800 Ga0495644_0007542
1801 Ga0495644_0009481
1802 Ga0495644_0013643
1803 Ga0495648_0000708
1804 Ga0495648_0001488
1805 Ga0495648_0007168
1806 Ga0495648_0011619
1807 Ga0495648_0036925
1808 Ga0495648_0038209
1809 Ga0495648_0048317
1810 Ga0495648_0085064
1811 Ga0495648_0165099
1812 Ga0495648_0215620
1813 Ga0495663_0002556
1814 Ga0495663_0017672
1815 Ga0495663_0086948
1816 Ga0495666_0000318
1817 Ga0495666_0000556
1818 Ga0495666_0008615
1819 Ga0495666_0018785
1820 Ga0495666_0039750
1821 Ga0495666_0046494
1822 Ga0495642_0000613
1823 Ga0495642_0004874
1824 Ga0495642_0007226
1825 Ga0495642_0009239
1826 Ga0495642_0011089
1827 Ga0495642_0012989
1828 Ga0495642_0016483
1829 Ga0495642_0041624
1830 Ga0495642_0066401
1831 Ga0495642_0069897
1832 Ga0495652_0001577
1833 Ga0495654_0000381
1834 Ga0495654_0004611
1835 Ga0495654_0018761
1836 Ga0495654_0028918
1837 Ga0495654_0107634
1838 Ga0495654_0198012
1839 Ga0495665_0020210
1840 Ga0495665_0049520
1841 Ga0495665_0060088
1842 Ga0495640_0017736
1843 Ga0495586_0009827
1844 Ga0495586_0012802
1845 Ga0495586_0024342
1846 Ga0495586_0152531
1847 Ga0495587_0243573
1848 Ga0495609_0001536
1849 Ga0495609_0003404
1850 Ga0495609_0003442
1851 Ga0495609_0004070
1852 Ga0495609_0004682
1853 Ga0495609_0015930
1854 Ga0495609_0016433
1855 Ga0495609_0021815
1856 Ga0495609_0029412
1857 Ga0495609_0033768
1858 Ga0495609_0048047
1859 Ga0495609_0065495
1860 Ga0495609_0099802
1861 Ga0495621_0003776
1862 Ga0495597_0001388
1863 Ga0495597_0002423
1864 Ga0495597_0003311
1865 Ga0495597_0005681
1866 Ga0495597_0009715
1867 Ga0495597_0010710
1868 Ga0495597_0035088
1869 Ga0495597_0038705
1870 Ga0495597_0171388
1871 Ga0495597_0219965
1872 Ga0495645_0037487
1873 Ga0495645_0211290
1874 Ga0495645_0392211
1875 Ga0495622_0000064
1876 Ga0495622_0000570
1877 Ga0495622_0006368
1878 Ga0495622_0032190
1879 Ga0495622_0054258
1880 Ga0495622_0102906
1881 Ga0495633_0003338
1882 Ga0495633_0004954
1883 Ga0495633_0008291
1884 Ga0495633_0032773
1885 Ga0495633_0034346
1886 Ga0495633_0060270
1887 Ga0495633_0065743
1888 Ga0495633_0079803
1889 Ga0495633_0115881
1890 Ga0495633_0260102
1891 Ga0495656_0002704
1892 Ga0495656_0017670
1893 Ga0495656_0040418
1894 Ga0495656_0044093
1895 Ga0495656_0073514
1896 Ga0495656_0300791
1897 Ga0495656_0386048
1898 Ga0495668_0000025
1899 Ga0495668_0000544
1900 Ga0495668_0000578
1901 Ga0495668_0003733
1902 Ga0495668_0021923
1903 Ga0495668_0029684
1904 Ga0495668_0034704
1905 Ga0495668_0045031
1906 Ga0495668_0055234
1907 Ga0495668_0066242
1908 Ga0495634_0053681
1909 Ga0495634_0369017
1910 Ga0495611_0000946
1911 Ga0495611_0003308
1912 Ga0495611_0011108
1913 Ga0495611_0012399
1914 Ga0495611_0025380
1915 Ga0495611_0030378
1916 Ga0495611_0033374
1917 Ga0495611_0101818
1918 Ga0495611_0125987
1919 Ga0495625_0004296
1920 Ga0495625_0004306
1921 Ga0495625_0026121
1922 Ga0495625_0029610
1923 Ga0495625_0040181
1924 Ga0495625_0051408
1925 Ga0495625_0052327
1926 Ga0495625_0129530
1927 Ga0495625_0155060
1928 Ga0495625_0179307
1929 Ga0495625_0249643
1930 Ga0495635_0001292
1931 Ga0495635_0015435
1932 Ga0495635_0121076
1933 Ga0495635_0246513
1934 Ga0495659_0000526
1935 Ga0495659_0000919
1936 Ga0495659_0008635
1937 Ga0495659_0013224
1938 Ga0495659_0316897
1939 Ga0495661_0002258
1940 Ga0495661_0004930
1941 Ga0495661_0009057
1942 Ga0495661_0016750
1943 Ga0495661_0023263
1944 Ga0495661_0024203
1945 Ga0495661_0038868
1946 Ga0495661_0051612
1947 Ga0495661_0063697
1948 Ga0495661_0088267
1949 Ga0495661_0100596
1950 Ga0495661_0103250
1951 Ga0495661_0110688
1952 Ga0495661_0168146
1953 Ga0495661_0175233
1954 Ga0495661_0218012
1955 Ga0495661_0316595
1956 Ga0495588_0003376
1957 Ga0495588_0024317
1958 Ga0495588_0036417
1959 Ga0495588_0046183
1960 Ga0495588_0096087
1961 Ga0495588_0166293
1962 Ga0495588_0189117
1963 Ga0495599_0008525
1964 Ga0495599_0175798
1965 Ga0495623_0002848
1966 Ga0495623_0091236
1967 Ga0495623_0172788
1968 Ga0495646_0001272
1969 Ga0495646_0008984
1970 Ga0495646_0119223
1971 Ga0495646_0126911
1972 Ga0495658_0229075
1973 Ga0495669_0000092
1974 Ga0495669_0000583
1975 Ga0495669_0002000
1976 Ga0495669_0014388
1977 Ga0495669_0018903
1978 Ga0495669_0053696
1979 Ga0495669_0062837
1980 Ga0495669_0097430
1981 Ga0495613_0033961
1982 Ga0495613_0108969
1983 Ga0495613_0143776
1984 Ga0495624_0004719
1985 Ga0495624_0013356
1986 Ga0495624_0018817
1987 Ga0495624_0021868
1988 Ga0495670_0001955
1989 Ga0495670_0003903
1990 Ga0495670_0023024
1991 Ga0495670_0041036
1992 Ga0495670_0053575
1993 Ga0495670_0065194
1994 Ga0495670_0097054
1995 Ga0495670_0106660
1996 Ga0495670_0110917
1997 Ga0495670_0116948
1998 Ga0495670_0263036
1999 Ga0495671_0002518
2000 Ga0495671_0009131
2001 Ga0495671_0011096
2002 Ga0495671_0029990
2003 Ga0495671_0035806
2004 Ga0495671_0056700
2005 Ga0495671_0101401
2006 Ga0495671_0138840
2007 Ga0495649_0001463
2008 Ga0495649_0003126
2009 Ga0495649_0005200
2010 Ga0495649_0006435
2011 Ga0495649_0006781
2012 Ga0495649_0009242
2013 Ga0495649_0015381
2014 Ga0495649_0029688
2015 Ga0495649_0063457
2016 Ga0495649_0118121
2017 Ga0495649_0122041
2018 Ga0495649_0152974
2019 Ga0495649_0194707
2020 Ga0495649_0304778
2021 Ga0495649_0319066
2022 Ga0495589_0000032
2023 Ga0495589_0002314
2024 Ga0495589_0004788
2025 Ga0495589_0005625
2026 Ga0495589_0013093
2027 Ga0495589_0014852
2028 Ga0495589_0024976
2029 Ga0495589_0050404
2030 Ga0495589_0090532
2031 Ga0495589_0103208
2032 Ga0495589_0115136
2033 Ga0495589_0146367
2034 Ga0495600_0000474
2035 Ga0495600_0002069
2036 Ga0495660_0009441
2037 Ga0495660_0010483
2038 Ga0495660_0011814
2039 Ga0495660_0013996
2040 Ga0495660_0025613
2041 Ga0495660_0042266
2042 Ga0495660_0071539
2043 Ga0495581_0008394
2044 Ga0495581_0015215
2045 Ga0495581_0015668
2046 Ga0495604_0020165
2047 Ga0495604_0030329
2048 Ga0495604_0038987
2049 Ga0495604_0047559
2050 Ga0495604_0051135
2051 Ga0495636_0001913
2052 Ga0495636_0002620
2053 Ga0495636_0028437
2054 Ga0495636_0042381
2055 Ga0495636_0051765
2056 Ga0495674_0004291
2057 Ga0495674_0008961
2058 Ga0495674_0359082
2059 Ga0495674_0400908
2060 Ga0495672_0000041
2061 Ga0495672_0004140
2062 Ga0495672_0006589
2063 Ga0495672_0042796
2064 Ga0495672_0052973
2065 Ga0495672_0156877
2066 Ga0495672_0289083
2067 Ga0495676_0000235
2068 Ga0495676_0025419
2069 Ga0495676_0045906
2070 Ga0495676_0122523
2071 Ga0495680_0042503
2072 Ga0495683_0001361
2073 Ga0495683_0003295
2074 Ga0495683_0004350
2075 Ga0495683_0016473
2076 Ga0495683_0030886
2077 Ga0495683_0034026
2078 Ga0495683_0045537
2079 Ga0495683_0070388
2080 Ga0495683_0114245
2081 Ga0495683_0229991
2082 Ga0495687_000127
2083 Ga0495687_000143
2084 Ga0495687_001108
2085 Ga0495687_004036
2086 Ga0495687_008098
2087 Ga0495687_034999
2088 Ga0495687_036591
2089 Ga0495675_0081573
2090 Ga0495675_0532871
2091 Ga0495677_0003200
2092 Ga0495677_0005113
2093 Ga0495677_0006278
2094 Ga0495677_0007859
2095 Ga0495677_0009153
2096 Ga0495677_0024912
2097 Ga0495677_0026448
2098 Ga0495677_0049226
2099 Ga0495677_0054027
2100 Ga0495677_0076995
2101 Ga0495677_0081048
2102 Ga0495679_000037
2103 Ga0495679_005470
2104 Ga0495679_021280
2105 Ga0495679_033196
2106 Ga0495685_000113
2107 Ga0495685_001114
2108 Ga0495685_008745
2109 Ga0495685_014165
2110 Ga0495685_015742
2111 Ga0495685_024327
2112 Ga0495673_0006800
2113 Ga0495673_0040844
2114 Ga0495673_0047964
2115 Ga0495681_0000694
2116 Ga0495681_0001600
2117 Ga0495681_0002505
2118 Ga0495681_0004999
2119 Ga0495681_0019417
2120 Ga0495681_0019747
2121 Ga0495681_0023569
2122 Ga0495681_0028377
2123 Ga0495681_0066454
2124 Ga0495681_0075090
2125 Ga0495686_0000288
2126 Ga0495686_0000656
2127 Ga0495686_0002328
2128 Ga0495686_0007355
2129 Ga0495686_0053453
2130 Ga0495686_0060892
2131 Ga0495593_0012820
2132 Ga0495593_0012935
2133 Ga0495593_0032542
2134 Ga0495593_0048888
2135 Ga0495602_0006574
2136 Ga0495602_0022460
2137 Ga0495602_0062779
2138 Ga0495602_0210740
2139 Ga0495614_0006362
2140 Ga0495614_0006654
2141 Ga0495614_0094288
2142 Ga0495626_0002049
2143 Ga0495626_0010705
2144 Ga0495626_0017842
2145 Ga0495626_0020742
2146 Ga0495626_0021140
2147 Ga0495626_0022862
2148 Ga0495626_0031484
2149 Ga0495626_0033862
2150 Ga0495626_0038091
2151 Ga0495626_0040299
2152 Ga0495626_0059781
2153 Ga0495626_0065980
2154 Ga0495626_0074515
2155 Ga0495626_0109953
2156 Ga0495626_0144554
2157 Ga0495626_0163969
2158 Ga0496100_0016601
2159 Ga0496100_0171134
2160 Ga0496100_0458653
2161 Ga0496100_0482716
2162 Ga0496101_0030388
2163 Ga0496102_0000931
2164 Ga0496102_0401793
2165 Ga0496103_0022931
2166 Ga0496103_0056910
2167 Ga0496103_0529000
2168 Ga0496104_0338360
2169 Ga0496105_0087572
2170 Ga0496107_0055316
2171 Ga0496109_0009606
2172 Ga0496109_0115613
2173 Ga0496110_0029094
2174 Ga0496110_0045736
2175 Ga0496110_0047706
2176 Ga0496110_0261305
2177 Ga0496110_0715854
2178 Ga0496111_0014930
2179 Ga0496111_0342997
2180 Ga0496113_0008457
2181 Ga0496114_0439153
2182 Ga0496115_0018367
2183 Ga0496115_0020248
2184 Ga0496115_0055871
2185 Ga0496115_0220001
2186 Ga0496115_0238318
2187 Ga0496115_0276349
2188 Ga0496116_0014132
2189 Ga0496116_0026637
2190 Ga0496116_0033774
2191 Ga0496117_0028920
2192 Ga0496117_0114372
2193 Ga0496117_0121972
2194 Ga0496118_0002886
2195 Ga0496118_0040010
2196 Ga0496118_0060865
2197 Ga0496121_0014458
2198 Ga0496121_0084985
2199 Ga0496121_0197583
2200 Ga0496122_0000261
2201 Ga0496122_0000445
2202 Ga0496122_0011752
2203 Ga0496123_0000218
2204 Ga0496123_0001568
2205 Ga0496123_0007592
2206 Ga0496124_0015077
2207 Ga0496124_0015517
2208 Ga0496124_0046689
2209 Ga0496124_0097419
2210 Ga0496124_0151501
2211 Ga0496124_0237922
2212 Ga0496124_0351417
2213 Ga0496124_0429036
2214 Ga0496125_0000256
2215 Ga0496125_0002859
2216 Ga0496125_0067915
2217 Ga0496126_0034799
2218 Ga0496126_0054778
2219 Ga0496126_0111802
2220 Ga0501306_002557
2221 Ga0501310_001443
2222 Ga0495678_000042
2223 Ga0495678_000316
2224 Ga0495678_003135
2225 Ga0495678_003427
2226 Ga0495678_003924
2227 Ga0495678_004684
2228 Ga0495678_006389
2229 Ga0495678_007748
2230 Ga0495678_009881
2231 Ga0495678_025595
2232 Ga0495678_033817
2233 Ga0495682_0000107
2234 Ga0495682_0033786
2235 Ga0495682_0038533
2236 Ga0495682_0084729
2237 Ga0495682_0094804
2238 Ga0501039_0066319
2239 Ga0501070_0147283
2240 Ga0501198_000102
2241 Ga0501222_000008
2242 Ga0501227_039267
2243 Ga0501249_003963
2244 Ga0501269_000210
2245 Ga0501279_000208
2246 Ga0501279_004406
2247 Ga0501279_036368
2248 nmdc:mga03683_277888_c1
2249 nmdc:mga0k408_132531_c1
2250 nmdc:mga0k408_177614_c1
2251 nmdc:mga0k408_196874_c1
2252 nmdc:mga0k408_22887_c1
2253 nmdc:mga0k408_487922_c1
2254 nmdc:mga0k408_59835_c1
2255 nmdc:mga07m45_5487_c1
2256 nmdc:mga08x19_12730_c1
2257 Ga0495601_0030324
2258 Ga0495601_0239427
2259 Ga0500635_0000083
2260 Ga0495595_0136294
2261 Ga0500651_0112998
2262 Ga0500595_003047
2263 Ga0500619_000742
2264 Ga0500634_0108608
2265 Ga0500637_0152420
2266 Ga0500587_000079
2267 Ga0500661_006935
2268 Ga0587091_002909
2269 Ga0587062_001995
2270 Ga0587111_0003612
2271 Ga0466962_0002972
2272 Ga0466962_0003937
2273 2511248376
2274 2550693536
2275 2644030407
2276 2819542751
2277 2819594530

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

51

231

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9676 3 199
1men-assembly1.cif.gz_A complex structure of human gar tfase and substrate beta-gar 0.9652 1 199
4zyv-assembly1.cif.gz_A human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) 0.9626 3 197
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9615 1 199
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9615 1 199
ID Description Score Start End Superfamily
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9668 2 182 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9615 1 199 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9614 3 199 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9602 3 199 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9552 1 183 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A561KLD6-F1-model_v4 deleted 0.9882 15 203
AF-A0A5Q1FXV9-F1-model_v4 deleted 0.9843 2 200
AF-A0A561KLD6-F1-model_v4 deleted 0.983 15 203
AF-A0A1G0J2J2-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9807 3 183 GO:0004644
GO:0005829
GO:0006189
AF-A0A090QZB5-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9805 1 156 GO:0004644
GO:0005829
GO:0006189

Map