F490666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1138 | 407 | 2277 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0000750|Ga0395905_0000750_18342_19109 |
| Length | 255 |
| Sequence | MPPISGLTRKSHSGCSTLSSNHFFLLCKPAIAAGFFISVAATRYGKMRAMKNIVILISGRGSNMQAIVRAAQAEQWPCRIAAVISNRADAEGLMFAAEHGIATEVVVSKEFPSRDAFDAALRLAIDRFAPDLVVLAGFMRILTPGFVEHYAGRMLNIHPSLLPSFPGLATHRQALAAGVKVHGATVHFVTAELDHGPIVAQAAVPVLPGDTEHSLAERVLVQEHVIYPRAVRWFVEGRLSIDNGLVHVNEAAPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 84 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 205 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 206 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 229 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 230 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 231 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 232 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 233 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 234 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 235 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 236 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 239 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 380 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 381 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 383 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 384 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 395 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 398 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 399 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 404 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 405 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 406 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 407 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.03 |
| Metatranscriptomes | 0.53 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.78 |
| Nodule | 0.7 |
| Rhizoplane | 2.9 |
| Rhizosphere | 77.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0000750 | 3300037471 | Bacteria | 42802 |
| 2 | JGI24740J21852_10000527 | 3300001979 | Bacteria | 16316 |
| 3 | JGI24739J22299_10030478 | 3300001989 | Bacteria | 1870 |
| 4 | JGI24737J22298_10012956 | 3300001990 | Bacteria | 2717 |
| 5 | JGI24735J21928_10009274 | 3300002067 | Bacteria | 3165 |
| 6 | JGI25155J39150_1000288 | 3300002704 | Bacteria | 17886 |
| 7 | JGI25156J39149_1000695 | 3300002705 | Bacteria | 18063 |
| 8 | JGI25156J39149_1002511 | 3300002705 | Bacteria | 6539 |
| 9 | JGI25156J39149_1007991 | 3300002705 | Bacteria | 2711 |
| 10 | JGI25154J39366_1000350 | 3300002738 | Bacteria | 26241 |
| 11 | JGI25154J39366_1000571 | 3300002738 | Bacteria | 18063 |
| 12 | JGI25154J39366_1001471 | 3300002738 | Bacteria | 8319 |
| 13 | JGI25154J39366_1003202 | 3300002738 | Bacteria | 3600 |
| 14 | JGI25154J39366_1003796 | 3300002738 | Bacteria | 2980 |
| 15 | JGI25158J39367_1001641 | 3300002739 | Bacteria | 3856 |
| 16 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 17 | JGI25157J39369_1000773 | 3300002741 | Bacteria | 16575 |
| 18 | JGI25150J39212_1012636 | 3300002774 | Bacteria | 1489 |
| 19 | JGI25159J45721_1005067 | 3300002987 | Bacteria | 4197 |
| 20 | JGI25151J46595_10035406 | 3300003187 | Bacteria | 1896 |
| 21 | JGI25151J46595_10055552 | 3300003187 | Bacteria | 1304 |
| 22 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 23 | JGI25153J46596_10017617 | 3300003215 | Bacteria | 2807 |
| 24 | rootH2_10128398 | 3300003320 | Bacteria | 1100 |
| 25 | rootL2_10017918 | 3300003322 | Bacteria | 1501 |
| 26 | rootH1_10042583 | 3300003316 | Bacteria | 4075 |
| 27 | rootH1_10042583 | 3300003323 | Bacteria | 1921 |
| 28 | rootH1_10042585 | 3300003323 | Bacteria | 1207 |
| 29 | rootH1_10186258 | 3300003323 | Bacteria | 1704 |
| 30 | JGI25160J50197_1002021 | 3300003354 | Bacteria | 9671 |
| 31 | JGI25161J50226_1001870 | 3300003374 | Bacteria | 5878 |
| 32 | Ga0007409J51694_1041494 | 3300003575 | Bacteria | 3994 |
| 33 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 34 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 35 | Ga0055539_1000146 | 3300003752 | Bacteria | 70677 |
| 36 | Ga0055539_1000240 | 3300003752 | Bacteria | 36494 |
| 37 | Ga0055539_1001263 | 3300003752 | Bacteria | 5036 |
| 38 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 39 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 40 | Ga0055533_1000150 | 3300003756 | Bacteria | 70677 |
| 41 | Ga0055533_1001052 | 3300003756 | Bacteria | 7936 |
| 42 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 43 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 44 | Ga0055525_1000198 | 3300003759 | Bacteria | 70677 |
| 45 | Ga0055525_1001499 | 3300003759 | Bacteria | 4023 |
| 46 | Ga0055535_1002863 | 3300003761 | Bacteria | 5417 |
| 47 | Ga0055542_1002038 | 3300003762 | Bacteria | 7643 |
| 48 | Ga0055526_1000161 | 3300003771 | Bacteria | 59705 |
| 49 | Ga0055526_1000827 | 3300003771 | Bacteria | 23107 |
| 50 | Ga0055526_1003727 | 3300003771 | Bacteria | 9515 |
| 51 | Ga0055537_1000111 | 3300003773 | Bacteria | 61884 |
| 52 | Ga0055524_1000015 | 3300003775 | Bacteria | 246493 |
| 53 | Ga0055524_1002005 | 3300003775 | Bacteria | 10873 |
| 54 | Ga0055524_1002542 | 3300003775 | Bacteria | 9325 |
| 55 | Ga0055524_1005899 | 3300003775 | Bacteria | 5397 |
| 56 | Ga0055524_1017165 | 3300003775 | Bacteria | 2563 |
| 57 | Ga0055536_1000252 | 3300003781 | Bacteria | 42499 |
| 58 | Ga0055534_1000268 | 3300003784 | Bacteria | 35791 |
| 59 | Ga0055534_1002782 | 3300003784 | Bacteria | 5845 |
| 60 | Ga0055534_1004596 | 3300003784 | Bacteria | 3938 |
| 61 | Ga0055528_1000178 | 3300003790 | Bacteria | 53709 |
| 62 | Ga0055530_10001043 | 3300003791 | Bacteria | 22076 |
| 63 | Ga0055530_10028903 | 3300003791 | Bacteria | 1489 |
| 64 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 65 | Ga0055531_10002737 | 3300003794 | Bacteria | 11585 |
| 66 | Ga0055531_10007375 | 3300003794 | Bacteria | 6022 |
| 67 | Ga0055531_10021621 | 3300003794 | Bacteria | 2487 |
| 68 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 69 | Ga0055541_1000098 | 3300003841 | Bacteria | 70677 |
| 70 | Ga0055541_1000789 | 3300003841 | Bacteria | 7895 |
| 71 | Ga0065165_1000286 | 3300005262 | Bacteria | 85993 |
| 72 | Ga0065165_1058816 | 3300005262 | Bacteria | 1060 |
| 73 | Ga0070658_10081833 | 3300005327 | Bacteria | 2653 |
| 74 | Ga0070658_10086907 | 3300005327 | Bacteria | 2573 |
| 75 | Ga0070658_10440175 | 3300005327 | Bacteria | 1122 |
| 76 | Ga0070658_10646273 | 3300005327 | Bacteria | 918 |
| 77 | Ga0070690_100031128 | 3300005330 | Bacteria | 3321 |
| 78 | Ga0070670_100273775 | 3300005331 | Bacteria | 1473 |
| 79 | Ga0070670_100295403 | 3300005331 | Bacteria | 1416 |
| 80 | Ga0070677_10023109 | 3300005333 | Bacteria | 2299 |
| 81 | Ga0068869_100037044 | 3300005334 | Bacteria | 3466 |
| 82 | Ga0070666_10019648 | 3300005335 | Bacteria | 4365 |
| 83 | Ga0068868_100195124 | 3300005338 | Bacteria | 1685 |
| 84 | Ga0070660_100227965 | 3300005339 | Bacteria | 1515 |
| 85 | Ga0070689_100346171 | 3300005340 | Bacteria | 1246 |
| 86 | Ga0070661_100023457 | 3300005344 | Bacteria | 4422 |
| 87 | Ga0070668_100059448 | 3300005347 | Bacteria | 2958 |
| 88 | Ga0070669_100004469 | 3300005353 | Bacteria | 10075 |
| 89 | Ga0070675_100066570 | 3300005354 | Bacteria | 2980 |
| 90 | Ga0070675_100501698 | 3300005354 | Bacteria | 1093 |
| 91 | Ga0070671_100031566 | 3300005355 | Bacteria | 4377 |
| 92 | Ga0070671_100187716 | 3300005355 | Bacteria | 1751 |
| 93 | Ga0070674_100028072 | 3300005356 | Bacteria | 3693 |
| 94 | Ga0070673_100028417 | 3300005364 | Bacteria | 4159 |
| 95 | Ga0070659_100003171 | 3300005366 | Bacteria | 11710 |
| 96 | Ga0070659_100004714 | 3300005366 | Bacteria | 9733 |
| 97 | Ga0070659_100174856 | 3300005366 | Bacteria | 1760 |
| 98 | Ga0070667_100002718 | 3300005367 | Bacteria | 15313 |
| 99 | Ga0070667_100246137 | 3300005367 | Bacteria | 1597 |
| 100 | Ga0070701_10066089 | 3300005438 | Bacteria | 1921 |
| 101 | Ga0070663_100023240 | 3300005455 | Bacteria | 4153 |
| 102 | Ga0070663_100384565 | 3300005455 | Bacteria | 1144 |
| 103 | Ga0070678_100130407 | 3300005456 | Bacteria | 1996 |
| 104 | Ga0070662_100016597 | 3300005457 | Bacteria | 4947 |
| 105 | Ga0068867_100027789 | 3300005459 | Bacteria | 4069 |
| 106 | Ga0068867_100122049 | 3300005459 | Bacteria | 2015 |
| 107 | Ga0068867_100800152 | 3300005459 | Bacteria | 841 |
| 108 | Ga0070684_100508873 | 3300005535 | Bacteria | 1116 |
| 109 | Ga0068853_100072486 | 3300005539 | Bacteria | 3001 |
| 110 | Ga0068853_100551899 | 3300005539 | Bacteria | 1091 |
| 111 | Ga0070672_100036953 | 3300005543 | Bacteria | 3724 |
| 112 | Ga0070686_100065917 | 3300005544 | Bacteria | 2354 |
| 113 | Ga0068855_100127299 | 3300005563 | Bacteria | 2911 |
| 114 | Ga0068855_100430825 | 3300005563 | Bacteria | 1442 |
| 115 | Ga0068857_100007953 | 3300005577 | Bacteria | 9152 |
| 116 | Ga0068854_100004599 | 3300005578 | Bacteria | 8706 |
| 117 | Ga0068856_100008259 | 3300005614 | Bacteria | 10149 |
| 118 | Ga0068856_100056975 | 3300005614 | Bacteria | 3858 |
| 119 | Ga0068856_100257418 | 3300005614 | Bacteria | 1760 |
| 120 | Ga0068852_100102675 | 3300005616 | Bacteria | 2584 |
| 121 | Ga0068852_100147709 | 3300005616 | Bacteria | 2182 |
| 122 | Ga0068852_100186438 | 3300005616 | Bacteria | 1954 |
| 123 | Ga0068852_100955562 | 3300005616 | Bacteria | 875 |
| 124 | Ga0068864_100301443 | 3300005618 | Bacteria | 1500 |
| 125 | Ga0068864_100560238 | 3300005618 | Bacteria | 1106 |
| 126 | Ga0068866_10010619 | 3300005718 | Bacteria | 3954 |
| 127 | Ga0068866_10309096 | 3300005718 | Bacteria | 990 |
| 128 | Ga0068861_100016063 | 3300005719 | Bacteria | 5287 |
| 129 | Ga0068861_100158841 | 3300005719 | Bacteria | 1863 |
| 130 | Ga0068863_100019781 | 3300005841 | Bacteria | 6439 |
| 131 | Ga0068863_100473095 | 3300005841 | Bacteria | 1231 |
| 132 | Ga0068858_100017353 | 3300005842 | Bacteria | 6752 |
| 133 | Ga0068860_100565456 | 3300005843 | Bacteria | 1140 |
| 134 | Ga0075363_100043109 | 3300006048 | Bacteria | 2386 |
| 135 | Ga0075366_10099523 | 3300006195 | Bacteria | 1744 |
| 136 | Ga0075366_10197495 | 3300006195 | Bacteria | 1223 |
| 137 | Ga0075370_10002946 | 3300006353 | Bacteria | 7999 |
| 138 | Ga0075370_10271119 | 3300006353 | Bacteria | 1007 |
| 139 | Ga0068871_100073893 | 3300006358 | Bacteria | 2812 |
| 140 | Ga0068865_100114600 | 3300006881 | Bacteria | 1994 |
| 141 | Ga0068865_100269843 | 3300006881 | Bacteria | 1350 |
| 142 | Ga0099824_1036213 | 3300006942 | Bacteria | 1447 |
| 143 | Ga0099823_1017932 | 3300006944 | Bacteria | 6859 |
| 144 | Ga0079104_1000309 | 3300006946 | Bacteria | 61858 |
| 145 | Ga0099826_10000018 | 3300006948 | Bacteria | 198330 |
| 146 | Ga0105251_10002082 | 3300009011 | Bacteria | 16156 |
| 147 | Ga0105251_10005601 | 3300009011 | Bacteria | 8174 |
| 148 | Ga0105251_10013210 | 3300009011 | Bacteria | 4629 |
| 149 | Ga0105251_10024566 | 3300009011 | Bacteria | 3093 |
| 150 | Ga0105251_10049399 | 3300009011 | Bacteria | 2013 |
| 151 | Ga0105244_10001133 | 3300009036 | Bacteria | 22165 |
| 152 | Ga0105244_10002953 | 3300009036 | Bacteria | 12532 |
| 153 | Ga0105244_10007523 | 3300009036 | Bacteria | 6913 |
| 154 | Ga0105244_10061761 | 3300009036 | Bacteria | 1885 |
| 155 | Ga0105240_10012100 | 3300009093 | Bacteria | 11952 |
| 156 | Ga0105240_10017206 | 3300009093 | Bacteria | 9753 |
| 157 | Ga0105240_10024629 | 3300009093 | Bacteria | 7928 |
| 158 | Ga0105245_10262933 | 3300009098 | Bacteria | 1680 |
| 159 | Ga0105243_10052625 | 3300009148 | Bacteria | 3226 |
| 160 | Ga0105243_10054161 | 3300009148 | Bacteria | 3184 |
| 161 | Ga0105241_10019955 | 3300009174 | Bacteria | 4947 |
| 162 | Ga0105241_10186928 | 3300009174 | Bacteria | 1722 |
| 163 | Ga0105242_10007036 | 3300009176 | Bacteria | 8688 |
| 164 | Ga0105248_10078637 | 3300009177 | Bacteria | 3708 |
| 165 | Ga0105237_10499422 | 3300009545 | Bacteria | 1223 |
| 166 | Ga0105237_10755773 | 3300009545 | Bacteria | 979 |
| 167 | Ga0105238_10030398 | 3300009551 | Bacteria | 5498 |
| 168 | Ga0105238_10055566 | 3300009551 | Bacteria | 3974 |
| 169 | Ga0105238_10061774 | 3300009551 | Bacteria | 3749 |
| 170 | Ga0105249_10007528 | 3300009553 | Bacteria | 9500 |
| 171 | Ga0105246_10099856 | 3300011119 | Bacteria | 2111 |
| 172 | Ga0157373_10045986 | 3300013100 | Bacteria | 3115 |
| 173 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 174 | Ga0157371_10207645 | 3300013102 | Bacteria | 1405 |
| 175 | Ga0157370_10366078 | 3300013104 | Bacteria | 1328 |
| 176 | Ga0157370_10764917 | 3300013104 | Bacteria | 880 |
| 177 | Ga0157369_10169148 | 3300013105 | Bacteria | 2304 |
| 178 | Ga0157369_10236802 | 3300013105 | Bacteria | 1907 |
| 179 | Ga0157369_10383864 | 3300013105 | Bacteria | 1458 |
| 180 | Ga0157374_10036965 | 3300013296 | Bacteria | 4477 |
| 181 | Ga0157374_10132950 | 3300013296 | Bacteria | 2409 |
| 182 | Ga0157378_10248522 | 3300013297 | Bacteria | 1702 |
| 183 | Ga0163162_10040965 | 3300013306 | Bacteria | 4633 |
| 184 | Ga0163162_10728762 | 3300013306 | Bacteria | 1112 |
| 185 | Ga0157372_10361837 | 3300013307 | Bacteria | 1690 |
| 186 | Ga0157372_10731731 | 3300013307 | Bacteria | 1150 |
| 187 | Ga0157375_10008692 | 3300013308 | Bacteria | 8901 |
| 188 | Ga0157375_10173565 | 3300013308 | Bacteria | 2304 |
| 189 | Ga0157380_10051165 | 3300014326 | Bacteria | 3266 |
| 190 | Ga0157380_10241647 | 3300014326 | Bacteria | 1628 |
| 191 | Ga0182008_10003842 | 3300014497 | Bacteria | 8925 |
| 192 | Ga0182008_10027616 | 3300014497 | Bacteria | 2873 |
| 193 | Ga0157377_10228313 | 3300014745 | Bacteria | 1195 |
| 194 | Ga0157376_10226589 | 3300014969 | Bacteria | 1734 |
| 195 | Ga0157376_10345560 | 3300014969 | Bacteria | 1422 |
| 196 | Ga0182006_1009422 | 3300015261 | Bacteria | 4374 |
| 197 | Ga0182007_10004447 | 3300015262 | Bacteria | 6350 |
| 198 | Ga0182007_10010110 | 3300015262 | Bacteria | 3748 |
| 199 | Ga0182007_10081906 | 3300015262 | Bacteria | 1059 |
| 200 | Ga0182007_10095791 | 3300015262 | Bacteria | 980 |
| 201 | Ga0182005_1000158 | 3300015265 | Bacteria | 47201 |
| 202 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 203 | Ga0213872_10002809 | 3300021361 | Bacteria | 9960 |
| 204 | Ga0213872_10019803 | 3300021361 | Bacteria | 3098 |
| 205 | Ga0213872_10038157 | 3300021361 | Bacteria | 2193 |
| 206 | Ga0213872_10046973 | 3300021361 | Bacteria | 1964 |
| 207 | Ga0213872_10052963 | 3300021361 | Bacteria | 1841 |
| 208 | Ga0213872_10141970 | 3300021361 | Bacteria | 1053 |
| 209 | Ga0209435_100160 | 3300025206 | Bacteria | 21645 |
| 210 | Ga0209435_100473 | 3300025206 | Bacteria | 7971 |
| 211 | Ga0209435_109601 | 3300025206 | Bacteria | 1055 |
| 212 | Ga0209436_100751 | 3300025208 | Bacteria | 13429 |
| 213 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 214 | Ga0209784_100365 | 3300025224 | Bacteria | 21497 |
| 215 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 216 | Ga0209566_100955 | 3300025225 | Bacteria | 13033 |
| 217 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 218 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 219 | Ga0209674_100184 | 3300025226 | Bacteria | 68529 |
| 220 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 221 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 222 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 223 | Ga0207427_101086 | 3300025231 | Bacteria | 11117 |
| 224 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 225 | Ga0209437_100259 | 3300025233 | Bacteria | 82489 |
| 226 | Ga0209258_100525 | 3300025242 | Bacteria | 36665 |
| 227 | Ga0209258_100580 | 3300025242 | Bacteria | 30726 |
| 228 | Ga0209646_1000035 | 3300025246 | Bacteria | 363209 |
| 229 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 230 | Ga0209646_1000403 | 3300025246 | Bacteria | 25548 |
| 231 | Ga0209646_1000503 | 3300025246 | Bacteria | 18211 |
| 232 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 233 | Ga0209026_1000760 | 3300025250 | Bacteria | 18093 |
| 234 | Ga0209026_1000967 | 3300025250 | Bacteria | 14329 |
| 235 | Ga0209026_1002757 | 3300025250 | Bacteria | 6282 |
| 236 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 237 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 238 | Ga0209677_100760 | 3300025253 | Bacteria | 16357 |
| 239 | Ga0209677_102322 | 3300025253 | Bacteria | 7314 |
| 240 | Ga0209677_102920 | 3300025253 | Bacteria | 5982 |
| 241 | Ga0209148_1000293 | 3300025254 | Bacteria | 74776 |
| 242 | Ga0209148_1005971 | 3300025254 | Bacteria | 2703 |
| 243 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 244 | Ga0209759_1000253 | 3300025256 | Bacteria | 79223 |
| 245 | Ga0209759_1001054 | 3300025256 | Bacteria | 18214 |
| 246 | Ga0209129_1000093 | 3300025258 | Bacteria | 173163 |
| 247 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 248 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 249 | Ga0209565_1000946 | 3300025263 | Bacteria | 15214 |
| 250 | Ga0209565_1001578 | 3300025263 | Bacteria | 9718 |
| 251 | Ga0209565_1002746 | 3300025263 | Bacteria | 6109 |
| 252 | Ga0209565_1012113 | 3300025263 | Bacteria | 2071 |
| 253 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 254 | Ga0209673_1006646 | 3300025273 | Bacteria | 5523 |
| 255 | Ga0209130_1001278 | 3300025284 | Bacteria | 17422 |
| 256 | Ga0209130_1001458 | 3300025284 | Bacteria | 15552 |
| 257 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 258 | Ga0209675_1000100 | 3300025291 | Bacteria | 128565 |
| 259 | Ga0209675_1000945 | 3300025291 | Bacteria | 18462 |
| 260 | Ga0209675_1007213 | 3300025291 | Bacteria | 4304 |
| 261 | Ga0209675_1009393 | 3300025291 | Bacteria | 3461 |
| 262 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 263 | Ga0209025_1001877 | 3300025294 | Bacteria | 24578 |
| 264 | Ga0209025_1004210 | 3300025294 | Bacteria | 12682 |
| 265 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 266 | Ga0209564_1003837 | 3300025295 | Bacteria | 9718 |
| 267 | Ga0209564_1003839 | 3300025295 | Bacteria | 9717 |
| 268 | Ga0209564_1004073 | 3300025295 | Bacteria | 9216 |
| 269 | Ga0209050_1000145 | 3300025298 | Bacteria | 168151 |
| 270 | Ga0209050_1007847 | 3300025298 | Bacteria | 5863 |
| 271 | Ga0209050_1012221 | 3300025298 | Bacteria | 3962 |
| 272 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 273 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 274 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 275 | Ga0209256_1000269 | 3300025299 | Bacteria | 91493 |
| 276 | Ga0209256_1000676 | 3300025299 | Bacteria | 46097 |
| 277 | Ga0209256_1002862 | 3300025299 | Bacteria | 13132 |
| 278 | Ga0209256_1007013 | 3300025299 | Bacteria | 5721 |
| 279 | Ga0207426_1002626 | 3300025302 | Bacteria | 11130 |
| 280 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 281 | Ga0209051_1004528 | 3300025303 | Bacteria | 8521 |
| 282 | Ga0209051_1005475 | 3300025303 | Bacteria | 7404 |
| 283 | Ga0209051_1016272 | 3300025303 | Bacteria | 3376 |
| 284 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 285 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 286 | Ga0209257_1004271 | 3300025304 | Bacteria | 11259 |
| 287 | Ga0207697_10031970 | 3300025315 | Bacteria | 2153 |
| 288 | Ga0207656_10276333 | 3300025321 | Bacteria | 827 |
| 289 | Ga0207655_1001288 | 3300025728 | Bacteria | 23781 |
| 290 | Ga0207713_1000135 | 3300025735 | Bacteria | 112173 |
| 291 | Ga0207713_1008988 | 3300025735 | Bacteria | 5683 |
| 292 | Ga0207713_1055329 | 3300025735 | Bacteria | 1549 |
| 293 | Ga0207682_10006644 | 3300025893 | Bacteria | 4648 |
| 294 | Ga0207682_10039046 | 3300025893 | Bacteria | 1928 |
| 295 | Ga0207642_10016456 | 3300025899 | Bacteria | 2786 |
| 296 | Ga0207680_10018874 | 3300025903 | Bacteria | 3677 |
| 297 | Ga0207647_10035754 | 3300025904 | Bacteria | 3163 |
| 298 | Ga0207645_10029160 | 3300025907 | Bacteria | 3558 |
| 299 | Ga0207645_10414350 | 3300025907 | Bacteria | 907 |
| 300 | Ga0207643_10097419 | 3300025908 | Bacteria | 1721 |
| 301 | Ga0207705_10106102 | 3300025909 | Bacteria | 2071 |
| 302 | Ga0207705_10191215 | 3300025909 | Bacteria | 1548 |
| 303 | Ga0207654_10289787 | 3300025911 | Bacteria | 1110 |
| 304 | Ga0207695_10009547 | 3300025913 | Bacteria | 11996 |
| 305 | Ga0207695_10010175 | 3300025913 | Bacteria | 11536 |
| 306 | Ga0207695_10032918 | 3300025913 | Bacteria | 5665 |
| 307 | Ga0207695_10079069 | 3300025913 | Bacteria | 3334 |
| 308 | Ga0207671_10033303 | 3300025914 | Bacteria | 3833 |
| 309 | Ga0207662_10002597 | 3300025918 | Bacteria | 9105 |
| 310 | Ga0207657_10149395 | 3300025919 | Bacteria | 1904 |
| 311 | Ga0207649_10252355 | 3300025920 | Bacteria | 1271 |
| 312 | Ga0207681_10008770 | 3300025923 | Bacteria | 6176 |
| 313 | Ga0207681_10184195 | 3300025923 | Bacteria | 1593 |
| 314 | Ga0207694_10059333 | 3300025924 | Bacteria | 2975 |
| 315 | Ga0207650_10350312 | 3300025925 | Bacteria | 1215 |
| 316 | Ga0207659_10032977 | 3300025926 | Bacteria | 3559 |
| 317 | Ga0207659_10038293 | 3300025926 | Bacteria | 3334 |
| 318 | Ga0207687_10034805 | 3300025927 | Bacteria | 3423 |
| 319 | Ga0207644_10048134 | 3300025931 | Bacteria | 3046 |
| 320 | Ga0207690_10004058 | 3300025932 | Bacteria | 8649 |
| 321 | Ga0207690_10507350 | 3300025932 | Bacteria | 976 |
| 322 | Ga0207706_10015322 | 3300025933 | Bacteria | 6930 |
| 323 | Ga0207706_10144106 | 3300025933 | Bacteria | 2096 |
| 324 | Ga0207709_10002721 | 3300025935 | Bacteria | 10914 |
| 325 | Ga0207670_10369958 | 3300025936 | Bacteria | 1139 |
| 326 | Ga0207669_10006656 | 3300025937 | Bacteria | 5296 |
| 327 | Ga0207691_10048281 | 3300025940 | Bacteria | 3904 |
| 328 | Ga0207691_10093888 | 3300025940 | Bacteria | 2685 |
| 329 | Ga0207691_10096426 | 3300025940 | Bacteria | 2644 |
| 330 | Ga0207689_10011506 | 3300025942 | Bacteria | 7583 |
| 331 | Ga0207689_10039908 | 3300025942 | Bacteria | 3886 |
| 332 | Ga0207661_10052657 | 3300025944 | Bacteria | 3253 |
| 333 | Ga0207667_10021476 | 3300025949 | Bacteria | 7152 |
| 334 | Ga0207712_10009755 | 3300025961 | Bacteria | 6084 |
| 335 | Ga0207668_10046072 | 3300025972 | Bacteria | 2977 |
| 336 | Ga0207640_10079351 | 3300025981 | Bacteria | 2237 |
| 337 | Ga0207640_10096861 | 3300025981 | Bacteria | 2058 |
| 338 | Ga0207658_10013291 | 3300025986 | Bacteria | 5622 |
| 339 | Ga0207677_10040223 | 3300026023 | Bacteria | 3080 |
| 340 | Ga0207703_10005816 | 3300026035 | Bacteria | 9879 |
| 341 | Ga0207678_10076301 | 3300026067 | Bacteria | 2871 |
| 342 | Ga0207678_10422419 | 3300026067 | Bacteria | 1156 |
| 343 | Ga0207678_10488071 | 3300026067 | Bacteria | 1073 |
| 344 | Ga0207702_10001261 | 3300026078 | Bacteria | 25509 |
| 345 | Ga0207702_10058186 | 3300026078 | Bacteria | 3288 |
| 346 | Ga0207641_10005241 | 3300026088 | Bacteria | 11086 |
| 347 | Ga0207648_10047299 | 3300026089 | Bacteria | 3772 |
| 348 | Ga0207648_10225905 | 3300026089 | Bacteria | 1665 |
| 349 | Ga0207648_10356977 | 3300026089 | Bacteria | 1318 |
| 350 | Ga0207674_10057723 | 3300026116 | Bacteria | 3935 |
| 351 | Ga0207675_100002925 | 3300026118 | Bacteria | 16801 |
| 352 | Ga0207675_100111936 | 3300026118 | Bacteria | 2576 |
| 353 | Ga0207683_10041387 | 3300026121 | Bacteria | 4024 |
| 354 | Ga0207683_10377001 | 3300026121 | Bacteria | 1304 |
| 355 | Ga0207698_10008917 | 3300026142 | Bacteria | 6359 |
| 356 | Ga0207698_10121456 | 3300026142 | Bacteria | 2212 |
| 357 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 358 | Ga0209968_1001095 | 3300027526 | Bacteria | 4135 |
| 359 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 360 | Ga0209282_1000052 | 3300027666 | Bacteria | 104317 |
| 361 | Ga0209966_1000003 | 3300027695 | Bacteria | 111077 |
| 362 | Ga0268266_10176480 | 3300028379 | Bacteria | 1943 |
| 363 | Ga0268264_10001986 | 3300028381 | Bacteria | 18405 |
| 364 | Ga0307515_10000708 | 3300028794 | Bacteria | 76903 |
| 365 | Ga0307515_10013083 | 3300028794 | Bacteria | 15535 |
| 366 | Ga0307515_10470144 | 3300028794 | Bacteria | 870 |
| 367 | Ga0307511_10076838 | 3300030521 | Bacteria | 2383 |
| 368 | Ga0307512_10056000 | 3300030522 | Bacteria | 3102 |
| 369 | Ga0265328_10005685 | 3300031239 | Bacteria | 5326 |
| 370 | Ga0265327_10000479 | 3300031251 | Bacteria | 70467 |
| 371 | Ga0265327_10031415 | 3300031251 | Bacteria | 2984 |
| 372 | Ga0307509_10073712 | 3300031507 | Bacteria | 3554 |
| 373 | Ga0307508_10000169 | 3300031616 | Bacteria | 78769 |
| 374 | Ga0307514_10085435 | 3300031649 | Bacteria | 2319 |
| 375 | Ga0316576_10077095 | 3300031727 | Bacteria | 2468 |
| 376 | Ga0307516_10008972 | 3300031730 | Bacteria | 11204 |
| 377 | Ga0307516_10009988 | 3300031730 | Bacteria | 10508 |
| 378 | Ga0307413_10273545 | 3300031824 | Bacteria | 1266 |
| 379 | Ga0307518_10127414 | 3300031838 | Bacteria | 1794 |
| 380 | Ga0307410_10247607 | 3300031852 | Bacteria | 1384 |
| 381 | Ga0307409_100226671 | 3300031995 | Bacteria | 1691 |
| 382 | Ga0307409_100280086 | 3300031995 | Bacteria | 1541 |
| 383 | Ga0307416_100005407 | 3300032002 | Bacteria | 7838 |
| 384 | Ga0307416_101791783 | 3300032002 | Bacteria | 718 |
| 385 | Ga0307414_10094204 | 3300032004 | Bacteria | 2234 |
| 386 | Ga0307507_10021968 | 3300033179 | Bacteria | 7077 |
| 387 | Ga0316574_0086518 | 3300035398 | Bacteria | 1995 |
| 388 | Ga0373924_0027378 | 3300035410 | Bacteria | 2266 |
| 389 | Ga0373933_0320756 | 3300035724 | Bacteria | 1005 |
| 390 | Ga0373937_0089551 | 3300036401 | Bacteria | 2849 |
| 391 | Ga0373937_0468785 | 3300036401 | Bacteria | 1196 |
| 392 | Ga0395899_0001064 | 3300037312 | Bacteria | 24780 |
| 393 | Ga0395899_0002813 | 3300037312 | Bacteria | 14019 |
| 394 | Ga0395899_0003608 | 3300037312 | Bacteria | 12242 |
| 395 | Ga0395900_0000131 | 3300037418 | Bacteria | 125554 |
| 396 | Ga0395900_0005698 | 3300037418 | Bacteria | 13021 |
| 397 | Ga0395900_0283273 | 3300037418 | Bacteria | 1648 |
| 398 | Ga0395898_0001532 | 3300037466 | Bacteria | 31823 |
| 399 | Ga0395898_0097883 | 3300037466 | Bacteria | 2817 |
| 400 | Ga0395905_0017710 | 3300037471 | Bacteria | 6763 |
| 401 | Ga0395905_0025730 | 3300037471 | Bacteria | 5549 |
| 402 | Ga0395905_0028213 | 3300037471 | Bacteria | 5291 |
| 403 | Ga0395905_0063403 | 3300037471 | Bacteria | 3458 |
| 404 | Ga0395905_0208288 | 3300037471 | Bacteria | 1832 |
| 405 | Ga0395901_0000002 | 3300038443 | Bacteria | 761045 |
| 406 | Ga0395901_0001718 | 3300038443 | Bacteria | 22613 |
| 407 | Ga0395901_0136559 | 3300038443 | Bacteria | 2577 |
| 408 | Ga0395901_1173314 | 3300038443 | Bacteria | 735 |
| 409 | Ga0436361_0144599 | 3300039447 | Bacteria | 904 |
| 410 | Ga0436361_0338967 | 3300039447 | Bacteria | 4771 |
| 411 | Ga0436361_0600769 | 3300039447 | Bacteria | 3349 |
| 412 | Ga0436361_0846070 | 3300039447 | Bacteria | 4410 |
| 413 | Ga0439461_0030468 | 3300041410 | Bacteria | 1122 |
| 414 | Ga0439465_0120827 | 3300041413 | Bacteria | 918 |
| 415 | Ga0451789_0491830 | 3300041443 | Bacteria | 1054 |
| 416 | Ga0451795_0419335 | 3300041456 | Bacteria | 1283 |
| 417 | Ga0451802_0970336 | 3300041460 | Bacteria | 1525 |
| 418 | Ga0451835_0864634 | 3300041492 | Bacteria | 979 |
| 419 | Ga0451839_0718016 | 3300041496 | Bacteria | 862 |
| 420 | Ga0451849_0077297 | 3300041505 | Bacteria | 878 |
| 421 | Ga0451851_0770517 | 3300041507 | Bacteria | 1466 |
| 422 | Ga0451843_0223084 | 3300041509 | Bacteria | 989 |
| 423 | Ga0439431_0031742 | 3300041997 | Bacteria | 1314 |
| 424 | Ga0439450_007594 | 3300042008 | Bacteria | 1993 |
| 425 | Ga0450906_010415 | 3300042145 | Bacteria | 1759 |
| 426 | Ga0439446_0014983 | 3300042156 | Bacteria | 2146 |
| 427 | Ga0439434_0039325 | 3300042435 | Bacteria | 1451 |
| 428 | Ga0439460_0095082 | 3300042461 | Bacteria | 951 |
| 429 | Ga0450918_001746 | 3300042531 | Bacteria | 4228 |
| 430 | Ga0451577_0091368 | 3300042876 | Bacteria | 2717 |
| 431 | Ga0451577_0751880 | 3300042876 | Bacteria | 882 |
| 432 | Ga0466969_0058160 | 3300044656 | Bacteria | 1882 |
| 433 | Ga0466972_0000088 | 3300044658 | Bacteria | 84167 |
| 434 | Ga0466972_0022575 | 3300044658 | Bacteria | 3132 |
| 435 | Ga0466978_0109275 | 3300044671 | Bacteria | 1714 |
| 436 | Ga0466965_0000666 | 3300044683 | Bacteria | 12609 |
| 437 | Ga0466965_0002051 | 3300044683 | Bacteria | 8434 |
| 438 | Ga0466966_0000687 | 3300044684 | Bacteria | 21520 |
| 439 | Ga0466966_0006128 | 3300044684 | Bacteria | 7946 |
| 440 | Ga0466966_0089471 | 3300044684 | Bacteria | 1912 |
| 441 | Ga0466961_0001458 | 3300044693 | Bacteria | 14699 |
| 442 | Ga0466961_0007342 | 3300044693 | Bacteria | 7013 |
| 443 | Ga0466961_0018736 | 3300044693 | Bacteria | 4453 |
| 444 | Ga0466963_0027945 | 3300044694 | Bacteria | 3616 |
| 445 | Ga0466963_0047308 | 3300044694 | Bacteria | 2839 |
| 446 | Ga0466964_0002548 | 3300044706 | Bacteria | 6493 |
| 447 | Ga0466964_0002848 | 3300044706 | Bacteria | 6238 |
| 448 | Ga0466964_0025767 | 3300044706 | Bacteria | 2298 |
| 449 | Ga0466964_0040051 | 3300044706 | Bacteria | 1890 |
| 450 | Ga0466964_0056879 | 3300044706 | Bacteria | 1618 |
| 451 | Ga0466964_0113758 | 3300044706 | Bacteria | 1210 |
| 452 | Ga0453684_0023234 | 3300044712 | Bacteria | 9147 |
| 453 | Ga0466971_0005142 | 3300044719 | Bacteria | 5665 |
| 454 | Ga0466971_0007302 | 3300044719 | Bacteria | 4811 |
| 455 | Ga0466971_0017715 | 3300044719 | Bacteria | 3154 |
| 456 | Ga0466971_0052756 | 3300044719 | Bacteria | 1832 |
| 457 | Ga0466968_0063481 | 3300044735 | Bacteria | 1596 |
| 458 | Ga0466970_0007806 | 3300044765 | Bacteria | 5370 |
| 459 | Ga0466970_0028412 | 3300044765 | Bacteria | 2938 |
| 460 | Ga0466970_0031025 | 3300044765 | Bacteria | 2821 |
| 461 | Ga0466957_0047867 | 3300044842 | Bacteria | 2598 |
| 462 | Ga0466957_0164008 | 3300044842 | Bacteria | 1444 |
| 463 | Ga0466957_0192226 | 3300044842 | Bacteria | 1337 |
| 464 | Ga0466960_0026488 | 3300044901 | Bacteria | 2634 |
| 465 | Ga0466959_0000287 | 3300045049 | Bacteria | 30550 |
| 466 | Ga0466959_0009422 | 3300045049 | Bacteria | 6947 |
| 467 | Ga0466959_0052023 | 3300045049 | Bacteria | 3001 |
| 468 | Ga0466959_0081458 | 3300045049 | Bacteria | 2332 |
| 469 | Ga0451576_0074320 | 3300045051 | Bacteria | 3537 |
| 470 | Ga0451576_0194483 | 3300045051 | Bacteria | 2118 |
| 471 | Ga0466958_0011505 | 3300045836 | Bacteria | 4983 |
| 472 | Ga0466958_0587412 | 3300045836 | Bacteria | 724 |
| 473 | Ga0466967_0024766 | 3300045976 | Bacteria | 4939 |
| 474 | Ga0466967_0090776 | 3300045976 | Bacteria | 2775 |
| 475 | Ga0466967_0141742 | 3300045976 | Bacteria | 2239 |
| 476 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 477 | Ga0495617_041726 | 3300046452 | Bacteria | 1533 |
| 478 | Ga0495617_085942 | 3300046452 | Bacteria | 1028 |
| 479 | Ga0495627_000207 | 3300046453 | Bacteria | 63763 |
| 480 | Ga0495627_042518 | 3300046453 | Bacteria | 1392 |
| 481 | Ga0495627_046735 | 3300046453 | Bacteria | 1314 |
| 482 | Ga0495592_0030409 | 3300046454 | Bacteria | 4085 |
| 483 | Ga0495592_0100052 | 3300046454 | Bacteria | 2067 |
| 484 | Ga0495603_0106430 | 3300046455 | Bacteria | 1636 |
| 485 | Ga0495603_0364263 | 3300046455 | Bacteria | 829 |
| 486 | Ga0495590_0000025 | 3300046457 | Bacteria | 165221 |
| 487 | Ga0495590_0018282 | 3300046457 | Bacteria | 2510 |
| 488 | Ga0495590_0021071 | 3300046457 | Bacteria | 2312 |
| 489 | Ga0495590_0054003 | 3300046457 | Bacteria | 1403 |
| 490 | Ga0495591_002755 | 3300046458 | Bacteria | 9489 |
| 491 | Ga0495629_0000878 | 3300046459 | Bacteria | 24225 |
| 492 | Ga0495629_0005319 | 3300046459 | Bacteria | 9625 |
| 493 | Ga0495638_0013390 | 3300046460 | Bacteria | 5585 |
| 494 | Ga0495638_0016484 | 3300046460 | Bacteria | 4948 |
| 495 | Ga0495638_0035516 | 3300046460 | Bacteria | 3177 |
| 496 | Ga0495638_0073932 | 3300046460 | Bacteria | 2079 |
| 497 | Ga0495638_0244567 | 3300046460 | Bacteria | 992 |
| 498 | Ga0495651_0100121 | 3300046462 | Bacteria | 2159 |
| 499 | Ga0495651_0134207 | 3300046462 | Bacteria | 1803 |
| 500 | Ga0495651_0351245 | 3300046462 | Bacteria | 974 |
| 501 | Ga0495653_0005181 | 3300046463 | Bacteria | 10598 |
| 502 | Ga0495653_0007366 | 3300046463 | Bacteria | 9015 |
| 503 | Ga0495653_0061355 | 3300046463 | Bacteria | 2845 |
| 504 | Ga0495653_0105341 | 3300046463 | Bacteria | 2036 |
| 505 | Ga0495653_0132732 | 3300046463 | Bacteria | 1760 |
| 506 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 507 | Ga0495650_0005573 | 3300046471 | Bacteria | 8121 |
| 508 | Ga0495650_0006345 | 3300046471 | Bacteria | 7391 |
| 509 | Ga0495650_0007195 | 3300046471 | Bacteria | 6744 |
| 510 | Ga0495650_0008662 | 3300046471 | Bacteria | 5893 |
| 511 | Ga0495650_0009150 | 3300046471 | Bacteria | 5673 |
| 512 | Ga0495580_0016442 | 3300046472 | Bacteria | 5551 |
| 513 | Ga0495580_0020600 | 3300046472 | Bacteria | 4878 |
| 514 | Ga0495580_0023359 | 3300046472 | Bacteria | 4542 |
| 515 | Ga0495580_0050910 | 3300046472 | Bacteria | 2928 |
| 516 | Ga0495580_0115644 | 3300046472 | Bacteria | 1863 |
| 517 | Ga0495580_0699376 | 3300046472 | Bacteria | 663 |
| 518 | Ga0495582_0002333 | 3300046473 | Bacteria | 10632 |
| 519 | Ga0495582_0027681 | 3300046473 | Bacteria | 3109 |
| 520 | Ga0495582_0044024 | 3300046473 | Bacteria | 2458 |
| 521 | Ga0495605_0001284 | 3300046474 | Bacteria | 16646 |
| 522 | Ga0495605_0003031 | 3300046474 | Bacteria | 10141 |
| 523 | Ga0495605_0012486 | 3300046474 | Bacteria | 4711 |
| 524 | Ga0495605_0025196 | 3300046474 | Bacteria | 3101 |
| 525 | Ga0495605_0026070 | 3300046474 | Bacteria | 3040 |
| 526 | Ga0495605_0240640 | 3300046474 | Bacteria | 777 |
| 527 | Ga0495662_0386912 | 3300046476 | Bacteria | 687 |
| 528 | Ga0495664_0019005 | 3300046477 | Bacteria | 3946 |
| 529 | Ga0495664_0495309 | 3300046477 | Bacteria | 730 |
| 530 | Ga0495584_0000070 | 3300046491 | Bacteria | 73237 |
| 531 | Ga0495584_0000560 | 3300046491 | Bacteria | 25087 |
| 532 | Ga0495584_0004898 | 3300046491 | Bacteria | 7146 |
| 533 | Ga0495584_0005783 | 3300046491 | Bacteria | 6521 |
| 534 | Ga0495584_0007322 | 3300046491 | Bacteria | 5754 |
| 535 | Ga0495584_0009129 | 3300046491 | Bacteria | 5119 |
| 536 | Ga0495584_0288096 | 3300046491 | Bacteria | 834 |
| 537 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 538 | Ga0495585_0006233 | 3300046492 | Bacteria | 7430 |
| 539 | Ga0495585_0006865 | 3300046492 | Bacteria | 7017 |
| 540 | Ga0495585_0010286 | 3300046492 | Bacteria | 5578 |
| 541 | Ga0495585_0010483 | 3300046492 | Bacteria | 5512 |
| 542 | Ga0495585_0013461 | 3300046492 | Bacteria | 4786 |
| 543 | Ga0495585_0026665 | 3300046492 | Bacteria | 3300 |
| 544 | Ga0495585_0030854 | 3300046492 | Bacteria | 3047 |
| 545 | Ga0495585_0032874 | 3300046492 | Bacteria | 2937 |
| 546 | Ga0495585_0034744 | 3300046492 | Bacteria | 2850 |
| 547 | Ga0495585_0059514 | 3300046492 | Bacteria | 2104 |
| 548 | Ga0495585_0068952 | 3300046492 | Bacteria | 1930 |
| 549 | Ga0495585_0154537 | 3300046492 | Bacteria | 1194 |
| 550 | Ga0495585_0193122 | 3300046492 | Bacteria | 1040 |
| 551 | Ga0495594_0003640 | 3300046499 | Bacteria | 7930 |
| 552 | Ga0495594_0005742 | 3300046499 | Bacteria | 6374 |
| 553 | Ga0495594_0013918 | 3300046499 | Bacteria | 4209 |
| 554 | Ga0495594_0030537 | 3300046499 | Bacteria | 2917 |
| 555 | Ga0495594_0069416 | 3300046499 | Bacteria | 1957 |
| 556 | Ga0495596_0000240 | 3300046500 | Bacteria | 37159 |
| 557 | Ga0495596_0001004 | 3300046500 | Bacteria | 16768 |
| 558 | Ga0495596_0001839 | 3300046500 | Bacteria | 11778 |
| 559 | Ga0495596_0008211 | 3300046500 | Bacteria | 4655 |
| 560 | Ga0495596_0008902 | 3300046500 | Bacteria | 4440 |
| 561 | Ga0495596_0009505 | 3300046500 | Bacteria | 4274 |
| 562 | Ga0495596_0011786 | 3300046500 | Bacteria | 3754 |
| 563 | Ga0495596_0012683 | 3300046500 | Bacteria | 3598 |
| 564 | Ga0495596_0031054 | 3300046500 | Bacteria | 2136 |
| 565 | Ga0495596_0033692 | 3300046500 | Bacteria | 2038 |
| 566 | Ga0495596_0041071 | 3300046500 | Bacteria | 1824 |
| 567 | Ga0495596_0070668 | 3300046500 | Bacteria | 1356 |
| 568 | Ga0495596_0196268 | 3300046500 | Bacteria | 784 |
| 569 | Ga0495607_0002594 | 3300046501 | Bacteria | 14550 |
| 570 | Ga0495607_0004085 | 3300046501 | Bacteria | 10913 |
| 571 | Ga0495607_0005057 | 3300046501 | Bacteria | 9558 |
| 572 | Ga0495607_0009947 | 3300046501 | Bacteria | 6404 |
| 573 | Ga0495607_0014386 | 3300046501 | Bacteria | 5152 |
| 574 | Ga0495607_0017453 | 3300046501 | Bacteria | 4607 |
| 575 | Ga0495607_0031280 | 3300046501 | Bacteria | 3259 |
| 576 | Ga0495607_0046605 | 3300046501 | Bacteria | 2544 |
| 577 | Ga0495607_0068424 | 3300046501 | Bacteria | 1991 |
| 578 | Ga0495607_0106432 | 3300046501 | Bacteria | 1493 |
| 579 | Ga0495607_0117837 | 3300046501 | Bacteria | 1398 |
| 580 | Ga0495607_0307808 | 3300046501 | Bacteria | 743 |
| 581 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 582 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 583 | Ga0495583_0000372 | 3300046506 | Bacteria | 69750 |
| 584 | Ga0495583_0000382 | 3300046506 | Bacteria | 68388 |
| 585 | Ga0495583_0000864 | 3300046506 | Bacteria | 36820 |
| 586 | Ga0495583_0002345 | 3300046506 | Bacteria | 16395 |
| 587 | Ga0495583_0004885 | 3300046506 | Bacteria | 9353 |
| 588 | Ga0495583_0023202 | 3300046506 | Bacteria | 3144 |
| 589 | Ga0495583_0056880 | 3300046506 | Bacteria | 1761 |
| 590 | Ga0495583_0101613 | 3300046506 | Bacteria | 1226 |
| 591 | Ga0495583_0167063 | 3300046506 | Bacteria | 905 |
| 592 | Ga0495583_0209989 | 3300046506 | Bacteria | 789 |
| 593 | Ga0495606_0002998 | 3300046507 | Bacteria | 18539 |
| 594 | Ga0495606_0004210 | 3300046507 | Bacteria | 14562 |
| 595 | Ga0495606_0013849 | 3300046507 | Bacteria | 6332 |
| 596 | Ga0495606_0038316 | 3300046507 | Bacteria | 3244 |
| 597 | Ga0495606_0039674 | 3300046507 | Bacteria | 3169 |
| 598 | Ga0495606_0041103 | 3300046507 | Bacteria | 3102 |
| 599 | Ga0495606_0133232 | 3300046507 | Bacteria | 1475 |
| 600 | Ga0495606_0133665 | 3300046507 | Bacteria | 1472 |
| 601 | Ga0495606_0306052 | 3300046507 | Bacteria | 859 |
| 602 | Ga0495608_0072156 | 3300046511 | Bacteria | 2252 |
| 603 | Ga0495610_0004511 | 3300046512 | Bacteria | 10257 |
| 604 | Ga0495610_0006028 | 3300046512 | Bacteria | 8463 |
| 605 | Ga0495610_0020472 | 3300046512 | Bacteria | 3673 |
| 606 | Ga0495610_0035172 | 3300046512 | Bacteria | 2574 |
| 607 | Ga0495616_0000057 | 3300046513 | Bacteria | 100806 |
| 608 | Ga0495616_0003140 | 3300046513 | Bacteria | 10676 |
| 609 | Ga0495616_0004533 | 3300046513 | Bacteria | 8746 |
| 610 | Ga0495616_0010511 | 3300046513 | Bacteria | 5355 |
| 611 | Ga0495616_0015188 | 3300046513 | Bacteria | 4284 |
| 612 | Ga0495616_0015417 | 3300046513 | Bacteria | 4251 |
| 613 | Ga0495616_0015591 | 3300046513 | Bacteria | 4222 |
| 614 | Ga0495616_0028366 | 3300046513 | Bacteria | 2964 |
| 615 | Ga0495616_0031036 | 3300046513 | Bacteria | 2802 |
| 616 | Ga0495616_0101666 | 3300046513 | Bacteria | 1347 |
| 617 | Ga0495620_0030549 | 3300046515 | Bacteria | 2479 |
| 618 | Ga0495620_0041244 | 3300046515 | Bacteria | 2026 |
| 619 | Ga0495620_0049470 | 3300046515 | Bacteria | 1798 |
| 620 | Ga0495620_0049791 | 3300046515 | Bacteria | 1790 |
| 621 | Ga0495628_0029302 | 3300046516 | Bacteria | 4464 |
| 622 | Ga0495628_0079729 | 3300046516 | Bacteria | 2545 |
| 623 | Ga0495630_0044173 | 3300046517 | Bacteria | 3329 |
| 624 | Ga0495630_0058357 | 3300046517 | Bacteria | 2893 |
| 625 | Ga0495631_0002820 | 3300046518 | Bacteria | 9652 |
| 626 | Ga0495631_0003219 | 3300046518 | Bacteria | 8985 |
| 627 | Ga0495631_0005293 | 3300046518 | Bacteria | 6776 |
| 628 | Ga0495631_0012520 | 3300046518 | Bacteria | 4139 |
| 629 | Ga0495631_0014987 | 3300046518 | Bacteria | 3727 |
| 630 | Ga0495631_0015637 | 3300046518 | Bacteria | 3630 |
| 631 | Ga0495631_0015837 | 3300046518 | Bacteria | 3604 |
| 632 | Ga0495631_0016374 | 3300046518 | Bacteria | 3536 |
| 633 | Ga0495631_0021138 | 3300046518 | Bacteria | 3032 |
| 634 | Ga0495631_0030586 | 3300046518 | Bacteria | 2441 |
| 635 | Ga0495631_0045981 | 3300046518 | Bacteria | 1920 |
| 636 | Ga0495631_0144685 | 3300046518 | Bacteria | 1020 |
| 637 | Ga0495631_0181164 | 3300046518 | Bacteria | 902 |
| 638 | Ga0495632_0000129 | 3300046519 | Bacteria | 77134 |
| 639 | Ga0495632_0000296 | 3300046519 | Bacteria | 48157 |
| 640 | Ga0495632_0000375 | 3300046519 | Bacteria | 42575 |
| 641 | Ga0495632_0008199 | 3300046519 | Bacteria | 6452 |
| 642 | Ga0495632_0022106 | 3300046519 | Bacteria | 3415 |
| 643 | Ga0495632_0022797 | 3300046519 | Bacteria | 3351 |
| 644 | Ga0495632_0025075 | 3300046519 | Bacteria | 3158 |
| 645 | Ga0495632_0026117 | 3300046519 | Bacteria | 3078 |
| 646 | Ga0495637_0000126 | 3300046520 | Bacteria | 57018 |
| 647 | Ga0495637_0023626 | 3300046520 | Bacteria | 2790 |
| 648 | Ga0495637_0070124 | 3300046520 | Bacteria | 1416 |
| 649 | Ga0495643_0000415 | 3300046522 | Bacteria | 55824 |
| 650 | Ga0495643_0011985 | 3300046522 | Bacteria | 5248 |
| 651 | Ga0495643_0026575 | 3300046522 | Bacteria | 3264 |
| 652 | Ga0495643_0031662 | 3300046522 | Bacteria | 2942 |
| 653 | Ga0495643_0048513 | 3300046522 | Bacteria | 2294 |
| 654 | Ga0495643_0095437 | 3300046522 | Bacteria | 1529 |
| 655 | Ga0495643_0125066 | 3300046522 | Bacteria | 1295 |
| 656 | Ga0495643_0313931 | 3300046522 | Bacteria | 710 |
| 657 | Ga0495644_0000389 | 3300046523 | Bacteria | 19747 |
| 658 | Ga0495644_0001948 | 3300046523 | Bacteria | 8291 |
| 659 | Ga0495644_0003401 | 3300046523 | Bacteria | 6293 |
| 660 | Ga0495644_0003438 | 3300046523 | Bacteria | 6265 |
| 661 | Ga0495644_0007023 | 3300046523 | Bacteria | 4355 |
| 662 | Ga0495644_0007542 | 3300046523 | Bacteria | 4194 |
| 663 | Ga0495644_0009481 | 3300046523 | Bacteria | 3752 |
| 664 | Ga0495644_0013643 | 3300046523 | Bacteria | 3117 |
| 665 | Ga0495648_0000708 | 3300046524 | Bacteria | 35539 |
| 666 | Ga0495648_0001488 | 3300046524 | Bacteria | 22912 |
| 667 | Ga0495648_0007168 | 3300046524 | Bacteria | 8955 |
| 668 | Ga0495648_0011619 | 3300046524 | Bacteria | 6616 |
| 669 | Ga0495648_0036925 | 3300046524 | Bacteria | 3144 |
| 670 | Ga0495648_0038209 | 3300046524 | Bacteria | 3074 |
| 671 | Ga0495648_0048317 | 3300046524 | Bacteria | 2620 |
| 672 | Ga0495648_0085064 | 3300046524 | Bacteria | 1788 |
| 673 | Ga0495648_0165099 | 3300046524 | Bacteria | 1140 |
| 674 | Ga0495648_0215620 | 3300046524 | Bacteria | 950 |
| 675 | Ga0495663_0002556 | 3300046525 | Bacteria | 5436 |
| 676 | Ga0495663_0017672 | 3300046525 | Bacteria | 2026 |
| 677 | Ga0495663_0086948 | 3300046525 | Bacteria | 1014 |
| 678 | Ga0495666_0000318 | 3300046526 | Bacteria | 20936 |
| 679 | Ga0495666_0000556 | 3300046526 | Bacteria | 16645 |
| 680 | Ga0495666_0008615 | 3300046526 | Bacteria | 5110 |
| 681 | Ga0495666_0018785 | 3300046526 | Bacteria | 3434 |
| 682 | Ga0495666_0039750 | 3300046526 | Bacteria | 2282 |
| 683 | Ga0495666_0046494 | 3300046526 | Bacteria | 2092 |
| 684 | Ga0495642_0000613 | 3300046528 | Bacteria | 17935 |
| 685 | Ga0495642_0004874 | 3300046528 | Bacteria | 5186 |
| 686 | Ga0495642_0007226 | 3300046528 | Bacteria | 4262 |
| 687 | Ga0495642_0009239 | 3300046528 | Bacteria | 3774 |
| 688 | Ga0495642_0011089 | 3300046528 | Bacteria | 3456 |
| 689 | Ga0495642_0012989 | 3300046528 | Bacteria | 3215 |
| 690 | Ga0495642_0016483 | 3300046528 | Bacteria | 2880 |
| 691 | Ga0495642_0041624 | 3300046528 | Bacteria | 1869 |
| 692 | Ga0495642_0066401 | 3300046528 | Bacteria | 1503 |
| 693 | Ga0495642_0069897 | 3300046528 | Bacteria | 1467 |
| 694 | Ga0495652_0001577 | 3300046529 | Bacteria | 24927 |
| 695 | Ga0495654_0000381 | 3300046530 | Bacteria | 38197 |
| 696 | Ga0495654_0004611 | 3300046530 | Bacteria | 8134 |
| 697 | Ga0495654_0018761 | 3300046530 | Bacteria | 3621 |
| 698 | Ga0495654_0028918 | 3300046530 | Bacteria | 2830 |
| 699 | Ga0495654_0107634 | 3300046530 | Bacteria | 1275 |
| 700 | Ga0495654_0198012 | 3300046530 | Bacteria | 861 |
| 701 | Ga0495665_0020210 | 3300046531 | Bacteria | 3578 |
| 702 | Ga0495665_0049520 | 3300046531 | Bacteria | 2227 |
| 703 | Ga0495665_0060088 | 3300046531 | Bacteria | 2006 |
| 704 | Ga0495640_0017736 | 3300046533 | Bacteria | 5297 |
| 705 | Ga0495586_0009827 | 3300046535 | Bacteria | 5093 |
| 706 | Ga0495586_0012802 | 3300046535 | Bacteria | 4445 |
| 707 | Ga0495586_0024342 | 3300046535 | Bacteria | 3236 |
| 708 | Ga0495586_0152531 | 3300046535 | Bacteria | 1300 |
| 709 | Ga0495587_0243573 | 3300046536 | Bacteria | 1012 |
| 710 | Ga0495609_0001536 | 3300046538 | Bacteria | 15150 |
| 711 | Ga0495609_0003404 | 3300046538 | Bacteria | 9126 |
| 712 | Ga0495609_0003442 | 3300046538 | Bacteria | 9060 |
| 713 | Ga0495609_0004070 | 3300046538 | Bacteria | 8147 |
| 714 | Ga0495609_0004682 | 3300046538 | Bacteria | 7411 |
| 715 | Ga0495609_0015930 | 3300046538 | Bacteria | 3509 |
| 716 | Ga0495609_0016433 | 3300046538 | Bacteria | 3448 |
| 717 | Ga0495609_0021815 | 3300046538 | Bacteria | 2954 |
| 718 | Ga0495609_0029412 | 3300046538 | Bacteria | 2502 |
| 719 | Ga0495609_0033768 | 3300046538 | Bacteria | 2321 |
| 720 | Ga0495609_0048047 | 3300046538 | Bacteria | 1908 |
| 721 | Ga0495609_0065495 | 3300046538 | Bacteria | 1601 |
| 722 | Ga0495609_0099802 | 3300046538 | Bacteria | 1258 |
| 723 | Ga0495621_0003776 | 3300046539 | Bacteria | 4199 |
| 724 | Ga0495597_0001388 | 3300046542 | Bacteria | 17478 |
| 725 | Ga0495597_0002423 | 3300046542 | Bacteria | 11849 |
| 726 | Ga0495597_0003311 | 3300046542 | Bacteria | 9513 |
| 727 | Ga0495597_0005681 | 3300046542 | Bacteria | 6565 |
| 728 | Ga0495597_0009715 | 3300046542 | Bacteria | 4739 |
| 729 | Ga0495597_0010710 | 3300046542 | Bacteria | 4471 |
| 730 | Ga0495597_0035088 | 3300046542 | Bacteria | 2264 |
| 731 | Ga0495597_0038705 | 3300046542 | Bacteria | 2137 |
| 732 | Ga0495597_0171388 | 3300046542 | Bacteria | 881 |
| 733 | Ga0495597_0219965 | 3300046542 | Bacteria | 754 |
| 734 | Ga0495645_0037487 | 3300046543 | Bacteria | 3534 |
| 735 | Ga0495645_0211290 | 3300046543 | Bacteria | 1310 |
| 736 | Ga0495645_0392211 | 3300046543 | Bacteria | 886 |
| 737 | Ga0495622_0000064 | 3300046557 | Bacteria | 93789 |
| 738 | Ga0495622_0000570 | 3300046557 | Bacteria | 22156 |
| 739 | Ga0495622_0006368 | 3300046557 | Bacteria | 5479 |
| 740 | Ga0495622_0032190 | 3300046557 | Bacteria | 2448 |
| 741 | Ga0495622_0054258 | 3300046557 | Bacteria | 1860 |
| 742 | Ga0495622_0102906 | 3300046557 | Bacteria | 1308 |
| 743 | Ga0495633_0003338 | 3300046558 | Bacteria | 10778 |
| 744 | Ga0495633_0004954 | 3300046558 | Bacteria | 8314 |
| 745 | Ga0495633_0008291 | 3300046558 | Bacteria | 5875 |
| 746 | Ga0495633_0032773 | 3300046558 | Bacteria | 2508 |
| 747 | Ga0495633_0034346 | 3300046558 | Bacteria | 2440 |
| 748 | Ga0495633_0060270 | 3300046558 | Bacteria | 1778 |
| 749 | Ga0495633_0065743 | 3300046558 | Bacteria | 1694 |
| 750 | Ga0495633_0079803 | 3300046558 | Bacteria | 1523 |
| 751 | Ga0495633_0115881 | 3300046558 | Bacteria | 1241 |
| 752 | Ga0495633_0260102 | 3300046558 | Bacteria | 791 |
| 753 | Ga0495656_0002704 | 3300046615 | Bacteria | 5923 |
| 754 | Ga0495656_0017670 | 3300046615 | Bacteria | 2724 |
| 755 | Ga0495656_0040418 | 3300046615 | Bacteria | 1943 |
| 756 | Ga0495656_0044093 | 3300046615 | Bacteria | 1876 |
| 757 | Ga0495656_0073514 | 3300046615 | Bacteria | 1525 |
| 758 | Ga0495656_0300791 | 3300046615 | Bacteria | 822 |
| 759 | Ga0495656_0386048 | 3300046615 | Bacteria | 730 |
| 760 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 761 | Ga0495668_0000544 | 3300046616 | Bacteria | 46835 |
| 762 | Ga0495668_0000578 | 3300046616 | Bacteria | 44611 |
| 763 | Ga0495668_0003733 | 3300046616 | Bacteria | 11198 |
| 764 | Ga0495668_0021923 | 3300046616 | Bacteria | 3655 |
| 765 | Ga0495668_0029684 | 3300046616 | Bacteria | 3088 |
| 766 | Ga0495668_0034704 | 3300046616 | Bacteria | 2828 |
| 767 | Ga0495668_0045031 | 3300046616 | Bacteria | 2452 |
| 768 | Ga0495668_0055234 | 3300046616 | Bacteria | 2193 |
| 769 | Ga0495668_0066242 | 3300046616 | Bacteria | 1987 |
| 770 | Ga0495634_0053681 | 3300046642 | Bacteria | 2699 |
| 771 | Ga0495634_0369017 | 3300046642 | Bacteria | 857 |
| 772 | Ga0495611_0000946 | 3300046648 | Bacteria | 15555 |
| 773 | Ga0495611_0003308 | 3300046648 | Bacteria | 7123 |
| 774 | Ga0495611_0011108 | 3300046648 | Bacteria | 3814 |
| 775 | Ga0495611_0012399 | 3300046648 | Bacteria | 3624 |
| 776 | Ga0495611_0025380 | 3300046648 | Bacteria | 2582 |
| 777 | Ga0495611_0030378 | 3300046648 | Bacteria | 2375 |
| 778 | Ga0495611_0033374 | 3300046648 | Bacteria | 2270 |
| 779 | Ga0495611_0101818 | 3300046648 | Bacteria | 1334 |
| 780 | Ga0495611_0125987 | 3300046648 | Bacteria | 1194 |
| 781 | Ga0495625_0004296 | 3300046660 | Bacteria | 13552 |
| 782 | Ga0495625_0004306 | 3300046660 | Bacteria | 13526 |
| 783 | Ga0495625_0026121 | 3300046660 | Bacteria | 4416 |
| 784 | Ga0495625_0029610 | 3300046660 | Bacteria | 4091 |
| 785 | Ga0495625_0040181 | 3300046660 | Bacteria | 3414 |
| 786 | Ga0495625_0051408 | 3300046660 | Bacteria | 2954 |
| 787 | Ga0495625_0052327 | 3300046660 | Bacteria | 2925 |
| 788 | Ga0495625_0129530 | 3300046660 | Bacteria | 1710 |
| 789 | Ga0495625_0155060 | 3300046660 | Bacteria | 1537 |
| 790 | Ga0495625_0179307 | 3300046660 | Bacteria | 1410 |
| 791 | Ga0495625_0249643 | 3300046660 | Bacteria | 1152 |
| 792 | Ga0495635_0001292 | 3300046663 | Bacteria | 16730 |
| 793 | Ga0495635_0015435 | 3300046663 | Bacteria | 5341 |
| 794 | Ga0495635_0121076 | 3300046663 | Bacteria | 1785 |
| 795 | Ga0495635_0246513 | 3300046663 | Bacteria | 1205 |
| 796 | Ga0495659_0000526 | 3300046664 | Bacteria | 14120 |
| 797 | Ga0495659_0000919 | 3300046664 | Bacteria | 10459 |
| 798 | Ga0495659_0008635 | 3300046664 | Bacteria | 3243 |
| 799 | Ga0495659_0013224 | 3300046664 | Bacteria | 2686 |
| 800 | Ga0495659_0316897 | 3300046664 | Bacteria | 661 |
| 801 | Ga0495661_0002258 | 3300046665 | Bacteria | 14917 |
| 802 | Ga0495661_0004930 | 3300046665 | Bacteria | 9550 |
| 803 | Ga0495661_0009057 | 3300046665 | Bacteria | 6849 |
| 804 | Ga0495661_0016750 | 3300046665 | Bacteria | 4849 |
| 805 | Ga0495661_0023263 | 3300046665 | Bacteria | 4022 |
| 806 | Ga0495661_0024203 | 3300046665 | Bacteria | 3931 |
| 807 | Ga0495661_0038868 | 3300046665 | Bacteria | 2961 |
| 808 | Ga0495661_0051612 | 3300046665 | Bacteria | 2482 |
| 809 | Ga0495661_0063697 | 3300046665 | Bacteria | 2178 |
| 810 | Ga0495661_0088267 | 3300046665 | Bacteria | 1770 |
| 811 | Ga0495661_0100596 | 3300046665 | Bacteria | 1627 |
| 812 | Ga0495661_0103250 | 3300046665 | Bacteria | 1600 |
| 813 | Ga0495661_0110688 | 3300046665 | Bacteria | 1531 |
| 814 | Ga0495661_0168146 | 3300046665 | Bacteria | 1171 |
| 815 | Ga0495661_0175233 | 3300046665 | Bacteria | 1140 |
| 816 | Ga0495661_0218012 | 3300046665 | Bacteria | 990 |
| 817 | Ga0495661_0316595 | 3300046665 | Bacteria | 776 |
| 818 | Ga0495588_0003376 | 3300046674 | Bacteria | 6937 |
| 819 | Ga0495588_0024317 | 3300046674 | Bacteria | 3008 |
| 820 | Ga0495588_0036417 | 3300046674 | Bacteria | 2496 |
| 821 | Ga0495588_0046183 | 3300046674 | Bacteria | 2233 |
| 822 | Ga0495588_0096087 | 3300046674 | Bacteria | 1554 |
| 823 | Ga0495588_0166293 | 3300046674 | Bacteria | 1166 |
| 824 | Ga0495588_0189117 | 3300046674 | Bacteria | 1087 |
| 825 | Ga0495599_0008525 | 3300046678 | Bacteria | 6237 |
| 826 | Ga0495599_0175798 | 3300046678 | Bacteria | 1320 |
| 827 | Ga0495623_0002848 | 3300046679 | Bacteria | 11409 |
| 828 | Ga0495623_0091236 | 3300046679 | Bacteria | 1869 |
| 829 | Ga0495623_0172788 | 3300046679 | Bacteria | 1261 |
| 830 | Ga0495646_0001272 | 3300046680 | Bacteria | 14827 |
| 831 | Ga0495646_0008984 | 3300046680 | Bacteria | 6344 |
| 832 | Ga0495646_0119223 | 3300046680 | Bacteria | 1494 |
| 833 | Ga0495646_0126911 | 3300046680 | Bacteria | 1439 |
| 834 | Ga0495658_0229075 | 3300046683 | Bacteria | 1165 |
| 835 | Ga0495669_0000092 | 3300046684 | Bacteria | 59765 |
| 836 | Ga0495669_0000583 | 3300046684 | Bacteria | 16207 |
| 837 | Ga0495669_0002000 | 3300046684 | Bacteria | 8364 |
| 838 | Ga0495669_0014388 | 3300046684 | Bacteria | 3382 |
| 839 | Ga0495669_0018903 | 3300046684 | Bacteria | 2968 |
| 840 | Ga0495669_0053696 | 3300046684 | Bacteria | 1812 |
| 841 | Ga0495669_0062837 | 3300046684 | Bacteria | 1683 |
| 842 | Ga0495669_0097430 | 3300046684 | Bacteria | 1363 |
| 843 | Ga0495613_0033961 | 3300046689 | Bacteria | 3789 |
| 844 | Ga0495613_0108969 | 3300046689 | Bacteria | 1997 |
| 845 | Ga0495613_0143776 | 3300046689 | Bacteria | 1703 |
| 846 | Ga0495624_0004719 | 3300046690 | Bacteria | 9913 |
| 847 | Ga0495624_0013356 | 3300046690 | Bacteria | 5600 |
| 848 | Ga0495624_0018817 | 3300046690 | Bacteria | 4616 |
| 849 | Ga0495624_0021868 | 3300046690 | Bacteria | 4236 |
| 850 | Ga0495670_0001955 | 3300046691 | Bacteria | 10140 |
| 851 | Ga0495670_0003903 | 3300046691 | Bacteria | 7323 |
| 852 | Ga0495670_0023024 | 3300046691 | Bacteria | 3075 |
| 853 | Ga0495670_0041036 | 3300046691 | Bacteria | 2308 |
| 854 | Ga0495670_0053575 | 3300046691 | Bacteria | 2020 |
| 855 | Ga0495670_0065194 | 3300046691 | Bacteria | 1835 |
| 856 | Ga0495670_0097054 | 3300046691 | Bacteria | 1514 |
| 857 | Ga0495670_0106660 | 3300046691 | Bacteria | 1447 |
| 858 | Ga0495670_0110917 | 3300046691 | Bacteria | 1419 |
| 859 | Ga0495670_0116948 | 3300046691 | Bacteria | 1383 |
| 860 | Ga0495670_0263036 | 3300046691 | Bacteria | 921 |
| 861 | Ga0495671_0002518 | 3300046692 | Bacteria | 11533 |
| 862 | Ga0495671_0009131 | 3300046692 | Bacteria | 5552 |
| 863 | Ga0495671_0011096 | 3300046692 | Bacteria | 4972 |
| 864 | Ga0495671_0029990 | 3300046692 | Bacteria | 2788 |
| 865 | Ga0495671_0035806 | 3300046692 | Bacteria | 2519 |
| 866 | Ga0495671_0056700 | 3300046692 | Bacteria | 1939 |
| 867 | Ga0495671_0101401 | 3300046692 | Bacteria | 1407 |
| 868 | Ga0495671_0138840 | 3300046692 | Bacteria | 1184 |
| 869 | Ga0495649_0001463 | 3300046694 | Bacteria | 17755 |
| 870 | Ga0495649_0003126 | 3300046694 | Bacteria | 11347 |
| 871 | Ga0495649_0005200 | 3300046694 | Bacteria | 8334 |
| 872 | Ga0495649_0006435 | 3300046694 | Bacteria | 7310 |
| 873 | Ga0495649_0006781 | 3300046694 | Bacteria | 7093 |
| 874 | Ga0495649_0009242 | 3300046694 | Bacteria | 5871 |
| 875 | Ga0495649_0015381 | 3300046694 | Bacteria | 4357 |
| 876 | Ga0495649_0029688 | 3300046694 | Bacteria | 3022 |
| 877 | Ga0495649_0063457 | 3300046694 | Bacteria | 1984 |
| 878 | Ga0495649_0118121 | 3300046694 | Bacteria | 1403 |
| 879 | Ga0495649_0122041 | 3300046694 | Bacteria | 1377 |
| 880 | Ga0495649_0152974 | 3300046694 | Bacteria | 1211 |
| 881 | Ga0495649_0194707 | 3300046694 | Bacteria | 1054 |
| 882 | Ga0495649_0304778 | 3300046694 | Bacteria | 810 |
| 883 | Ga0495649_0319066 | 3300046694 | Bacteria | 789 |
| 884 | Ga0495589_0000032 | 3300046794 | Bacteria | 167736 |
| 885 | Ga0495589_0002314 | 3300046794 | Bacteria | 10704 |
| 886 | Ga0495589_0004788 | 3300046794 | Bacteria | 7194 |
| 887 | Ga0495589_0005625 | 3300046794 | Bacteria | 6611 |
| 888 | Ga0495589_0013093 | 3300046794 | Bacteria | 4283 |
| 889 | Ga0495589_0014852 | 3300046794 | Bacteria | 4006 |
| 890 | Ga0495589_0024976 | 3300046794 | Bacteria | 3034 |
| 891 | Ga0495589_0050404 | 3300046794 | Bacteria | 2059 |
| 892 | Ga0495589_0090532 | 3300046794 | Bacteria | 1485 |
| 893 | Ga0495589_0103208 | 3300046794 | Bacteria | 1378 |
| 894 | Ga0495589_0115136 | 3300046794 | Bacteria | 1296 |
| 895 | Ga0495589_0146367 | 3300046794 | Bacteria | 1129 |
| 896 | Ga0495600_0000474 | 3300046809 | Bacteria | 20802 |
| 897 | Ga0495600_0002069 | 3300046809 | Bacteria | 11320 |
| 898 | Ga0495660_0009441 | 3300046810 | Bacteria | 5688 |
| 899 | Ga0495660_0010483 | 3300046810 | Bacteria | 5390 |
| 900 | Ga0495660_0011814 | 3300046810 | Bacteria | 5062 |
| 901 | Ga0495660_0013996 | 3300046810 | Bacteria | 4651 |
| 902 | Ga0495660_0025613 | 3300046810 | Bacteria | 3349 |
| 903 | Ga0495660_0042266 | 3300046810 | Bacteria | 2519 |
| 904 | Ga0495660_0071539 | 3300046810 | Bacteria | 1839 |
| 905 | Ga0495581_0008394 | 3300047315 | Bacteria | 5987 |
| 906 | Ga0495581_0015215 | 3300047315 | Bacteria | 4465 |
| 907 | Ga0495581_0015668 | 3300047315 | Bacteria | 4399 |
| 908 | Ga0495604_0020165 | 3300047317 | Bacteria | 5327 |
| 909 | Ga0495604_0030329 | 3300047317 | Bacteria | 4295 |
| 910 | Ga0495604_0038987 | 3300047317 | Bacteria | 3735 |
| 911 | Ga0495604_0047559 | 3300047317 | Bacteria | 3340 |
| 912 | Ga0495604_0051135 | 3300047317 | Bacteria | 3205 |
| 913 | Ga0495636_0001913 | 3300047318 | Bacteria | 7964 |
| 914 | Ga0495636_0002620 | 3300047318 | Bacteria | 6925 |
| 915 | Ga0495636_0028437 | 3300047318 | Bacteria | 2280 |
| 916 | Ga0495636_0042381 | 3300047318 | Bacteria | 1891 |
| 917 | Ga0495636_0051765 | 3300047318 | Bacteria | 1722 |
| 918 | Ga0495674_0004291 | 3300047319 | Bacteria | 13716 |
| 919 | Ga0495674_0008961 | 3300047319 | Bacteria | 9507 |
| 920 | Ga0495674_0359082 | 3300047319 | Bacteria | 1181 |
| 921 | Ga0495674_0400908 | 3300047319 | Bacteria | 1107 |
| 922 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 923 | Ga0495672_0004140 | 3300047320 | Bacteria | 12054 |
| 924 | Ga0495672_0006589 | 3300047320 | Bacteria | 8943 |
| 925 | Ga0495672_0042796 | 3300047320 | Bacteria | 2728 |
| 926 | Ga0495672_0052973 | 3300047320 | Bacteria | 2380 |
| 927 | Ga0495672_0156877 | 3300047320 | Bacteria | 1174 |
| 928 | Ga0495672_0289083 | 3300047320 | Bacteria | 780 |
| 929 | Ga0495676_0000235 | 3300047321 | Bacteria | 44374 |
| 930 | Ga0495676_0025419 | 3300047321 | Bacteria | 5113 |
| 931 | Ga0495676_0045906 | 3300047321 | Bacteria | 3551 |
| 932 | Ga0495676_0122523 | 3300047321 | Bacteria | 1889 |
| 933 | Ga0495680_0042503 | 3300047322 | Bacteria | 3605 |
| 934 | Ga0495683_0001361 | 3300047323 | Bacteria | 16273 |
| 935 | Ga0495683_0003295 | 3300047323 | Bacteria | 9440 |
| 936 | Ga0495683_0004350 | 3300047323 | Bacteria | 8069 |
| 937 | Ga0495683_0016473 | 3300047323 | Bacteria | 3838 |
| 938 | Ga0495683_0030886 | 3300047323 | Bacteria | 2731 |
| 939 | Ga0495683_0034026 | 3300047323 | Bacteria | 2592 |
| 940 | Ga0495683_0045537 | 3300047323 | Bacteria | 2204 |
| 941 | Ga0495683_0070388 | 3300047323 | Bacteria | 1717 |
| 942 | Ga0495683_0114245 | 3300047323 | Bacteria | 1286 |
| 943 | Ga0495683_0229991 | 3300047323 | Bacteria | 823 |
| 944 | Ga0495687_000127 | 3300047443 | Bacteria | 117520 |
| 945 | Ga0495687_000143 | 3300047443 | Bacteria | 108306 |
| 946 | Ga0495687_001108 | 3300047443 | Bacteria | 26234 |
| 947 | Ga0495687_004036 | 3300047443 | Bacteria | 10188 |
| 948 | Ga0495687_008098 | 3300047443 | Bacteria | 6072 |
| 949 | Ga0495687_034999 | 3300047443 | Bacteria | 2263 |
| 950 | Ga0495687_036591 | 3300047443 | Bacteria | 2195 |
| 951 | Ga0495675_0081573 | 3300047444 | Bacteria | 2036 |
| 952 | Ga0495675_0532871 | 3300047444 | Bacteria | 671 |
| 953 | Ga0495677_0003200 | 3300047445 | Bacteria | 6384 |
| 954 | Ga0495677_0005113 | 3300047445 | Bacteria | 4995 |
| 955 | Ga0495677_0006278 | 3300047445 | Bacteria | 4490 |
| 956 | Ga0495677_0007859 | 3300047445 | Bacteria | 3969 |
| 957 | Ga0495677_0009153 | 3300047445 | Bacteria | 3659 |
| 958 | Ga0495677_0024912 | 3300047445 | Bacteria | 2170 |
| 959 | Ga0495677_0026448 | 3300047445 | Bacteria | 2105 |
| 960 | Ga0495677_0049226 | 3300047445 | Bacteria | 1548 |
| 961 | Ga0495677_0054027 | 3300047445 | Bacteria | 1481 |
| 962 | Ga0495677_0076995 | 3300047445 | Bacteria | 1247 |
| 963 | Ga0495677_0081048 | 3300047445 | Bacteria | 1216 |
| 964 | Ga0495679_000037 | 3300047446 | Bacteria | 158099 |
| 965 | Ga0495679_005470 | 3300047446 | Bacteria | 5628 |
| 966 | Ga0495679_021280 | 3300047446 | Bacteria | 2243 |
| 967 | Ga0495679_033196 | 3300047446 | Bacteria | 1650 |
| 968 | Ga0495685_000113 | 3300047447 | Bacteria | 28884 |
| 969 | Ga0495685_001114 | 3300047447 | Bacteria | 8216 |
| 970 | Ga0495685_008745 | 3300047447 | Bacteria | 3372 |
| 971 | Ga0495685_014165 | 3300047447 | Bacteria | 2708 |
| 972 | Ga0495685_015742 | 3300047447 | Bacteria | 2582 |
| 973 | Ga0495685_024327 | 3300047447 | Bacteria | 2084 |
| 974 | Ga0495673_0006800 | 3300047469 | Bacteria | 6678 |
| 975 | Ga0495673_0040844 | 3300047469 | Bacteria | 2091 |
| 976 | Ga0495673_0047964 | 3300047469 | Bacteria | 1885 |
| 977 | Ga0495681_0000694 | 3300047470 | Bacteria | 25709 |
| 978 | Ga0495681_0001600 | 3300047470 | Bacteria | 16834 |
| 979 | Ga0495681_0002505 | 3300047470 | Bacteria | 13086 |
| 980 | Ga0495681_0004999 | 3300047470 | Bacteria | 8943 |
| 981 | Ga0495681_0019417 | 3300047470 | Bacteria | 3712 |
| 982 | Ga0495681_0019747 | 3300047470 | Bacteria | 3670 |
| 983 | Ga0495681_0023569 | 3300047470 | Bacteria | 3267 |
| 984 | Ga0495681_0028377 | 3300047470 | Bacteria | 2880 |
| 985 | Ga0495681_0066454 | 3300047470 | Bacteria | 1645 |
| 986 | Ga0495681_0075090 | 3300047470 | Bacteria | 1522 |
| 987 | Ga0495686_0000288 | 3300047472 | Bacteria | 88523 |
| 988 | Ga0495686_0000656 | 3300047472 | Bacteria | 47216 |
| 989 | Ga0495686_0002328 | 3300047472 | Bacteria | 18154 |
| 990 | Ga0495686_0007355 | 3300047472 | Bacteria | 8260 |
| 991 | Ga0495686_0053453 | 3300047472 | Bacteria | 2531 |
| 992 | Ga0495686_0060892 | 3300047472 | Bacteria | 2345 |
| 993 | Ga0495593_0012820 | 3300047673 | Bacteria | 4788 |
| 994 | Ga0495593_0012935 | 3300047673 | Bacteria | 4765 |
| 995 | Ga0495593_0032542 | 3300047673 | Bacteria | 2842 |
| 996 | Ga0495593_0048888 | 3300047673 | Bacteria | 2246 |
| 997 | Ga0495602_0006574 | 3300048088 | Bacteria | 12184 |
| 998 | Ga0495602_0022460 | 3300048088 | Bacteria | 6174 |
| 999 | Ga0495602_0062779 | 3300048088 | Bacteria | 3222 |
| 1000 | Ga0495602_0210740 | 3300048088 | Bacteria | 1475 |
| 1001 | Ga0495614_0006362 | 3300048089 | Bacteria | 5305 |
| 1002 | Ga0495614_0006654 | 3300048089 | Bacteria | 5174 |
| 1003 | Ga0495614_0094288 | 3300048089 | Bacteria | 1304 |
| 1004 | Ga0495626_0002049 | 3300048091 | Bacteria | 14744 |
| 1005 | Ga0495626_0010705 | 3300048091 | Bacteria | 4878 |
| 1006 | Ga0495626_0017842 | 3300048091 | Bacteria | 3579 |
| 1007 | Ga0495626_0020742 | 3300048091 | Bacteria | 3270 |
| 1008 | Ga0495626_0021140 | 3300048091 | Bacteria | 3232 |
| 1009 | Ga0495626_0022862 | 3300048091 | Bacteria | 3085 |
| 1010 | Ga0495626_0031484 | 3300048091 | Bacteria | 2552 |
| 1011 | Ga0495626_0033862 | 3300048091 | Bacteria | 2446 |
| 1012 | Ga0495626_0038091 | 3300048091 | Bacteria | 2281 |
| 1013 | Ga0495626_0040299 | 3300048091 | Bacteria | 2207 |
| 1014 | Ga0495626_0059781 | 3300048091 | Bacteria | 1738 |
| 1015 | Ga0495626_0065980 | 3300048091 | Bacteria | 1637 |
| 1016 | Ga0495626_0074515 | 3300048091 | Bacteria | 1518 |
| 1017 | Ga0495626_0109953 | 3300048091 | Bacteria | 1194 |
| 1018 | Ga0495626_0144554 | 3300048091 | Bacteria | 1006 |
| 1019 | Ga0495626_0163969 | 3300048091 | Bacteria | 930 |
| 1020 | Ga0496100_0016601 | 3300048903 | Bacteria | 4327 |
| 1021 | Ga0496100_0171134 | 3300048903 | Bacteria | 1564 |
| 1022 | Ga0496100_0458653 | 3300048903 | Bacteria | 978 |
| 1023 | Ga0496100_0482716 | 3300048903 | Bacteria | 953 |
| 1024 | Ga0496101_0030388 | 3300048904 | Bacteria | 3787 |
| 1025 | Ga0496102_0000931 | 3300048905 | Bacteria | 27579 |
| 1026 | Ga0496102_0401793 | 3300048905 | Bacteria | 1288 |
| 1027 | Ga0496103_0022931 | 3300048906 | Bacteria | 3762 |
| 1028 | Ga0496103_0056910 | 3300048906 | Bacteria | 2427 |
| 1029 | Ga0496103_0529000 | 3300048906 | Bacteria | 753 |
| 1030 | Ga0496104_0338360 | 3300048907 | Bacteria | 1418 |
| 1031 | Ga0496105_0087572 | 3300048908 | Bacteria | 2573 |
| 1032 | Ga0496107_0055316 | 3300048910 | Bacteria | 2866 |
| 1033 | Ga0496109_0009606 | 3300048912 | Bacteria | 8249 |
| 1034 | Ga0496109_0115613 | 3300048912 | Bacteria | 2496 |
| 1035 | Ga0496110_0029094 | 3300048913 | Bacteria | 4750 |
| 1036 | Ga0496110_0045736 | 3300048913 | Bacteria | 3827 |
| 1037 | Ga0496110_0047706 | 3300048913 | Bacteria | 3752 |
| 1038 | Ga0496110_0261305 | 3300048913 | Bacteria | 1576 |
| 1039 | Ga0496110_0715854 | 3300048913 | Bacteria | 903 |
| 1040 | Ga0496111_0014930 | 3300048914 | Bacteria | 5319 |
| 1041 | Ga0496111_0342997 | 3300048914 | Bacteria | 1106 |
| 1042 | Ga0496113_0008457 | 3300048916 | Bacteria | 6707 |
| 1043 | Ga0496114_0439153 | 3300048917 | Bacteria | 1156 |
| 1044 | Ga0496115_0018367 | 3300048918 | Bacteria | 5367 |
| 1045 | Ga0496115_0020248 | 3300048918 | Bacteria | 5130 |
| 1046 | Ga0496115_0055871 | 3300048918 | Bacteria | 3172 |
| 1047 | Ga0496115_0220001 | 3300048918 | Bacteria | 1567 |
| 1048 | Ga0496115_0238318 | 3300048918 | Bacteria | 1500 |
| 1049 | Ga0496115_0276349 | 3300048918 | Bacteria | 1379 |
| 1050 | Ga0496116_0014132 | 3300048919 | Bacteria | 6391 |
| 1051 | Ga0496116_0026637 | 3300048919 | Bacteria | 4223 |
| 1052 | Ga0496116_0033774 | 3300048919 | Bacteria | 3623 |
| 1053 | Ga0496117_0028920 | 3300048920 | Bacteria | 4282 |
| 1054 | Ga0496117_0114372 | 3300048920 | Bacteria | 1673 |
| 1055 | Ga0496117_0121972 | 3300048920 | Bacteria | 1599 |
| 1056 | Ga0496118_0002886 | 3300048921 | Bacteria | 22384 |
| 1057 | Ga0496118_0040010 | 3300048921 | Bacteria | 3733 |
| 1058 | Ga0496118_0060865 | 3300048921 | Bacteria | 2800 |
| 1059 | Ga0496121_0014458 | 3300048924 | Bacteria | 8371 |
| 1060 | Ga0496121_0084985 | 3300048924 | Bacteria | 2492 |
| 1061 | Ga0496121_0197583 | 3300048924 | Bacteria | 1436 |
| 1062 | Ga0496122_0000261 | 3300048925 | Bacteria | 118793 |
| 1063 | Ga0496122_0000445 | 3300048925 | Bacteria | 86566 |
| 1064 | Ga0496122_0011752 | 3300048925 | Bacteria | 8821 |
| 1065 | Ga0496123_0000218 | 3300048926 | Bacteria | 116615 |
| 1066 | Ga0496123_0001568 | 3300048926 | Bacteria | 31272 |
| 1067 | Ga0496123_0007592 | 3300048926 | Bacteria | 10163 |
| 1068 | Ga0496124_0015077 | 3300048927 | Bacteria | 7431 |
| 1069 | Ga0496124_0015517 | 3300048927 | Bacteria | 7294 |
| 1070 | Ga0496124_0046689 | 3300048927 | Bacteria | 3707 |
| 1071 | Ga0496124_0097419 | 3300048927 | Bacteria | 2388 |
| 1072 | Ga0496124_0151501 | 3300048927 | Bacteria | 1818 |
| 1073 | Ga0496124_0237922 | 3300048927 | Bacteria | 1356 |
| 1074 | Ga0496124_0351417 | 3300048927 | Bacteria | 1043 |
| 1075 | Ga0496124_0429036 | 3300048927 | Bacteria | 908 |
| 1076 | Ga0496125_0000256 | 3300048928 | Bacteria | 109696 |
| 1077 | Ga0496125_0002859 | 3300048928 | Bacteria | 21722 |
| 1078 | Ga0496125_0067915 | 3300048928 | Bacteria | 2806 |
| 1079 | Ga0496126_0034799 | 3300048929 | Bacteria | 4726 |
| 1080 | Ga0496126_0054778 | 3300048929 | Bacteria | 3611 |
| 1081 | Ga0496126_0111802 | 3300048929 | Bacteria | 2379 |
| 1082 | Ga0501306_002557 | 3300049127 | Bacteria | 1880 |
| 1083 | Ga0501310_001443 | 3300049130 | Bacteria | 2171 |
| 1084 | Ga0495678_000042 | 3300049459 | Bacteria | 174125 |
| 1085 | Ga0495678_000316 | 3300049459 | Bacteria | 51625 |
| 1086 | Ga0495678_003135 | 3300049459 | Bacteria | 10459 |
| 1087 | Ga0495678_003427 | 3300049459 | Bacteria | 9828 |
| 1088 | Ga0495678_003924 | 3300049459 | Bacteria | 8918 |
| 1089 | Ga0495678_004684 | 3300049459 | Bacteria | 7829 |
| 1090 | Ga0495678_006389 | 3300049459 | Bacteria | 6281 |
| 1091 | Ga0495678_007748 | 3300049459 | Bacteria | 5531 |
| 1092 | Ga0495678_009881 | 3300049459 | Bacteria | 4678 |
| 1093 | Ga0495678_025595 | 3300049459 | Bacteria | 2532 |
| 1094 | Ga0495678_033817 | 3300049459 | Bacteria | 2108 |
| 1095 | Ga0495682_0000107 | 3300049460 | Bacteria | 73486 |
| 1096 | Ga0495682_0033786 | 3300049460 | Bacteria | 1887 |
| 1097 | Ga0495682_0038533 | 3300049460 | Bacteria | 1756 |
| 1098 | Ga0495682_0084729 | 3300049460 | Bacteria | 1139 |
| 1099 | Ga0495682_0094804 | 3300049460 | Bacteria | 1071 |
| 1100 | Ga0501039_0066319 | 3300049575 | Bacteria | 2802 |
| 1101 | Ga0501070_0147283 | 3300049586 | Bacteria | 1943 |
| 1102 | Ga0501198_000102 | 3300049649 | Bacteria | 16377 |
| 1103 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 1104 | Ga0501227_039267 | 3300049665 | Bacteria | 1164 |
| 1105 | Ga0501249_003963 | 3300049679 | Bacteria | 2997 |
| 1106 | Ga0501269_000210 | 3300049766 | Bacteria | 17330 |
| 1107 | Ga0501279_000208 | 3300049775 | Bacteria | 8130 |
| 1108 | Ga0501279_004406 | 3300049775 | Bacteria | 1847 |
| 1109 | Ga0501279_036368 | 3300049775 | Bacteria | 744 |
| 1110 | nmdc:mga03683_277888_c1 | 3300050489 | Bacteria | 782 |
| 1111 | nmdc:mga0k408_132531_c1 | 3300050493 | Bacteria | 1480 |
| 1112 | nmdc:mga0k408_177614_c1 | 3300050493 | Bacteria | 1270 |
| 1113 | nmdc:mga0k408_196874_c1 | 3300050493 | Bacteria | 1203 |
| 1114 | nmdc:mga0k408_22887_c1 | 3300050493 | Bacteria | 1916 |
| 1115 | nmdc:mga0k408_487922_c1 | 3300050493 | Bacteria | 731 |
| 1116 | nmdc:mga0k408_59835_c1 | 3300050493 | Bacteria | 2214 |
| 1117 | nmdc:mga07m45_5487_c1 | 3300050496 | Bacteria | 6318 |
| 1118 | nmdc:mga08x19_12730_c1 | 3300050514 | Bacteria | 5072 |
| 1119 | Ga0495601_0030324 | 3300053077 | Bacteria | 3357 |
| 1120 | Ga0495601_0239427 | 3300053077 | Bacteria | 1185 |
| 1121 | Ga0500635_0000083 | 3300053080 | Bacteria | 61980 |
| 1122 | Ga0495595_0136294 | 3300053084 | Bacteria | 1202 |
| 1123 | Ga0500651_0112998 | 3300053093 | Bacteria | 1656 |
| 1124 | Ga0500595_003047 | 3300053119 | Bacteria | 7965 |
| 1125 | Ga0500619_000742 | 3300053154 | Bacteria | 5568 |
| 1126 | Ga0500634_0108608 | 3300053161 | Bacteria | 1374 |
| 1127 | Ga0500637_0152420 | 3300053178 | Bacteria | 1335 |
| 1128 | Ga0500587_000079 | 3300053739 | Bacteria | 8123 |
| 1129 | Ga0500661_006935 | 3300055283 | Bacteria | 2102 |
| 1130 | Ga0587091_002909 | 3300059511 | Bacteria | 2096 |
| 1131 | Ga0587062_001995 | 3300059639 | Bacteria | 1881 |
| 1132 | Ga0587111_0003612 | 3300060346 | Bacteria | 2220 |
| 1133 | Ga0466962_0002972 | 3300061719 | Bacteria | 8086 |
| 1134 | Ga0466962_0003937 | 3300061719 | Bacteria | 7106 |
| 1135 | 2511248376 | 2511231003 | Bacteria | 5606035 |
| 1136 | 2550693536 | 2548876994 | Bacteria | 4904866 |
| 1137 | 2644030407 | 2643221603 | Bacteria | 6147767 |
| 1138 | 2819542751 | 2818991436 | Bacteria | 5376622 |
| 1139 | 2819594530 | 2818991445 | Bacteria | 4955017 |
| 1140 | Ga0395905_0000750 | |||
| 1141 | JGI24740J21852_10000527 | |||
| 1142 | JGI24739J22299_10030478 | |||
| 1143 | JGI24737J22298_10012956 | |||
| 1144 | JGI24735J21928_10009274 | |||
| 1145 | JGI25155J39150_1000288 | |||
| 1146 | JGI25156J39149_1000695 | |||
| 1147 | JGI25156J39149_1002511 | |||
| 1148 | JGI25156J39149_1007991 | |||
| 1149 | JGI25154J39366_1000350 | |||
| 1150 | JGI25154J39366_1000571 | |||
| 1151 | JGI25154J39366_1001471 | |||
| 1152 | JGI25154J39366_1003202 | |||
| 1153 | JGI25154J39366_1003796 | |||
| 1154 | JGI25158J39367_1001641 | |||
| 1155 | JGI25157J39369_1000018 | |||
| 1156 | JGI25157J39369_1000773 | |||
| 1157 | JGI25150J39212_1012636 | |||
| 1158 | JGI25159J45721_1005067 | |||
| 1159 | JGI25151J46595_10035406 | |||
| 1160 | JGI25151J46595_10055552 | |||
| 1161 | JGI25165J46597_1000001 | |||
| 1162 | JGI25153J46596_10017617 | |||
| 1163 | rootH2_10128398 | |||
| 1164 | rootL2_10017918 | |||
| 1165 | rootH1_10042583 | |||
| 1166 | rootH1_10042585 | |||
| 1167 | rootH1_10186258 | |||
| 1168 | JGI25160J50197_1002021 | |||
| 1169 | JGI25161J50226_1001870 | |||
| 1170 | Ga0007409J51694_1041494 | |||
| 1171 | Ga0055538_1000001 | |||
| 1172 | Ga0055539_1000001 | |||
| 1173 | Ga0055539_1000146 | |||
| 1174 | Ga0055539_1000240 | |||
| 1175 | Ga0055539_1001263 | |||
| 1176 | Ga0055533_1000003 | |||
| 1177 | Ga0055533_1000103 | |||
| 1178 | Ga0055533_1000150 | |||
| 1179 | Ga0055533_1001052 | |||
| 1180 | Ga0055532_1000005 | |||
| 1181 | Ga0055525_1000003 | |||
| 1182 | Ga0055525_1000198 | |||
| 1183 | Ga0055525_1001499 | |||
| 1184 | Ga0055535_1002863 | |||
| 1185 | Ga0055542_1002038 | |||
| 1186 | Ga0055526_1000161 | |||
| 1187 | Ga0055526_1000827 | |||
| 1188 | Ga0055526_1003727 | |||
| 1189 | Ga0055537_1000111 | |||
| 1190 | Ga0055524_1000015 | |||
| 1191 | Ga0055524_1002005 | |||
| 1192 | Ga0055524_1002542 | |||
| 1193 | Ga0055524_1005899 | |||
| 1194 | Ga0055524_1017165 | |||
| 1195 | Ga0055536_1000252 | |||
| 1196 | Ga0055534_1000268 | |||
| 1197 | Ga0055534_1002782 | |||
| 1198 | Ga0055534_1004596 | |||
| 1199 | Ga0055528_1000178 | |||
| 1200 | Ga0055530_10001043 | |||
| 1201 | Ga0055530_10028903 | |||
| 1202 | Ga0055540_1000001 | |||
| 1203 | Ga0055531_10002737 | |||
| 1204 | Ga0055531_10007375 | |||
| 1205 | Ga0055531_10021621 | |||
| 1206 | Ga0055541_1000001 | |||
| 1207 | Ga0055541_1000098 | |||
| 1208 | Ga0055541_1000789 | |||
| 1209 | Ga0065165_1000286 | |||
| 1210 | Ga0065165_1058816 | |||
| 1211 | Ga0070658_10081833 | |||
| 1212 | Ga0070658_10086907 | |||
| 1213 | Ga0070658_10440175 | |||
| 1214 | Ga0070658_10646273 | |||
| 1215 | Ga0070690_100031128 | |||
| 1216 | Ga0070670_100273775 | |||
| 1217 | Ga0070670_100295403 | |||
| 1218 | Ga0070677_10023109 | |||
| 1219 | Ga0068869_100037044 | |||
| 1220 | Ga0070666_10019648 | |||
| 1221 | Ga0068868_100195124 | |||
| 1222 | Ga0070660_100227965 | |||
| 1223 | Ga0070689_100346171 | |||
| 1224 | Ga0070661_100023457 | |||
| 1225 | Ga0070668_100059448 | |||
| 1226 | Ga0070669_100004469 | |||
| 1227 | Ga0070675_100066570 | |||
| 1228 | Ga0070675_100501698 | |||
| 1229 | Ga0070671_100031566 | |||
| 1230 | Ga0070671_100187716 | |||
| 1231 | Ga0070674_100028072 | |||
| 1232 | Ga0070673_100028417 | |||
| 1233 | Ga0070659_100003171 | |||
| 1234 | Ga0070659_100004714 | |||
| 1235 | Ga0070659_100174856 | |||
| 1236 | Ga0070667_100002718 | |||
| 1237 | Ga0070667_100246137 | |||
| 1238 | Ga0070701_10066089 | |||
| 1239 | Ga0070663_100023240 | |||
| 1240 | Ga0070663_100384565 | |||
| 1241 | Ga0070678_100130407 | |||
| 1242 | Ga0070662_100016597 | |||
| 1243 | Ga0068867_100027789 | |||
| 1244 | Ga0068867_100122049 | |||
| 1245 | Ga0068867_100800152 | |||
| 1246 | Ga0070684_100508873 | |||
| 1247 | Ga0068853_100072486 | |||
| 1248 | Ga0068853_100551899 | |||
| 1249 | Ga0070672_100036953 | |||
| 1250 | Ga0070686_100065917 | |||
| 1251 | Ga0068855_100127299 | |||
| 1252 | Ga0068855_100430825 | |||
| 1253 | Ga0068857_100007953 | |||
| 1254 | Ga0068854_100004599 | |||
| 1255 | Ga0068856_100008259 | |||
| 1256 | Ga0068856_100056975 | |||
| 1257 | Ga0068856_100257418 | |||
| 1258 | Ga0068852_100102675 | |||
| 1259 | Ga0068852_100147709 | |||
| 1260 | Ga0068852_100186438 | |||
| 1261 | Ga0068852_100955562 | |||
| 1262 | Ga0068864_100301443 | |||
| 1263 | Ga0068864_100560238 | |||
| 1264 | Ga0068866_10010619 | |||
| 1265 | Ga0068866_10309096 | |||
| 1266 | Ga0068861_100016063 | |||
| 1267 | Ga0068861_100158841 | |||
| 1268 | Ga0068863_100019781 | |||
| 1269 | Ga0068863_100473095 | |||
| 1270 | Ga0068858_100017353 | |||
| 1271 | Ga0068860_100565456 | |||
| 1272 | Ga0075363_100043109 | |||
| 1273 | Ga0075366_10099523 | |||
| 1274 | Ga0075366_10197495 | |||
| 1275 | Ga0075370_10002946 | |||
| 1276 | Ga0075370_10271119 | |||
| 1277 | Ga0068871_100073893 | |||
| 1278 | Ga0068865_100114600 | |||
| 1279 | Ga0068865_100269843 | |||
| 1280 | Ga0099824_1036213 | |||
| 1281 | Ga0099823_1017932 | |||
| 1282 | Ga0079104_1000309 | |||
| 1283 | Ga0099826_10000018 | |||
| 1284 | Ga0105251_10002082 | |||
| 1285 | Ga0105251_10005601 | |||
| 1286 | Ga0105251_10013210 | |||
| 1287 | Ga0105251_10024566 | |||
| 1288 | Ga0105251_10049399 | |||
| 1289 | Ga0105244_10001133 | |||
| 1290 | Ga0105244_10002953 | |||
| 1291 | Ga0105244_10007523 | |||
| 1292 | Ga0105244_10061761 | |||
| 1293 | Ga0105240_10012100 | |||
| 1294 | Ga0105240_10017206 | |||
| 1295 | Ga0105240_10024629 | |||
| 1296 | Ga0105245_10262933 | |||
| 1297 | Ga0105243_10052625 | |||
| 1298 | Ga0105243_10054161 | |||
| 1299 | Ga0105241_10019955 | |||
| 1300 | Ga0105241_10186928 | |||
| 1301 | Ga0105242_10007036 | |||
| 1302 | Ga0105248_10078637 | |||
| 1303 | Ga0105237_10499422 | |||
| 1304 | Ga0105237_10755773 | |||
| 1305 | Ga0105238_10030398 | |||
| 1306 | Ga0105238_10055566 | |||
| 1307 | Ga0105238_10061774 | |||
| 1308 | Ga0105249_10007528 | |||
| 1309 | Ga0105246_10099856 | |||
| 1310 | Ga0157373_10045986 | |||
| 1311 | Ga0157371_10000001 | |||
| 1312 | Ga0157371_10207645 | |||
| 1313 | Ga0157370_10366078 | |||
| 1314 | Ga0157370_10764917 | |||
| 1315 | Ga0157369_10169148 | |||
| 1316 | Ga0157369_10236802 | |||
| 1317 | Ga0157369_10383864 | |||
| 1318 | Ga0157374_10036965 | |||
| 1319 | Ga0157374_10132950 | |||
| 1320 | Ga0157378_10248522 | |||
| 1321 | Ga0163162_10040965 | |||
| 1322 | Ga0163162_10728762 | |||
| 1323 | Ga0157372_10361837 | |||
| 1324 | Ga0157372_10731731 | |||
| 1325 | Ga0157375_10008692 | |||
| 1326 | Ga0157375_10173565 | |||
| 1327 | Ga0157380_10051165 | |||
| 1328 | Ga0157380_10241647 | |||
| 1329 | Ga0182008_10003842 | |||
| 1330 | Ga0182008_10027616 | |||
| 1331 | Ga0157377_10228313 | |||
| 1332 | Ga0157376_10226589 | |||
| 1333 | Ga0157376_10345560 | |||
| 1334 | Ga0182006_1009422 | |||
| 1335 | Ga0182007_10004447 | |||
| 1336 | Ga0182007_10010110 | |||
| 1337 | Ga0182007_10081906 | |||
| 1338 | Ga0182007_10095791 | |||
| 1339 | Ga0182005_1000158 | |||
| 1340 | Ga0213872_10000002 | |||
| 1341 | Ga0213872_10002809 | |||
| 1342 | Ga0213872_10019803 | |||
| 1343 | Ga0213872_10038157 | |||
| 1344 | Ga0213872_10046973 | |||
| 1345 | Ga0213872_10052963 | |||
| 1346 | Ga0213872_10141970 | |||
| 1347 | Ga0209435_100160 | |||
| 1348 | Ga0209435_100473 | |||
| 1349 | Ga0209435_109601 | |||
| 1350 | Ga0209436_100751 | |||
| 1351 | Ga0209784_100004 | |||
| 1352 | Ga0209784_100365 | |||
| 1353 | Ga0209566_100004 | |||
| 1354 | Ga0209566_100955 | |||
| 1355 | Ga0209674_100003 | |||
| 1356 | Ga0209674_100006 | |||
| 1357 | Ga0209674_100184 | |||
| 1358 | Ga0209147_100011 | |||
| 1359 | Ga0209563_100009 | |||
| 1360 | Ga0209563_100010 | |||
| 1361 | Ga0207427_101086 | |||
| 1362 | Ga0209437_100004 | |||
| 1363 | Ga0209437_100259 | |||
| 1364 | Ga0209258_100525 | |||
| 1365 | Ga0209258_100580 | |||
| 1366 | Ga0209646_1000035 | |||
| 1367 | Ga0209646_1000067 | |||
| 1368 | Ga0209646_1000403 | |||
| 1369 | Ga0209646_1000503 | |||
| 1370 | Ga0209026_1000033 | |||
| 1371 | Ga0209026_1000760 | |||
| 1372 | Ga0209026_1000967 | |||
| 1373 | Ga0209026_1002757 | |||
| 1374 | Ga0209677_100005 | |||
| 1375 | Ga0209677_100068 | |||
| 1376 | Ga0209677_100760 | |||
| 1377 | Ga0209677_102322 | |||
| 1378 | Ga0209677_102920 | |||
| 1379 | Ga0209148_1000293 | |||
| 1380 | Ga0209148_1005971 | |||
| 1381 | Ga0209759_1000024 | |||
| 1382 | Ga0209759_1000253 | |||
| 1383 | Ga0209759_1001054 | |||
| 1384 | Ga0209129_1000093 | |||
| 1385 | Ga0209233_1000005 | |||
| 1386 | Ga0209565_1000009 | |||
| 1387 | Ga0209565_1000946 | |||
| 1388 | Ga0209565_1001578 | |||
| 1389 | Ga0209565_1002746 | |||
| 1390 | Ga0209565_1012113 | |||
| 1391 | Ga0209673_1000036 | |||
| 1392 | Ga0209673_1006646 | |||
| 1393 | Ga0209130_1001278 | |||
| 1394 | Ga0209130_1001458 | |||
| 1395 | Ga0209675_1000013 | |||
| 1396 | Ga0209675_1000100 | |||
| 1397 | Ga0209675_1000945 | |||
| 1398 | Ga0209675_1007213 | |||
| 1399 | Ga0209675_1009393 | |||
| 1400 | Ga0209676_1000012 | |||
| 1401 | Ga0209025_1001877 | |||
| 1402 | Ga0209025_1004210 | |||
| 1403 | Ga0209564_1000122 | |||
| 1404 | Ga0209564_1003837 | |||
| 1405 | Ga0209564_1003839 | |||
| 1406 | Ga0209564_1004073 | |||
| 1407 | Ga0209050_1000145 | |||
| 1408 | Ga0209050_1007847 | |||
| 1409 | Ga0209050_1012221 | |||
| 1410 | Ga0209256_1000005 | |||
| 1411 | Ga0209256_1000061 | |||
| 1412 | Ga0209256_1000106 | |||
| 1413 | Ga0209256_1000269 | |||
| 1414 | Ga0209256_1000676 | |||
| 1415 | Ga0209256_1002862 | |||
| 1416 | Ga0209256_1007013 | |||
| 1417 | Ga0207426_1002626 | |||
| 1418 | Ga0209051_1000018 | |||
| 1419 | Ga0209051_1004528 | |||
| 1420 | Ga0209051_1005475 | |||
| 1421 | Ga0209051_1016272 | |||
| 1422 | Ga0209257_1000010 | |||
| 1423 | Ga0209257_1000084 | |||
| 1424 | Ga0209257_1004271 | |||
| 1425 | Ga0207697_10031970 | |||
| 1426 | Ga0207656_10276333 | |||
| 1427 | Ga0207655_1001288 | |||
| 1428 | Ga0207713_1000135 | |||
| 1429 | Ga0207713_1008988 | |||
| 1430 | Ga0207713_1055329 | |||
| 1431 | Ga0207682_10006644 | |||
| 1432 | Ga0207682_10039046 | |||
| 1433 | Ga0207642_10016456 | |||
| 1434 | Ga0207680_10018874 | |||
| 1435 | Ga0207647_10035754 | |||
| 1436 | Ga0207645_10029160 | |||
| 1437 | Ga0207645_10414350 | |||
| 1438 | Ga0207643_10097419 | |||
| 1439 | Ga0207705_10106102 | |||
| 1440 | Ga0207705_10191215 | |||
| 1441 | Ga0207654_10289787 | |||
| 1442 | Ga0207695_10009547 | |||
| 1443 | Ga0207695_10010175 | |||
| 1444 | Ga0207695_10032918 | |||
| 1445 | Ga0207695_10079069 | |||
| 1446 | Ga0207671_10033303 | |||
| 1447 | Ga0207662_10002597 | |||
| 1448 | Ga0207657_10149395 | |||
| 1449 | Ga0207649_10252355 | |||
| 1450 | Ga0207681_10008770 | |||
| 1451 | Ga0207681_10184195 | |||
| 1452 | Ga0207694_10059333 | |||
| 1453 | Ga0207650_10350312 | |||
| 1454 | Ga0207659_10032977 | |||
| 1455 | Ga0207659_10038293 | |||
| 1456 | Ga0207687_10034805 | |||
| 1457 | Ga0207644_10048134 | |||
| 1458 | Ga0207690_10004058 | |||
| 1459 | Ga0207690_10507350 | |||
| 1460 | Ga0207706_10015322 | |||
| 1461 | Ga0207706_10144106 | |||
| 1462 | Ga0207709_10002721 | |||
| 1463 | Ga0207670_10369958 | |||
| 1464 | Ga0207669_10006656 | |||
| 1465 | Ga0207691_10048281 | |||
| 1466 | Ga0207691_10093888 | |||
| 1467 | Ga0207691_10096426 | |||
| 1468 | Ga0207689_10011506 | |||
| 1469 | Ga0207689_10039908 | |||
| 1470 | Ga0207661_10052657 | |||
| 1471 | Ga0207667_10021476 | |||
| 1472 | Ga0207712_10009755 | |||
| 1473 | Ga0207668_10046072 | |||
| 1474 | Ga0207640_10079351 | |||
| 1475 | Ga0207640_10096861 | |||
| 1476 | Ga0207658_10013291 | |||
| 1477 | Ga0207677_10040223 | |||
| 1478 | Ga0207703_10005816 | |||
| 1479 | Ga0207678_10076301 | |||
| 1480 | Ga0207678_10422419 | |||
| 1481 | Ga0207678_10488071 | |||
| 1482 | Ga0207702_10001261 | |||
| 1483 | Ga0207702_10058186 | |||
| 1484 | Ga0207641_10005241 | |||
| 1485 | Ga0207648_10047299 | |||
| 1486 | Ga0207648_10225905 | |||
| 1487 | Ga0207648_10356977 | |||
| 1488 | Ga0207674_10057723 | |||
| 1489 | Ga0207675_100002925 | |||
| 1490 | Ga0207675_100111936 | |||
| 1491 | Ga0207683_10041387 | |||
| 1492 | Ga0207683_10377001 | |||
| 1493 | Ga0207698_10008917 | |||
| 1494 | Ga0207698_10121456 | |||
| 1495 | Ga0209281_1000103 | |||
| 1496 | Ga0209968_1001095 | |||
| 1497 | Ga0209282_1000002 | |||
| 1498 | Ga0209282_1000052 | |||
| 1499 | Ga0209966_1000003 | |||
| 1500 | Ga0268266_10176480 | |||
| 1501 | Ga0268264_10001986 | |||
| 1502 | Ga0307515_10000708 | |||
| 1503 | Ga0307515_10013083 | |||
| 1504 | Ga0307515_10470144 | |||
| 1505 | Ga0307511_10076838 | |||
| 1506 | Ga0307512_10056000 | |||
| 1507 | Ga0265328_10005685 | |||
| 1508 | Ga0265327_10000479 | |||
| 1509 | Ga0265327_10031415 | |||
| 1510 | Ga0307509_10073712 | |||
| 1511 | Ga0307508_10000169 | |||
| 1512 | Ga0307514_10085435 | |||
| 1513 | Ga0316576_10077095 | |||
| 1514 | Ga0307516_10008972 | |||
| 1515 | Ga0307516_10009988 | |||
| 1516 | Ga0307413_10273545 | |||
| 1517 | Ga0307518_10127414 | |||
| 1518 | Ga0307410_10247607 | |||
| 1519 | Ga0307409_100226671 | |||
| 1520 | Ga0307409_100280086 | |||
| 1521 | Ga0307416_100005407 | |||
| 1522 | Ga0307416_101791783 | |||
| 1523 | Ga0307414_10094204 | |||
| 1524 | Ga0307507_10021968 | |||
| 1525 | Ga0316574_0086518 | |||
| 1526 | Ga0373924_0027378 | |||
| 1527 | Ga0373933_0320756 | |||
| 1528 | Ga0373937_0089551 | |||
| 1529 | Ga0373937_0468785 | |||
| 1530 | Ga0395899_0001064 | |||
| 1531 | Ga0395899_0002813 | |||
| 1532 | Ga0395899_0003608 | |||
| 1533 | Ga0395900_0000131 | |||
| 1534 | Ga0395900_0005698 | |||
| 1535 | Ga0395900_0283273 | |||
| 1536 | Ga0395898_0001532 | |||
| 1537 | Ga0395898_0097883 | |||
| 1538 | Ga0395905_0017710 | |||
| 1539 | Ga0395905_0025730 | |||
| 1540 | Ga0395905_0028213 | |||
| 1541 | Ga0395905_0063403 | |||
| 1542 | Ga0395905_0208288 | |||
| 1543 | Ga0395901_0000002 | |||
| 1544 | Ga0395901_0001718 | |||
| 1545 | Ga0395901_0136559 | |||
| 1546 | Ga0395901_1173314 | |||
| 1547 | Ga0436361_0144599 | |||
| 1548 | Ga0436361_0338967 | |||
| 1549 | Ga0436361_0600769 | |||
| 1550 | Ga0436361_0846070 | |||
| 1551 | Ga0439461_0030468 | |||
| 1552 | Ga0439465_0120827 | |||
| 1553 | Ga0451789_0491830 | |||
| 1554 | Ga0451795_0419335 | |||
| 1555 | Ga0451802_0970336 | |||
| 1556 | Ga0451835_0864634 | |||
| 1557 | Ga0451839_0718016 | |||
| 1558 | Ga0451849_0077297 | |||
| 1559 | Ga0451851_0770517 | |||
| 1560 | Ga0451843_0223084 | |||
| 1561 | Ga0439431_0031742 | |||
| 1562 | Ga0439450_007594 | |||
| 1563 | Ga0450906_010415 | |||
| 1564 | Ga0439446_0014983 | |||
| 1565 | Ga0439434_0039325 | |||
| 1566 | Ga0439460_0095082 | |||
| 1567 | Ga0450918_001746 | |||
| 1568 | Ga0451577_0091368 | |||
| 1569 | Ga0451577_0751880 | |||
| 1570 | Ga0466969_0058160 | |||
| 1571 | Ga0466972_0000088 | |||
| 1572 | Ga0466972_0022575 | |||
| 1573 | Ga0466978_0109275 | |||
| 1574 | Ga0466965_0000666 | |||
| 1575 | Ga0466965_0002051 | |||
| 1576 | Ga0466966_0000687 | |||
| 1577 | Ga0466966_0006128 | |||
| 1578 | Ga0466966_0089471 | |||
| 1579 | Ga0466961_0001458 | |||
| 1580 | Ga0466961_0007342 | |||
| 1581 | Ga0466961_0018736 | |||
| 1582 | Ga0466963_0027945 | |||
| 1583 | Ga0466963_0047308 | |||
| 1584 | Ga0466964_0002548 | |||
| 1585 | Ga0466964_0002848 | |||
| 1586 | Ga0466964_0025767 | |||
| 1587 | Ga0466964_0040051 | |||
| 1588 | Ga0466964_0056879 | |||
| 1589 | Ga0466964_0113758 | |||
| 1590 | Ga0453684_0023234 | |||
| 1591 | Ga0466971_0005142 | |||
| 1592 | Ga0466971_0007302 | |||
| 1593 | Ga0466971_0017715 | |||
| 1594 | Ga0466971_0052756 | |||
| 1595 | Ga0466968_0063481 | |||
| 1596 | Ga0466970_0007806 | |||
| 1597 | Ga0466970_0028412 | |||
| 1598 | Ga0466970_0031025 | |||
| 1599 | Ga0466957_0047867 | |||
| 1600 | Ga0466957_0164008 | |||
| 1601 | Ga0466957_0192226 | |||
| 1602 | Ga0466960_0026488 | |||
| 1603 | Ga0466959_0000287 | |||
| 1604 | Ga0466959_0009422 | |||
| 1605 | Ga0466959_0052023 | |||
| 1606 | Ga0466959_0081458 | |||
| 1607 | Ga0451576_0074320 | |||
| 1608 | Ga0451576_0194483 | |||
| 1609 | Ga0466958_0011505 | |||
| 1610 | Ga0466958_0587412 | |||
| 1611 | Ga0466967_0024766 | |||
| 1612 | Ga0466967_0090776 | |||
| 1613 | Ga0466967_0141742 | |||
| 1614 | Ga0495617_000002 | |||
| 1615 | Ga0495617_041726 | |||
| 1616 | Ga0495617_085942 | |||
| 1617 | Ga0495627_000207 | |||
| 1618 | Ga0495627_042518 | |||
| 1619 | Ga0495627_046735 | |||
| 1620 | Ga0495592_0030409 | |||
| 1621 | Ga0495592_0100052 | |||
| 1622 | Ga0495603_0106430 | |||
| 1623 | Ga0495603_0364263 | |||
| 1624 | Ga0495590_0000025 | |||
| 1625 | Ga0495590_0018282 | |||
| 1626 | Ga0495590_0021071 | |||
| 1627 | Ga0495590_0054003 | |||
| 1628 | Ga0495591_002755 | |||
| 1629 | Ga0495629_0000878 | |||
| 1630 | Ga0495629_0005319 | |||
| 1631 | Ga0495638_0013390 | |||
| 1632 | Ga0495638_0016484 | |||
| 1633 | Ga0495638_0035516 | |||
| 1634 | Ga0495638_0073932 | |||
| 1635 | Ga0495638_0244567 | |||
| 1636 | Ga0495651_0100121 | |||
| 1637 | Ga0495651_0134207 | |||
| 1638 | Ga0495651_0351245 | |||
| 1639 | Ga0495653_0005181 | |||
| 1640 | Ga0495653_0007366 | |||
| 1641 | Ga0495653_0061355 | |||
| 1642 | Ga0495653_0105341 | |||
| 1643 | Ga0495653_0132732 | |||
| 1644 | Ga0495650_0000015 | |||
| 1645 | Ga0495650_0005573 | |||
| 1646 | Ga0495650_0006345 | |||
| 1647 | Ga0495650_0007195 | |||
| 1648 | Ga0495650_0008662 | |||
| 1649 | Ga0495650_0009150 | |||
| 1650 | Ga0495580_0016442 | |||
| 1651 | Ga0495580_0020600 | |||
| 1652 | Ga0495580_0023359 | |||
| 1653 | Ga0495580_0050910 | |||
| 1654 | Ga0495580_0115644 | |||
| 1655 | Ga0495580_0699376 | |||
| 1656 | Ga0495582_0002333 | |||
| 1657 | Ga0495582_0027681 | |||
| 1658 | Ga0495582_0044024 | |||
| 1659 | Ga0495605_0001284 | |||
| 1660 | Ga0495605_0003031 | |||
| 1661 | Ga0495605_0012486 | |||
| 1662 | Ga0495605_0025196 | |||
| 1663 | Ga0495605_0026070 | |||
| 1664 | Ga0495605_0240640 | |||
| 1665 | Ga0495662_0386912 | |||
| 1666 | Ga0495664_0019005 | |||
| 1667 | Ga0495664_0495309 | |||
| 1668 | Ga0495584_0000070 | |||
| 1669 | Ga0495584_0000560 | |||
| 1670 | Ga0495584_0004898 | |||
| 1671 | Ga0495584_0005783 | |||
| 1672 | Ga0495584_0007322 | |||
| 1673 | Ga0495584_0009129 | |||
| 1674 | Ga0495584_0288096 | |||
| 1675 | Ga0495585_0000006 | |||
| 1676 | Ga0495585_0006233 | |||
| 1677 | Ga0495585_0006865 | |||
| 1678 | Ga0495585_0010286 | |||
| 1679 | Ga0495585_0010483 | |||
| 1680 | Ga0495585_0013461 | |||
| 1681 | Ga0495585_0026665 | |||
| 1682 | Ga0495585_0030854 | |||
| 1683 | Ga0495585_0032874 | |||
| 1684 | Ga0495585_0034744 | |||
| 1685 | Ga0495585_0059514 | |||
| 1686 | Ga0495585_0068952 | |||
| 1687 | Ga0495585_0154537 | |||
| 1688 | Ga0495585_0193122 | |||
| 1689 | Ga0495594_0003640 | |||
| 1690 | Ga0495594_0005742 | |||
| 1691 | Ga0495594_0013918 | |||
| 1692 | Ga0495594_0030537 | |||
| 1693 | Ga0495594_0069416 | |||
| 1694 | Ga0495596_0000240 | |||
| 1695 | Ga0495596_0001004 | |||
| 1696 | Ga0495596_0001839 | |||
| 1697 | Ga0495596_0008211 | |||
| 1698 | Ga0495596_0008902 | |||
| 1699 | Ga0495596_0009505 | |||
| 1700 | Ga0495596_0011786 | |||
| 1701 | Ga0495596_0012683 | |||
| 1702 | Ga0495596_0031054 | |||
| 1703 | Ga0495596_0033692 | |||
| 1704 | Ga0495596_0041071 | |||
| 1705 | Ga0495596_0070668 | |||
| 1706 | Ga0495596_0196268 | |||
| 1707 | Ga0495607_0002594 | |||
| 1708 | Ga0495607_0004085 | |||
| 1709 | Ga0495607_0005057 | |||
| 1710 | Ga0495607_0009947 | |||
| 1711 | Ga0495607_0014386 | |||
| 1712 | Ga0495607_0017453 | |||
| 1713 | Ga0495607_0031280 | |||
| 1714 | Ga0495607_0046605 | |||
| 1715 | Ga0495607_0068424 | |||
| 1716 | Ga0495607_0106432 | |||
| 1717 | Ga0495607_0117837 | |||
| 1718 | Ga0495607_0307808 | |||
| 1719 | Ga0495583_0000056 | |||
| 1720 | Ga0495583_0000159 | |||
| 1721 | Ga0495583_0000372 | |||
| 1722 | Ga0495583_0000382 | |||
| 1723 | Ga0495583_0000864 | |||
| 1724 | Ga0495583_0002345 | |||
| 1725 | Ga0495583_0004885 | |||
| 1726 | Ga0495583_0023202 | |||
| 1727 | Ga0495583_0056880 | |||
| 1728 | Ga0495583_0101613 | |||
| 1729 | Ga0495583_0167063 | |||
| 1730 | Ga0495583_0209989 | |||
| 1731 | Ga0495606_0002998 | |||
| 1732 | Ga0495606_0004210 | |||
| 1733 | Ga0495606_0013849 | |||
| 1734 | Ga0495606_0038316 | |||
| 1735 | Ga0495606_0039674 | |||
| 1736 | Ga0495606_0041103 | |||
| 1737 | Ga0495606_0133232 | |||
| 1738 | Ga0495606_0133665 | |||
| 1739 | Ga0495606_0306052 | |||
| 1740 | Ga0495608_0072156 | |||
| 1741 | Ga0495610_0004511 | |||
| 1742 | Ga0495610_0006028 | |||
| 1743 | Ga0495610_0020472 | |||
| 1744 | Ga0495610_0035172 | |||
| 1745 | Ga0495616_0000057 | |||
| 1746 | Ga0495616_0003140 | |||
| 1747 | Ga0495616_0004533 | |||
| 1748 | Ga0495616_0010511 | |||
| 1749 | Ga0495616_0015188 | |||
| 1750 | Ga0495616_0015417 | |||
| 1751 | Ga0495616_0015591 | |||
| 1752 | Ga0495616_0028366 | |||
| 1753 | Ga0495616_0031036 | |||
| 1754 | Ga0495616_0101666 | |||
| 1755 | Ga0495620_0030549 | |||
| 1756 | Ga0495620_0041244 | |||
| 1757 | Ga0495620_0049470 | |||
| 1758 | Ga0495620_0049791 | |||
| 1759 | Ga0495628_0029302 | |||
| 1760 | Ga0495628_0079729 | |||
| 1761 | Ga0495630_0044173 | |||
| 1762 | Ga0495630_0058357 | |||
| 1763 | Ga0495631_0002820 | |||
| 1764 | Ga0495631_0003219 | |||
| 1765 | Ga0495631_0005293 | |||
| 1766 | Ga0495631_0012520 | |||
| 1767 | Ga0495631_0014987 | |||
| 1768 | Ga0495631_0015637 | |||
| 1769 | Ga0495631_0015837 | |||
| 1770 | Ga0495631_0016374 | |||
| 1771 | Ga0495631_0021138 | |||
| 1772 | Ga0495631_0030586 | |||
| 1773 | Ga0495631_0045981 | |||
| 1774 | Ga0495631_0144685 | |||
| 1775 | Ga0495631_0181164 | |||
| 1776 | Ga0495632_0000129 | |||
| 1777 | Ga0495632_0000296 | |||
| 1778 | Ga0495632_0000375 | |||
| 1779 | Ga0495632_0008199 | |||
| 1780 | Ga0495632_0022106 | |||
| 1781 | Ga0495632_0022797 | |||
| 1782 | Ga0495632_0025075 | |||
| 1783 | Ga0495632_0026117 | |||
| 1784 | Ga0495637_0000126 | |||
| 1785 | Ga0495637_0023626 | |||
| 1786 | Ga0495637_0070124 | |||
| 1787 | Ga0495643_0000415 | |||
| 1788 | Ga0495643_0011985 | |||
| 1789 | Ga0495643_0026575 | |||
| 1790 | Ga0495643_0031662 | |||
| 1791 | Ga0495643_0048513 | |||
| 1792 | Ga0495643_0095437 | |||
| 1793 | Ga0495643_0125066 | |||
| 1794 | Ga0495643_0313931 | |||
| 1795 | Ga0495644_0000389 | |||
| 1796 | Ga0495644_0001948 | |||
| 1797 | Ga0495644_0003401 | |||
| 1798 | Ga0495644_0003438 | |||
| 1799 | Ga0495644_0007023 | |||
| 1800 | Ga0495644_0007542 | |||
| 1801 | Ga0495644_0009481 | |||
| 1802 | Ga0495644_0013643 | |||
| 1803 | Ga0495648_0000708 | |||
| 1804 | Ga0495648_0001488 | |||
| 1805 | Ga0495648_0007168 | |||
| 1806 | Ga0495648_0011619 | |||
| 1807 | Ga0495648_0036925 | |||
| 1808 | Ga0495648_0038209 | |||
| 1809 | Ga0495648_0048317 | |||
| 1810 | Ga0495648_0085064 | |||
| 1811 | Ga0495648_0165099 | |||
| 1812 | Ga0495648_0215620 | |||
| 1813 | Ga0495663_0002556 | |||
| 1814 | Ga0495663_0017672 | |||
| 1815 | Ga0495663_0086948 | |||
| 1816 | Ga0495666_0000318 | |||
| 1817 | Ga0495666_0000556 | |||
| 1818 | Ga0495666_0008615 | |||
| 1819 | Ga0495666_0018785 | |||
| 1820 | Ga0495666_0039750 | |||
| 1821 | Ga0495666_0046494 | |||
| 1822 | Ga0495642_0000613 | |||
| 1823 | Ga0495642_0004874 | |||
| 1824 | Ga0495642_0007226 | |||
| 1825 | Ga0495642_0009239 | |||
| 1826 | Ga0495642_0011089 | |||
| 1827 | Ga0495642_0012989 | |||
| 1828 | Ga0495642_0016483 | |||
| 1829 | Ga0495642_0041624 | |||
| 1830 | Ga0495642_0066401 | |||
| 1831 | Ga0495642_0069897 | |||
| 1832 | Ga0495652_0001577 | |||
| 1833 | Ga0495654_0000381 | |||
| 1834 | Ga0495654_0004611 | |||
| 1835 | Ga0495654_0018761 | |||
| 1836 | Ga0495654_0028918 | |||
| 1837 | Ga0495654_0107634 | |||
| 1838 | Ga0495654_0198012 | |||
| 1839 | Ga0495665_0020210 | |||
| 1840 | Ga0495665_0049520 | |||
| 1841 | Ga0495665_0060088 | |||
| 1842 | Ga0495640_0017736 | |||
| 1843 | Ga0495586_0009827 | |||
| 1844 | Ga0495586_0012802 | |||
| 1845 | Ga0495586_0024342 | |||
| 1846 | Ga0495586_0152531 | |||
| 1847 | Ga0495587_0243573 | |||
| 1848 | Ga0495609_0001536 | |||
| 1849 | Ga0495609_0003404 | |||
| 1850 | Ga0495609_0003442 | |||
| 1851 | Ga0495609_0004070 | |||
| 1852 | Ga0495609_0004682 | |||
| 1853 | Ga0495609_0015930 | |||
| 1854 | Ga0495609_0016433 | |||
| 1855 | Ga0495609_0021815 | |||
| 1856 | Ga0495609_0029412 | |||
| 1857 | Ga0495609_0033768 | |||
| 1858 | Ga0495609_0048047 | |||
| 1859 | Ga0495609_0065495 | |||
| 1860 | Ga0495609_0099802 | |||
| 1861 | Ga0495621_0003776 | |||
| 1862 | Ga0495597_0001388 | |||
| 1863 | Ga0495597_0002423 | |||
| 1864 | Ga0495597_0003311 | |||
| 1865 | Ga0495597_0005681 | |||
| 1866 | Ga0495597_0009715 | |||
| 1867 | Ga0495597_0010710 | |||
| 1868 | Ga0495597_0035088 | |||
| 1869 | Ga0495597_0038705 | |||
| 1870 | Ga0495597_0171388 | |||
| 1871 | Ga0495597_0219965 | |||
| 1872 | Ga0495645_0037487 | |||
| 1873 | Ga0495645_0211290 | |||
| 1874 | Ga0495645_0392211 | |||
| 1875 | Ga0495622_0000064 | |||
| 1876 | Ga0495622_0000570 | |||
| 1877 | Ga0495622_0006368 | |||
| 1878 | Ga0495622_0032190 | |||
| 1879 | Ga0495622_0054258 | |||
| 1880 | Ga0495622_0102906 | |||
| 1881 | Ga0495633_0003338 | |||
| 1882 | Ga0495633_0004954 | |||
| 1883 | Ga0495633_0008291 | |||
| 1884 | Ga0495633_0032773 | |||
| 1885 | Ga0495633_0034346 | |||
| 1886 | Ga0495633_0060270 | |||
| 1887 | Ga0495633_0065743 | |||
| 1888 | Ga0495633_0079803 | |||
| 1889 | Ga0495633_0115881 | |||
| 1890 | Ga0495633_0260102 | |||
| 1891 | Ga0495656_0002704 | |||
| 1892 | Ga0495656_0017670 | |||
| 1893 | Ga0495656_0040418 | |||
| 1894 | Ga0495656_0044093 | |||
| 1895 | Ga0495656_0073514 | |||
| 1896 | Ga0495656_0300791 | |||
| 1897 | Ga0495656_0386048 | |||
| 1898 | Ga0495668_0000025 | |||
| 1899 | Ga0495668_0000544 | |||
| 1900 | Ga0495668_0000578 | |||
| 1901 | Ga0495668_0003733 | |||
| 1902 | Ga0495668_0021923 | |||
| 1903 | Ga0495668_0029684 | |||
| 1904 | Ga0495668_0034704 | |||
| 1905 | Ga0495668_0045031 | |||
| 1906 | Ga0495668_0055234 | |||
| 1907 | Ga0495668_0066242 | |||
| 1908 | Ga0495634_0053681 | |||
| 1909 | Ga0495634_0369017 | |||
| 1910 | Ga0495611_0000946 | |||
| 1911 | Ga0495611_0003308 | |||
| 1912 | Ga0495611_0011108 | |||
| 1913 | Ga0495611_0012399 | |||
| 1914 | Ga0495611_0025380 | |||
| 1915 | Ga0495611_0030378 | |||
| 1916 | Ga0495611_0033374 | |||
| 1917 | Ga0495611_0101818 | |||
| 1918 | Ga0495611_0125987 | |||
| 1919 | Ga0495625_0004296 | |||
| 1920 | Ga0495625_0004306 | |||
| 1921 | Ga0495625_0026121 | |||
| 1922 | Ga0495625_0029610 | |||
| 1923 | Ga0495625_0040181 | |||
| 1924 | Ga0495625_0051408 | |||
| 1925 | Ga0495625_0052327 | |||
| 1926 | Ga0495625_0129530 | |||
| 1927 | Ga0495625_0155060 | |||
| 1928 | Ga0495625_0179307 | |||
| 1929 | Ga0495625_0249643 | |||
| 1930 | Ga0495635_0001292 | |||
| 1931 | Ga0495635_0015435 | |||
| 1932 | Ga0495635_0121076 | |||
| 1933 | Ga0495635_0246513 | |||
| 1934 | Ga0495659_0000526 | |||
| 1935 | Ga0495659_0000919 | |||
| 1936 | Ga0495659_0008635 | |||
| 1937 | Ga0495659_0013224 | |||
| 1938 | Ga0495659_0316897 | |||
| 1939 | Ga0495661_0002258 | |||
| 1940 | Ga0495661_0004930 | |||
| 1941 | Ga0495661_0009057 | |||
| 1942 | Ga0495661_0016750 | |||
| 1943 | Ga0495661_0023263 | |||
| 1944 | Ga0495661_0024203 | |||
| 1945 | Ga0495661_0038868 | |||
| 1946 | Ga0495661_0051612 | |||
| 1947 | Ga0495661_0063697 | |||
| 1948 | Ga0495661_0088267 | |||
| 1949 | Ga0495661_0100596 | |||
| 1950 | Ga0495661_0103250 | |||
| 1951 | Ga0495661_0110688 | |||
| 1952 | Ga0495661_0168146 | |||
| 1953 | Ga0495661_0175233 | |||
| 1954 | Ga0495661_0218012 | |||
| 1955 | Ga0495661_0316595 | |||
| 1956 | Ga0495588_0003376 | |||
| 1957 | Ga0495588_0024317 | |||
| 1958 | Ga0495588_0036417 | |||
| 1959 | Ga0495588_0046183 | |||
| 1960 | Ga0495588_0096087 | |||
| 1961 | Ga0495588_0166293 | |||
| 1962 | Ga0495588_0189117 | |||
| 1963 | Ga0495599_0008525 | |||
| 1964 | Ga0495599_0175798 | |||
| 1965 | Ga0495623_0002848 | |||
| 1966 | Ga0495623_0091236 | |||
| 1967 | Ga0495623_0172788 | |||
| 1968 | Ga0495646_0001272 | |||
| 1969 | Ga0495646_0008984 | |||
| 1970 | Ga0495646_0119223 | |||
| 1971 | Ga0495646_0126911 | |||
| 1972 | Ga0495658_0229075 | |||
| 1973 | Ga0495669_0000092 | |||
| 1974 | Ga0495669_0000583 | |||
| 1975 | Ga0495669_0002000 | |||
| 1976 | Ga0495669_0014388 | |||
| 1977 | Ga0495669_0018903 | |||
| 1978 | Ga0495669_0053696 | |||
| 1979 | Ga0495669_0062837 | |||
| 1980 | Ga0495669_0097430 | |||
| 1981 | Ga0495613_0033961 | |||
| 1982 | Ga0495613_0108969 | |||
| 1983 | Ga0495613_0143776 | |||
| 1984 | Ga0495624_0004719 | |||
| 1985 | Ga0495624_0013356 | |||
| 1986 | Ga0495624_0018817 | |||
| 1987 | Ga0495624_0021868 | |||
| 1988 | Ga0495670_0001955 | |||
| 1989 | Ga0495670_0003903 | |||
| 1990 | Ga0495670_0023024 | |||
| 1991 | Ga0495670_0041036 | |||
| 1992 | Ga0495670_0053575 | |||
| 1993 | Ga0495670_0065194 | |||
| 1994 | Ga0495670_0097054 | |||
| 1995 | Ga0495670_0106660 | |||
| 1996 | Ga0495670_0110917 | |||
| 1997 | Ga0495670_0116948 | |||
| 1998 | Ga0495670_0263036 | |||
| 1999 | Ga0495671_0002518 | |||
| 2000 | Ga0495671_0009131 | |||
| 2001 | Ga0495671_0011096 | |||
| 2002 | Ga0495671_0029990 | |||
| 2003 | Ga0495671_0035806 | |||
| 2004 | Ga0495671_0056700 | |||
| 2005 | Ga0495671_0101401 | |||
| 2006 | Ga0495671_0138840 | |||
| 2007 | Ga0495649_0001463 | |||
| 2008 | Ga0495649_0003126 | |||
| 2009 | Ga0495649_0005200 | |||
| 2010 | Ga0495649_0006435 | |||
| 2011 | Ga0495649_0006781 | |||
| 2012 | Ga0495649_0009242 | |||
| 2013 | Ga0495649_0015381 | |||
| 2014 | Ga0495649_0029688 | |||
| 2015 | Ga0495649_0063457 | |||
| 2016 | Ga0495649_0118121 | |||
| 2017 | Ga0495649_0122041 | |||
| 2018 | Ga0495649_0152974 | |||
| 2019 | Ga0495649_0194707 | |||
| 2020 | Ga0495649_0304778 | |||
| 2021 | Ga0495649_0319066 | |||
| 2022 | Ga0495589_0000032 | |||
| 2023 | Ga0495589_0002314 | |||
| 2024 | Ga0495589_0004788 | |||
| 2025 | Ga0495589_0005625 | |||
| 2026 | Ga0495589_0013093 | |||
| 2027 | Ga0495589_0014852 | |||
| 2028 | Ga0495589_0024976 | |||
| 2029 | Ga0495589_0050404 | |||
| 2030 | Ga0495589_0090532 | |||
| 2031 | Ga0495589_0103208 | |||
| 2032 | Ga0495589_0115136 | |||
| 2033 | Ga0495589_0146367 | |||
| 2034 | Ga0495600_0000474 | |||
| 2035 | Ga0495600_0002069 | |||
| 2036 | Ga0495660_0009441 | |||
| 2037 | Ga0495660_0010483 | |||
| 2038 | Ga0495660_0011814 | |||
| 2039 | Ga0495660_0013996 | |||
| 2040 | Ga0495660_0025613 | |||
| 2041 | Ga0495660_0042266 | |||
| 2042 | Ga0495660_0071539 | |||
| 2043 | Ga0495581_0008394 | |||
| 2044 | Ga0495581_0015215 | |||
| 2045 | Ga0495581_0015668 | |||
| 2046 | Ga0495604_0020165 | |||
| 2047 | Ga0495604_0030329 | |||
| 2048 | Ga0495604_0038987 | |||
| 2049 | Ga0495604_0047559 | |||
| 2050 | Ga0495604_0051135 | |||
| 2051 | Ga0495636_0001913 | |||
| 2052 | Ga0495636_0002620 | |||
| 2053 | Ga0495636_0028437 | |||
| 2054 | Ga0495636_0042381 | |||
| 2055 | Ga0495636_0051765 | |||
| 2056 | Ga0495674_0004291 | |||
| 2057 | Ga0495674_0008961 | |||
| 2058 | Ga0495674_0359082 | |||
| 2059 | Ga0495674_0400908 | |||
| 2060 | Ga0495672_0000041 | |||
| 2061 | Ga0495672_0004140 | |||
| 2062 | Ga0495672_0006589 | |||
| 2063 | Ga0495672_0042796 | |||
| 2064 | Ga0495672_0052973 | |||
| 2065 | Ga0495672_0156877 | |||
| 2066 | Ga0495672_0289083 | |||
| 2067 | Ga0495676_0000235 | |||
| 2068 | Ga0495676_0025419 | |||
| 2069 | Ga0495676_0045906 | |||
| 2070 | Ga0495676_0122523 | |||
| 2071 | Ga0495680_0042503 | |||
| 2072 | Ga0495683_0001361 | |||
| 2073 | Ga0495683_0003295 | |||
| 2074 | Ga0495683_0004350 | |||
| 2075 | Ga0495683_0016473 | |||
| 2076 | Ga0495683_0030886 | |||
| 2077 | Ga0495683_0034026 | |||
| 2078 | Ga0495683_0045537 | |||
| 2079 | Ga0495683_0070388 | |||
| 2080 | Ga0495683_0114245 | |||
| 2081 | Ga0495683_0229991 | |||
| 2082 | Ga0495687_000127 | |||
| 2083 | Ga0495687_000143 | |||
| 2084 | Ga0495687_001108 | |||
| 2085 | Ga0495687_004036 | |||
| 2086 | Ga0495687_008098 | |||
| 2087 | Ga0495687_034999 | |||
| 2088 | Ga0495687_036591 | |||
| 2089 | Ga0495675_0081573 | |||
| 2090 | Ga0495675_0532871 | |||
| 2091 | Ga0495677_0003200 | |||
| 2092 | Ga0495677_0005113 | |||
| 2093 | Ga0495677_0006278 | |||
| 2094 | Ga0495677_0007859 | |||
| 2095 | Ga0495677_0009153 | |||
| 2096 | Ga0495677_0024912 | |||
| 2097 | Ga0495677_0026448 | |||
| 2098 | Ga0495677_0049226 | |||
| 2099 | Ga0495677_0054027 | |||
| 2100 | Ga0495677_0076995 | |||
| 2101 | Ga0495677_0081048 | |||
| 2102 | Ga0495679_000037 | |||
| 2103 | Ga0495679_005470 | |||
| 2104 | Ga0495679_021280 | |||
| 2105 | Ga0495679_033196 | |||
| 2106 | Ga0495685_000113 | |||
| 2107 | Ga0495685_001114 | |||
| 2108 | Ga0495685_008745 | |||
| 2109 | Ga0495685_014165 | |||
| 2110 | Ga0495685_015742 | |||
| 2111 | Ga0495685_024327 | |||
| 2112 | Ga0495673_0006800 | |||
| 2113 | Ga0495673_0040844 | |||
| 2114 | Ga0495673_0047964 | |||
| 2115 | Ga0495681_0000694 | |||
| 2116 | Ga0495681_0001600 | |||
| 2117 | Ga0495681_0002505 | |||
| 2118 | Ga0495681_0004999 | |||
| 2119 | Ga0495681_0019417 | |||
| 2120 | Ga0495681_0019747 | |||
| 2121 | Ga0495681_0023569 | |||
| 2122 | Ga0495681_0028377 | |||
| 2123 | Ga0495681_0066454 | |||
| 2124 | Ga0495681_0075090 | |||
| 2125 | Ga0495686_0000288 | |||
| 2126 | Ga0495686_0000656 | |||
| 2127 | Ga0495686_0002328 | |||
| 2128 | Ga0495686_0007355 | |||
| 2129 | Ga0495686_0053453 | |||
| 2130 | Ga0495686_0060892 | |||
| 2131 | Ga0495593_0012820 | |||
| 2132 | Ga0495593_0012935 | |||
| 2133 | Ga0495593_0032542 | |||
| 2134 | Ga0495593_0048888 | |||
| 2135 | Ga0495602_0006574 | |||
| 2136 | Ga0495602_0022460 | |||
| 2137 | Ga0495602_0062779 | |||
| 2138 | Ga0495602_0210740 | |||
| 2139 | Ga0495614_0006362 | |||
| 2140 | Ga0495614_0006654 | |||
| 2141 | Ga0495614_0094288 | |||
| 2142 | Ga0495626_0002049 | |||
| 2143 | Ga0495626_0010705 | |||
| 2144 | Ga0495626_0017842 | |||
| 2145 | Ga0495626_0020742 | |||
| 2146 | Ga0495626_0021140 | |||
| 2147 | Ga0495626_0022862 | |||
| 2148 | Ga0495626_0031484 | |||
| 2149 | Ga0495626_0033862 | |||
| 2150 | Ga0495626_0038091 | |||
| 2151 | Ga0495626_0040299 | |||
| 2152 | Ga0495626_0059781 | |||
| 2153 | Ga0495626_0065980 | |||
| 2154 | Ga0495626_0074515 | |||
| 2155 | Ga0495626_0109953 | |||
| 2156 | Ga0495626_0144554 | |||
| 2157 | Ga0495626_0163969 | |||
| 2158 | Ga0496100_0016601 | |||
| 2159 | Ga0496100_0171134 | |||
| 2160 | Ga0496100_0458653 | |||
| 2161 | Ga0496100_0482716 | |||
| 2162 | Ga0496101_0030388 | |||
| 2163 | Ga0496102_0000931 | |||
| 2164 | Ga0496102_0401793 | |||
| 2165 | Ga0496103_0022931 | |||
| 2166 | Ga0496103_0056910 | |||
| 2167 | Ga0496103_0529000 | |||
| 2168 | Ga0496104_0338360 | |||
| 2169 | Ga0496105_0087572 | |||
| 2170 | Ga0496107_0055316 | |||
| 2171 | Ga0496109_0009606 | |||
| 2172 | Ga0496109_0115613 | |||
| 2173 | Ga0496110_0029094 | |||
| 2174 | Ga0496110_0045736 | |||
| 2175 | Ga0496110_0047706 | |||
| 2176 | Ga0496110_0261305 | |||
| 2177 | Ga0496110_0715854 | |||
| 2178 | Ga0496111_0014930 | |||
| 2179 | Ga0496111_0342997 | |||
| 2180 | Ga0496113_0008457 | |||
| 2181 | Ga0496114_0439153 | |||
| 2182 | Ga0496115_0018367 | |||
| 2183 | Ga0496115_0020248 | |||
| 2184 | Ga0496115_0055871 | |||
| 2185 | Ga0496115_0220001 | |||
| 2186 | Ga0496115_0238318 | |||
| 2187 | Ga0496115_0276349 | |||
| 2188 | Ga0496116_0014132 | |||
| 2189 | Ga0496116_0026637 | |||
| 2190 | Ga0496116_0033774 | |||
| 2191 | Ga0496117_0028920 | |||
| 2192 | Ga0496117_0114372 | |||
| 2193 | Ga0496117_0121972 | |||
| 2194 | Ga0496118_0002886 | |||
| 2195 | Ga0496118_0040010 | |||
| 2196 | Ga0496118_0060865 | |||
| 2197 | Ga0496121_0014458 | |||
| 2198 | Ga0496121_0084985 | |||
| 2199 | Ga0496121_0197583 | |||
| 2200 | Ga0496122_0000261 | |||
| 2201 | Ga0496122_0000445 | |||
| 2202 | Ga0496122_0011752 | |||
| 2203 | Ga0496123_0000218 | |||
| 2204 | Ga0496123_0001568 | |||
| 2205 | Ga0496123_0007592 | |||
| 2206 | Ga0496124_0015077 | |||
| 2207 | Ga0496124_0015517 | |||
| 2208 | Ga0496124_0046689 | |||
| 2209 | Ga0496124_0097419 | |||
| 2210 | Ga0496124_0151501 | |||
| 2211 | Ga0496124_0237922 | |||
| 2212 | Ga0496124_0351417 | |||
| 2213 | Ga0496124_0429036 | |||
| 2214 | Ga0496125_0000256 | |||
| 2215 | Ga0496125_0002859 | |||
| 2216 | Ga0496125_0067915 | |||
| 2217 | Ga0496126_0034799 | |||
| 2218 | Ga0496126_0054778 | |||
| 2219 | Ga0496126_0111802 | |||
| 2220 | Ga0501306_002557 | |||
| 2221 | Ga0501310_001443 | |||
| 2222 | Ga0495678_000042 | |||
| 2223 | Ga0495678_000316 | |||
| 2224 | Ga0495678_003135 | |||
| 2225 | Ga0495678_003427 | |||
| 2226 | Ga0495678_003924 | |||
| 2227 | Ga0495678_004684 | |||
| 2228 | Ga0495678_006389 | |||
| 2229 | Ga0495678_007748 | |||
| 2230 | Ga0495678_009881 | |||
| 2231 | Ga0495678_025595 | |||
| 2232 | Ga0495678_033817 | |||
| 2233 | Ga0495682_0000107 | |||
| 2234 | Ga0495682_0033786 | |||
| 2235 | Ga0495682_0038533 | |||
| 2236 | Ga0495682_0084729 | |||
| 2237 | Ga0495682_0094804 | |||
| 2238 | Ga0501039_0066319 | |||
| 2239 | Ga0501070_0147283 | |||
| 2240 | Ga0501198_000102 | |||
| 2241 | Ga0501222_000008 | |||
| 2242 | Ga0501227_039267 | |||
| 2243 | Ga0501249_003963 | |||
| 2244 | Ga0501269_000210 | |||
| 2245 | Ga0501279_000208 | |||
| 2246 | Ga0501279_004406 | |||
| 2247 | Ga0501279_036368 | |||
| 2248 | nmdc:mga03683_277888_c1 | |||
| 2249 | nmdc:mga0k408_132531_c1 | |||
| 2250 | nmdc:mga0k408_177614_c1 | |||
| 2251 | nmdc:mga0k408_196874_c1 | |||
| 2252 | nmdc:mga0k408_22887_c1 | |||
| 2253 | nmdc:mga0k408_487922_c1 | |||
| 2254 | nmdc:mga0k408_59835_c1 | |||
| 2255 | nmdc:mga07m45_5487_c1 | |||
| 2256 | nmdc:mga08x19_12730_c1 | |||
| 2257 | Ga0495601_0030324 | |||
| 2258 | Ga0495601_0239427 | |||
| 2259 | Ga0500635_0000083 | |||
| 2260 | Ga0495595_0136294 | |||
| 2261 | Ga0500651_0112998 | |||
| 2262 | Ga0500595_003047 | |||
| 2263 | Ga0500619_000742 | |||
| 2264 | Ga0500634_0108608 | |||
| 2265 | Ga0500637_0152420 | |||
| 2266 | Ga0500587_000079 | |||
| 2267 | Ga0500661_006935 | |||
| 2268 | Ga0587091_002909 | |||
| 2269 | Ga0587062_001995 | |||
| 2270 | Ga0587111_0003612 | |||
| 2271 | Ga0466962_0002972 | |||
| 2272 | Ga0466962_0003937 | |||
| 2273 | 2511248376 | |||
| 2274 | 2550693536 | |||
| 2275 | 2644030407 | |||
| 2276 | 2819542751 | |||
| 2277 | 2819594530 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c2t-assembly1.cif.gz_A | new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. | 0.9676 | 3 | 199 |
| 1men-assembly1.cif.gz_A | complex structure of human gar tfase and substrate beta-gar | 0.9652 | 1 | 199 |
| 4zyv-assembly1.cif.gz_A | human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) | 0.9626 | 3 | 197 |
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9615 | 1 | 199 |
| 2ywr-assembly1.cif.gz_A | crystal structure of gar transformylase from aquifex aeolicus | 0.9615 | 1 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20143_783_975_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9668 | 2 | 182 | 3.40.50.170 |
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9615 | 1 | 199 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9614 | 3 | 199 | 3.40.50.170 |
| 1njsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9602 | 3 | 199 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9552 | 1 | 183 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A561KLD6-F1-model_v4 | deleted | 0.9882 | 15 | 203 |
|
| AF-A0A5Q1FXV9-F1-model_v4 | deleted | 0.9843 | 2 | 200 |
|
| AF-A0A561KLD6-F1-model_v4 | deleted | 0.983 | 15 | 203 |
|
| AF-A0A1G0J2J2-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9807 | 3 | 183 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A090QZB5-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9805 | 1 | 156 |
GO:0004644
GO:0005829 GO:0006189 |