F490674

General Info

Members Datasets Scaffolds Average Seq Length
1139 526 2278 253

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100070236|Ga0070670_1000702363
Length 297
Sequence MKGPLRGPVATAEVKRSSLRGRAFAAPTVASRAHPRYRYKLSFTMKLPLRRLPHALLIAGALCTSLAHAGDVQVAVAANFAGPLAKIGEGFTAATGHSLTVSAGATGKFYSQVVAGAPFEVLIAADDETPARLVKEGLAVPGTDFTYAIGTLVLWSAQPGLVDDQGAVLTSGRFDHLAVANPKLAPYGRAGMEVLKARGLVDALAPKLVTGETIAQTYQFIATGNAELGFVALSQALVPGKPVVGSYWRVPPSLHGAIRQDAVLLKAGEKNAAAVALLTYLKSDAARRVIQAYGYGH

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
161 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
199 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
202 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
203 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
204 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
205 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
206 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
207 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
242 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
345 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
346 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
349 2511231004 Pseudomonas sp. GM102 Isolate Nodule
350 2511231006 Pseudomonas sp. GM17 Isolate Nodule
351 2511231007 Pseudomonas sp. GM18 Isolate Nodule
352 2511231008 Pseudomonas sp. GM21 Isolate Nodule
353 2511231010 Pseudomonas sp. GM25 Isolate Nodule
354 2511231011 Pseudomonas sp. GM30 Isolate Nodule
355 2511231012 Pseudomonas sp. GM33 Isolate Nodule
356 2511231014 Pseudomonas sp. GM48 Isolate Nodule
357 2511231015 Pseudomonas sp. GM49 Isolate Nodule
358 2511231016 Pseudomonas sp. GM50 Isolate Nodule
359 2511231017 Pseudomonas sp. GM55 Isolate Nodule
360 2511231018 Pseudomonas sp. GM60 Isolate Nodule
361 2511231019 Pseudomonas sp. GM67 Isolate Nodule
362 2511231020 Pseudomonas sp. GM74 Isolate Nodule
363 2511231022 Pseudomonas sp. GM79 Isolate Nodule
364 2511231023 Pseudomonas sp. GM80 Isolate Nodule
365 2511231024 Pseudomonas sp. GM84 Isolate Nodule
366 2511231031 Pseudomonas sp. GM16 Isolate Nodule
367 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
368 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
369 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
370 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
371 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
372 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
373 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
374 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
375 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
376 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
377 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
378 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
379 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
380 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
381 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
382 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
383 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
384 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
385 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
386 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
387 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
388 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
389 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
390 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
391 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
392 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
393 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
394 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
395 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
396 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
397 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
398 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
399 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
400 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
401 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
402 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
403 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
404 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
405 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
406 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
407 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
408 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
409 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
410 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
411 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
412 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
413 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
414 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
415 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
416 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
417 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
418 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
419 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
420 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
421 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
422 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
423 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
424 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
425 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
426 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
427 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
428 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
429 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
430 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
431 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
432 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
433 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
434 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
435 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
436 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
437 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
438 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
439 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
440 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
441 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
442 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
443 2773857670 Pseudomonas sp. 478 Isolate Unclassified
444 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
445 2773857673 Pseudomonas sp. 443 Isolate Unclassified
446 2784132063 Pseudomonas sp. 424 Isolate Unclassified
447 2784132072 Pseudomonas sp. 460 Isolate Unclassified
448 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
449 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
450 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
451 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
452 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
453 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
454 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
455 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
456 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
457 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
458 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
459 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
460 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
461 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
462 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
463 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
464 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
465 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
466 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
467 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
468 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
469 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
470 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
471 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
472 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
473 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
474 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
475 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
476 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
477 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
478 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
479 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
480 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
481 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
482 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
483 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
484 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
485 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
486 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
487 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
488 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
489 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
490 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
491 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
492 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
493 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
494 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
495 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
496 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
497 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
498 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
499 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
500 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
501 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
502 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
503 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
504 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
505 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
506 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
507 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
508 639633007 Azoarcus olearius BH72 Isolate Unclassified
509 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
510 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
511 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
512 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
513 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
514 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
515 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
516 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
517 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
518 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
519 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
520 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
521 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
522 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
523 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
524 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
525 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
526 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.28
Metatranscriptomes 0
Isolates 15.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 6.32
Nodule 2.28
Rhizoplane 6.23
Rhizosphere 74.89
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100070236 3300005331 Bacteria 3006
2 SwRhRL2b_contig_3815165 2162886007 Bacteria 1078
3 JGI24739J22299_10060794 3300001989 Bacteria 1195
4 JGI24735J21928_10008513 3300002067 Bacteria 3313
5 JGI24744J21845_10014316 3300002077 Bacteria 1594
6 JGI25162J39368_1000030 3300002737 Bacteria 218717
7 JGI25163J39215_1000059 3300002771 Bacteria 49468
8 JGI25164J39214_1000123 3300002772 Bacteria 74810
9 JGI25165J46597_1000056 3300003214 Bacteria 218721
10 rootL2_10116134 3300003322 Bacteria 2885
11 Ga0055538_1000007 3300003751 Bacteria 399715
12 Ga0055539_1000011 3300003752 Bacteria 399747
13 Ga0055533_1000014 3300003756 Bacteria 399747
14 Ga0055532_1000009 3300003758 Bacteria 399537
15 Ga0055525_1000016 3300003759 Bacteria 399724
16 Ga0055535_1008860 3300003761 Bacteria 1777
17 Ga0055537_1000060 3300003773 Bacteria 79376
18 Ga0055536_1000084 3300003781 Bacteria 80899
19 Ga0055536_1000262 3300003781 Bacteria 41063
20 Ga0055534_1000009 3300003784 Bacteria 210256
21 Ga0055528_1000012 3300003790 Bacteria 182704
22 Ga0055530_10000215 3300003791 Bacteria 52142
23 Ga0055530_10000402 3300003791 Bacteria 38808
24 Ga0055540_1000284 3300003792 Bacteria 45364
25 Ga0055540_1000358 3300003792 Bacteria 38808
26 Ga0055541_1000008 3300003841 Bacteria 399724
27 Ga0055543_1011074 3300004625 Bacteria 1863
28 Ga0065165_1000051 3300005262 Bacteria 194844
29 Ga0065714_10000049 3300005288 Bacteria 14170
30 Ga0065714_10003058 3300005288 Bacteria 11304
31 Ga0065714_10004477 3300005288 Bacteria 5102
32 Ga0065714_10006867 3300005288 Bacteria 4202
33 Ga0065714_10013213 3300005288 Bacteria 2158
34 Ga0065714_10065510 3300005288 Bacteria 9683
35 Ga0065714_10084625 3300005288 Bacteria 2188
36 Ga0065714_10084895 3300005288 Bacteria 2174
37 Ga0065714_10087062 3300005288 Bacteria 2063
38 Ga0065714_10088010 3300005288 Bacteria 2035
39 Ga0065704_10105196 3300005289 Bacteria 2118
40 Ga0065712_10068023 3300005290 Bacteria 16944
41 Ga0065712_10069803 3300005290 Bacteria 6681
42 Ga0065712_10079095 3300005290 Bacteria 3259
43 Ga0065715_10011768 3300005293 Bacteria 2193
44 Ga0065707_10010384 3300005295 Bacteria 2138
45 Ga0070670_100000473 3300005331 Bacteria 32395
46 Ga0068868_100067269 3300005338 Bacteria 2851
47 Ga0068868_100099803 3300005338 Bacteria 2349
48 Ga0070691_10158507 3300005341 Bacteria 1165
49 Ga0070661_100000175 3300005344 Bacteria 52437
50 Ga0070668_100013601 3300005347 Bacteria 6077
51 Ga0070669_100019700 3300005353 Bacteria 4820
52 Ga0070669_100024294 3300005353 Bacteria 4345
53 Ga0070669_100064670 3300005353 Bacteria 2694
54 Ga0070669_100149193 3300005353 Bacteria 1809
55 Ga0070671_100262229 3300005355 Bacteria 1469
56 Ga0070667_100201312 3300005367 Bacteria 1767
57 Ga0070700_100213559 3300005441 Bacteria 1363
58 Ga0070694_100189817 3300005444 Bacteria 1525
59 Ga0070663_100173065 3300005455 Bacteria 1670
60 Ga0070662_100030452 3300005457 Bacteria 3776
61 Ga0068867_100000066 3300005459 Bacteria 63559
62 Ga0070699_100491498 3300005518 Bacteria 1114
63 Ga0070672_100015840 3300005543 Bacteria 5382
64 Ga0070696_100083654 3300005546 Bacteria 2264
65 Ga0070665_100474986 3300005548 Bacteria 1261
66 Ga0070664_100000118 3300005564 Bacteria 52446
67 Ga0068857_100053499 3300005577 Bacteria 3581
68 Ga0068857_100120774 3300005577 Bacteria 2359
69 Ga0068854_100347685 3300005578 Bacteria 1213
70 Ga0068864_100000342 3300005618 Bacteria 41217
71 Ga0068864_100013403 3300005618 Bacteria 6794
72 Ga0068851_10000860 3300005834 Bacteria 13058
73 Ga0068870_10009177 3300005840 Bacteria 4484
74 Ga0068863_100000149 3300005841 Bacteria 73130
75 Ga0068863_100022849 3300005841 Bacteria 5975
76 Ga0068860_100061947 3300005843 Bacteria 3555
77 Ga0068862_100034456 3300005844 Bacteria 4284
78 Ga0075364_10028562 3300006051 Bacteria 3571
79 Ga0075364_10092729 3300006051 Bacteria 2005
80 Ga0075364_10147660 3300006051 Bacteria 1584
81 Ga0075432_10000920 3300006058 Bacteria 9280
82 Ga0075432_10006692 3300006058 Bacteria 3926
83 Ga0075432_10010219 3300006058 Bacteria 3181
84 Ga0075432_10048495 3300006058 Bacteria 1494
85 Ga0075432_10053979 3300006058 Bacteria 1422
86 Ga0075432_10058799 3300006058 Bacteria 1365
87 Ga0075432_10079751 3300006058 Bacteria 1185
88 Ga0075432_10092707 3300006058 Bacteria 1107
89 Ga0070716_100160138 3300006173 Unclassified 1457
90 Ga0075369_10081575 3300006186 Bacteria 1435
91 Ga0075366_10029325 3300006195 Bacteria 3233
92 Ga0075370_10005241 3300006353 Bacteria 6415
93 Ga0075370_10008666 3300006353 Bacteria 5243
94 Ga0068871_100609624 3300006358 Bacteria 993
95 Ga0075430_100212588 3300006846 Bacteria 1605
96 Ga0075430_100354868 3300006846 Bacteria 1211
97 Ga0068865_100101956 3300006881 Bacteria 2103
98 Ga0075436_100111534 3300006914 Bacteria 1909
99 Ga0075436_100115478 3300006914 Bacteria 1875
100 Ga0079104_1000081 3300006946 Bacteria 140632
101 Ga0079104_1000435 3300006946 Bacteria 47549
102 Ga0079104_1008195 3300006946 Bacteria 3692
103 Ga0105251_10001130 3300009011 Bacteria 23182
104 Ga0105251_10005958 3300009011 Bacteria 7870
105 Ga0105251_10016388 3300009011 Bacteria 4006
106 Ga0105251_10030420 3300009011 Bacteria 2712
107 Ga0105251_10037071 3300009011 Bacteria 2394
108 Ga0105251_10047470 3300009011 Bacteria 2063
109 Ga0105251_10081030 3300009011 Bacteria 1500
110 Ga0105244_10000113 3300009036 Bacteria 84458
111 Ga0105244_10001018 3300009036 Bacteria 23466
112 Ga0105244_10002954 3300009036 Bacteria 12531
113 Ga0105244_10008244 3300009036 Bacteria 6527
114 Ga0105244_10024075 3300009036 Bacteria 3328
115 Ga0105244_10033139 3300009036 Bacteria 2726
116 Ga0105250_10000047 3300009092 Bacteria 124276
117 Ga0105250_10000393 3300009092 Bacteria 32467
118 Ga0105250_10015432 3300009092 Bacteria 3127
119 Ga0105250_10088088 3300009092 Bacteria 1261
120 Ga0111539_10111983 3300009094 Bacteria 3202
121 Ga0111539_10911049 3300009094 Bacteria 1022
122 Ga0105245_10002025 3300009098 Bacteria 18380
123 Ga0105247_10089659 3300009101 Bacteria 1950
124 Ga0105243_10000170 3300009148 Bacteria 74646
125 Ga0105243_10001782 3300009148 Bacteria 18475
126 Ga0105243_10003572 3300009148 Bacteria 12555
127 Ga0105243_10072319 3300009148 Bacteria 2791
128 Ga0105242_10000292 3300009176 Bacteria 39953
129 Ga0105242_10142126 3300009176 Bacteria 2084
130 Ga0105248_10293948 3300009177 Bacteria 1829
131 Ga0105237_10000618 3300009545 Bacteria 49609
132 Ga0105237_10312662 3300009545 Bacteria 1574
133 Ga0105237_10691288 3300009545 Bacteria 1027
134 Ga0105237_10787467 3300009545 Bacteria 958
135 Ga0105246_10000014 3300011119 Bacteria 66861
136 Ga0105246_10000554 3300011119 Bacteria 20602
137 Ga0105246_10001405 3300011119 Bacteria 14249
138 Ga0105246_10017825 3300011119 Bacteria 4516
139 Ga0105246_10273528 3300011119 Bacteria 1351
140 Ga0105246_10285042 3300011119 Bacteria 1327
141 Ga0157345_1000014 3300012498 Bacteria 50849
142 Ga0157373_10001077 3300013100 Bacteria 21002
143 Ga0157373_10001889 3300013100 Bacteria 15894
144 Ga0157373_10002066 3300013100 Bacteria 15221
145 Ga0157373_10003646 3300013100 Bacteria 11637
146 Ga0157373_10004408 3300013100 Bacteria 10603
147 Ga0157373_10004797 3300013100 Bacteria 10174
148 Ga0157373_10008623 3300013100 Bacteria 7566
149 Ga0157373_10012916 3300013100 Bacteria 6131
150 Ga0157371_10001376 3300013102 Bacteria 25495
151 Ga0157371_10002377 3300013102 Bacteria 18000
152 Ga0157371_10002745 3300013102 Bacteria 16556
153 Ga0157371_10006783 3300013102 Bacteria 9359
154 Ga0157370_10008555 3300013104 Bacteria 11029
155 Ga0157370_10013939 3300013104 Bacteria 8254
156 Ga0157370_10023614 3300013104 Bacteria 6103
157 Ga0157370_10112239 3300013104 Bacteria 2548
158 Ga0157370_10142607 3300013104 Bacteria 2232
159 Ga0157370_10262510 3300013104 Bacteria 1596
160 Ga0157369_10000417 3300013105 Bacteria 56214
161 Ga0157369_10002624 3300013105 Bacteria 21494
162 Ga0157369_10003097 3300013105 Bacteria 19860
163 Ga0157369_10004453 3300013105 Bacteria 16503
164 Ga0157369_10006855 3300013105 Bacteria 13140
165 Ga0157369_10023766 3300013105 Bacteria 6823
166 Ga0157369_10024615 3300013105 Bacteria 6693
167 Ga0157369_10305490 3300013105 Bacteria 1655
168 Ga0157369_10561764 3300013105 Bacteria 1179
169 Ga0157374_10146229 3300013296 Bacteria 2296
170 Ga0163162_10000210 3300013306 Bacteria 54200
171 Ga0163162_10009619 3300013306 Bacteria 9404
172 Ga0163162_10720659 3300013306 Bacteria 1118
173 Ga0163162_11062961 3300013306 Bacteria 916
174 Ga0163162_11062962 3300013306 Bacteria 916
175 Ga0157372_10001195 3300013307 Bacteria 28099
176 Ga0157372_10002997 3300013307 Bacteria 18209
177 Ga0157372_10111748 3300013307 Bacteria 3130
178 Ga0157375_10002075 3300013308 Bacteria 17331
179 Ga0157375_10005652 3300013308 Bacteria 10882
180 Ga0182008_10000706 3300014497 Bacteria 23874
181 Ga0182008_10000752 3300014497 Bacteria 22790
182 Ga0182008_10002526 3300014497 Bacteria 11397
183 Ga0182008_10009319 3300014497 Bacteria 5306
184 Ga0182008_10034227 3300014497 Bacteria 2547
185 Ga0182008_10074084 3300014497 Bacteria 1675
186 Ga0157377_10000035 3300014745 Bacteria 116860
187 Ga0157379_10237890 3300014968 Bacteria 1651
188 Ga0182006_1001537 3300015261 Bacteria 13789
189 Ga0182006_1001539 3300015261 Bacteria 13783
190 Ga0182006_1002098 3300015261 Bacteria 11139
191 Ga0182006_1007073 3300015261 Bacteria 5163
192 Ga0182006_1016915 3300015261 Bacteria 3106
193 Ga0182006_1090149 3300015261 Bacteria 1105
194 Ga0182007_10000315 3300015262 Bacteria 30804
195 Ga0182007_10002696 3300015262 Bacteria 8685
196 Ga0182007_10010563 3300015262 Bacteria 3639
197 Ga0182005_1001275 3300015265 Bacteria 10365
198 Ga0182005_1002287 3300015265 Bacteria 7006
199 Ga0182005_1004539 3300015265 Bacteria 4472
200 Ga0163161_10000221 3300017792 Bacteria 51978
201 Ga0163161_10005118 3300017792 Bacteria 9125
202 Ga0163161_10007828 3300017792 Bacteria 7393
203 Ga0163161_10009285 3300017792 Bacteria 6803
204 Ga0163161_10023646 3300017792 Bacteria 4336
205 Ga0163161_10030414 3300017792 Bacteria 3843
206 Ga0163161_10041264 3300017792 Bacteria 3315
207 Ga0163161_10052937 3300017792 Bacteria 2942
208 Ga0163161_10070164 3300017792 Bacteria 2562
209 Ga0163161_10457172 3300017792 Bacteria 1033
210 Ga0209435_100778 3300025206 Bacteria 5215
211 Ga0209760_100016 3300025207 Bacteria 173755
212 Ga0209784_100023 3300025224 Bacteria 399841
213 Ga0209566_100019 3300025225 Bacteria 414836
214 Ga0209674_100034 3300025226 Bacteria 414903
215 Ga0209147_100027 3300025229 Bacteria 414610
216 Ga0209563_100037 3300025230 Bacteria 414903
217 Ga0209563_102231 3300025230 Bacteria 4489
218 Ga0207427_100022 3300025231 Bacteria 469701
219 Ga0209437_100002 3300025233 Bacteria 1574801
220 Ga0209258_100166 3300025242 Bacteria 148022
221 Ga0209646_1000110 3300025246 Bacteria 156257
222 Ga0209677_100021 3300025253 Bacteria 414954
223 Ga0209759_1011401 3300025256 Bacteria 2529
224 Ga0209233_1000004 3300025261 Bacteria 1574798
225 Ga0209565_1000015 3300025263 Bacteria 494091
226 Ga0209673_1000017 3300025273 Bacteria 492994
227 Ga0209130_1000063 3300025284 Bacteria 198142
228 Ga0209675_1000012 3300025291 Bacteria 494061
229 Ga0209676_1000003 3300025292 Bacteria 1454178
230 Ga0209676_1000050 3300025292 Bacteria 398350
231 Ga0209676_1000777 3300025292 Bacteria 42671
232 Ga0209676_1013219 3300025292 Bacteria 3189
233 Ga0209676_1020135 3300025292 Bacteria 2275
234 Ga0209025_1000026 3300025294 Bacteria 519850
235 Ga0209564_1000016 3300025295 Bacteria 613131
236 Ga0209050_1000004 3300025298 Bacteria 1600040
237 Ga0209050_1000009 3300025298 Bacteria 1047265
238 Ga0209050_1001872 3300025298 Bacteria 20226
239 Ga0209256_1000346 3300025299 Bacteria 75456
240 Ga0207426_1002554 3300025302 Bacteria 11397
241 Ga0207426_1014840 3300025302 Bacteria 2846
242 Ga0209051_1000006 3300025303 Bacteria 1015785
243 Ga0209051_1000438 3300025303 Bacteria 56435
244 Ga0209051_1004148 3300025303 Bacteria 9059
245 Ga0209257_1009378 3300025304 Bacteria 5264
246 Ga0207656_10001465 3300025321 Bacteria 7824
247 Ga0207696_1000002 3300025711 Bacteria 1098043
248 Ga0207696_1000017 3300025711 Bacteria 491130
249 Ga0207696_1003966 3300025711 Bacteria 6516
250 Ga0207696_1033548 3300025711 Bacteria 1538
251 Ga0207696_1047711 3300025711 Bacteria 1233
252 Ga0207655_1000074 3300025728 Bacteria 232056
253 Ga0207655_1001619 3300025728 Bacteria 20023
254 Ga0207655_1002477 3300025728 Bacteria 14961
255 Ga0207655_1003770 3300025728 Bacteria 11113
256 Ga0207655_1012987 3300025728 Bacteria 4814
257 Ga0207655_1026761 3300025728 Bacteria 2762
258 Ga0207655_1037546 3300025728 Bacteria 2132
259 Ga0207655_1044996 3300025728 Bacteria 1848
260 Ga0207655_1075595 3300025728 Bacteria 1235
261 Ga0207713_1000369 3300025735 Bacteria 48934
262 Ga0207713_1000634 3300025735 Bacteria 34196
263 Ga0207713_1001110 3300025735 Bacteria 22998
264 Ga0207713_1005223 3300025735 Bacteria 8190
265 Ga0207713_1007056 3300025735 Bacteria 6728
266 Ga0207713_1054312 3300025735 Bacteria 1571
267 Ga0207713_1058575 3300025735 Bacteria 1483
268 Ga0207710_10075327 3300025900 Bacteria 1555
269 Ga0207647_10040798 3300025904 Bacteria 2921
270 Ga0207643_10041813 3300025908 Bacteria 2584
271 Ga0207695_10277586 3300025913 Bacteria 1570
272 Ga0207671_10000964 3300025914 Bacteria 35697
273 Ga0207649_10000146 3300025920 Bacteria 57984
274 Ga0207681_10047560 3300025923 Bacteria 2891
275 Ga0207681_10055629 3300025923 Bacteria 2696
276 Ga0207681_10164426 3300025923 Bacteria 1676
277 Ga0207694_10084412 3300025924 Bacteria 2498
278 Ga0207650_10000865 3300025925 Bacteria 22953
279 Ga0207687_10029261 3300025927 Bacteria 3705
280 Ga0207644_10028782 3300025931 Bacteria 3850
281 Ga0207706_10009548 3300025933 Bacteria 8909
282 Ga0207686_10020116 3300025934 Bacteria 3808
283 Ga0207709_10000004 3300025935 Bacteria 825156
284 Ga0207709_10000858 3300025935 Bacteria 23259
285 Ga0207709_10001664 3300025935 Bacteria 14986
286 Ga0207665_10083484 3300025939 Bacteria 2203
287 Ga0207691_10449838 3300025940 Bacteria 1096
288 Ga0207711_10349351 3300025941 Bacteria 1369
289 Ga0207689_10050466 3300025942 Bacteria 3430
290 Ga0207679_10000097 3300025945 Bacteria 75900
291 Ga0207668_10002267 3300025972 Bacteria 11223
292 Ga0207640_10554256 3300025981 Bacteria 966
293 Ga0207641_10000120 3300026088 Bacteria 116070
294 Ga0207641_10025533 3300026088 Bacteria 4873
295 Ga0207648_10000040 3300026089 Bacteria 116539
296 Ga0207676_10000091 3300026095 Bacteria 82019
297 Ga0207674_10059129 3300026116 Bacteria 3880
298 Ga0207683_10243589 3300026121 Bacteria 1640
299 Ga0209281_1000011 3300027111 Bacteria 695292
300 Ga0209281_1000055 3300027111 Bacteria 308297
301 Ga0209281_1001921 3300027111 Bacteria 9816
302 Ga0209281_1003929 3300027111 Bacteria 4627
303 Ga0207428_10006877 3300027907 Bacteria 10424
304 Ga0207428_10052943 3300027907 Bacteria 3239
305 Ga0207428_10076459 3300027907 Bacteria 2622
306 Ga0207428_10112400 3300027907 Bacteria 2095
307 Ga0207428_10278645 3300027907 Bacteria 1242
308 Ga0268266_10412387 3300028379 Bacteria 1279
309 Ga0268266_10481636 3300028379 Bacteria 1183
310 Ga0268265_10013736 3300028380 Bacteria 5510
311 Ga0265319_1000177 3300028563 Bacteria 48363
312 Ga0265318_10000258 3300028577 Bacteria 46107
313 Ga0265336_10000013 3300028666 Bacteria 252156
314 Ga0307517_10190564 3300028786 Bacteria 1303
315 Ga0307515_10128455 3300028794 Bacteria 2810
316 Ga0265324_10000536 3300029957 Bacteria 26052
317 Ga0265324_10112891 3300029957 Bacteria 923
318 Ga0307512_10030456 3300030522 Bacteria 4694
319 Ga0316178_1159482 3300030735 Bacteria 22902
320 Ga0265330_10000359 3300031235 Bacteria 32172
321 Ga0265332_10000138 3300031238 Bacteria 60108
322 Ga0265328_10002580 3300031239 Bacteria 8115
323 Ga0265328_10056884 3300031239 Bacteria 1435
324 Ga0265320_10002735 3300031240 Bacteria 12195
325 Ga0265325_10004955 3300031241 Bacteria 8299
326 Ga0265325_10048260 3300031241 Bacteria 2201
327 Ga0265329_10000076 3300031242 Bacteria 44517
328 Ga0265340_10000688 3300031247 Bacteria 18993
329 Ga0265339_10005622 3300031249 Bacteria 8319
330 Ga0265331_10001134 3300031250 Bacteria 20335
331 Ga0265331_10067422 3300031250 Bacteria 1679
332 Ga0265327_10000681 3300031251 Bacteria 54587
333 Ga0265327_10154522 3300031251 Bacteria 1064
334 Ga0265316_10000843 3300031344 Bacteria 33894
335 Ga0307509_10003432 3300031507 Bacteria 24057
336 Ga0307408_100008176 3300031548 Bacteria 6910
337 Ga0307408_100289878 3300031548 Bacteria 1366
338 Ga0265313_10000089 3300031595 Bacteria 90452
339 Ga0307514_10001667 3300031649 Bacteria 25806
340 Ga0307514_10139272 3300031649 Bacteria 1653
341 Ga0265314_10000211 3300031711 Bacteria 86370
342 Ga0265342_10000390 3300031712 Bacteria 48465
343 Ga0316576_10053093 3300031727 Bacteria 2953
344 Ga0316576_10062189 3300031727 Bacteria 2737
345 Ga0307412_10003248 3300031911 Bacteria 9036
346 Ga0307412_10030227 3300031911 Bacteria 3408
347 Ga0307409_100142661 3300031995 Bacteria 2066
348 Ga0307416_100147453 3300032002 Bacteria 2151
349 Ga0307416_100263493 3300032002 Bacteria 1686
350 Ga0307414_10415776 3300032004 Bacteria 1171
351 Ga0307411_10013877 3300032005 Bacteria 4463
352 Ga0316583_10002676 3300032133 Bacteria 6228
353 Ga0307510_10008022 3300033180 Bacteria 12565
354 Ga0307510_10031972 3300033180 Bacteria 5935
355 Ga0373931_0135990 3300035691 Bacteria 1419
356 Ga0373937_0042280 3300036401 Bacteria 4157
357 Ga0316584_0255742 3300036712 Bacteria 1278
358 Ga0395905_0029368 3300037471 Bacteria 5180
359 Ga0395905_0074385 3300037471 Bacteria 3183
360 Ga0439438_001790 3300041405 Bacteria 9430
361 Ga0439438_002060 3300041405 Bacteria 8729
362 Ga0439438_002339 3300041405 Bacteria 8082
363 Ga0439438_002391 3300041405 Bacteria 7994
364 Ga0439439_0058117 3300041406 Bacteria 1023
365 Ga0439447_000130 3300041407 Bacteria 25753
366 Ga0439447_001809 3300041407 Bacteria 7835
367 Ga0439447_002141 3300041407 Bacteria 7239
368 Ga0439447_002328 3300041407 Bacteria 6945
369 Ga0439447_003975 3300041407 Bacteria 5174
370 Ga0439447_027876 3300041407 Bacteria 1439
371 Ga0439466_0000227 3300041411 Bacteria 22275
372 Ga0439466_0000530 3300041411 Bacteria 14407
373 Ga0439466_0001072 3300041411 Bacteria 10565
374 Ga0439466_0001383 3300041411 Bacteria 9450
375 Ga0439466_0002138 3300041411 Bacteria 7748
376 Ga0439466_0020568 3300041411 Bacteria 2350
377 Ga0439466_0027583 3300041411 Bacteria 1966
378 Ga0439466_0106545 3300041411 Bacteria 871
379 Ga0439432_000016 3300042006 Bacteria 63199
380 Ga0439432_000485 3300042006 Bacteria 14844
381 Ga0439432_002780 3300042006 Bacteria 6524
382 Ga0439432_006718 3300042006 Bacteria 4097
383 Ga0439432_025172 3300042006 Bacteria 1954
384 Ga0439449_0012448 3300042007 Bacteria 3198
385 Ga0439451_000475 3300042009 Bacteria 7813
386 Ga0439451_001556 3300042009 Bacteria 4534
387 Ga0439451_004521 3300042009 Bacteria 2828
388 Ga0439451_010667 3300042009 Bacteria 1851
389 Ga0439452_000123 3300042010 Bacteria 59209
390 Ga0439452_007770 3300042010 Bacteria 3263
391 Ga0439452_009774 3300042010 Bacteria 2816
392 Ga0439452_011180 3300042010 Bacteria 2587
393 Ga0439456_003216 3300042013 Bacteria 3302
394 Ga0439456_006054 3300042013 Bacteria 2462
395 Ga0439456_009637 3300042013 Bacteria 1995
396 Ga0439462_0004775 3300042015 Bacteria 3322
397 Ga0439463_006609 3300042016 Bacteria 2870
398 Ga0439463_050169 3300042016 Bacteria 1064
399 Ga0450911_000510 3300042115 Bacteria 12299
400 Ga0450911_002200 3300042115 Bacteria 3941
401 Ga0450911_006530 3300042115 Bacteria 1734
402 Ga0450922_001389 3300042124 Bacteria 2383
403 Ga0450903_002021 3300042138 Bacteria 3656
404 Ga0450903_017824 3300042138 Bacteria 1108
405 Ga0450906_002391 3300042145 Bacteria 4109
406 Ga0450907_000175 3300042146 Bacteria 23553
407 Ga0450907_000547 3300042146 Bacteria 10232
408 Ga0450910_000379 3300042147 Bacteria 5204
409 Ga0439446_0007494 3300042156 Bacteria 2870
410 Ga0439446_0015668 3300042156 Bacteria 2104
411 Ga0450908_000208 3300042184 Bacteria 11906
412 Ga0450909_000113 3300042185 Bacteria 8076
413 Ga0439460_0006502 3300042461 Bacteria 2903
414 Ga0439460_0063627 3300042461 Bacteria 1130
415 Ga0450918_009443 3300042531 Bacteria 1710
416 Ga0450901_000164 3300042533 Bacteria 7602
417 Ga0451577_0014108 3300042876 Bacteria 7453
418 Ga0451577_0015785 3300042876 Bacteria 7009
419 Ga0451577_0036966 3300042876 Bacteria 4396
420 Ga0451577_0038116 3300042876 Bacteria 4324
421 Ga0451577_0092220 3300042876 Unclassified 2704
422 Ga0439440_0001431 3300042993 Bacteria 4329
423 Ga0439440_0005906 3300042993 Bacteria 2445
424 Ga0466972_0010636 3300044658 Bacteria 4616
425 Ga0453683_0007327 3300044673 Bacteria 7500
426 Ga0453684_0000471 3300044712 Bacteria 159987
427 Ga0453684_0010999 3300044712 Bacteria 15294
428 Ga0453684_0011162 3300044712 Bacteria 15134
429 Ga0453684_0084631 3300044712 Bacteria 3943
430 Ga0453684_0121702 3300044712 Bacteria 3149
431 Ga0453684_0124832 3300044712 Bacteria 3100
432 Ga0451576_0000099 3300045051 Bacteria 220245
433 Ga0451576_0000320 3300045051 Bacteria 116612
434 Ga0451576_0001981 3300045051 Bacteria 32534
435 Ga0451576_0027118 3300045051 Bacteria 6156
436 Ga0451576_0039260 3300045051 Bacteria 5010
437 Ga0451576_0045983 3300045051 Bacteria 4596
438 Ga0451576_0124573 3300045051 Bacteria 2685
439 Ga0451576_0701431 3300045051 Bacteria 1063
440 Ga0495617_000074 3300046452 Bacteria 80489
441 Ga0495617_000231 3300046452 Bacteria 33929
442 Ga0495617_000317 3300046452 Bacteria 27128
443 Ga0495617_009615 3300046452 Bacteria 3317
444 Ga0495617_011812 3300046452 Bacteria 2978
445 Ga0495617_022513 3300046452 Bacteria 2130
446 Ga0495627_000369 3300046453 Bacteria 41831
447 Ga0495627_000894 3300046453 Bacteria 20947
448 Ga0495627_001104 3300046453 Bacteria 17592
449 Ga0495627_003083 3300046453 Bacteria 7573
450 Ga0495592_0000203 3300046454 Bacteria 50733
451 Ga0495603_0003212 3300046455 Bacteria 9729
452 Ga0495603_0020824 3300046455 Bacteria 3970
453 Ga0495590_0000178 3300046457 Bacteria 37358
454 Ga0495590_0000821 3300046457 Bacteria 14103
455 Ga0495590_0000839 3300046457 Bacteria 13872
456 Ga0495590_0021825 3300046457 Bacteria 2267
457 Ga0495590_0033343 3300046457 Bacteria 1800
458 Ga0495591_000086 3300046458 Bacteria 104667
459 Ga0495591_000177 3300046458 Bacteria 65867
460 Ga0495591_000949 3300046458 Bacteria 19807
461 Ga0495591_001101 3300046458 Bacteria 17988
462 Ga0495591_006794 3300046458 Bacteria 4981
463 Ga0495591_030944 3300046458 Bacteria 1610
464 Ga0495629_0000819 3300046459 Bacteria 25210
465 Ga0495629_0003181 3300046459 Bacteria 12431
466 Ga0495638_0001745 3300046460 Bacteria 19048
467 Ga0495638_0007263 3300046460 Bacteria 7965
468 Ga0495638_0021556 3300046460 Bacteria 4243
469 Ga0495638_0025561 3300046460 Bacteria 3835
470 Ga0495638_0033363 3300046460 Bacteria 3293
471 Ga0495638_0038025 3300046460 Bacteria 3061
472 Ga0495638_0057135 3300046460 Bacteria 2421
473 Ga0495638_0074178 3300046460 Bacteria 2075
474 Ga0495638_0097443 3300046460 Bacteria 1763
475 Ga0495638_0328016 3300046460 Bacteria 815
476 Ga0495653_0000427 3300046463 Bacteria 33277
477 Ga0495653_0001253 3300046463 Bacteria 19659
478 Ga0495653_0054643 3300046463 Bacteria 3050
479 Ga0495653_0054793 3300046463 Bacteria 3045
480 Ga0495650_0000294 3300046471 Bacteria 91542
481 Ga0495650_0000522 3300046471 Bacteria 56293
482 Ga0495650_0003349 3300046471 Bacteria 11775
483 Ga0495650_0005875 3300046471 Bacteria 7807
484 Ga0495650_0008823 3300046471 Bacteria 5825
485 Ga0495650_0008974 3300046471 Bacteria 5749
486 Ga0495650_0009991 3300046471 Bacteria 5341
487 Ga0495650_0076093 3300046471 Bacteria 1305
488 Ga0495580_0038238 3300046472 Bacteria 3438
489 Ga0495582_0028869 3300046473 Bacteria 3045
490 Ga0495605_0000189 3300046474 Bacteria 76904
491 Ga0495605_0000585 3300046474 Bacteria 29313
492 Ga0495605_0004347 3300046474 Bacteria 8332
493 Ga0495605_0006681 3300046474 Bacteria 6604
494 Ga0495605_0006695 3300046474 Bacteria 6595
495 Ga0495605_0032805 3300046474 Bacteria 2641
496 Ga0495605_0061185 3300046474 Bacteria 1802
497 Ga0495639_0000002 3300046475 Bacteria 192403
498 Ga0495639_0036924 3300046475 Bacteria 2189
499 Ga0495662_0023017 3300046476 Bacteria 3008
500 Ga0495664_0035404 3300046477 Bacteria 2939
501 Ga0495664_0130985 3300046477 Bacteria 1518
502 Ga0495584_0000019 3300046491 Bacteria 140608
503 Ga0495584_0000084 3300046491 Bacteria 65138
504 Ga0495584_0000094 3300046491 Bacteria 60342
505 Ga0495584_0002625 3300046491 Bacteria 10138
506 Ga0495584_0007539 3300046491 Bacteria 5670
507 Ga0495584_0008888 3300046491 Bacteria 5193
508 Ga0495584_0009580 3300046491 Bacteria 4989
509 Ga0495584_0015470 3300046491 Bacteria 3887
510 Ga0495584_0032547 3300046491 Bacteria 2639
511 Ga0495584_0057247 3300046491 Bacteria 1961
512 Ga0495584_0081367 3300046491 Bacteria 1630
513 Ga0495584_0214834 3300046491 Bacteria 977
514 Ga0495585_0000101 3300046492 Bacteria 91556
515 Ga0495585_0001655 3300046492 Bacteria 17039
516 Ga0495585_0002281 3300046492 Bacteria 13851
517 Ga0495585_0002474 3300046492 Bacteria 13192
518 Ga0495585_0004048 3300046492 Bacteria 9647
519 Ga0495585_0007440 3300046492 Bacteria 6704
520 Ga0495585_0008195 3300046492 Bacteria 6346
521 Ga0495585_0028489 3300046492 Bacteria 3185
522 Ga0495585_0035691 3300046492 Bacteria 2808
523 Ga0495585_0075756 3300046492 Bacteria 1828
524 Ga0495594_0188058 3300046499 Bacteria 1176
525 Ga0495596_0000027 3300046500 Bacteria 104155
526 Ga0495596_0009591 3300046500 Bacteria 4253
527 Ga0495596_0033339 3300046500 Bacteria 2049
528 Ga0495607_0000092 3300046501 Bacteria 93857
529 Ga0495607_0001404 3300046501 Bacteria 21432
530 Ga0495607_0002010 3300046501 Bacteria 17065
531 Ga0495607_0002682 3300046501 Bacteria 14220
532 Ga0495607_0005469 3300046501 Bacteria 9087
533 Ga0495607_0005513 3300046501 Bacteria 9036
534 Ga0495607_0007372 3300046501 Bacteria 7615
535 Ga0495607_0018207 3300046501 Bacteria 4483
536 Ga0495607_0030875 3300046501 Bacteria 3284
537 Ga0495607_0257608 3300046501 Bacteria 837
538 Ga0495583_0000445 3300046506 Bacteria 61949
539 Ga0495583_0001410 3300046506 Bacteria 24498
540 Ga0495583_0001452 3300046506 Bacteria 23971
541 Ga0495583_0002185 3300046506 Bacteria 17422
542 Ga0495606_0000625 3300046507 Bacteria 55768
543 Ga0495606_0001005 3300046507 Bacteria 41122
544 Ga0495606_0001535 3300046507 Bacteria 30529
545 Ga0495606_0001830 3300046507 Bacteria 26928
546 Ga0495606_0008703 3300046507 Bacteria 8740
547 Ga0495606_0023245 3300046507 Bacteria 4497
548 Ga0495606_0029221 3300046507 Bacteria 3875
549 Ga0495606_0059497 3300046507 Bacteria 2450
550 Ga0495610_0000722 3300046512 Bacteria 31430
551 Ga0495610_0001435 3300046512 Bacteria 21058
552 Ga0495610_0001943 3300046512 Bacteria 17781
553 Ga0495610_0003870 3300046512 Bacteria 11372
554 Ga0495610_0004236 3300046512 Bacteria 10685
555 Ga0495610_0004286 3300046512 Bacteria 10609
556 Ga0495610_0004894 3300046512 Bacteria 9732
557 Ga0495610_0007190 3300046512 Bacteria 7486
558 Ga0495610_0011004 3300046512 Bacteria 5566
559 Ga0495610_0023294 3300046512 Bacteria 3370
560 Ga0495610_0023373 3300046512 Bacteria 3363
561 Ga0495610_0025696 3300046512 Bacteria 3155
562 Ga0495610_0088789 3300046512 Bacteria 1404
563 Ga0495616_0000079 3300046513 Bacteria 81296
564 Ga0495616_0000249 3300046513 Bacteria 43451
565 Ga0495616_0001332 3300046513 Bacteria 17256
566 Ga0495616_0002103 3300046513 Bacteria 13366
567 Ga0495616_0008289 3300046513 Bacteria 6168
568 Ga0495616_0034797 3300046513 Bacteria 2612
569 Ga0495616_0046726 3300046513 Bacteria 2183
570 Ga0495616_0125259 3300046513 Bacteria 1182
571 Ga0495620_0000106 3300046515 Bacteria 66942
572 Ga0495620_0002056 3300046515 Bacteria 11719
573 Ga0495620_0004913 3300046515 Bacteria 7498
574 Ga0495620_0005977 3300046515 Bacteria 6742
575 Ga0495620_0031462 3300046515 Bacteria 2431
576 Ga0495628_0002997 3300046516 Bacteria 15135
577 Ga0495630_0032152 3300046517 Bacteria 3908
578 Ga0495631_0000072 3300046518 Bacteria 64445
579 Ga0495631_0000824 3300046518 Bacteria 19819
580 Ga0495631_0111770 3300046518 Bacteria 1174
581 Ga0495631_0114888 3300046518 Bacteria 1157
582 Ga0495632_0000200 3300046519 Bacteria 60951
583 Ga0495632_0000204 3300046519 Bacteria 60521
584 Ga0495632_0000243 3300046519 Bacteria 53988
585 Ga0495632_0001300 3300046519 Bacteria 21132
586 Ga0495632_0002506 3300046519 Bacteria 13919
587 Ga0495632_0003289 3300046519 Bacteria 11543
588 Ga0495632_0015268 3300046519 Bacteria 4315
589 Ga0495632_0020383 3300046519 Bacteria 3590
590 Ga0495632_0026646 3300046519 Bacteria 3039
591 Ga0495632_0036592 3300046519 Bacteria 2496
592 Ga0495632_0068762 3300046519 Bacteria 1705
593 Ga0495637_0000256 3300046520 Bacteria 41886
594 Ga0495637_0000545 3300046520 Bacteria 27051
595 Ga0495637_0000847 3300046520 Bacteria 20183
596 Ga0495637_0001339 3300046520 Bacteria 14775
597 Ga0495637_0002416 3300046520 Bacteria 10336
598 Ga0495637_0002592 3300046520 Bacteria 9925
599 Ga0495637_0009604 3300046520 Bacteria 4716
600 Ga0495637_0023096 3300046520 Bacteria 2830
601 Ga0495637_0054432 3300046520 Bacteria 1662
602 Ga0495637_0057761 3300046520 Bacteria 1601
603 Ga0495637_0081881 3300046520 Bacteria 1285
604 Ga0495643_0002227 3300046522 Bacteria 15757
605 Ga0495643_0002647 3300046522 Bacteria 13892
606 Ga0495643_0002651 3300046522 Bacteria 13868
607 Ga0495643_0004175 3300046522 Bacteria 10254
608 Ga0495643_0021611 3300046522 Bacteria 3688
609 Ga0495643_0031498 3300046522 Bacteria 2950
610 Ga0495643_0065328 3300046522 Bacteria 1921
611 Ga0495644_0000022 3300046523 Bacteria 79714
612 Ga0495644_0000098 3300046523 Bacteria 42137
613 Ga0495644_0000932 3300046523 Bacteria 12152
614 Ga0495644_0088910 3300046523 Bacteria 1165
615 Ga0495648_0000396 3300046524 Bacteria 47811
616 Ga0495648_0000461 3300046524 Bacteria 44058
617 Ga0495648_0006863 3300046524 Bacteria 9194
618 Ga0495648_0009619 3300046524 Bacteria 7458
619 Ga0495648_0024609 3300046524 Bacteria 4094
620 Ga0495648_0047974 3300046524 Bacteria 2633
621 Ga0495648_0053370 3300046524 Bacteria 2449
622 Ga0495648_0104773 3300046524 Bacteria 1552
623 Ga0495648_0133070 3300046524 Bacteria 1319
624 Ga0495648_0194371 3300046524 Bacteria 1021
625 Ga0495666_0000015 3300046526 Bacteria 76311
626 Ga0495666_0018898 3300046526 Bacteria 3423
627 Ga0495666_0052621 3300046526 Bacteria 1955
628 Ga0495666_0107110 3300046526 Bacteria 1314
629 Ga0495642_0000043 3300046528 Bacteria 74977
630 Ga0495642_0000119 3300046528 Bacteria 45337
631 Ga0495642_0000575 3300046528 Bacteria 18424
632 Ga0495642_0002942 3300046528 Bacteria 6788
633 Ga0495642_0038533 3300046528 Bacteria 1937
634 Ga0495652_0002621 3300046529 Bacteria 18366
635 Ga0495654_0000239 3300046530 Bacteria 51583
636 Ga0495654_0000382 3300046530 Bacteria 38175
637 Ga0495654_0000560 3300046530 Bacteria 30039
638 Ga0495654_0000781 3300046530 Bacteria 24557
639 Ga0495654_0002354 3300046530 Bacteria 12214
640 Ga0495654_0008334 3300046530 Bacteria 5730
641 Ga0495654_0009503 3300046530 Bacteria 5330
642 Ga0495654_0010621 3300046530 Bacteria 5003
643 Ga0495654_0021065 3300046530 Bacteria 3394
644 Ga0495654_0021345 3300046530 Bacteria 3369
645 Ga0495654_0022158 3300046530 Bacteria 3302
646 Ga0495665_0000011 3300046531 Bacteria 71017
647 Ga0495665_0016754 3300046531 Bacteria 3945
648 Ga0495586_0011759 3300046535 Bacteria 4654
649 Ga0495586_0263805 3300046535 Bacteria 984
650 Ga0495587_0001836 3300046536 Bacteria 14161
651 Ga0495587_0048545 3300046536 Bacteria 2513
652 Ga0495609_0000160 3300046538 Bacteria 69846
653 Ga0495609_0002853 3300046538 Bacteria 10335
654 Ga0495609_0003497 3300046538 Bacteria 8978
655 Ga0495609_0005248 3300046538 Bacteria 6882
656 Ga0495609_0097130 3300046538 Bacteria 1278
657 Ga0495597_0000776 3300046542 Bacteria 25284
658 Ga0495597_0001758 3300046542 Bacteria 14894
659 Ga0495597_0016121 3300046542 Bacteria 3532
660 Ga0495597_0042031 3300046542 Bacteria 2039
661 Ga0495597_0076094 3300046542 Bacteria 1439
662 Ga0495645_0006438 3300046543 Bacteria 8147
663 Ga0495645_0071074 3300046543 Bacteria 2510
664 Ga0495622_0000378 3300046557 Bacteria 30622
665 Ga0495622_0000411 3300046557 Bacteria 28575
666 Ga0495622_0003600 3300046557 Bacteria 7274
667 Ga0495622_0010921 3300046557 Bacteria 4189
668 Ga0495622_0051318 3300046557 Bacteria 1913
669 Ga0495633_0004863 3300046558 Bacteria 8401
670 Ga0495633_0015278 3300046558 Bacteria 3986
671 Ga0495667_0014469 3300046559 Bacteria 5331
672 Ga0495656_0051121 3300046615 Bacteria 1767
673 Ga0495668_0000281 3300046616 Bacteria 70290
674 Ga0495668_0001550 3300046616 Bacteria 21791
675 Ga0495668_0015324 3300046616 Bacteria 4480
676 Ga0495668_0025087 3300046616 Bacteria 3389
677 Ga0495634_0000218 3300046642 Bacteria 53752
678 Ga0495611_0000048 3300046648 Bacteria 85172
679 Ga0495611_0004661 3300046648 Bacteria 5888
680 Ga0495611_0024482 3300046648 Bacteria 2626
681 Ga0495625_0000790 3300046660 Bacteria 43942
682 Ga0495625_0003012 3300046660 Bacteria 17365
683 Ga0495625_0003190 3300046660 Bacteria 16661
684 Ga0495625_0004247 3300046660 Bacteria 13644
685 Ga0495625_0012811 3300046660 Bacteria 6780
686 Ga0495625_0014191 3300046660 Bacteria 6371
687 Ga0495625_0015309 3300046660 Bacteria 6078
688 Ga0495625_0020970 3300046660 Bacteria 5037
689 Ga0495625_0110067 3300046660 Bacteria 1883
690 Ga0495625_0276637 3300046660 Bacteria 1081
691 Ga0495635_0001815 3300046663 Bacteria 14425
692 Ga0495635_0005778 3300046663 Bacteria 8625
693 Ga0495635_0016161 3300046663 Bacteria 5210
694 Ga0495659_0000035 3300046664 Bacteria 64001
695 Ga0495659_0001278 3300046664 Bacteria 8655
696 Ga0495659_0003768 3300046664 Bacteria 4817
697 Ga0495661_0000011 3300046665 Bacteria 277997
698 Ga0495661_0001173 3300046665 Bacteria 22811
699 Ga0495661_0002752 3300046665 Bacteria 13365
700 Ga0495661_0004925 3300046665 Bacteria 9554
701 Ga0495661_0007307 3300046665 Bacteria 7700
702 Ga0495661_0010217 3300046665 Bacteria 6413
703 Ga0495661_0043912 3300046665 Bacteria 2744
704 Ga0495661_0061949 3300046665 Bacteria 2218
705 Ga0495661_0097042 3300046665 Bacteria 1665
706 Ga0495588_0000433 3300046674 Bacteria 21750
707 Ga0495623_0003360 3300046679 Bacteria 10579
708 Ga0495623_0006494 3300046679 Bacteria 7611
709 Ga0495646_0000777 3300046680 Bacteria 17813
710 Ga0495646_0001145 3300046680 Bacteria 15478
711 Ga0495646_0006387 3300046680 Bacteria 7475
712 Ga0495646_0007303 3300046680 Bacteria 7019
713 Ga0495646_0017436 3300046680 Bacteria 4555
714 Ga0495658_0043765 3300046683 Bacteria 2506
715 Ga0495669_0001494 3300046684 Bacteria 9642
716 Ga0495669_0010225 3300046684 Bacteria 3963
717 Ga0495669_0090569 3300046684 Bacteria 1411
718 Ga0495624_0000133 3300046690 Bacteria 52717
719 Ga0495624_0001440 3300046690 Bacteria 18484
720 Ga0495670_0000169 3300046691 Bacteria 28831
721 Ga0495670_0000280 3300046691 Bacteria 24045
722 Ga0495670_0023001 3300046691 Bacteria 3076
723 Ga0495670_0110925 3300046691 Bacteria 1419
724 Ga0495670_0127301 3300046691 Bacteria 1326
725 Ga0495671_0000136 3300046692 Bacteria 65148
726 Ga0495671_0001038 3300046692 Bacteria 19312
727 Ga0495671_0001847 3300046692 Bacteria 13620
728 Ga0495671_0005112 3300046692 Bacteria 7720
729 Ga0495671_0015228 3300046692 Bacteria 4127
730 Ga0495671_0025531 3300046692 Bacteria 3070
731 Ga0495671_0044501 3300046692 Bacteria 2226
732 Ga0495671_0080112 3300046692 Bacteria 1600
733 Ga0495671_0102923 3300046692 Bacteria 1395
734 Ga0495671_0116602 3300046692 Bacteria 1303
735 Ga0495649_0000083 3300046694 Bacteria 81883
736 Ga0495649_0000316 3300046694 Bacteria 42011
737 Ga0495649_0000430 3300046694 Bacteria 36287
738 Ga0495649_0000495 3300046694 Bacteria 33735
739 Ga0495649_0001099 3300046694 Bacteria 21118
740 Ga0495649_0008492 3300046694 Bacteria 6172
741 Ga0495649_0012954 3300046694 Bacteria 4827
742 Ga0495649_0013424 3300046694 Bacteria 4725
743 Ga0495649_0020775 3300046694 Bacteria 3679
744 Ga0495649_0023261 3300046694 Bacteria 3463
745 Ga0495649_0023527 3300046694 Bacteria 3441
746 Ga0495649_0042659 3300046694 Bacteria 2477
747 Ga0495589_0002311 3300046794 Bacteria 10710
748 Ga0495589_0004383 3300046794 Bacteria 7517
749 Ga0495589_0006414 3300046794 Bacteria 6211
750 Ga0495589_0011742 3300046794 Bacteria 4544
751 Ga0495589_0019791 3300046794 Bacteria 3444
752 Ga0495600_0007213 3300046809 Bacteria 6786
753 Ga0495600_0025616 3300046809 Bacteria 3801
754 Ga0495660_0000487 3300046810 Bacteria 33011
755 Ga0495660_0001546 3300046810 Bacteria 15491
756 Ga0495660_0003102 3300046810 Bacteria 10360
757 Ga0495660_0007904 3300046810 Bacteria 6244
758 Ga0495660_0009323 3300046810 Bacteria 5724
759 Ga0495660_0029073 3300046810 Bacteria 3120
760 Ga0495660_0046984 3300046810 Bacteria 2365
761 Ga0495660_0060109 3300046810 Bacteria 2042
762 Ga0495660_0157927 3300046810 Bacteria 1114
763 Ga0495581_0009537 3300047315 Bacteria 5616
764 Ga0495604_0001695 3300047317 Bacteria 18122
765 Ga0495604_0006676 3300047317 Bacteria 9145
766 Ga0495604_0026862 3300047317 Bacteria 4581
767 Ga0495636_0005171 3300047318 Bacteria 5118
768 Ga0495674_0012957 3300047319 Bacteria 7849
769 Ga0495674_0037134 3300047319 Bacteria 4378
770 Ga0495674_0104487 3300047319 Bacteria 2408
771 Ga0495672_0001626 3300047320 Bacteria 21880
772 Ga0495672_0001695 3300047320 Bacteria 21354
773 Ga0495672_0002779 3300047320 Bacteria 15644
774 Ga0495672_0006170 3300047320 Bacteria 9347
775 Ga0495672_0006897 3300047320 Bacteria 8659
776 Ga0495672_0007362 3300047320 Bacteria 8290
777 Ga0495672_0009071 3300047320 Bacteria 7253
778 Ga0495672_0011128 3300047320 Bacteria 6364
779 Ga0495672_0011198 3300047320 Bacteria 6339
780 Ga0495672_0060206 3300047320 Bacteria 2194
781 Ga0495672_0154326 3300047320 Bacteria 1187
782 Ga0495676_0000178 3300047321 Bacteria 50077
783 Ga0495676_0002539 3300047321 Bacteria 16239
784 Ga0495680_0000939 3300047322 Bacteria 32333
785 Ga0495680_0002463 3300047322 Bacteria 18949
786 Ga0495680_0003676 3300047322 Bacteria 14983
787 Ga0495680_0011267 3300047322 Bacteria 7927
788 Ga0495680_0018941 3300047322 Bacteria 5829
789 Ga0495680_0066668 3300047322 Bacteria 2754
790 Ga0495680_0226498 3300047322 Bacteria 1332
791 Ga0495680_0239683 3300047322 Bacteria 1288
792 Ga0495683_0001324 3300047323 Bacteria 16613
793 Ga0495683_0001705 3300047323 Bacteria 13955
794 Ga0495683_0004324 3300047323 Bacteria 8094
795 Ga0495683_0006186 3300047323 Bacteria 6556
796 Ga0495683_0067648 3300047323 Bacteria 1758
797 Ga0495683_0068104 3300047323 Bacteria 1751
798 Ga0495687_001541 3300047443 Bacteria 20940
799 Ga0495687_002798 3300047443 Bacteria 13462
800 Ga0495687_008086 3300047443 Bacteria 6077
801 Ga0495687_011380 3300047443 Bacteria 4791
802 Ga0495687_054899 3300047443 Bacteria 1669
803 Ga0495675_0001899 3300047444 Bacteria 12444
804 Ga0495677_0000425 3300047445 Bacteria 18123
805 Ga0495679_000224 3300047446 Bacteria 47851
806 Ga0495679_000550 3300047446 Bacteria 26414
807 Ga0495679_000801 3300047446 Bacteria 19954
808 Ga0495679_001151 3300047446 Bacteria 15824
809 Ga0495679_004735 3300047446 Bacteria 6178
810 Ga0495679_010182 3300047446 Bacteria 3710
811 Ga0495679_043309 3300047446 Bacteria 1384
812 Ga0495685_004329 3300047447 Bacteria 4579
813 Ga0495673_0000276 3300047469 Bacteria 69967
814 Ga0495673_0000479 3300047469 Bacteria 42800
815 Ga0495673_0000945 3300047469 Bacteria 26309
816 Ga0495673_0001202 3300047469 Bacteria 21580
817 Ga0495673_0001803 3300047469 Bacteria 16220
818 Ga0495673_0002783 3300047469 Bacteria 11963
819 Ga0495673_0004029 3300047469 Bacteria 9367
820 Ga0495673_0013477 3300047469 Bacteria 4289
821 Ga0495673_0037014 3300047469 Bacteria 2232
822 Ga0495673_0041120 3300047469 Bacteria 2084
823 Ga0495681_0000031 3300047470 Bacteria 128177
824 Ga0495681_0000377 3300047470 Bacteria 34813
825 Ga0495681_0001017 3300047470 Bacteria 21462
826 Ga0495681_0002674 3300047470 Bacteria 12624
827 Ga0495681_0003336 3300047470 Bacteria 11169
828 Ga0495681_0003348 3300047470 Bacteria 11152
829 Ga0495681_0004763 3300047470 Bacteria 9192
830 Ga0495681_0007992 3300047470 Bacteria 6681
831 Ga0495686_0002283 3300047472 Bacteria 18416
832 Ga0495686_0002866 3300047472 Bacteria 15527
833 Ga0495686_0015258 3300047472 Bacteria 5253
834 Ga0495686_0108371 3300047472 Bacteria 1669
835 Ga0495593_0000147 3300047673 Bacteria 34669
836 Ga0495593_0000378 3300047673 Bacteria 24648
837 Ga0495593_0007762 3300047673 Bacteria 6253
838 Ga0495593_0018168 3300047673 Bacteria 3954
839 Ga0495593_0022104 3300047673 Bacteria 3548
840 Ga0495593_0030627 3300047673 Bacteria 2943
841 Ga0495593_0109893 3300047673 Bacteria 1408
842 Ga0495602_0000644 3300048088 Bacteria 32644
843 Ga0495602_0001483 3300048088 Bacteria 23331
844 Ga0495602_0046370 3300048088 Bacteria 3926
845 Ga0495614_0122550 3300048089 Bacteria 1147
846 Ga0495626_0000077 3300048091 Bacteria 130910
847 Ga0495626_0000247 3300048091 Bacteria 62776
848 Ga0495626_0000277 3300048091 Bacteria 56289
849 Ga0495626_0000310 3300048091 Bacteria 51701
850 Ga0495626_0001215 3300048091 Bacteria 21240
851 Ga0495626_0001915 3300048091 Bacteria 15471
852 Ga0495626_0001995 3300048091 Bacteria 15066
853 Ga0495626_0008193 3300048091 Bacteria 5756
854 Ga0495626_0022754 3300048091 Bacteria 3093
855 Ga0495626_0076674 3300048091 Bacteria 1491
856 Ga0496100_0020050 3300048903 Bacteria 4002
857 Ga0496100_0071617 3300048903 Bacteria 2315
858 Ga0496101_0001181 3300048904 Bacteria 15657
859 Ga0496102_0000475 3300048905 Bacteria 44485
860 Ga0496102_0026173 3300048905 Bacteria 5199
861 Ga0496103_0001728 3300048906 Bacteria 14256
862 Ga0496104_0296771 3300048907 Bacteria 1528
863 Ga0496104_0341152 3300048907 Bacteria 1411
864 Ga0496105_0034177 3300048908 Bacteria 4181
865 Ga0496105_0252899 3300048908 Bacteria 1427
866 Ga0496106_0001408 3300048909 Bacteria 18043
867 Ga0496107_0025407 3300048910 Bacteria 4194
868 Ga0496109_0093301 3300048912 Bacteria 2786
869 Ga0496110_0137563 3300048913 Bacteria 2208
870 Ga0496111_0010280 3300048914 Bacteria 6270
871 Ga0496112_0092939 3300048915 Bacteria 2986
872 Ga0496113_0007984 3300048916 Bacteria 6858
873 Ga0496114_0001072 3300048917 Bacteria 20590
874 Ga0496115_0110338 3300048918 Bacteria 2260
875 Ga0496115_0145875 3300048918 Bacteria 1953
876 Ga0496116_0000010 3300048919 Bacteria 665608
877 Ga0496116_0000435 3300048919 Bacteria 58557
878 Ga0496116_0000951 3300048919 Bacteria 35680
879 Ga0496116_0011667 3300048919 Bacteria 7245
880 Ga0496117_0001606 3300048920 Bacteria 31979
881 Ga0496117_0002171 3300048920 Bacteria 25570
882 Ga0496117_0007543 3300048920 Bacteria 10599
883 Ga0496117_0009807 3300048920 Bacteria 8827
884 Ga0496117_0014140 3300048920 Bacteria 6898
885 Ga0496117_0021855 3300048920 Bacteria 5157
886 Ga0496117_0094932 3300048920 Bacteria 1907
887 Ga0496117_0212396 3300048920 Bacteria 1084
888 Ga0496118_0000434 3300048921 Bacteria 69469
889 Ga0496118_0003714 3300048921 Bacteria 18912
890 Ga0496118_0005118 3300048921 Bacteria 15064
891 Ga0496118_0008349 3300048921 Bacteria 10718
892 Ga0496118_0068622 3300048921 Bacteria 2573
893 Ga0496118_0246785 3300048921 Bacteria 1018
894 Ga0496119_0000011 3300048922 Bacteria 438315
895 Ga0496120_0000306 3300048923 Bacteria 81699
896 Ga0496120_0002732 3300048923 Bacteria 17224
897 Ga0496120_0130691 3300048923 Bacteria 1286
898 Ga0496121_0000050 3300048924 Bacteria 318295
899 Ga0496121_0002613 3300048924 Bacteria 27210
900 Ga0496121_0009486 3300048924 Bacteria 11172
901 Ga0496121_0010556 3300048924 Bacteria 10389
902 Ga0496121_0103391 3300048924 Bacteria 2191
903 Ga0496121_0265268 3300048924 Bacteria 1183
904 Ga0496121_0282268 3300048924 Bacteria 1135
905 Ga0496122_0000544 3300048925 Bacteria 78038
906 Ga0496122_0004185 3300048925 Bacteria 18147
907 Ga0496122_0074126 3300048925 Bacteria 2409
908 Ga0496122_0095048 3300048925 Bacteria 2015
909 Ga0496122_0113780 3300048925 Bacteria 1767
910 Ga0496122_0219687 3300048925 Bacteria 1092
911 Ga0496123_0001978 3300048926 Bacteria 26544
912 Ga0496123_0002628 3300048926 Bacteria 21765
913 Ga0496123_0023766 3300048926 Bacteria 4681
914 Ga0496123_0043282 3300048926 Bacteria 3096
915 Ga0496123_0065743 3300048926 Bacteria 2302
916 Ga0496124_0000086 3300048927 Bacteria 202844
917 Ga0496124_0003120 3300048927 Bacteria 20563
918 Ga0496124_0012738 3300048927 Bacteria 8266
919 Ga0496124_0020438 3300048927 Bacteria 6116
920 Ga0496124_0068122 3300048927 Bacteria 2959
921 Ga0496125_0000665 3300048928 Bacteria 57218
922 Ga0496125_0003087 3300048928 Bacteria 20788
923 Ga0496125_0004650 3300048928 Bacteria 15661
924 Ga0496125_0007718 3300048928 Bacteria 11396
925 Ga0496125_0010687 3300048928 Bacteria 9262
926 Ga0496125_0022274 3300048928 Bacteria 5887
927 Ga0496125_0025595 3300048928 Bacteria 5400
928 Ga0496126_0007071 3300048929 Bacteria 12361
929 Ga0496126_0058421 3300048929 Bacteria 3477
930 Ga0496126_0251349 3300048929 Bacteria 1473
931 Ga0495678_000255 3300049459 Bacteria 59619
932 Ga0495678_001235 3300049459 Bacteria 20849
933 Ga0495678_001291 3300049459 Bacteria 20231
934 Ga0495678_002715 3300049459 Bacteria 11655
935 Ga0495678_016381 3300049459 Bacteria 3391
936 Ga0495678_043814 3300049459 Bacteria 1774
937 Ga0495678_047972 3300049459 Bacteria 1668
938 Ga0495678_059280 3300049459 Bacteria 1443
939 Ga0495682_0000542 3300049460 Bacteria 26108
940 Ga0495682_0000701 3300049460 Bacteria 21947
941 Ga0495682_0005895 3300049460 Bacteria 5028
942 Ga0495682_0090547 3300049460 Bacteria 1098
943 Ga0501032_0044703 3300049569 Bacteria 2997
944 Ga0501034_0091139 3300049571 Bacteria 3046
945 Ga0501034_0392484 3300049571 Bacteria 1312
946 Ga0501257_019127 3300049686 Bacteria 1601
947 Ga0501241_000072 3300049758 Bacteria 23226
948 nmdc:mga03683_182881_c1 3300050489 Bacteria 957
949 nmdc:mga00v17_156239_c1 3300050491 Bacteria 1467
950 nmdc:mga00v17_18917_c1 3300050491 Bacteria 3921
951 nmdc:mga0k408_11123_c1 3300050493 Bacteria 3780
952 nmdc:mga0k408_27900_c1 3300050493 Bacteria 3208
953 nmdc:mga0k408_45834_c1 3300050493 Bacteria 2524
954 nmdc:mga07m45_37398_c1 3300050496 Bacteria 2707
955 nmdc:mga07m45_6970_c1 3300050496 Bacteria 5745
956 nmdc:mga08y16_46313_c1 3300050511 Bacteria 4553
957 Ga0500564_042495 3300053138 Bacteria 2090
958 Ga0500619_008139 3300053154 Bacteria 2528
959 Ga0590071_006398 3300059421 Bacteria 2805
960 Ga0590075_063031 3300059424 Bacteria 956
961 2510312114 2510065058 Bacteria 5005894
962 2511255091 2511231004 Bacteria 6669789
963 2511263529 2511231006 Bacteria 6794709
964 2511270484 2511231007 Bacteria 6306603
965 2511278148 2511231008 Bacteria 6624100
966 2511292363 2511231010 Bacteria 6373152
967 2511296026 2511231011 Bacteria 6149768
968 2511302658 2511231012 Bacteria 6738011
969 2511313313 2511231014 Bacteria 6462302
970 2511320124 2511231015 Bacteria 6598026
971 2511328167 2511231016 Bacteria 6704427
972 2511334163 2511231017 Bacteria 6503007
973 2511339407 2511231018 Bacteria 6436256
974 2511342327 2511231019 Bacteria 6520662
975 2511352421 2511231020 Bacteria 6115223
976 2511365576 2511231022 Bacteria 6719296
977 2511369688 2511231023 Bacteria 6808468
978 2511372818 2511231024 Bacteria 5835885
979 2511412651 2511231031 Bacteria 6558529
980 2511824292 2511231156 Bacteria 6845832
981 2512328806 2512047018 Bacteria 6663241
982 2555670386 2554235341 Bacteria 6867980
983 2583792185 2582580891 Bacteria 6800976
984 2597858517 2597489887 Bacteria 6666321
985 2597864003 2597489888 Bacteria 6179543
986 2599352586 2599185160 Bacteria 6844013
987 2599358930 2599185161 Bacteria 6960462
988 2599365549 2599185162 Bacteria 6957254
989 2599371624 2599185163 Bacteria 6995158
990 2599377694 2599185164 Bacteria 6841688
991 2599384929 2599185165 Bacteria 6843250
992 2599390482 2599185166 Bacteria 6959206
993 2599398396 2599185167 Bacteria 6353609
994 2599402667 2599185168 Bacteria 6997636
995 2599450418 2599185179 Bacteria 6611171
996 2599459420 2599185181 Bacteria 6844519
997 2599466241 2599185182 Bacteria 6883168
998 2599486492 2599185185 Bacteria 6652270
999 2599488441 2599185186 Bacteria 6831633
1000 2599507300 2599185189 Bacteria 5862825
1001 2599512900 2599185190 Bacteria 6285678
1002 2599521748 2599185191 Bacteria 6297582
1003 2599611123 2599185212 Bacteria 6765997
1004 2599803114 2599185257 Bacteria 6492581
1005 2599881261 2599185288 Bacteria 6666191
1006 2599887377 2599185289 Bacteria 6778765
1007 2599891577 2599185290 Bacteria 6289611
1008 2599898458 2599185291 Bacteria 6775623
1009 2599946722 2599185303 Bacteria 6512725
1010 2599958917 2599185305 Bacteria 6748700
1011 2599968971 2599185306 Bacteria 6637356
1012 2599980228 2599185308 Bacteria 6621546
1013 2599994457 2599185311 Bacteria 6354990
1014 2600006089 2599185313 Bacteria 6658188
1015 2600009428 2599185314 Bacteria 6621749
1016 2600017239 2599185315 Bacteria 6771107
1017 2600028301 2599185317 Bacteria 6435722
1018 2600035699 2599185318 Bacteria 6961590
1019 2600044937 2599185319 Bacteria 6637840
1020 2600052062 2599185321 Bacteria 6764560
1021 2600057063 2599185322 Bacteria 6763055
1022 2600065012 2599185323 Bacteria 6688755
1023 2600069720 2599185324 Bacteria 6590677
1024 2600212025 2599185356 Bacteria 6843884
1025 2600357250 2600254930 Bacteria 6431253
1026 2600362645 2600254931 Bacteria 6734225
1027 2601691936 2600255296 Bacteria 5784754
1028 2601772193 2600255313 Bacteria 6842543
1029 2601798886 2600255318 Bacteria 6383414
1030 2606077781 2603880185 Bacteria 6379190
1031 2606130044 2603880199 Bacteria 6377649
1032 2624481001 2623620443 Bacteria 6427864
1033 2624492132 2623620446 Bacteria 6500345
1034 2643841518 2643221565 Bacteria 6216018
1035 2643874088 2643221571 Bacteria 6228673
1036 2643954253 2643221589 Bacteria 6250934
1037 2644023062 2643221602 Bacteria 6249926
1038 2644284768 2643221650 Bacteria 7029547
1039 2652546082 2651869719 Bacteria 6047974
1040 2671090950 2667528170 Bacteria 6786960
1041 2671095838 2667528171 Bacteria 6900659
1042 2671124736 2667528176 Bacteria 6724917
1043 2671769262 2671180172 Bacteria 6495783
1044 2677896488 2675903420 Bacteria 6247433
1045 2678263974 2675903515 Bacteria 6580491
1046 2715753042 2713897148 Bacteria 5883533
1047 2715757046 2713897149 Bacteria 6506249
1048 2723248785 2721755607 Bacteria 5841722
1049 2738806778 2738541294 Bacteria 6925949
1050 2738894138 2738541309 Bacteria 6926455
1051 2739199388 2738543004 Bacteria 6381073
1052 2739257124 2738543015 Bacteria 6750701
1053 2739314657 2738543025 Bacteria 6600348
1054 2743737966 2740892503 Bacteria 6855563
1055 2745004428 2744054620 Bacteria 6551379
1056 2774120490 2773857670 Bacteria 6407454
1057 2774131419 2773857672 Bacteria 4993178
1058 2774133965 2773857673 Bacteria 6513460
1059 2784264264 2784132063 Bacteria 6262788
1060 2784312963 2784132072 Bacteria 6596533
1061 2794597863 2791355520 Bacteria 5948615
1062 2808907353 2808606373 Bacteria 4423627
1063 2808956201 2808606382 Bacteria 6841132
1064 2809214701 2808606445 Bacteria 6057339
1065 2819613994 2818991449 Bacteria 5518009
1066 2819659527 2818991456 Bacteria 6123676
1067 2819700683 2818991464 Bacteria 6907494
1068 2825657246 2825651385 Bacteria 6715909
1069 2834034086 2834028612 Bacteria 6354979
1070 2837681595 2837678835 Bacteria 5252418
1071 2842827010 2842826826 Bacteria 5974129
1072 2842834932 2842832357 Bacteria 5959113
1073 2842839210 2842837860 Bacteria 6066181
1074 2842843865 2842843487 Bacteria 6004777
1075 2844670990 2844665904 Bacteria 6817974
1076 2852657650 2852657418 Bacteria 6472974
1077 2860342853 2860339153 Bacteria 6846989
1078 2860870676 2860867994 Bacteria 5645326
1079 2878032928 2878029506 Bacteria 6418441
1080 2904550385 2904550169 Bacteria 6221258
1081 2908449813 2908446538 Bacteria 6829095
1082 2913039183 2913036834 Bacteria 6704877
1083 2917074208 2917070673 Bacteria 6868303
1084 2917834283 2917832318 Bacteria 5346010
1085 2919064766 2919063839 Bacteria 6302690
1086 2919127835 2919125081 Bacteria 5385106
1087 2919157087 2919155634 Bacteria 4860545
1088 2919387244 2919385768 Bacteria 5897293
1089 2919491935 2919487758 Bacteria 5929766
1090 2919698316 2919697872 Bacteria 6553725
1091 2923157014 2923153595 Bacteria 6870622
1092 2923586664 2923586266 Bacteria 6565975
1093 2929146461 2929144301 Bacteria 6622272
1094 2929192672 2929189879 Bacteria 5930554
1095 2931369868 2931369376 Bacteria 6847892
1096 2931393938 2931390751 Bacteria 6273349
1097 2931401603 2931396565 Bacteria 7251677
1098 2935355727 2935353572 Unclassified 6955622
1099 2939639053 2939636861 Bacteria 6297853
1100 2945933523 2945928738 Bacteria 6053221
1101 2945963290 2945961074 Bacteria 7342064
1102 2946009711 2946006987 Bacteria 6705746
1103 2946030872 2946027586 Bacteria 6049274
1104 2947237903 2947233263 Bacteria 6439278
1105 2969307839 2969304461 Bacteria 6601805
1106 2974290675 2974289157 Bacteria 6080362
1107 2974298566 2974298342 Bacteria 4840922
1108 2984289061 2984286254 Bacteria 6702062
1109 2984500807 2984499530 Bacteria 5020881
1110 2998143133 2998139840 Bacteria 6073514
1111 3007254810 3007252601 Bacteria 4559114
1112 3007396433 3007395558 Bacteria 6755444
1113 3007514080 3007511990 Bacteria 6481491
1114 3007616037 3007614139 Bacteria 6053559
1115 3007625273 3007619802 Bacteria 6411688
1116 3007722539 3007718800 Bacteria 5971527
1117 3007857123 3007855910 Bacteria 5637581
1118 3007861863 3007861166 Bacteria 6045338
1119 3007869805 3007866637 Bacteria 5899198
1120 637320750 637000220 Bacteria 7074893
1121 639789006 639633007 Bacteria 4376040
1122 8015691258 8015687852 Bacteria 6613826
1123 8019772600 8019769354 Bacteria 6924660
1124 8019779255 8019775933 Bacteria 6858656
1125 8029997648 8029995093 Bacteria 5990776
1126 8054285869 8054285046 Bacteria 6919322
1127 8054352353 8054347763 Bacteria 5901107
1128 8054506431 8054503363 Bacteria 6101651
1129 8055774397 8055770955 Bacteria 6827675
1130 8055821183 8055817908 Bacteria 6609162
1131 8056118424 8056115690 Bacteria 5527654
1132 8056128643 8056125926 Bacteria 6228218
1133 8056150960 8056148874 Bacteria 6479865
1134 8056158871 8056155041 Bacteria 6486948
1135 8056166144 8056161164 Bacteria 6106669
1136 8056168048 8056166840 Bacteria 5820959
1137 8056174522 8056172158 Bacteria 6133900
1138 8056178019 8056177738 Bacteria 6748268
1139 8057800949 8057798959 Bacteria 6713499
1140 Ga0070670_100070236
1141 SwRhRL2b_contig_3815165
1142 JGI24739J22299_10060794
1143 JGI24735J21928_10008513
1144 JGI24744J21845_10014316
1145 JGI25162J39368_1000030
1146 JGI25163J39215_1000059
1147 JGI25164J39214_1000123
1148 JGI25165J46597_1000056
1149 rootL2_10116134
1150 Ga0055538_1000007
1151 Ga0055539_1000011
1152 Ga0055533_1000014
1153 Ga0055532_1000009
1154 Ga0055525_1000016
1155 Ga0055535_1008860
1156 Ga0055537_1000060
1157 Ga0055536_1000084
1158 Ga0055536_1000262
1159 Ga0055534_1000009
1160 Ga0055528_1000012
1161 Ga0055530_10000215
1162 Ga0055530_10000402
1163 Ga0055540_1000284
1164 Ga0055540_1000358
1165 Ga0055541_1000008
1166 Ga0055543_1011074
1167 Ga0065165_1000051
1168 Ga0065714_10000049
1169 Ga0065714_10003058
1170 Ga0065714_10004477
1171 Ga0065714_10006867
1172 Ga0065714_10013213
1173 Ga0065714_10065510
1174 Ga0065714_10084625
1175 Ga0065714_10084895
1176 Ga0065714_10087062
1177 Ga0065714_10088010
1178 Ga0065704_10105196
1179 Ga0065712_10068023
1180 Ga0065712_10069803
1181 Ga0065712_10079095
1182 Ga0065715_10011768
1183 Ga0065707_10010384
1184 Ga0070670_100000473
1185 Ga0068868_100067269
1186 Ga0068868_100099803
1187 Ga0070691_10158507
1188 Ga0070661_100000175
1189 Ga0070668_100013601
1190 Ga0070669_100019700
1191 Ga0070669_100024294
1192 Ga0070669_100064670
1193 Ga0070669_100149193
1194 Ga0070671_100262229
1195 Ga0070667_100201312
1196 Ga0070700_100213559
1197 Ga0070694_100189817
1198 Ga0070663_100173065
1199 Ga0070662_100030452
1200 Ga0068867_100000066
1201 Ga0070699_100491498
1202 Ga0070672_100015840
1203 Ga0070696_100083654
1204 Ga0070665_100474986
1205 Ga0070664_100000118
1206 Ga0068857_100053499
1207 Ga0068857_100120774
1208 Ga0068854_100347685
1209 Ga0068864_100000342
1210 Ga0068864_100013403
1211 Ga0068851_10000860
1212 Ga0068870_10009177
1213 Ga0068863_100000149
1214 Ga0068863_100022849
1215 Ga0068860_100061947
1216 Ga0068862_100034456
1217 Ga0075364_10028562
1218 Ga0075364_10092729
1219 Ga0075364_10147660
1220 Ga0075432_10000920
1221 Ga0075432_10006692
1222 Ga0075432_10010219
1223 Ga0075432_10048495
1224 Ga0075432_10053979
1225 Ga0075432_10058799
1226 Ga0075432_10079751
1227 Ga0075432_10092707
1228 Ga0070716_100160138
1229 Ga0075369_10081575
1230 Ga0075366_10029325
1231 Ga0075370_10005241
1232 Ga0075370_10008666
1233 Ga0068871_100609624
1234 Ga0075430_100212588
1235 Ga0075430_100354868
1236 Ga0068865_100101956
1237 Ga0075436_100111534
1238 Ga0075436_100115478
1239 Ga0079104_1000081
1240 Ga0079104_1000435
1241 Ga0079104_1008195
1242 Ga0105251_10001130
1243 Ga0105251_10005958
1244 Ga0105251_10016388
1245 Ga0105251_10030420
1246 Ga0105251_10037071
1247 Ga0105251_10047470
1248 Ga0105251_10081030
1249 Ga0105244_10000113
1250 Ga0105244_10001018
1251 Ga0105244_10002954
1252 Ga0105244_10008244
1253 Ga0105244_10024075
1254 Ga0105244_10033139
1255 Ga0105250_10000047
1256 Ga0105250_10000393
1257 Ga0105250_10015432
1258 Ga0105250_10088088
1259 Ga0111539_10111983
1260 Ga0111539_10911049
1261 Ga0105245_10002025
1262 Ga0105247_10089659
1263 Ga0105243_10000170
1264 Ga0105243_10001782
1265 Ga0105243_10003572
1266 Ga0105243_10072319
1267 Ga0105242_10000292
1268 Ga0105242_10142126
1269 Ga0105248_10293948
1270 Ga0105237_10000618
1271 Ga0105237_10312662
1272 Ga0105237_10691288
1273 Ga0105237_10787467
1274 Ga0105246_10000014
1275 Ga0105246_10000554
1276 Ga0105246_10001405
1277 Ga0105246_10017825
1278 Ga0105246_10273528
1279 Ga0105246_10285042
1280 Ga0157345_1000014
1281 Ga0157373_10001077
1282 Ga0157373_10001889
1283 Ga0157373_10002066
1284 Ga0157373_10003646
1285 Ga0157373_10004408
1286 Ga0157373_10004797
1287 Ga0157373_10008623
1288 Ga0157373_10012916
1289 Ga0157371_10001376
1290 Ga0157371_10002377
1291 Ga0157371_10002745
1292 Ga0157371_10006783
1293 Ga0157370_10008555
1294 Ga0157370_10013939
1295 Ga0157370_10023614
1296 Ga0157370_10112239
1297 Ga0157370_10142607
1298 Ga0157370_10262510
1299 Ga0157369_10000417
1300 Ga0157369_10002624
1301 Ga0157369_10003097
1302 Ga0157369_10004453
1303 Ga0157369_10006855
1304 Ga0157369_10023766
1305 Ga0157369_10024615
1306 Ga0157369_10305490
1307 Ga0157369_10561764
1308 Ga0157374_10146229
1309 Ga0163162_10000210
1310 Ga0163162_10009619
1311 Ga0163162_10720659
1312 Ga0163162_11062961
1313 Ga0163162_11062962
1314 Ga0157372_10001195
1315 Ga0157372_10002997
1316 Ga0157372_10111748
1317 Ga0157375_10002075
1318 Ga0157375_10005652
1319 Ga0182008_10000706
1320 Ga0182008_10000752
1321 Ga0182008_10002526
1322 Ga0182008_10009319
1323 Ga0182008_10034227
1324 Ga0182008_10074084
1325 Ga0157377_10000035
1326 Ga0157379_10237890
1327 Ga0182006_1001537
1328 Ga0182006_1001539
1329 Ga0182006_1002098
1330 Ga0182006_1007073
1331 Ga0182006_1016915
1332 Ga0182006_1090149
1333 Ga0182007_10000315
1334 Ga0182007_10002696
1335 Ga0182007_10010563
1336 Ga0182005_1001275
1337 Ga0182005_1002287
1338 Ga0182005_1004539
1339 Ga0163161_10000221
1340 Ga0163161_10005118
1341 Ga0163161_10007828
1342 Ga0163161_10009285
1343 Ga0163161_10023646
1344 Ga0163161_10030414
1345 Ga0163161_10041264
1346 Ga0163161_10052937
1347 Ga0163161_10070164
1348 Ga0163161_10457172
1349 Ga0209435_100778
1350 Ga0209760_100016
1351 Ga0209784_100023
1352 Ga0209566_100019
1353 Ga0209674_100034
1354 Ga0209147_100027
1355 Ga0209563_100037
1356 Ga0209563_102231
1357 Ga0207427_100022
1358 Ga0209437_100002
1359 Ga0209258_100166
1360 Ga0209646_1000110
1361 Ga0209677_100021
1362 Ga0209759_1011401
1363 Ga0209233_1000004
1364 Ga0209565_1000015
1365 Ga0209673_1000017
1366 Ga0209130_1000063
1367 Ga0209675_1000012
1368 Ga0209676_1000003
1369 Ga0209676_1000050
1370 Ga0209676_1000777
1371 Ga0209676_1013219
1372 Ga0209676_1020135
1373 Ga0209025_1000026
1374 Ga0209564_1000016
1375 Ga0209050_1000004
1376 Ga0209050_1000009
1377 Ga0209050_1001872
1378 Ga0209256_1000346
1379 Ga0207426_1002554
1380 Ga0207426_1014840
1381 Ga0209051_1000006
1382 Ga0209051_1000438
1383 Ga0209051_1004148
1384 Ga0209257_1009378
1385 Ga0207656_10001465
1386 Ga0207696_1000002
1387 Ga0207696_1000017
1388 Ga0207696_1003966
1389 Ga0207696_1033548
1390 Ga0207696_1047711
1391 Ga0207655_1000074
1392 Ga0207655_1001619
1393 Ga0207655_1002477
1394 Ga0207655_1003770
1395 Ga0207655_1012987
1396 Ga0207655_1026761
1397 Ga0207655_1037546
1398 Ga0207655_1044996
1399 Ga0207655_1075595
1400 Ga0207713_1000369
1401 Ga0207713_1000634
1402 Ga0207713_1001110
1403 Ga0207713_1005223
1404 Ga0207713_1007056
1405 Ga0207713_1054312
1406 Ga0207713_1058575
1407 Ga0207710_10075327
1408 Ga0207647_10040798
1409 Ga0207643_10041813
1410 Ga0207695_10277586
1411 Ga0207671_10000964
1412 Ga0207649_10000146
1413 Ga0207681_10047560
1414 Ga0207681_10055629
1415 Ga0207681_10164426
1416 Ga0207694_10084412
1417 Ga0207650_10000865
1418 Ga0207687_10029261
1419 Ga0207644_10028782
1420 Ga0207706_10009548
1421 Ga0207686_10020116
1422 Ga0207709_10000004
1423 Ga0207709_10000858
1424 Ga0207709_10001664
1425 Ga0207665_10083484
1426 Ga0207691_10449838
1427 Ga0207711_10349351
1428 Ga0207689_10050466
1429 Ga0207679_10000097
1430 Ga0207668_10002267
1431 Ga0207640_10554256
1432 Ga0207641_10000120
1433 Ga0207641_10025533
1434 Ga0207648_10000040
1435 Ga0207676_10000091
1436 Ga0207674_10059129
1437 Ga0207683_10243589
1438 Ga0209281_1000011
1439 Ga0209281_1000055
1440 Ga0209281_1001921
1441 Ga0209281_1003929
1442 Ga0207428_10006877
1443 Ga0207428_10052943
1444 Ga0207428_10076459
1445 Ga0207428_10112400
1446 Ga0207428_10278645
1447 Ga0268266_10412387
1448 Ga0268266_10481636
1449 Ga0268265_10013736
1450 Ga0265319_1000177
1451 Ga0265318_10000258
1452 Ga0265336_10000013
1453 Ga0307517_10190564
1454 Ga0307515_10128455
1455 Ga0265324_10000536
1456 Ga0265324_10112891
1457 Ga0307512_10030456
1458 Ga0316178_1159482
1459 Ga0265330_10000359
1460 Ga0265332_10000138
1461 Ga0265328_10002580
1462 Ga0265328_10056884
1463 Ga0265320_10002735
1464 Ga0265325_10004955
1465 Ga0265325_10048260
1466 Ga0265329_10000076
1467 Ga0265340_10000688
1468 Ga0265339_10005622
1469 Ga0265331_10001134
1470 Ga0265331_10067422
1471 Ga0265327_10000681
1472 Ga0265327_10154522
1473 Ga0265316_10000843
1474 Ga0307509_10003432
1475 Ga0307408_100008176
1476 Ga0307408_100289878
1477 Ga0265313_10000089
1478 Ga0307514_10001667
1479 Ga0307514_10139272
1480 Ga0265314_10000211
1481 Ga0265342_10000390
1482 Ga0316576_10053093
1483 Ga0316576_10062189
1484 Ga0307412_10003248
1485 Ga0307412_10030227
1486 Ga0307409_100142661
1487 Ga0307416_100147453
1488 Ga0307416_100263493
1489 Ga0307414_10415776
1490 Ga0307411_10013877
1491 Ga0316583_10002676
1492 Ga0307510_10008022
1493 Ga0307510_10031972
1494 Ga0373931_0135990
1495 Ga0373937_0042280
1496 Ga0316584_0255742
1497 Ga0395905_0029368
1498 Ga0395905_0074385
1499 Ga0439438_001790
1500 Ga0439438_002060
1501 Ga0439438_002339
1502 Ga0439438_002391
1503 Ga0439439_0058117
1504 Ga0439447_000130
1505 Ga0439447_001809
1506 Ga0439447_002141
1507 Ga0439447_002328
1508 Ga0439447_003975
1509 Ga0439447_027876
1510 Ga0439466_0000227
1511 Ga0439466_0000530
1512 Ga0439466_0001072
1513 Ga0439466_0001383
1514 Ga0439466_0002138
1515 Ga0439466_0020568
1516 Ga0439466_0027583
1517 Ga0439466_0106545
1518 Ga0439432_000016
1519 Ga0439432_000485
1520 Ga0439432_002780
1521 Ga0439432_006718
1522 Ga0439432_025172
1523 Ga0439449_0012448
1524 Ga0439451_000475
1525 Ga0439451_001556
1526 Ga0439451_004521
1527 Ga0439451_010667
1528 Ga0439452_000123
1529 Ga0439452_007770
1530 Ga0439452_009774
1531 Ga0439452_011180
1532 Ga0439456_003216
1533 Ga0439456_006054
1534 Ga0439456_009637
1535 Ga0439462_0004775
1536 Ga0439463_006609
1537 Ga0439463_050169
1538 Ga0450911_000510
1539 Ga0450911_002200
1540 Ga0450911_006530
1541 Ga0450922_001389
1542 Ga0450903_002021
1543 Ga0450903_017824
1544 Ga0450906_002391
1545 Ga0450907_000175
1546 Ga0450907_000547
1547 Ga0450910_000379
1548 Ga0439446_0007494
1549 Ga0439446_0015668
1550 Ga0450908_000208
1551 Ga0450909_000113
1552 Ga0439460_0006502
1553 Ga0439460_0063627
1554 Ga0450918_009443
1555 Ga0450901_000164
1556 Ga0451577_0014108
1557 Ga0451577_0015785
1558 Ga0451577_0036966
1559 Ga0451577_0038116
1560 Ga0451577_0092220
1561 Ga0439440_0001431
1562 Ga0439440_0005906
1563 Ga0466972_0010636
1564 Ga0453683_0007327
1565 Ga0453684_0000471
1566 Ga0453684_0010999
1567 Ga0453684_0011162
1568 Ga0453684_0084631
1569 Ga0453684_0121702
1570 Ga0453684_0124832
1571 Ga0451576_0000099
1572 Ga0451576_0000320
1573 Ga0451576_0001981
1574 Ga0451576_0027118
1575 Ga0451576_0039260
1576 Ga0451576_0045983
1577 Ga0451576_0124573
1578 Ga0451576_0701431
1579 Ga0495617_000074
1580 Ga0495617_000231
1581 Ga0495617_000317
1582 Ga0495617_009615
1583 Ga0495617_011812
1584 Ga0495617_022513
1585 Ga0495627_000369
1586 Ga0495627_000894
1587 Ga0495627_001104
1588 Ga0495627_003083
1589 Ga0495592_0000203
1590 Ga0495603_0003212
1591 Ga0495603_0020824
1592 Ga0495590_0000178
1593 Ga0495590_0000821
1594 Ga0495590_0000839
1595 Ga0495590_0021825
1596 Ga0495590_0033343
1597 Ga0495591_000086
1598 Ga0495591_000177
1599 Ga0495591_000949
1600 Ga0495591_001101
1601 Ga0495591_006794
1602 Ga0495591_030944
1603 Ga0495629_0000819
1604 Ga0495629_0003181
1605 Ga0495638_0001745
1606 Ga0495638_0007263
1607 Ga0495638_0021556
1608 Ga0495638_0025561
1609 Ga0495638_0033363
1610 Ga0495638_0038025
1611 Ga0495638_0057135
1612 Ga0495638_0074178
1613 Ga0495638_0097443
1614 Ga0495638_0328016
1615 Ga0495653_0000427
1616 Ga0495653_0001253
1617 Ga0495653_0054643
1618 Ga0495653_0054793
1619 Ga0495650_0000294
1620 Ga0495650_0000522
1621 Ga0495650_0003349
1622 Ga0495650_0005875
1623 Ga0495650_0008823
1624 Ga0495650_0008974
1625 Ga0495650_0009991
1626 Ga0495650_0076093
1627 Ga0495580_0038238
1628 Ga0495582_0028869
1629 Ga0495605_0000189
1630 Ga0495605_0000585
1631 Ga0495605_0004347
1632 Ga0495605_0006681
1633 Ga0495605_0006695
1634 Ga0495605_0032805
1635 Ga0495605_0061185
1636 Ga0495639_0000002
1637 Ga0495639_0036924
1638 Ga0495662_0023017
1639 Ga0495664_0035404
1640 Ga0495664_0130985
1641 Ga0495584_0000019
1642 Ga0495584_0000084
1643 Ga0495584_0000094
1644 Ga0495584_0002625
1645 Ga0495584_0007539
1646 Ga0495584_0008888
1647 Ga0495584_0009580
1648 Ga0495584_0015470
1649 Ga0495584_0032547
1650 Ga0495584_0057247
1651 Ga0495584_0081367
1652 Ga0495584_0214834
1653 Ga0495585_0000101
1654 Ga0495585_0001655
1655 Ga0495585_0002281
1656 Ga0495585_0002474
1657 Ga0495585_0004048
1658 Ga0495585_0007440
1659 Ga0495585_0008195
1660 Ga0495585_0028489
1661 Ga0495585_0035691
1662 Ga0495585_0075756
1663 Ga0495594_0188058
1664 Ga0495596_0000027
1665 Ga0495596_0009591
1666 Ga0495596_0033339
1667 Ga0495607_0000092
1668 Ga0495607_0001404
1669 Ga0495607_0002010
1670 Ga0495607_0002682
1671 Ga0495607_0005469
1672 Ga0495607_0005513
1673 Ga0495607_0007372
1674 Ga0495607_0018207
1675 Ga0495607_0030875
1676 Ga0495607_0257608
1677 Ga0495583_0000445
1678 Ga0495583_0001410
1679 Ga0495583_0001452
1680 Ga0495583_0002185
1681 Ga0495606_0000625
1682 Ga0495606_0001005
1683 Ga0495606_0001535
1684 Ga0495606_0001830
1685 Ga0495606_0008703
1686 Ga0495606_0023245
1687 Ga0495606_0029221
1688 Ga0495606_0059497
1689 Ga0495610_0000722
1690 Ga0495610_0001435
1691 Ga0495610_0001943
1692 Ga0495610_0003870
1693 Ga0495610_0004236
1694 Ga0495610_0004286
1695 Ga0495610_0004894
1696 Ga0495610_0007190
1697 Ga0495610_0011004
1698 Ga0495610_0023294
1699 Ga0495610_0023373
1700 Ga0495610_0025696
1701 Ga0495610_0088789
1702 Ga0495616_0000079
1703 Ga0495616_0000249
1704 Ga0495616_0001332
1705 Ga0495616_0002103
1706 Ga0495616_0008289
1707 Ga0495616_0034797
1708 Ga0495616_0046726
1709 Ga0495616_0125259
1710 Ga0495620_0000106
1711 Ga0495620_0002056
1712 Ga0495620_0004913
1713 Ga0495620_0005977
1714 Ga0495620_0031462
1715 Ga0495628_0002997
1716 Ga0495630_0032152
1717 Ga0495631_0000072
1718 Ga0495631_0000824
1719 Ga0495631_0111770
1720 Ga0495631_0114888
1721 Ga0495632_0000200
1722 Ga0495632_0000204
1723 Ga0495632_0000243
1724 Ga0495632_0001300
1725 Ga0495632_0002506
1726 Ga0495632_0003289
1727 Ga0495632_0015268
1728 Ga0495632_0020383
1729 Ga0495632_0026646
1730 Ga0495632_0036592
1731 Ga0495632_0068762
1732 Ga0495637_0000256
1733 Ga0495637_0000545
1734 Ga0495637_0000847
1735 Ga0495637_0001339
1736 Ga0495637_0002416
1737 Ga0495637_0002592
1738 Ga0495637_0009604
1739 Ga0495637_0023096
1740 Ga0495637_0054432
1741 Ga0495637_0057761
1742 Ga0495637_0081881
1743 Ga0495643_0002227
1744 Ga0495643_0002647
1745 Ga0495643_0002651
1746 Ga0495643_0004175
1747 Ga0495643_0021611
1748 Ga0495643_0031498
1749 Ga0495643_0065328
1750 Ga0495644_0000022
1751 Ga0495644_0000098
1752 Ga0495644_0000932
1753 Ga0495644_0088910
1754 Ga0495648_0000396
1755 Ga0495648_0000461
1756 Ga0495648_0006863
1757 Ga0495648_0009619
1758 Ga0495648_0024609
1759 Ga0495648_0047974
1760 Ga0495648_0053370
1761 Ga0495648_0104773
1762 Ga0495648_0133070
1763 Ga0495648_0194371
1764 Ga0495666_0000015
1765 Ga0495666_0018898
1766 Ga0495666_0052621
1767 Ga0495666_0107110
1768 Ga0495642_0000043
1769 Ga0495642_0000119
1770 Ga0495642_0000575
1771 Ga0495642_0002942
1772 Ga0495642_0038533
1773 Ga0495652_0002621
1774 Ga0495654_0000239
1775 Ga0495654_0000382
1776 Ga0495654_0000560
1777 Ga0495654_0000781
1778 Ga0495654_0002354
1779 Ga0495654_0008334
1780 Ga0495654_0009503
1781 Ga0495654_0010621
1782 Ga0495654_0021065
1783 Ga0495654_0021345
1784 Ga0495654_0022158
1785 Ga0495665_0000011
1786 Ga0495665_0016754
1787 Ga0495586_0011759
1788 Ga0495586_0263805
1789 Ga0495587_0001836
1790 Ga0495587_0048545
1791 Ga0495609_0000160
1792 Ga0495609_0002853
1793 Ga0495609_0003497
1794 Ga0495609_0005248
1795 Ga0495609_0097130
1796 Ga0495597_0000776
1797 Ga0495597_0001758
1798 Ga0495597_0016121
1799 Ga0495597_0042031
1800 Ga0495597_0076094
1801 Ga0495645_0006438
1802 Ga0495645_0071074
1803 Ga0495622_0000378
1804 Ga0495622_0000411
1805 Ga0495622_0003600
1806 Ga0495622_0010921
1807 Ga0495622_0051318
1808 Ga0495633_0004863
1809 Ga0495633_0015278
1810 Ga0495667_0014469
1811 Ga0495656_0051121
1812 Ga0495668_0000281
1813 Ga0495668_0001550
1814 Ga0495668_0015324
1815 Ga0495668_0025087
1816 Ga0495634_0000218
1817 Ga0495611_0000048
1818 Ga0495611_0004661
1819 Ga0495611_0024482
1820 Ga0495625_0000790
1821 Ga0495625_0003012
1822 Ga0495625_0003190
1823 Ga0495625_0004247
1824 Ga0495625_0012811
1825 Ga0495625_0014191
1826 Ga0495625_0015309
1827 Ga0495625_0020970
1828 Ga0495625_0110067
1829 Ga0495625_0276637
1830 Ga0495635_0001815
1831 Ga0495635_0005778
1832 Ga0495635_0016161
1833 Ga0495659_0000035
1834 Ga0495659_0001278
1835 Ga0495659_0003768
1836 Ga0495661_0000011
1837 Ga0495661_0001173
1838 Ga0495661_0002752
1839 Ga0495661_0004925
1840 Ga0495661_0007307
1841 Ga0495661_0010217
1842 Ga0495661_0043912
1843 Ga0495661_0061949
1844 Ga0495661_0097042
1845 Ga0495588_0000433
1846 Ga0495623_0003360
1847 Ga0495623_0006494
1848 Ga0495646_0000777
1849 Ga0495646_0001145
1850 Ga0495646_0006387
1851 Ga0495646_0007303
1852 Ga0495646_0017436
1853 Ga0495658_0043765
1854 Ga0495669_0001494
1855 Ga0495669_0010225
1856 Ga0495669_0090569
1857 Ga0495624_0000133
1858 Ga0495624_0001440
1859 Ga0495670_0000169
1860 Ga0495670_0000280
1861 Ga0495670_0023001
1862 Ga0495670_0110925
1863 Ga0495670_0127301
1864 Ga0495671_0000136
1865 Ga0495671_0001038
1866 Ga0495671_0001847
1867 Ga0495671_0005112
1868 Ga0495671_0015228
1869 Ga0495671_0025531
1870 Ga0495671_0044501
1871 Ga0495671_0080112
1872 Ga0495671_0102923
1873 Ga0495671_0116602
1874 Ga0495649_0000083
1875 Ga0495649_0000316
1876 Ga0495649_0000430
1877 Ga0495649_0000495
1878 Ga0495649_0001099
1879 Ga0495649_0008492
1880 Ga0495649_0012954
1881 Ga0495649_0013424
1882 Ga0495649_0020775
1883 Ga0495649_0023261
1884 Ga0495649_0023527
1885 Ga0495649_0042659
1886 Ga0495589_0002311
1887 Ga0495589_0004383
1888 Ga0495589_0006414
1889 Ga0495589_0011742
1890 Ga0495589_0019791
1891 Ga0495600_0007213
1892 Ga0495600_0025616
1893 Ga0495660_0000487
1894 Ga0495660_0001546
1895 Ga0495660_0003102
1896 Ga0495660_0007904
1897 Ga0495660_0009323
1898 Ga0495660_0029073
1899 Ga0495660_0046984
1900 Ga0495660_0060109
1901 Ga0495660_0157927
1902 Ga0495581_0009537
1903 Ga0495604_0001695
1904 Ga0495604_0006676
1905 Ga0495604_0026862
1906 Ga0495636_0005171
1907 Ga0495674_0012957
1908 Ga0495674_0037134
1909 Ga0495674_0104487
1910 Ga0495672_0001626
1911 Ga0495672_0001695
1912 Ga0495672_0002779
1913 Ga0495672_0006170
1914 Ga0495672_0006897
1915 Ga0495672_0007362
1916 Ga0495672_0009071
1917 Ga0495672_0011128
1918 Ga0495672_0011198
1919 Ga0495672_0060206
1920 Ga0495672_0154326
1921 Ga0495676_0000178
1922 Ga0495676_0002539
1923 Ga0495680_0000939
1924 Ga0495680_0002463
1925 Ga0495680_0003676
1926 Ga0495680_0011267
1927 Ga0495680_0018941
1928 Ga0495680_0066668
1929 Ga0495680_0226498
1930 Ga0495680_0239683
1931 Ga0495683_0001324
1932 Ga0495683_0001705
1933 Ga0495683_0004324
1934 Ga0495683_0006186
1935 Ga0495683_0067648
1936 Ga0495683_0068104
1937 Ga0495687_001541
1938 Ga0495687_002798
1939 Ga0495687_008086
1940 Ga0495687_011380
1941 Ga0495687_054899
1942 Ga0495675_0001899
1943 Ga0495677_0000425
1944 Ga0495679_000224
1945 Ga0495679_000550
1946 Ga0495679_000801
1947 Ga0495679_001151
1948 Ga0495679_004735
1949 Ga0495679_010182
1950 Ga0495679_043309
1951 Ga0495685_004329
1952 Ga0495673_0000276
1953 Ga0495673_0000479
1954 Ga0495673_0000945
1955 Ga0495673_0001202
1956 Ga0495673_0001803
1957 Ga0495673_0002783
1958 Ga0495673_0004029
1959 Ga0495673_0013477
1960 Ga0495673_0037014
1961 Ga0495673_0041120
1962 Ga0495681_0000031
1963 Ga0495681_0000377
1964 Ga0495681_0001017
1965 Ga0495681_0002674
1966 Ga0495681_0003336
1967 Ga0495681_0003348
1968 Ga0495681_0004763
1969 Ga0495681_0007992
1970 Ga0495686_0002283
1971 Ga0495686_0002866
1972 Ga0495686_0015258
1973 Ga0495686_0108371
1974 Ga0495593_0000147
1975 Ga0495593_0000378
1976 Ga0495593_0007762
1977 Ga0495593_0018168
1978 Ga0495593_0022104
1979 Ga0495593_0030627
1980 Ga0495593_0109893
1981 Ga0495602_0000644
1982 Ga0495602_0001483
1983 Ga0495602_0046370
1984 Ga0495614_0122550
1985 Ga0495626_0000077
1986 Ga0495626_0000247
1987 Ga0495626_0000277
1988 Ga0495626_0000310
1989 Ga0495626_0001215
1990 Ga0495626_0001915
1991 Ga0495626_0001995
1992 Ga0495626_0008193
1993 Ga0495626_0022754
1994 Ga0495626_0076674
1995 Ga0496100_0020050
1996 Ga0496100_0071617
1997 Ga0496101_0001181
1998 Ga0496102_0000475
1999 Ga0496102_0026173
2000 Ga0496103_0001728
2001 Ga0496104_0296771
2002 Ga0496104_0341152
2003 Ga0496105_0034177
2004 Ga0496105_0252899
2005 Ga0496106_0001408
2006 Ga0496107_0025407
2007 Ga0496109_0093301
2008 Ga0496110_0137563
2009 Ga0496111_0010280
2010 Ga0496112_0092939
2011 Ga0496113_0007984
2012 Ga0496114_0001072
2013 Ga0496115_0110338
2014 Ga0496115_0145875
2015 Ga0496116_0000010
2016 Ga0496116_0000435
2017 Ga0496116_0000951
2018 Ga0496116_0011667
2019 Ga0496117_0001606
2020 Ga0496117_0002171
2021 Ga0496117_0007543
2022 Ga0496117_0009807
2023 Ga0496117_0014140
2024 Ga0496117_0021855
2025 Ga0496117_0094932
2026 Ga0496117_0212396
2027 Ga0496118_0000434
2028 Ga0496118_0003714
2029 Ga0496118_0005118
2030 Ga0496118_0008349
2031 Ga0496118_0068622
2032 Ga0496118_0246785
2033 Ga0496119_0000011
2034 Ga0496120_0000306
2035 Ga0496120_0002732
2036 Ga0496120_0130691
2037 Ga0496121_0000050
2038 Ga0496121_0002613
2039 Ga0496121_0009486
2040 Ga0496121_0010556
2041 Ga0496121_0103391
2042 Ga0496121_0265268
2043 Ga0496121_0282268
2044 Ga0496122_0000544
2045 Ga0496122_0004185
2046 Ga0496122_0074126
2047 Ga0496122_0095048
2048 Ga0496122_0113780
2049 Ga0496122_0219687
2050 Ga0496123_0001978
2051 Ga0496123_0002628
2052 Ga0496123_0023766
2053 Ga0496123_0043282
2054 Ga0496123_0065743
2055 Ga0496124_0000086
2056 Ga0496124_0003120
2057 Ga0496124_0012738
2058 Ga0496124_0020438
2059 Ga0496124_0068122
2060 Ga0496125_0000665
2061 Ga0496125_0003087
2062 Ga0496125_0004650
2063 Ga0496125_0007718
2064 Ga0496125_0010687
2065 Ga0496125_0022274
2066 Ga0496125_0025595
2067 Ga0496126_0007071
2068 Ga0496126_0058421
2069 Ga0496126_0251349
2070 Ga0495678_000255
2071 Ga0495678_001235
2072 Ga0495678_001291
2073 Ga0495678_002715
2074 Ga0495678_016381
2075 Ga0495678_043814
2076 Ga0495678_047972
2077 Ga0495678_059280
2078 Ga0495682_0000542
2079 Ga0495682_0000701
2080 Ga0495682_0005895
2081 Ga0495682_0090547
2082 Ga0501032_0044703
2083 Ga0501034_0091139
2084 Ga0501034_0392484
2085 Ga0501257_019127
2086 Ga0501241_000072
2087 nmdc:mga03683_182881_c1
2088 nmdc:mga00v17_156239_c1
2089 nmdc:mga00v17_18917_c1
2090 nmdc:mga0k408_11123_c1
2091 nmdc:mga0k408_27900_c1
2092 nmdc:mga0k408_45834_c1
2093 nmdc:mga07m45_37398_c1
2094 nmdc:mga07m45_6970_c1
2095 nmdc:mga08y16_46313_c1
2096 Ga0500564_042495
2097 Ga0500619_008139
2098 Ga0590071_006398
2099 Ga0590075_063031
2100 2510312114
2101 2511255091
2102 2511263529
2103 2511270484
2104 2511278148
2105 2511292363
2106 2511296026
2107 2511302658
2108 2511313313
2109 2511320124
2110 2511328167
2111 2511334163
2112 2511339407
2113 2511342327
2114 2511352421
2115 2511365576
2116 2511369688
2117 2511372818
2118 2511412651
2119 2511824292
2120 2512328806
2121 2555670386
2122 2583792185
2123 2597858517
2124 2597864003
2125 2599352586
2126 2599358930
2127 2599365549
2128 2599371624
2129 2599377694
2130 2599384929
2131 2599390482
2132 2599398396
2133 2599402667
2134 2599450418
2135 2599459420
2136 2599466241
2137 2599486492
2138 2599488441
2139 2599507300
2140 2599512900
2141 2599521748
2142 2599611123
2143 2599803114
2144 2599881261
2145 2599887377
2146 2599891577
2147 2599898458
2148 2599946722
2149 2599958917
2150 2599968971
2151 2599980228
2152 2599994457
2153 2600006089
2154 2600009428
2155 2600017239
2156 2600028301
2157 2600035699
2158 2600044937
2159 2600052062
2160 2600057063
2161 2600065012
2162 2600069720
2163 2600212025
2164 2600357250
2165 2600362645
2166 2601691936
2167 2601772193
2168 2601798886
2169 2606077781
2170 2606130044
2171 2624481001
2172 2624492132
2173 2643841518
2174 2643874088
2175 2643954253
2176 2644023062
2177 2644284768
2178 2652546082
2179 2671090950
2180 2671095838
2181 2671124736
2182 2671769262
2183 2677896488
2184 2678263974
2185 2715753042
2186 2715757046
2187 2723248785
2188 2738806778
2189 2738894138
2190 2739199388
2191 2739257124
2192 2739314657
2193 2743737966
2194 2745004428
2195 2774120490
2196 2774131419
2197 2774133965
2198 2784264264
2199 2784312963
2200 2794597863
2201 2808907353
2202 2808956201
2203 2809214701
2204 2819613994
2205 2819659527
2206 2819700683
2207 2825657246
2208 2834034086
2209 2837681595
2210 2842827010
2211 2842834932
2212 2842839210
2213 2842843865
2214 2844670990
2215 2852657650
2216 2860342853
2217 2860870676
2218 2878032928
2219 2904550385
2220 2908449813
2221 2913039183
2222 2917074208
2223 2917834283
2224 2919064766
2225 2919127835
2226 2919157087
2227 2919387244
2228 2919491935
2229 2919698316
2230 2923157014
2231 2923586664
2232 2929146461
2233 2929192672
2234 2931369868
2235 2931393938
2236 2931401603
2237 2935355727
2238 2939639053
2239 2945933523
2240 2945963290
2241 2946009711
2242 2946030872
2243 2947237903
2244 2969307839
2245 2974290675
2246 2974298566
2247 2984289061
2248 2984500807
2249 2998143133
2250 3007254810
2251 3007396433
2252 3007514080
2253 3007616037
2254 3007625273
2255 3007722539
2256 3007857123
2257 3007861863
2258 3007869805
2259 637320750
2260 639789006
2261 8015691258
2262 8019772600
2263 8019779255
2264 8029997648
2265 8054285869
2266 8054352353
2267 8054506431
2268 8055774397
2269 8055821183
2270 8056118424
2271 8056128643
2272 8056150960
2273 8056158871
2274 8056166144
2275 8056168048
2276 8056174522
2277 8056178019
2278 8057800949

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

72

296

0.96

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

77

288

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t50-assembly2.cif.gz_B crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form 0.9517 25 250
7t50-assembly2.cif.gz_B crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form 0.9437 25 250
1atg-assembly1.cif.gz_A azotobacter vinelandii periplasmic molybdate-binding protein 0.9401 25 250
1atg-assembly1.cif.gz_A azotobacter vinelandii periplasmic molybdate-binding protein 0.9168 25 250
7tav-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8562 21 249
ID Description Score Start End Superfamily
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9528 25 250 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9525 25 250 3.40.190.10
1atgA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9501 105 210 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.947 25 89 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9271 21 101 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1B3PKZ0-F1-model_v4 Molybdate ABC transporter, periplasmic molybdate-binding protein 0.9834 25 250 GO:0015689
GO:0030973
GO:0046872
AF-A0A2E5YIN4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9799 43 250 GO:0015689
GO:0030973
AF-A0A1J4TKV7-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9793 69 249 GO:0015689
GO:0030973
AF-A0A1B3PKZ0-F1-model_v4 Molybdate ABC transporter, periplasmic molybdate-binding protein 0.9749 25 250 GO:0015689
GO:0030973
GO:0046872
AF-A0A2E5YIN4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9662 43 250 GO:0015689
GO:0030973

Map