F490674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1139 | 526 | 2278 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100070236|Ga0070670_1000702363 |
| Length | 297 |
| Sequence | MKGPLRGPVATAEVKRSSLRGRAFAAPTVASRAHPRYRYKLSFTMKLPLRRLPHALLIAGALCTSLAHAGDVQVAVAANFAGPLAKIGEGFTAATGHSLTVSAGATGKFYSQVVAGAPFEVLIAADDETPARLVKEGLAVPGTDFTYAIGTLVLWSAQPGLVDDQGAVLTSGRFDHLAVANPKLAPYGRAGMEVLKARGLVDALAPKLVTGETIAQTYQFIATGNAELGFVALSQALVPGKPVVGSYWRVPPSLHGAIRQDAVLLKAGEKNAAAVALLTYLKSDAARRVIQAYGYGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 159 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 161 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 192 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 193 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 194 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 195 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 198 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 199 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 202 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 203 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 204 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 205 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 206 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 207 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 210 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 213 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 216 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 217 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 329 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 339 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 346 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 347 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 348 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 349 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 350 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 351 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 352 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 353 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 354 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 355 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 356 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 357 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 358 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 359 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 360 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 361 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 362 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 363 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 364 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 365 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 366 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 367 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 368 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 369 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 370 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 371 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 372 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 373 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 374 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 375 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 376 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 377 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 378 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 379 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 380 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 381 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 382 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 383 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 384 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 385 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 386 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 387 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 388 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 389 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 390 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 391 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 392 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 393 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 394 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 395 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 396 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 397 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 398 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 399 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 400 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 401 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 402 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 403 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 404 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 405 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 406 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 407 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 408 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 409 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 410 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 411 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 412 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 413 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 414 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 415 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 416 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 417 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 418 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 419 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 420 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 421 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 422 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 423 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 424 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 425 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 426 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 427 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 428 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 429 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 430 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 431 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 432 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 433 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 434 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 435 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 436 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 437 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 438 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 439 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 440 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 441 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 442 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 443 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 444 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 445 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 446 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 447 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 448 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 449 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 450 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 451 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 452 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 453 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 454 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 455 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 456 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 457 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 458 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 459 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 460 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 461 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 462 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 463 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 464 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 465 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 466 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 467 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 468 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 469 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 470 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 471 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 472 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 473 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 474 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 475 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 476 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 477 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 478 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 479 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 480 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 481 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 482 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 483 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 484 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 485 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 486 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 487 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 488 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 489 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 490 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 491 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 492 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 493 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 494 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 495 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 496 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 497 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 498 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 499 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 500 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 501 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 502 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 503 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 504 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 505 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 506 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 507 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 508 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 509 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 510 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 511 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 512 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 513 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 514 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 515 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 516 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 517 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 518 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 519 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 520 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 521 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 522 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 523 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 524 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 525 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 526 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.28 |
| Metatranscriptomes | 0 |
| Isolates | 15.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 6.32 |
| Nodule | 2.28 |
| Rhizoplane | 6.23 |
| Rhizosphere | 74.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100070236 | 3300005331 | Bacteria | 3006 |
| 2 | SwRhRL2b_contig_3815165 | 2162886007 | Bacteria | 1078 |
| 3 | JGI24739J22299_10060794 | 3300001989 | Bacteria | 1195 |
| 4 | JGI24735J21928_10008513 | 3300002067 | Bacteria | 3313 |
| 5 | JGI24744J21845_10014316 | 3300002077 | Bacteria | 1594 |
| 6 | JGI25162J39368_1000030 | 3300002737 | Bacteria | 218717 |
| 7 | JGI25163J39215_1000059 | 3300002771 | Bacteria | 49468 |
| 8 | JGI25164J39214_1000123 | 3300002772 | Bacteria | 74810 |
| 9 | JGI25165J46597_1000056 | 3300003214 | Bacteria | 218721 |
| 10 | rootL2_10116134 | 3300003322 | Bacteria | 2885 |
| 11 | Ga0055538_1000007 | 3300003751 | Bacteria | 399715 |
| 12 | Ga0055539_1000011 | 3300003752 | Bacteria | 399747 |
| 13 | Ga0055533_1000014 | 3300003756 | Bacteria | 399747 |
| 14 | Ga0055532_1000009 | 3300003758 | Bacteria | 399537 |
| 15 | Ga0055525_1000016 | 3300003759 | Bacteria | 399724 |
| 16 | Ga0055535_1008860 | 3300003761 | Bacteria | 1777 |
| 17 | Ga0055537_1000060 | 3300003773 | Bacteria | 79376 |
| 18 | Ga0055536_1000084 | 3300003781 | Bacteria | 80899 |
| 19 | Ga0055536_1000262 | 3300003781 | Bacteria | 41063 |
| 20 | Ga0055534_1000009 | 3300003784 | Bacteria | 210256 |
| 21 | Ga0055528_1000012 | 3300003790 | Bacteria | 182704 |
| 22 | Ga0055530_10000215 | 3300003791 | Bacteria | 52142 |
| 23 | Ga0055530_10000402 | 3300003791 | Bacteria | 38808 |
| 24 | Ga0055540_1000284 | 3300003792 | Bacteria | 45364 |
| 25 | Ga0055540_1000358 | 3300003792 | Bacteria | 38808 |
| 26 | Ga0055541_1000008 | 3300003841 | Bacteria | 399724 |
| 27 | Ga0055543_1011074 | 3300004625 | Bacteria | 1863 |
| 28 | Ga0065165_1000051 | 3300005262 | Bacteria | 194844 |
| 29 | Ga0065714_10000049 | 3300005288 | Bacteria | 14170 |
| 30 | Ga0065714_10003058 | 3300005288 | Bacteria | 11304 |
| 31 | Ga0065714_10004477 | 3300005288 | Bacteria | 5102 |
| 32 | Ga0065714_10006867 | 3300005288 | Bacteria | 4202 |
| 33 | Ga0065714_10013213 | 3300005288 | Bacteria | 2158 |
| 34 | Ga0065714_10065510 | 3300005288 | Bacteria | 9683 |
| 35 | Ga0065714_10084625 | 3300005288 | Bacteria | 2188 |
| 36 | Ga0065714_10084895 | 3300005288 | Bacteria | 2174 |
| 37 | Ga0065714_10087062 | 3300005288 | Bacteria | 2063 |
| 38 | Ga0065714_10088010 | 3300005288 | Bacteria | 2035 |
| 39 | Ga0065704_10105196 | 3300005289 | Bacteria | 2118 |
| 40 | Ga0065712_10068023 | 3300005290 | Bacteria | 16944 |
| 41 | Ga0065712_10069803 | 3300005290 | Bacteria | 6681 |
| 42 | Ga0065712_10079095 | 3300005290 | Bacteria | 3259 |
| 43 | Ga0065715_10011768 | 3300005293 | Bacteria | 2193 |
| 44 | Ga0065707_10010384 | 3300005295 | Bacteria | 2138 |
| 45 | Ga0070670_100000473 | 3300005331 | Bacteria | 32395 |
| 46 | Ga0068868_100067269 | 3300005338 | Bacteria | 2851 |
| 47 | Ga0068868_100099803 | 3300005338 | Bacteria | 2349 |
| 48 | Ga0070691_10158507 | 3300005341 | Bacteria | 1165 |
| 49 | Ga0070661_100000175 | 3300005344 | Bacteria | 52437 |
| 50 | Ga0070668_100013601 | 3300005347 | Bacteria | 6077 |
| 51 | Ga0070669_100019700 | 3300005353 | Bacteria | 4820 |
| 52 | Ga0070669_100024294 | 3300005353 | Bacteria | 4345 |
| 53 | Ga0070669_100064670 | 3300005353 | Bacteria | 2694 |
| 54 | Ga0070669_100149193 | 3300005353 | Bacteria | 1809 |
| 55 | Ga0070671_100262229 | 3300005355 | Bacteria | 1469 |
| 56 | Ga0070667_100201312 | 3300005367 | Bacteria | 1767 |
| 57 | Ga0070700_100213559 | 3300005441 | Bacteria | 1363 |
| 58 | Ga0070694_100189817 | 3300005444 | Bacteria | 1525 |
| 59 | Ga0070663_100173065 | 3300005455 | Bacteria | 1670 |
| 60 | Ga0070662_100030452 | 3300005457 | Bacteria | 3776 |
| 61 | Ga0068867_100000066 | 3300005459 | Bacteria | 63559 |
| 62 | Ga0070699_100491498 | 3300005518 | Bacteria | 1114 |
| 63 | Ga0070672_100015840 | 3300005543 | Bacteria | 5382 |
| 64 | Ga0070696_100083654 | 3300005546 | Bacteria | 2264 |
| 65 | Ga0070665_100474986 | 3300005548 | Bacteria | 1261 |
| 66 | Ga0070664_100000118 | 3300005564 | Bacteria | 52446 |
| 67 | Ga0068857_100053499 | 3300005577 | Bacteria | 3581 |
| 68 | Ga0068857_100120774 | 3300005577 | Bacteria | 2359 |
| 69 | Ga0068854_100347685 | 3300005578 | Bacteria | 1213 |
| 70 | Ga0068864_100000342 | 3300005618 | Bacteria | 41217 |
| 71 | Ga0068864_100013403 | 3300005618 | Bacteria | 6794 |
| 72 | Ga0068851_10000860 | 3300005834 | Bacteria | 13058 |
| 73 | Ga0068870_10009177 | 3300005840 | Bacteria | 4484 |
| 74 | Ga0068863_100000149 | 3300005841 | Bacteria | 73130 |
| 75 | Ga0068863_100022849 | 3300005841 | Bacteria | 5975 |
| 76 | Ga0068860_100061947 | 3300005843 | Bacteria | 3555 |
| 77 | Ga0068862_100034456 | 3300005844 | Bacteria | 4284 |
| 78 | Ga0075364_10028562 | 3300006051 | Bacteria | 3571 |
| 79 | Ga0075364_10092729 | 3300006051 | Bacteria | 2005 |
| 80 | Ga0075364_10147660 | 3300006051 | Bacteria | 1584 |
| 81 | Ga0075432_10000920 | 3300006058 | Bacteria | 9280 |
| 82 | Ga0075432_10006692 | 3300006058 | Bacteria | 3926 |
| 83 | Ga0075432_10010219 | 3300006058 | Bacteria | 3181 |
| 84 | Ga0075432_10048495 | 3300006058 | Bacteria | 1494 |
| 85 | Ga0075432_10053979 | 3300006058 | Bacteria | 1422 |
| 86 | Ga0075432_10058799 | 3300006058 | Bacteria | 1365 |
| 87 | Ga0075432_10079751 | 3300006058 | Bacteria | 1185 |
| 88 | Ga0075432_10092707 | 3300006058 | Bacteria | 1107 |
| 89 | Ga0070716_100160138 | 3300006173 | Unclassified | 1457 |
| 90 | Ga0075369_10081575 | 3300006186 | Bacteria | 1435 |
| 91 | Ga0075366_10029325 | 3300006195 | Bacteria | 3233 |
| 92 | Ga0075370_10005241 | 3300006353 | Bacteria | 6415 |
| 93 | Ga0075370_10008666 | 3300006353 | Bacteria | 5243 |
| 94 | Ga0068871_100609624 | 3300006358 | Bacteria | 993 |
| 95 | Ga0075430_100212588 | 3300006846 | Bacteria | 1605 |
| 96 | Ga0075430_100354868 | 3300006846 | Bacteria | 1211 |
| 97 | Ga0068865_100101956 | 3300006881 | Bacteria | 2103 |
| 98 | Ga0075436_100111534 | 3300006914 | Bacteria | 1909 |
| 99 | Ga0075436_100115478 | 3300006914 | Bacteria | 1875 |
| 100 | Ga0079104_1000081 | 3300006946 | Bacteria | 140632 |
| 101 | Ga0079104_1000435 | 3300006946 | Bacteria | 47549 |
| 102 | Ga0079104_1008195 | 3300006946 | Bacteria | 3692 |
| 103 | Ga0105251_10001130 | 3300009011 | Bacteria | 23182 |
| 104 | Ga0105251_10005958 | 3300009011 | Bacteria | 7870 |
| 105 | Ga0105251_10016388 | 3300009011 | Bacteria | 4006 |
| 106 | Ga0105251_10030420 | 3300009011 | Bacteria | 2712 |
| 107 | Ga0105251_10037071 | 3300009011 | Bacteria | 2394 |
| 108 | Ga0105251_10047470 | 3300009011 | Bacteria | 2063 |
| 109 | Ga0105251_10081030 | 3300009011 | Bacteria | 1500 |
| 110 | Ga0105244_10000113 | 3300009036 | Bacteria | 84458 |
| 111 | Ga0105244_10001018 | 3300009036 | Bacteria | 23466 |
| 112 | Ga0105244_10002954 | 3300009036 | Bacteria | 12531 |
| 113 | Ga0105244_10008244 | 3300009036 | Bacteria | 6527 |
| 114 | Ga0105244_10024075 | 3300009036 | Bacteria | 3328 |
| 115 | Ga0105244_10033139 | 3300009036 | Bacteria | 2726 |
| 116 | Ga0105250_10000047 | 3300009092 | Bacteria | 124276 |
| 117 | Ga0105250_10000393 | 3300009092 | Bacteria | 32467 |
| 118 | Ga0105250_10015432 | 3300009092 | Bacteria | 3127 |
| 119 | Ga0105250_10088088 | 3300009092 | Bacteria | 1261 |
| 120 | Ga0111539_10111983 | 3300009094 | Bacteria | 3202 |
| 121 | Ga0111539_10911049 | 3300009094 | Bacteria | 1022 |
| 122 | Ga0105245_10002025 | 3300009098 | Bacteria | 18380 |
| 123 | Ga0105247_10089659 | 3300009101 | Bacteria | 1950 |
| 124 | Ga0105243_10000170 | 3300009148 | Bacteria | 74646 |
| 125 | Ga0105243_10001782 | 3300009148 | Bacteria | 18475 |
| 126 | Ga0105243_10003572 | 3300009148 | Bacteria | 12555 |
| 127 | Ga0105243_10072319 | 3300009148 | Bacteria | 2791 |
| 128 | Ga0105242_10000292 | 3300009176 | Bacteria | 39953 |
| 129 | Ga0105242_10142126 | 3300009176 | Bacteria | 2084 |
| 130 | Ga0105248_10293948 | 3300009177 | Bacteria | 1829 |
| 131 | Ga0105237_10000618 | 3300009545 | Bacteria | 49609 |
| 132 | Ga0105237_10312662 | 3300009545 | Bacteria | 1574 |
| 133 | Ga0105237_10691288 | 3300009545 | Bacteria | 1027 |
| 134 | Ga0105237_10787467 | 3300009545 | Bacteria | 958 |
| 135 | Ga0105246_10000014 | 3300011119 | Bacteria | 66861 |
| 136 | Ga0105246_10000554 | 3300011119 | Bacteria | 20602 |
| 137 | Ga0105246_10001405 | 3300011119 | Bacteria | 14249 |
| 138 | Ga0105246_10017825 | 3300011119 | Bacteria | 4516 |
| 139 | Ga0105246_10273528 | 3300011119 | Bacteria | 1351 |
| 140 | Ga0105246_10285042 | 3300011119 | Bacteria | 1327 |
| 141 | Ga0157345_1000014 | 3300012498 | Bacteria | 50849 |
| 142 | Ga0157373_10001077 | 3300013100 | Bacteria | 21002 |
| 143 | Ga0157373_10001889 | 3300013100 | Bacteria | 15894 |
| 144 | Ga0157373_10002066 | 3300013100 | Bacteria | 15221 |
| 145 | Ga0157373_10003646 | 3300013100 | Bacteria | 11637 |
| 146 | Ga0157373_10004408 | 3300013100 | Bacteria | 10603 |
| 147 | Ga0157373_10004797 | 3300013100 | Bacteria | 10174 |
| 148 | Ga0157373_10008623 | 3300013100 | Bacteria | 7566 |
| 149 | Ga0157373_10012916 | 3300013100 | Bacteria | 6131 |
| 150 | Ga0157371_10001376 | 3300013102 | Bacteria | 25495 |
| 151 | Ga0157371_10002377 | 3300013102 | Bacteria | 18000 |
| 152 | Ga0157371_10002745 | 3300013102 | Bacteria | 16556 |
| 153 | Ga0157371_10006783 | 3300013102 | Bacteria | 9359 |
| 154 | Ga0157370_10008555 | 3300013104 | Bacteria | 11029 |
| 155 | Ga0157370_10013939 | 3300013104 | Bacteria | 8254 |
| 156 | Ga0157370_10023614 | 3300013104 | Bacteria | 6103 |
| 157 | Ga0157370_10112239 | 3300013104 | Bacteria | 2548 |
| 158 | Ga0157370_10142607 | 3300013104 | Bacteria | 2232 |
| 159 | Ga0157370_10262510 | 3300013104 | Bacteria | 1596 |
| 160 | Ga0157369_10000417 | 3300013105 | Bacteria | 56214 |
| 161 | Ga0157369_10002624 | 3300013105 | Bacteria | 21494 |
| 162 | Ga0157369_10003097 | 3300013105 | Bacteria | 19860 |
| 163 | Ga0157369_10004453 | 3300013105 | Bacteria | 16503 |
| 164 | Ga0157369_10006855 | 3300013105 | Bacteria | 13140 |
| 165 | Ga0157369_10023766 | 3300013105 | Bacteria | 6823 |
| 166 | Ga0157369_10024615 | 3300013105 | Bacteria | 6693 |
| 167 | Ga0157369_10305490 | 3300013105 | Bacteria | 1655 |
| 168 | Ga0157369_10561764 | 3300013105 | Bacteria | 1179 |
| 169 | Ga0157374_10146229 | 3300013296 | Bacteria | 2296 |
| 170 | Ga0163162_10000210 | 3300013306 | Bacteria | 54200 |
| 171 | Ga0163162_10009619 | 3300013306 | Bacteria | 9404 |
| 172 | Ga0163162_10720659 | 3300013306 | Bacteria | 1118 |
| 173 | Ga0163162_11062961 | 3300013306 | Bacteria | 916 |
| 174 | Ga0163162_11062962 | 3300013306 | Bacteria | 916 |
| 175 | Ga0157372_10001195 | 3300013307 | Bacteria | 28099 |
| 176 | Ga0157372_10002997 | 3300013307 | Bacteria | 18209 |
| 177 | Ga0157372_10111748 | 3300013307 | Bacteria | 3130 |
| 178 | Ga0157375_10002075 | 3300013308 | Bacteria | 17331 |
| 179 | Ga0157375_10005652 | 3300013308 | Bacteria | 10882 |
| 180 | Ga0182008_10000706 | 3300014497 | Bacteria | 23874 |
| 181 | Ga0182008_10000752 | 3300014497 | Bacteria | 22790 |
| 182 | Ga0182008_10002526 | 3300014497 | Bacteria | 11397 |
| 183 | Ga0182008_10009319 | 3300014497 | Bacteria | 5306 |
| 184 | Ga0182008_10034227 | 3300014497 | Bacteria | 2547 |
| 185 | Ga0182008_10074084 | 3300014497 | Bacteria | 1675 |
| 186 | Ga0157377_10000035 | 3300014745 | Bacteria | 116860 |
| 187 | Ga0157379_10237890 | 3300014968 | Bacteria | 1651 |
| 188 | Ga0182006_1001537 | 3300015261 | Bacteria | 13789 |
| 189 | Ga0182006_1001539 | 3300015261 | Bacteria | 13783 |
| 190 | Ga0182006_1002098 | 3300015261 | Bacteria | 11139 |
| 191 | Ga0182006_1007073 | 3300015261 | Bacteria | 5163 |
| 192 | Ga0182006_1016915 | 3300015261 | Bacteria | 3106 |
| 193 | Ga0182006_1090149 | 3300015261 | Bacteria | 1105 |
| 194 | Ga0182007_10000315 | 3300015262 | Bacteria | 30804 |
| 195 | Ga0182007_10002696 | 3300015262 | Bacteria | 8685 |
| 196 | Ga0182007_10010563 | 3300015262 | Bacteria | 3639 |
| 197 | Ga0182005_1001275 | 3300015265 | Bacteria | 10365 |
| 198 | Ga0182005_1002287 | 3300015265 | Bacteria | 7006 |
| 199 | Ga0182005_1004539 | 3300015265 | Bacteria | 4472 |
| 200 | Ga0163161_10000221 | 3300017792 | Bacteria | 51978 |
| 201 | Ga0163161_10005118 | 3300017792 | Bacteria | 9125 |
| 202 | Ga0163161_10007828 | 3300017792 | Bacteria | 7393 |
| 203 | Ga0163161_10009285 | 3300017792 | Bacteria | 6803 |
| 204 | Ga0163161_10023646 | 3300017792 | Bacteria | 4336 |
| 205 | Ga0163161_10030414 | 3300017792 | Bacteria | 3843 |
| 206 | Ga0163161_10041264 | 3300017792 | Bacteria | 3315 |
| 207 | Ga0163161_10052937 | 3300017792 | Bacteria | 2942 |
| 208 | Ga0163161_10070164 | 3300017792 | Bacteria | 2562 |
| 209 | Ga0163161_10457172 | 3300017792 | Bacteria | 1033 |
| 210 | Ga0209435_100778 | 3300025206 | Bacteria | 5215 |
| 211 | Ga0209760_100016 | 3300025207 | Bacteria | 173755 |
| 212 | Ga0209784_100023 | 3300025224 | Bacteria | 399841 |
| 213 | Ga0209566_100019 | 3300025225 | Bacteria | 414836 |
| 214 | Ga0209674_100034 | 3300025226 | Bacteria | 414903 |
| 215 | Ga0209147_100027 | 3300025229 | Bacteria | 414610 |
| 216 | Ga0209563_100037 | 3300025230 | Bacteria | 414903 |
| 217 | Ga0209563_102231 | 3300025230 | Bacteria | 4489 |
| 218 | Ga0207427_100022 | 3300025231 | Bacteria | 469701 |
| 219 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 220 | Ga0209258_100166 | 3300025242 | Bacteria | 148022 |
| 221 | Ga0209646_1000110 | 3300025246 | Bacteria | 156257 |
| 222 | Ga0209677_100021 | 3300025253 | Bacteria | 414954 |
| 223 | Ga0209759_1011401 | 3300025256 | Bacteria | 2529 |
| 224 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 225 | Ga0209565_1000015 | 3300025263 | Bacteria | 494091 |
| 226 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 227 | Ga0209130_1000063 | 3300025284 | Bacteria | 198142 |
| 228 | Ga0209675_1000012 | 3300025291 | Bacteria | 494061 |
| 229 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 230 | Ga0209676_1000050 | 3300025292 | Bacteria | 398350 |
| 231 | Ga0209676_1000777 | 3300025292 | Bacteria | 42671 |
| 232 | Ga0209676_1013219 | 3300025292 | Bacteria | 3189 |
| 233 | Ga0209676_1020135 | 3300025292 | Bacteria | 2275 |
| 234 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 235 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 236 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 237 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 238 | Ga0209050_1001872 | 3300025298 | Bacteria | 20226 |
| 239 | Ga0209256_1000346 | 3300025299 | Bacteria | 75456 |
| 240 | Ga0207426_1002554 | 3300025302 | Bacteria | 11397 |
| 241 | Ga0207426_1014840 | 3300025302 | Bacteria | 2846 |
| 242 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 243 | Ga0209051_1000438 | 3300025303 | Bacteria | 56435 |
| 244 | Ga0209051_1004148 | 3300025303 | Bacteria | 9059 |
| 245 | Ga0209257_1009378 | 3300025304 | Bacteria | 5264 |
| 246 | Ga0207656_10001465 | 3300025321 | Bacteria | 7824 |
| 247 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 248 | Ga0207696_1000017 | 3300025711 | Bacteria | 491130 |
| 249 | Ga0207696_1003966 | 3300025711 | Bacteria | 6516 |
| 250 | Ga0207696_1033548 | 3300025711 | Bacteria | 1538 |
| 251 | Ga0207696_1047711 | 3300025711 | Bacteria | 1233 |
| 252 | Ga0207655_1000074 | 3300025728 | Bacteria | 232056 |
| 253 | Ga0207655_1001619 | 3300025728 | Bacteria | 20023 |
| 254 | Ga0207655_1002477 | 3300025728 | Bacteria | 14961 |
| 255 | Ga0207655_1003770 | 3300025728 | Bacteria | 11113 |
| 256 | Ga0207655_1012987 | 3300025728 | Bacteria | 4814 |
| 257 | Ga0207655_1026761 | 3300025728 | Bacteria | 2762 |
| 258 | Ga0207655_1037546 | 3300025728 | Bacteria | 2132 |
| 259 | Ga0207655_1044996 | 3300025728 | Bacteria | 1848 |
| 260 | Ga0207655_1075595 | 3300025728 | Bacteria | 1235 |
| 261 | Ga0207713_1000369 | 3300025735 | Bacteria | 48934 |
| 262 | Ga0207713_1000634 | 3300025735 | Bacteria | 34196 |
| 263 | Ga0207713_1001110 | 3300025735 | Bacteria | 22998 |
| 264 | Ga0207713_1005223 | 3300025735 | Bacteria | 8190 |
| 265 | Ga0207713_1007056 | 3300025735 | Bacteria | 6728 |
| 266 | Ga0207713_1054312 | 3300025735 | Bacteria | 1571 |
| 267 | Ga0207713_1058575 | 3300025735 | Bacteria | 1483 |
| 268 | Ga0207710_10075327 | 3300025900 | Bacteria | 1555 |
| 269 | Ga0207647_10040798 | 3300025904 | Bacteria | 2921 |
| 270 | Ga0207643_10041813 | 3300025908 | Bacteria | 2584 |
| 271 | Ga0207695_10277586 | 3300025913 | Bacteria | 1570 |
| 272 | Ga0207671_10000964 | 3300025914 | Bacteria | 35697 |
| 273 | Ga0207649_10000146 | 3300025920 | Bacteria | 57984 |
| 274 | Ga0207681_10047560 | 3300025923 | Bacteria | 2891 |
| 275 | Ga0207681_10055629 | 3300025923 | Bacteria | 2696 |
| 276 | Ga0207681_10164426 | 3300025923 | Bacteria | 1676 |
| 277 | Ga0207694_10084412 | 3300025924 | Bacteria | 2498 |
| 278 | Ga0207650_10000865 | 3300025925 | Bacteria | 22953 |
| 279 | Ga0207687_10029261 | 3300025927 | Bacteria | 3705 |
| 280 | Ga0207644_10028782 | 3300025931 | Bacteria | 3850 |
| 281 | Ga0207706_10009548 | 3300025933 | Bacteria | 8909 |
| 282 | Ga0207686_10020116 | 3300025934 | Bacteria | 3808 |
| 283 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 284 | Ga0207709_10000858 | 3300025935 | Bacteria | 23259 |
| 285 | Ga0207709_10001664 | 3300025935 | Bacteria | 14986 |
| 286 | Ga0207665_10083484 | 3300025939 | Bacteria | 2203 |
| 287 | Ga0207691_10449838 | 3300025940 | Bacteria | 1096 |
| 288 | Ga0207711_10349351 | 3300025941 | Bacteria | 1369 |
| 289 | Ga0207689_10050466 | 3300025942 | Bacteria | 3430 |
| 290 | Ga0207679_10000097 | 3300025945 | Bacteria | 75900 |
| 291 | Ga0207668_10002267 | 3300025972 | Bacteria | 11223 |
| 292 | Ga0207640_10554256 | 3300025981 | Bacteria | 966 |
| 293 | Ga0207641_10000120 | 3300026088 | Bacteria | 116070 |
| 294 | Ga0207641_10025533 | 3300026088 | Bacteria | 4873 |
| 295 | Ga0207648_10000040 | 3300026089 | Bacteria | 116539 |
| 296 | Ga0207676_10000091 | 3300026095 | Bacteria | 82019 |
| 297 | Ga0207674_10059129 | 3300026116 | Bacteria | 3880 |
| 298 | Ga0207683_10243589 | 3300026121 | Bacteria | 1640 |
| 299 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 300 | Ga0209281_1000055 | 3300027111 | Bacteria | 308297 |
| 301 | Ga0209281_1001921 | 3300027111 | Bacteria | 9816 |
| 302 | Ga0209281_1003929 | 3300027111 | Bacteria | 4627 |
| 303 | Ga0207428_10006877 | 3300027907 | Bacteria | 10424 |
| 304 | Ga0207428_10052943 | 3300027907 | Bacteria | 3239 |
| 305 | Ga0207428_10076459 | 3300027907 | Bacteria | 2622 |
| 306 | Ga0207428_10112400 | 3300027907 | Bacteria | 2095 |
| 307 | Ga0207428_10278645 | 3300027907 | Bacteria | 1242 |
| 308 | Ga0268266_10412387 | 3300028379 | Bacteria | 1279 |
| 309 | Ga0268266_10481636 | 3300028379 | Bacteria | 1183 |
| 310 | Ga0268265_10013736 | 3300028380 | Bacteria | 5510 |
| 311 | Ga0265319_1000177 | 3300028563 | Bacteria | 48363 |
| 312 | Ga0265318_10000258 | 3300028577 | Bacteria | 46107 |
| 313 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 314 | Ga0307517_10190564 | 3300028786 | Bacteria | 1303 |
| 315 | Ga0307515_10128455 | 3300028794 | Bacteria | 2810 |
| 316 | Ga0265324_10000536 | 3300029957 | Bacteria | 26052 |
| 317 | Ga0265324_10112891 | 3300029957 | Bacteria | 923 |
| 318 | Ga0307512_10030456 | 3300030522 | Bacteria | 4694 |
| 319 | Ga0316178_1159482 | 3300030735 | Bacteria | 22902 |
| 320 | Ga0265330_10000359 | 3300031235 | Bacteria | 32172 |
| 321 | Ga0265332_10000138 | 3300031238 | Bacteria | 60108 |
| 322 | Ga0265328_10002580 | 3300031239 | Bacteria | 8115 |
| 323 | Ga0265328_10056884 | 3300031239 | Bacteria | 1435 |
| 324 | Ga0265320_10002735 | 3300031240 | Bacteria | 12195 |
| 325 | Ga0265325_10004955 | 3300031241 | Bacteria | 8299 |
| 326 | Ga0265325_10048260 | 3300031241 | Bacteria | 2201 |
| 327 | Ga0265329_10000076 | 3300031242 | Bacteria | 44517 |
| 328 | Ga0265340_10000688 | 3300031247 | Bacteria | 18993 |
| 329 | Ga0265339_10005622 | 3300031249 | Bacteria | 8319 |
| 330 | Ga0265331_10001134 | 3300031250 | Bacteria | 20335 |
| 331 | Ga0265331_10067422 | 3300031250 | Bacteria | 1679 |
| 332 | Ga0265327_10000681 | 3300031251 | Bacteria | 54587 |
| 333 | Ga0265327_10154522 | 3300031251 | Bacteria | 1064 |
| 334 | Ga0265316_10000843 | 3300031344 | Bacteria | 33894 |
| 335 | Ga0307509_10003432 | 3300031507 | Bacteria | 24057 |
| 336 | Ga0307408_100008176 | 3300031548 | Bacteria | 6910 |
| 337 | Ga0307408_100289878 | 3300031548 | Bacteria | 1366 |
| 338 | Ga0265313_10000089 | 3300031595 | Bacteria | 90452 |
| 339 | Ga0307514_10001667 | 3300031649 | Bacteria | 25806 |
| 340 | Ga0307514_10139272 | 3300031649 | Bacteria | 1653 |
| 341 | Ga0265314_10000211 | 3300031711 | Bacteria | 86370 |
| 342 | Ga0265342_10000390 | 3300031712 | Bacteria | 48465 |
| 343 | Ga0316576_10053093 | 3300031727 | Bacteria | 2953 |
| 344 | Ga0316576_10062189 | 3300031727 | Bacteria | 2737 |
| 345 | Ga0307412_10003248 | 3300031911 | Bacteria | 9036 |
| 346 | Ga0307412_10030227 | 3300031911 | Bacteria | 3408 |
| 347 | Ga0307409_100142661 | 3300031995 | Bacteria | 2066 |
| 348 | Ga0307416_100147453 | 3300032002 | Bacteria | 2151 |
| 349 | Ga0307416_100263493 | 3300032002 | Bacteria | 1686 |
| 350 | Ga0307414_10415776 | 3300032004 | Bacteria | 1171 |
| 351 | Ga0307411_10013877 | 3300032005 | Bacteria | 4463 |
| 352 | Ga0316583_10002676 | 3300032133 | Bacteria | 6228 |
| 353 | Ga0307510_10008022 | 3300033180 | Bacteria | 12565 |
| 354 | Ga0307510_10031972 | 3300033180 | Bacteria | 5935 |
| 355 | Ga0373931_0135990 | 3300035691 | Bacteria | 1419 |
| 356 | Ga0373937_0042280 | 3300036401 | Bacteria | 4157 |
| 357 | Ga0316584_0255742 | 3300036712 | Bacteria | 1278 |
| 358 | Ga0395905_0029368 | 3300037471 | Bacteria | 5180 |
| 359 | Ga0395905_0074385 | 3300037471 | Bacteria | 3183 |
| 360 | Ga0439438_001790 | 3300041405 | Bacteria | 9430 |
| 361 | Ga0439438_002060 | 3300041405 | Bacteria | 8729 |
| 362 | Ga0439438_002339 | 3300041405 | Bacteria | 8082 |
| 363 | Ga0439438_002391 | 3300041405 | Bacteria | 7994 |
| 364 | Ga0439439_0058117 | 3300041406 | Bacteria | 1023 |
| 365 | Ga0439447_000130 | 3300041407 | Bacteria | 25753 |
| 366 | Ga0439447_001809 | 3300041407 | Bacteria | 7835 |
| 367 | Ga0439447_002141 | 3300041407 | Bacteria | 7239 |
| 368 | Ga0439447_002328 | 3300041407 | Bacteria | 6945 |
| 369 | Ga0439447_003975 | 3300041407 | Bacteria | 5174 |
| 370 | Ga0439447_027876 | 3300041407 | Bacteria | 1439 |
| 371 | Ga0439466_0000227 | 3300041411 | Bacteria | 22275 |
| 372 | Ga0439466_0000530 | 3300041411 | Bacteria | 14407 |
| 373 | Ga0439466_0001072 | 3300041411 | Bacteria | 10565 |
| 374 | Ga0439466_0001383 | 3300041411 | Bacteria | 9450 |
| 375 | Ga0439466_0002138 | 3300041411 | Bacteria | 7748 |
| 376 | Ga0439466_0020568 | 3300041411 | Bacteria | 2350 |
| 377 | Ga0439466_0027583 | 3300041411 | Bacteria | 1966 |
| 378 | Ga0439466_0106545 | 3300041411 | Bacteria | 871 |
| 379 | Ga0439432_000016 | 3300042006 | Bacteria | 63199 |
| 380 | Ga0439432_000485 | 3300042006 | Bacteria | 14844 |
| 381 | Ga0439432_002780 | 3300042006 | Bacteria | 6524 |
| 382 | Ga0439432_006718 | 3300042006 | Bacteria | 4097 |
| 383 | Ga0439432_025172 | 3300042006 | Bacteria | 1954 |
| 384 | Ga0439449_0012448 | 3300042007 | Bacteria | 3198 |
| 385 | Ga0439451_000475 | 3300042009 | Bacteria | 7813 |
| 386 | Ga0439451_001556 | 3300042009 | Bacteria | 4534 |
| 387 | Ga0439451_004521 | 3300042009 | Bacteria | 2828 |
| 388 | Ga0439451_010667 | 3300042009 | Bacteria | 1851 |
| 389 | Ga0439452_000123 | 3300042010 | Bacteria | 59209 |
| 390 | Ga0439452_007770 | 3300042010 | Bacteria | 3263 |
| 391 | Ga0439452_009774 | 3300042010 | Bacteria | 2816 |
| 392 | Ga0439452_011180 | 3300042010 | Bacteria | 2587 |
| 393 | Ga0439456_003216 | 3300042013 | Bacteria | 3302 |
| 394 | Ga0439456_006054 | 3300042013 | Bacteria | 2462 |
| 395 | Ga0439456_009637 | 3300042013 | Bacteria | 1995 |
| 396 | Ga0439462_0004775 | 3300042015 | Bacteria | 3322 |
| 397 | Ga0439463_006609 | 3300042016 | Bacteria | 2870 |
| 398 | Ga0439463_050169 | 3300042016 | Bacteria | 1064 |
| 399 | Ga0450911_000510 | 3300042115 | Bacteria | 12299 |
| 400 | Ga0450911_002200 | 3300042115 | Bacteria | 3941 |
| 401 | Ga0450911_006530 | 3300042115 | Bacteria | 1734 |
| 402 | Ga0450922_001389 | 3300042124 | Bacteria | 2383 |
| 403 | Ga0450903_002021 | 3300042138 | Bacteria | 3656 |
| 404 | Ga0450903_017824 | 3300042138 | Bacteria | 1108 |
| 405 | Ga0450906_002391 | 3300042145 | Bacteria | 4109 |
| 406 | Ga0450907_000175 | 3300042146 | Bacteria | 23553 |
| 407 | Ga0450907_000547 | 3300042146 | Bacteria | 10232 |
| 408 | Ga0450910_000379 | 3300042147 | Bacteria | 5204 |
| 409 | Ga0439446_0007494 | 3300042156 | Bacteria | 2870 |
| 410 | Ga0439446_0015668 | 3300042156 | Bacteria | 2104 |
| 411 | Ga0450908_000208 | 3300042184 | Bacteria | 11906 |
| 412 | Ga0450909_000113 | 3300042185 | Bacteria | 8076 |
| 413 | Ga0439460_0006502 | 3300042461 | Bacteria | 2903 |
| 414 | Ga0439460_0063627 | 3300042461 | Bacteria | 1130 |
| 415 | Ga0450918_009443 | 3300042531 | Bacteria | 1710 |
| 416 | Ga0450901_000164 | 3300042533 | Bacteria | 7602 |
| 417 | Ga0451577_0014108 | 3300042876 | Bacteria | 7453 |
| 418 | Ga0451577_0015785 | 3300042876 | Bacteria | 7009 |
| 419 | Ga0451577_0036966 | 3300042876 | Bacteria | 4396 |
| 420 | Ga0451577_0038116 | 3300042876 | Bacteria | 4324 |
| 421 | Ga0451577_0092220 | 3300042876 | Unclassified | 2704 |
| 422 | Ga0439440_0001431 | 3300042993 | Bacteria | 4329 |
| 423 | Ga0439440_0005906 | 3300042993 | Bacteria | 2445 |
| 424 | Ga0466972_0010636 | 3300044658 | Bacteria | 4616 |
| 425 | Ga0453683_0007327 | 3300044673 | Bacteria | 7500 |
| 426 | Ga0453684_0000471 | 3300044712 | Bacteria | 159987 |
| 427 | Ga0453684_0010999 | 3300044712 | Bacteria | 15294 |
| 428 | Ga0453684_0011162 | 3300044712 | Bacteria | 15134 |
| 429 | Ga0453684_0084631 | 3300044712 | Bacteria | 3943 |
| 430 | Ga0453684_0121702 | 3300044712 | Bacteria | 3149 |
| 431 | Ga0453684_0124832 | 3300044712 | Bacteria | 3100 |
| 432 | Ga0451576_0000099 | 3300045051 | Bacteria | 220245 |
| 433 | Ga0451576_0000320 | 3300045051 | Bacteria | 116612 |
| 434 | Ga0451576_0001981 | 3300045051 | Bacteria | 32534 |
| 435 | Ga0451576_0027118 | 3300045051 | Bacteria | 6156 |
| 436 | Ga0451576_0039260 | 3300045051 | Bacteria | 5010 |
| 437 | Ga0451576_0045983 | 3300045051 | Bacteria | 4596 |
| 438 | Ga0451576_0124573 | 3300045051 | Bacteria | 2685 |
| 439 | Ga0451576_0701431 | 3300045051 | Bacteria | 1063 |
| 440 | Ga0495617_000074 | 3300046452 | Bacteria | 80489 |
| 441 | Ga0495617_000231 | 3300046452 | Bacteria | 33929 |
| 442 | Ga0495617_000317 | 3300046452 | Bacteria | 27128 |
| 443 | Ga0495617_009615 | 3300046452 | Bacteria | 3317 |
| 444 | Ga0495617_011812 | 3300046452 | Bacteria | 2978 |
| 445 | Ga0495617_022513 | 3300046452 | Bacteria | 2130 |
| 446 | Ga0495627_000369 | 3300046453 | Bacteria | 41831 |
| 447 | Ga0495627_000894 | 3300046453 | Bacteria | 20947 |
| 448 | Ga0495627_001104 | 3300046453 | Bacteria | 17592 |
| 449 | Ga0495627_003083 | 3300046453 | Bacteria | 7573 |
| 450 | Ga0495592_0000203 | 3300046454 | Bacteria | 50733 |
| 451 | Ga0495603_0003212 | 3300046455 | Bacteria | 9729 |
| 452 | Ga0495603_0020824 | 3300046455 | Bacteria | 3970 |
| 453 | Ga0495590_0000178 | 3300046457 | Bacteria | 37358 |
| 454 | Ga0495590_0000821 | 3300046457 | Bacteria | 14103 |
| 455 | Ga0495590_0000839 | 3300046457 | Bacteria | 13872 |
| 456 | Ga0495590_0021825 | 3300046457 | Bacteria | 2267 |
| 457 | Ga0495590_0033343 | 3300046457 | Bacteria | 1800 |
| 458 | Ga0495591_000086 | 3300046458 | Bacteria | 104667 |
| 459 | Ga0495591_000177 | 3300046458 | Bacteria | 65867 |
| 460 | Ga0495591_000949 | 3300046458 | Bacteria | 19807 |
| 461 | Ga0495591_001101 | 3300046458 | Bacteria | 17988 |
| 462 | Ga0495591_006794 | 3300046458 | Bacteria | 4981 |
| 463 | Ga0495591_030944 | 3300046458 | Bacteria | 1610 |
| 464 | Ga0495629_0000819 | 3300046459 | Bacteria | 25210 |
| 465 | Ga0495629_0003181 | 3300046459 | Bacteria | 12431 |
| 466 | Ga0495638_0001745 | 3300046460 | Bacteria | 19048 |
| 467 | Ga0495638_0007263 | 3300046460 | Bacteria | 7965 |
| 468 | Ga0495638_0021556 | 3300046460 | Bacteria | 4243 |
| 469 | Ga0495638_0025561 | 3300046460 | Bacteria | 3835 |
| 470 | Ga0495638_0033363 | 3300046460 | Bacteria | 3293 |
| 471 | Ga0495638_0038025 | 3300046460 | Bacteria | 3061 |
| 472 | Ga0495638_0057135 | 3300046460 | Bacteria | 2421 |
| 473 | Ga0495638_0074178 | 3300046460 | Bacteria | 2075 |
| 474 | Ga0495638_0097443 | 3300046460 | Bacteria | 1763 |
| 475 | Ga0495638_0328016 | 3300046460 | Bacteria | 815 |
| 476 | Ga0495653_0000427 | 3300046463 | Bacteria | 33277 |
| 477 | Ga0495653_0001253 | 3300046463 | Bacteria | 19659 |
| 478 | Ga0495653_0054643 | 3300046463 | Bacteria | 3050 |
| 479 | Ga0495653_0054793 | 3300046463 | Bacteria | 3045 |
| 480 | Ga0495650_0000294 | 3300046471 | Bacteria | 91542 |
| 481 | Ga0495650_0000522 | 3300046471 | Bacteria | 56293 |
| 482 | Ga0495650_0003349 | 3300046471 | Bacteria | 11775 |
| 483 | Ga0495650_0005875 | 3300046471 | Bacteria | 7807 |
| 484 | Ga0495650_0008823 | 3300046471 | Bacteria | 5825 |
| 485 | Ga0495650_0008974 | 3300046471 | Bacteria | 5749 |
| 486 | Ga0495650_0009991 | 3300046471 | Bacteria | 5341 |
| 487 | Ga0495650_0076093 | 3300046471 | Bacteria | 1305 |
| 488 | Ga0495580_0038238 | 3300046472 | Bacteria | 3438 |
| 489 | Ga0495582_0028869 | 3300046473 | Bacteria | 3045 |
| 490 | Ga0495605_0000189 | 3300046474 | Bacteria | 76904 |
| 491 | Ga0495605_0000585 | 3300046474 | Bacteria | 29313 |
| 492 | Ga0495605_0004347 | 3300046474 | Bacteria | 8332 |
| 493 | Ga0495605_0006681 | 3300046474 | Bacteria | 6604 |
| 494 | Ga0495605_0006695 | 3300046474 | Bacteria | 6595 |
| 495 | Ga0495605_0032805 | 3300046474 | Bacteria | 2641 |
| 496 | Ga0495605_0061185 | 3300046474 | Bacteria | 1802 |
| 497 | Ga0495639_0000002 | 3300046475 | Bacteria | 192403 |
| 498 | Ga0495639_0036924 | 3300046475 | Bacteria | 2189 |
| 499 | Ga0495662_0023017 | 3300046476 | Bacteria | 3008 |
| 500 | Ga0495664_0035404 | 3300046477 | Bacteria | 2939 |
| 501 | Ga0495664_0130985 | 3300046477 | Bacteria | 1518 |
| 502 | Ga0495584_0000019 | 3300046491 | Bacteria | 140608 |
| 503 | Ga0495584_0000084 | 3300046491 | Bacteria | 65138 |
| 504 | Ga0495584_0000094 | 3300046491 | Bacteria | 60342 |
| 505 | Ga0495584_0002625 | 3300046491 | Bacteria | 10138 |
| 506 | Ga0495584_0007539 | 3300046491 | Bacteria | 5670 |
| 507 | Ga0495584_0008888 | 3300046491 | Bacteria | 5193 |
| 508 | Ga0495584_0009580 | 3300046491 | Bacteria | 4989 |
| 509 | Ga0495584_0015470 | 3300046491 | Bacteria | 3887 |
| 510 | Ga0495584_0032547 | 3300046491 | Bacteria | 2639 |
| 511 | Ga0495584_0057247 | 3300046491 | Bacteria | 1961 |
| 512 | Ga0495584_0081367 | 3300046491 | Bacteria | 1630 |
| 513 | Ga0495584_0214834 | 3300046491 | Bacteria | 977 |
| 514 | Ga0495585_0000101 | 3300046492 | Bacteria | 91556 |
| 515 | Ga0495585_0001655 | 3300046492 | Bacteria | 17039 |
| 516 | Ga0495585_0002281 | 3300046492 | Bacteria | 13851 |
| 517 | Ga0495585_0002474 | 3300046492 | Bacteria | 13192 |
| 518 | Ga0495585_0004048 | 3300046492 | Bacteria | 9647 |
| 519 | Ga0495585_0007440 | 3300046492 | Bacteria | 6704 |
| 520 | Ga0495585_0008195 | 3300046492 | Bacteria | 6346 |
| 521 | Ga0495585_0028489 | 3300046492 | Bacteria | 3185 |
| 522 | Ga0495585_0035691 | 3300046492 | Bacteria | 2808 |
| 523 | Ga0495585_0075756 | 3300046492 | Bacteria | 1828 |
| 524 | Ga0495594_0188058 | 3300046499 | Bacteria | 1176 |
| 525 | Ga0495596_0000027 | 3300046500 | Bacteria | 104155 |
| 526 | Ga0495596_0009591 | 3300046500 | Bacteria | 4253 |
| 527 | Ga0495596_0033339 | 3300046500 | Bacteria | 2049 |
| 528 | Ga0495607_0000092 | 3300046501 | Bacteria | 93857 |
| 529 | Ga0495607_0001404 | 3300046501 | Bacteria | 21432 |
| 530 | Ga0495607_0002010 | 3300046501 | Bacteria | 17065 |
| 531 | Ga0495607_0002682 | 3300046501 | Bacteria | 14220 |
| 532 | Ga0495607_0005469 | 3300046501 | Bacteria | 9087 |
| 533 | Ga0495607_0005513 | 3300046501 | Bacteria | 9036 |
| 534 | Ga0495607_0007372 | 3300046501 | Bacteria | 7615 |
| 535 | Ga0495607_0018207 | 3300046501 | Bacteria | 4483 |
| 536 | Ga0495607_0030875 | 3300046501 | Bacteria | 3284 |
| 537 | Ga0495607_0257608 | 3300046501 | Bacteria | 837 |
| 538 | Ga0495583_0000445 | 3300046506 | Bacteria | 61949 |
| 539 | Ga0495583_0001410 | 3300046506 | Bacteria | 24498 |
| 540 | Ga0495583_0001452 | 3300046506 | Bacteria | 23971 |
| 541 | Ga0495583_0002185 | 3300046506 | Bacteria | 17422 |
| 542 | Ga0495606_0000625 | 3300046507 | Bacteria | 55768 |
| 543 | Ga0495606_0001005 | 3300046507 | Bacteria | 41122 |
| 544 | Ga0495606_0001535 | 3300046507 | Bacteria | 30529 |
| 545 | Ga0495606_0001830 | 3300046507 | Bacteria | 26928 |
| 546 | Ga0495606_0008703 | 3300046507 | Bacteria | 8740 |
| 547 | Ga0495606_0023245 | 3300046507 | Bacteria | 4497 |
| 548 | Ga0495606_0029221 | 3300046507 | Bacteria | 3875 |
| 549 | Ga0495606_0059497 | 3300046507 | Bacteria | 2450 |
| 550 | Ga0495610_0000722 | 3300046512 | Bacteria | 31430 |
| 551 | Ga0495610_0001435 | 3300046512 | Bacteria | 21058 |
| 552 | Ga0495610_0001943 | 3300046512 | Bacteria | 17781 |
| 553 | Ga0495610_0003870 | 3300046512 | Bacteria | 11372 |
| 554 | Ga0495610_0004236 | 3300046512 | Bacteria | 10685 |
| 555 | Ga0495610_0004286 | 3300046512 | Bacteria | 10609 |
| 556 | Ga0495610_0004894 | 3300046512 | Bacteria | 9732 |
| 557 | Ga0495610_0007190 | 3300046512 | Bacteria | 7486 |
| 558 | Ga0495610_0011004 | 3300046512 | Bacteria | 5566 |
| 559 | Ga0495610_0023294 | 3300046512 | Bacteria | 3370 |
| 560 | Ga0495610_0023373 | 3300046512 | Bacteria | 3363 |
| 561 | Ga0495610_0025696 | 3300046512 | Bacteria | 3155 |
| 562 | Ga0495610_0088789 | 3300046512 | Bacteria | 1404 |
| 563 | Ga0495616_0000079 | 3300046513 | Bacteria | 81296 |
| 564 | Ga0495616_0000249 | 3300046513 | Bacteria | 43451 |
| 565 | Ga0495616_0001332 | 3300046513 | Bacteria | 17256 |
| 566 | Ga0495616_0002103 | 3300046513 | Bacteria | 13366 |
| 567 | Ga0495616_0008289 | 3300046513 | Bacteria | 6168 |
| 568 | Ga0495616_0034797 | 3300046513 | Bacteria | 2612 |
| 569 | Ga0495616_0046726 | 3300046513 | Bacteria | 2183 |
| 570 | Ga0495616_0125259 | 3300046513 | Bacteria | 1182 |
| 571 | Ga0495620_0000106 | 3300046515 | Bacteria | 66942 |
| 572 | Ga0495620_0002056 | 3300046515 | Bacteria | 11719 |
| 573 | Ga0495620_0004913 | 3300046515 | Bacteria | 7498 |
| 574 | Ga0495620_0005977 | 3300046515 | Bacteria | 6742 |
| 575 | Ga0495620_0031462 | 3300046515 | Bacteria | 2431 |
| 576 | Ga0495628_0002997 | 3300046516 | Bacteria | 15135 |
| 577 | Ga0495630_0032152 | 3300046517 | Bacteria | 3908 |
| 578 | Ga0495631_0000072 | 3300046518 | Bacteria | 64445 |
| 579 | Ga0495631_0000824 | 3300046518 | Bacteria | 19819 |
| 580 | Ga0495631_0111770 | 3300046518 | Bacteria | 1174 |
| 581 | Ga0495631_0114888 | 3300046518 | Bacteria | 1157 |
| 582 | Ga0495632_0000200 | 3300046519 | Bacteria | 60951 |
| 583 | Ga0495632_0000204 | 3300046519 | Bacteria | 60521 |
| 584 | Ga0495632_0000243 | 3300046519 | Bacteria | 53988 |
| 585 | Ga0495632_0001300 | 3300046519 | Bacteria | 21132 |
| 586 | Ga0495632_0002506 | 3300046519 | Bacteria | 13919 |
| 587 | Ga0495632_0003289 | 3300046519 | Bacteria | 11543 |
| 588 | Ga0495632_0015268 | 3300046519 | Bacteria | 4315 |
| 589 | Ga0495632_0020383 | 3300046519 | Bacteria | 3590 |
| 590 | Ga0495632_0026646 | 3300046519 | Bacteria | 3039 |
| 591 | Ga0495632_0036592 | 3300046519 | Bacteria | 2496 |
| 592 | Ga0495632_0068762 | 3300046519 | Bacteria | 1705 |
| 593 | Ga0495637_0000256 | 3300046520 | Bacteria | 41886 |
| 594 | Ga0495637_0000545 | 3300046520 | Bacteria | 27051 |
| 595 | Ga0495637_0000847 | 3300046520 | Bacteria | 20183 |
| 596 | Ga0495637_0001339 | 3300046520 | Bacteria | 14775 |
| 597 | Ga0495637_0002416 | 3300046520 | Bacteria | 10336 |
| 598 | Ga0495637_0002592 | 3300046520 | Bacteria | 9925 |
| 599 | Ga0495637_0009604 | 3300046520 | Bacteria | 4716 |
| 600 | Ga0495637_0023096 | 3300046520 | Bacteria | 2830 |
| 601 | Ga0495637_0054432 | 3300046520 | Bacteria | 1662 |
| 602 | Ga0495637_0057761 | 3300046520 | Bacteria | 1601 |
| 603 | Ga0495637_0081881 | 3300046520 | Bacteria | 1285 |
| 604 | Ga0495643_0002227 | 3300046522 | Bacteria | 15757 |
| 605 | Ga0495643_0002647 | 3300046522 | Bacteria | 13892 |
| 606 | Ga0495643_0002651 | 3300046522 | Bacteria | 13868 |
| 607 | Ga0495643_0004175 | 3300046522 | Bacteria | 10254 |
| 608 | Ga0495643_0021611 | 3300046522 | Bacteria | 3688 |
| 609 | Ga0495643_0031498 | 3300046522 | Bacteria | 2950 |
| 610 | Ga0495643_0065328 | 3300046522 | Bacteria | 1921 |
| 611 | Ga0495644_0000022 | 3300046523 | Bacteria | 79714 |
| 612 | Ga0495644_0000098 | 3300046523 | Bacteria | 42137 |
| 613 | Ga0495644_0000932 | 3300046523 | Bacteria | 12152 |
| 614 | Ga0495644_0088910 | 3300046523 | Bacteria | 1165 |
| 615 | Ga0495648_0000396 | 3300046524 | Bacteria | 47811 |
| 616 | Ga0495648_0000461 | 3300046524 | Bacteria | 44058 |
| 617 | Ga0495648_0006863 | 3300046524 | Bacteria | 9194 |
| 618 | Ga0495648_0009619 | 3300046524 | Bacteria | 7458 |
| 619 | Ga0495648_0024609 | 3300046524 | Bacteria | 4094 |
| 620 | Ga0495648_0047974 | 3300046524 | Bacteria | 2633 |
| 621 | Ga0495648_0053370 | 3300046524 | Bacteria | 2449 |
| 622 | Ga0495648_0104773 | 3300046524 | Bacteria | 1552 |
| 623 | Ga0495648_0133070 | 3300046524 | Bacteria | 1319 |
| 624 | Ga0495648_0194371 | 3300046524 | Bacteria | 1021 |
| 625 | Ga0495666_0000015 | 3300046526 | Bacteria | 76311 |
| 626 | Ga0495666_0018898 | 3300046526 | Bacteria | 3423 |
| 627 | Ga0495666_0052621 | 3300046526 | Bacteria | 1955 |
| 628 | Ga0495666_0107110 | 3300046526 | Bacteria | 1314 |
| 629 | Ga0495642_0000043 | 3300046528 | Bacteria | 74977 |
| 630 | Ga0495642_0000119 | 3300046528 | Bacteria | 45337 |
| 631 | Ga0495642_0000575 | 3300046528 | Bacteria | 18424 |
| 632 | Ga0495642_0002942 | 3300046528 | Bacteria | 6788 |
| 633 | Ga0495642_0038533 | 3300046528 | Bacteria | 1937 |
| 634 | Ga0495652_0002621 | 3300046529 | Bacteria | 18366 |
| 635 | Ga0495654_0000239 | 3300046530 | Bacteria | 51583 |
| 636 | Ga0495654_0000382 | 3300046530 | Bacteria | 38175 |
| 637 | Ga0495654_0000560 | 3300046530 | Bacteria | 30039 |
| 638 | Ga0495654_0000781 | 3300046530 | Bacteria | 24557 |
| 639 | Ga0495654_0002354 | 3300046530 | Bacteria | 12214 |
| 640 | Ga0495654_0008334 | 3300046530 | Bacteria | 5730 |
| 641 | Ga0495654_0009503 | 3300046530 | Bacteria | 5330 |
| 642 | Ga0495654_0010621 | 3300046530 | Bacteria | 5003 |
| 643 | Ga0495654_0021065 | 3300046530 | Bacteria | 3394 |
| 644 | Ga0495654_0021345 | 3300046530 | Bacteria | 3369 |
| 645 | Ga0495654_0022158 | 3300046530 | Bacteria | 3302 |
| 646 | Ga0495665_0000011 | 3300046531 | Bacteria | 71017 |
| 647 | Ga0495665_0016754 | 3300046531 | Bacteria | 3945 |
| 648 | Ga0495586_0011759 | 3300046535 | Bacteria | 4654 |
| 649 | Ga0495586_0263805 | 3300046535 | Bacteria | 984 |
| 650 | Ga0495587_0001836 | 3300046536 | Bacteria | 14161 |
| 651 | Ga0495587_0048545 | 3300046536 | Bacteria | 2513 |
| 652 | Ga0495609_0000160 | 3300046538 | Bacteria | 69846 |
| 653 | Ga0495609_0002853 | 3300046538 | Bacteria | 10335 |
| 654 | Ga0495609_0003497 | 3300046538 | Bacteria | 8978 |
| 655 | Ga0495609_0005248 | 3300046538 | Bacteria | 6882 |
| 656 | Ga0495609_0097130 | 3300046538 | Bacteria | 1278 |
| 657 | Ga0495597_0000776 | 3300046542 | Bacteria | 25284 |
| 658 | Ga0495597_0001758 | 3300046542 | Bacteria | 14894 |
| 659 | Ga0495597_0016121 | 3300046542 | Bacteria | 3532 |
| 660 | Ga0495597_0042031 | 3300046542 | Bacteria | 2039 |
| 661 | Ga0495597_0076094 | 3300046542 | Bacteria | 1439 |
| 662 | Ga0495645_0006438 | 3300046543 | Bacteria | 8147 |
| 663 | Ga0495645_0071074 | 3300046543 | Bacteria | 2510 |
| 664 | Ga0495622_0000378 | 3300046557 | Bacteria | 30622 |
| 665 | Ga0495622_0000411 | 3300046557 | Bacteria | 28575 |
| 666 | Ga0495622_0003600 | 3300046557 | Bacteria | 7274 |
| 667 | Ga0495622_0010921 | 3300046557 | Bacteria | 4189 |
| 668 | Ga0495622_0051318 | 3300046557 | Bacteria | 1913 |
| 669 | Ga0495633_0004863 | 3300046558 | Bacteria | 8401 |
| 670 | Ga0495633_0015278 | 3300046558 | Bacteria | 3986 |
| 671 | Ga0495667_0014469 | 3300046559 | Bacteria | 5331 |
| 672 | Ga0495656_0051121 | 3300046615 | Bacteria | 1767 |
| 673 | Ga0495668_0000281 | 3300046616 | Bacteria | 70290 |
| 674 | Ga0495668_0001550 | 3300046616 | Bacteria | 21791 |
| 675 | Ga0495668_0015324 | 3300046616 | Bacteria | 4480 |
| 676 | Ga0495668_0025087 | 3300046616 | Bacteria | 3389 |
| 677 | Ga0495634_0000218 | 3300046642 | Bacteria | 53752 |
| 678 | Ga0495611_0000048 | 3300046648 | Bacteria | 85172 |
| 679 | Ga0495611_0004661 | 3300046648 | Bacteria | 5888 |
| 680 | Ga0495611_0024482 | 3300046648 | Bacteria | 2626 |
| 681 | Ga0495625_0000790 | 3300046660 | Bacteria | 43942 |
| 682 | Ga0495625_0003012 | 3300046660 | Bacteria | 17365 |
| 683 | Ga0495625_0003190 | 3300046660 | Bacteria | 16661 |
| 684 | Ga0495625_0004247 | 3300046660 | Bacteria | 13644 |
| 685 | Ga0495625_0012811 | 3300046660 | Bacteria | 6780 |
| 686 | Ga0495625_0014191 | 3300046660 | Bacteria | 6371 |
| 687 | Ga0495625_0015309 | 3300046660 | Bacteria | 6078 |
| 688 | Ga0495625_0020970 | 3300046660 | Bacteria | 5037 |
| 689 | Ga0495625_0110067 | 3300046660 | Bacteria | 1883 |
| 690 | Ga0495625_0276637 | 3300046660 | Bacteria | 1081 |
| 691 | Ga0495635_0001815 | 3300046663 | Bacteria | 14425 |
| 692 | Ga0495635_0005778 | 3300046663 | Bacteria | 8625 |
| 693 | Ga0495635_0016161 | 3300046663 | Bacteria | 5210 |
| 694 | Ga0495659_0000035 | 3300046664 | Bacteria | 64001 |
| 695 | Ga0495659_0001278 | 3300046664 | Bacteria | 8655 |
| 696 | Ga0495659_0003768 | 3300046664 | Bacteria | 4817 |
| 697 | Ga0495661_0000011 | 3300046665 | Bacteria | 277997 |
| 698 | Ga0495661_0001173 | 3300046665 | Bacteria | 22811 |
| 699 | Ga0495661_0002752 | 3300046665 | Bacteria | 13365 |
| 700 | Ga0495661_0004925 | 3300046665 | Bacteria | 9554 |
| 701 | Ga0495661_0007307 | 3300046665 | Bacteria | 7700 |
| 702 | Ga0495661_0010217 | 3300046665 | Bacteria | 6413 |
| 703 | Ga0495661_0043912 | 3300046665 | Bacteria | 2744 |
| 704 | Ga0495661_0061949 | 3300046665 | Bacteria | 2218 |
| 705 | Ga0495661_0097042 | 3300046665 | Bacteria | 1665 |
| 706 | Ga0495588_0000433 | 3300046674 | Bacteria | 21750 |
| 707 | Ga0495623_0003360 | 3300046679 | Bacteria | 10579 |
| 708 | Ga0495623_0006494 | 3300046679 | Bacteria | 7611 |
| 709 | Ga0495646_0000777 | 3300046680 | Bacteria | 17813 |
| 710 | Ga0495646_0001145 | 3300046680 | Bacteria | 15478 |
| 711 | Ga0495646_0006387 | 3300046680 | Bacteria | 7475 |
| 712 | Ga0495646_0007303 | 3300046680 | Bacteria | 7019 |
| 713 | Ga0495646_0017436 | 3300046680 | Bacteria | 4555 |
| 714 | Ga0495658_0043765 | 3300046683 | Bacteria | 2506 |
| 715 | Ga0495669_0001494 | 3300046684 | Bacteria | 9642 |
| 716 | Ga0495669_0010225 | 3300046684 | Bacteria | 3963 |
| 717 | Ga0495669_0090569 | 3300046684 | Bacteria | 1411 |
| 718 | Ga0495624_0000133 | 3300046690 | Bacteria | 52717 |
| 719 | Ga0495624_0001440 | 3300046690 | Bacteria | 18484 |
| 720 | Ga0495670_0000169 | 3300046691 | Bacteria | 28831 |
| 721 | Ga0495670_0000280 | 3300046691 | Bacteria | 24045 |
| 722 | Ga0495670_0023001 | 3300046691 | Bacteria | 3076 |
| 723 | Ga0495670_0110925 | 3300046691 | Bacteria | 1419 |
| 724 | Ga0495670_0127301 | 3300046691 | Bacteria | 1326 |
| 725 | Ga0495671_0000136 | 3300046692 | Bacteria | 65148 |
| 726 | Ga0495671_0001038 | 3300046692 | Bacteria | 19312 |
| 727 | Ga0495671_0001847 | 3300046692 | Bacteria | 13620 |
| 728 | Ga0495671_0005112 | 3300046692 | Bacteria | 7720 |
| 729 | Ga0495671_0015228 | 3300046692 | Bacteria | 4127 |
| 730 | Ga0495671_0025531 | 3300046692 | Bacteria | 3070 |
| 731 | Ga0495671_0044501 | 3300046692 | Bacteria | 2226 |
| 732 | Ga0495671_0080112 | 3300046692 | Bacteria | 1600 |
| 733 | Ga0495671_0102923 | 3300046692 | Bacteria | 1395 |
| 734 | Ga0495671_0116602 | 3300046692 | Bacteria | 1303 |
| 735 | Ga0495649_0000083 | 3300046694 | Bacteria | 81883 |
| 736 | Ga0495649_0000316 | 3300046694 | Bacteria | 42011 |
| 737 | Ga0495649_0000430 | 3300046694 | Bacteria | 36287 |
| 738 | Ga0495649_0000495 | 3300046694 | Bacteria | 33735 |
| 739 | Ga0495649_0001099 | 3300046694 | Bacteria | 21118 |
| 740 | Ga0495649_0008492 | 3300046694 | Bacteria | 6172 |
| 741 | Ga0495649_0012954 | 3300046694 | Bacteria | 4827 |
| 742 | Ga0495649_0013424 | 3300046694 | Bacteria | 4725 |
| 743 | Ga0495649_0020775 | 3300046694 | Bacteria | 3679 |
| 744 | Ga0495649_0023261 | 3300046694 | Bacteria | 3463 |
| 745 | Ga0495649_0023527 | 3300046694 | Bacteria | 3441 |
| 746 | Ga0495649_0042659 | 3300046694 | Bacteria | 2477 |
| 747 | Ga0495589_0002311 | 3300046794 | Bacteria | 10710 |
| 748 | Ga0495589_0004383 | 3300046794 | Bacteria | 7517 |
| 749 | Ga0495589_0006414 | 3300046794 | Bacteria | 6211 |
| 750 | Ga0495589_0011742 | 3300046794 | Bacteria | 4544 |
| 751 | Ga0495589_0019791 | 3300046794 | Bacteria | 3444 |
| 752 | Ga0495600_0007213 | 3300046809 | Bacteria | 6786 |
| 753 | Ga0495600_0025616 | 3300046809 | Bacteria | 3801 |
| 754 | Ga0495660_0000487 | 3300046810 | Bacteria | 33011 |
| 755 | Ga0495660_0001546 | 3300046810 | Bacteria | 15491 |
| 756 | Ga0495660_0003102 | 3300046810 | Bacteria | 10360 |
| 757 | Ga0495660_0007904 | 3300046810 | Bacteria | 6244 |
| 758 | Ga0495660_0009323 | 3300046810 | Bacteria | 5724 |
| 759 | Ga0495660_0029073 | 3300046810 | Bacteria | 3120 |
| 760 | Ga0495660_0046984 | 3300046810 | Bacteria | 2365 |
| 761 | Ga0495660_0060109 | 3300046810 | Bacteria | 2042 |
| 762 | Ga0495660_0157927 | 3300046810 | Bacteria | 1114 |
| 763 | Ga0495581_0009537 | 3300047315 | Bacteria | 5616 |
| 764 | Ga0495604_0001695 | 3300047317 | Bacteria | 18122 |
| 765 | Ga0495604_0006676 | 3300047317 | Bacteria | 9145 |
| 766 | Ga0495604_0026862 | 3300047317 | Bacteria | 4581 |
| 767 | Ga0495636_0005171 | 3300047318 | Bacteria | 5118 |
| 768 | Ga0495674_0012957 | 3300047319 | Bacteria | 7849 |
| 769 | Ga0495674_0037134 | 3300047319 | Bacteria | 4378 |
| 770 | Ga0495674_0104487 | 3300047319 | Bacteria | 2408 |
| 771 | Ga0495672_0001626 | 3300047320 | Bacteria | 21880 |
| 772 | Ga0495672_0001695 | 3300047320 | Bacteria | 21354 |
| 773 | Ga0495672_0002779 | 3300047320 | Bacteria | 15644 |
| 774 | Ga0495672_0006170 | 3300047320 | Bacteria | 9347 |
| 775 | Ga0495672_0006897 | 3300047320 | Bacteria | 8659 |
| 776 | Ga0495672_0007362 | 3300047320 | Bacteria | 8290 |
| 777 | Ga0495672_0009071 | 3300047320 | Bacteria | 7253 |
| 778 | Ga0495672_0011128 | 3300047320 | Bacteria | 6364 |
| 779 | Ga0495672_0011198 | 3300047320 | Bacteria | 6339 |
| 780 | Ga0495672_0060206 | 3300047320 | Bacteria | 2194 |
| 781 | Ga0495672_0154326 | 3300047320 | Bacteria | 1187 |
| 782 | Ga0495676_0000178 | 3300047321 | Bacteria | 50077 |
| 783 | Ga0495676_0002539 | 3300047321 | Bacteria | 16239 |
| 784 | Ga0495680_0000939 | 3300047322 | Bacteria | 32333 |
| 785 | Ga0495680_0002463 | 3300047322 | Bacteria | 18949 |
| 786 | Ga0495680_0003676 | 3300047322 | Bacteria | 14983 |
| 787 | Ga0495680_0011267 | 3300047322 | Bacteria | 7927 |
| 788 | Ga0495680_0018941 | 3300047322 | Bacteria | 5829 |
| 789 | Ga0495680_0066668 | 3300047322 | Bacteria | 2754 |
| 790 | Ga0495680_0226498 | 3300047322 | Bacteria | 1332 |
| 791 | Ga0495680_0239683 | 3300047322 | Bacteria | 1288 |
| 792 | Ga0495683_0001324 | 3300047323 | Bacteria | 16613 |
| 793 | Ga0495683_0001705 | 3300047323 | Bacteria | 13955 |
| 794 | Ga0495683_0004324 | 3300047323 | Bacteria | 8094 |
| 795 | Ga0495683_0006186 | 3300047323 | Bacteria | 6556 |
| 796 | Ga0495683_0067648 | 3300047323 | Bacteria | 1758 |
| 797 | Ga0495683_0068104 | 3300047323 | Bacteria | 1751 |
| 798 | Ga0495687_001541 | 3300047443 | Bacteria | 20940 |
| 799 | Ga0495687_002798 | 3300047443 | Bacteria | 13462 |
| 800 | Ga0495687_008086 | 3300047443 | Bacteria | 6077 |
| 801 | Ga0495687_011380 | 3300047443 | Bacteria | 4791 |
| 802 | Ga0495687_054899 | 3300047443 | Bacteria | 1669 |
| 803 | Ga0495675_0001899 | 3300047444 | Bacteria | 12444 |
| 804 | Ga0495677_0000425 | 3300047445 | Bacteria | 18123 |
| 805 | Ga0495679_000224 | 3300047446 | Bacteria | 47851 |
| 806 | Ga0495679_000550 | 3300047446 | Bacteria | 26414 |
| 807 | Ga0495679_000801 | 3300047446 | Bacteria | 19954 |
| 808 | Ga0495679_001151 | 3300047446 | Bacteria | 15824 |
| 809 | Ga0495679_004735 | 3300047446 | Bacteria | 6178 |
| 810 | Ga0495679_010182 | 3300047446 | Bacteria | 3710 |
| 811 | Ga0495679_043309 | 3300047446 | Bacteria | 1384 |
| 812 | Ga0495685_004329 | 3300047447 | Bacteria | 4579 |
| 813 | Ga0495673_0000276 | 3300047469 | Bacteria | 69967 |
| 814 | Ga0495673_0000479 | 3300047469 | Bacteria | 42800 |
| 815 | Ga0495673_0000945 | 3300047469 | Bacteria | 26309 |
| 816 | Ga0495673_0001202 | 3300047469 | Bacteria | 21580 |
| 817 | Ga0495673_0001803 | 3300047469 | Bacteria | 16220 |
| 818 | Ga0495673_0002783 | 3300047469 | Bacteria | 11963 |
| 819 | Ga0495673_0004029 | 3300047469 | Bacteria | 9367 |
| 820 | Ga0495673_0013477 | 3300047469 | Bacteria | 4289 |
| 821 | Ga0495673_0037014 | 3300047469 | Bacteria | 2232 |
| 822 | Ga0495673_0041120 | 3300047469 | Bacteria | 2084 |
| 823 | Ga0495681_0000031 | 3300047470 | Bacteria | 128177 |
| 824 | Ga0495681_0000377 | 3300047470 | Bacteria | 34813 |
| 825 | Ga0495681_0001017 | 3300047470 | Bacteria | 21462 |
| 826 | Ga0495681_0002674 | 3300047470 | Bacteria | 12624 |
| 827 | Ga0495681_0003336 | 3300047470 | Bacteria | 11169 |
| 828 | Ga0495681_0003348 | 3300047470 | Bacteria | 11152 |
| 829 | Ga0495681_0004763 | 3300047470 | Bacteria | 9192 |
| 830 | Ga0495681_0007992 | 3300047470 | Bacteria | 6681 |
| 831 | Ga0495686_0002283 | 3300047472 | Bacteria | 18416 |
| 832 | Ga0495686_0002866 | 3300047472 | Bacteria | 15527 |
| 833 | Ga0495686_0015258 | 3300047472 | Bacteria | 5253 |
| 834 | Ga0495686_0108371 | 3300047472 | Bacteria | 1669 |
| 835 | Ga0495593_0000147 | 3300047673 | Bacteria | 34669 |
| 836 | Ga0495593_0000378 | 3300047673 | Bacteria | 24648 |
| 837 | Ga0495593_0007762 | 3300047673 | Bacteria | 6253 |
| 838 | Ga0495593_0018168 | 3300047673 | Bacteria | 3954 |
| 839 | Ga0495593_0022104 | 3300047673 | Bacteria | 3548 |
| 840 | Ga0495593_0030627 | 3300047673 | Bacteria | 2943 |
| 841 | Ga0495593_0109893 | 3300047673 | Bacteria | 1408 |
| 842 | Ga0495602_0000644 | 3300048088 | Bacteria | 32644 |
| 843 | Ga0495602_0001483 | 3300048088 | Bacteria | 23331 |
| 844 | Ga0495602_0046370 | 3300048088 | Bacteria | 3926 |
| 845 | Ga0495614_0122550 | 3300048089 | Bacteria | 1147 |
| 846 | Ga0495626_0000077 | 3300048091 | Bacteria | 130910 |
| 847 | Ga0495626_0000247 | 3300048091 | Bacteria | 62776 |
| 848 | Ga0495626_0000277 | 3300048091 | Bacteria | 56289 |
| 849 | Ga0495626_0000310 | 3300048091 | Bacteria | 51701 |
| 850 | Ga0495626_0001215 | 3300048091 | Bacteria | 21240 |
| 851 | Ga0495626_0001915 | 3300048091 | Bacteria | 15471 |
| 852 | Ga0495626_0001995 | 3300048091 | Bacteria | 15066 |
| 853 | Ga0495626_0008193 | 3300048091 | Bacteria | 5756 |
| 854 | Ga0495626_0022754 | 3300048091 | Bacteria | 3093 |
| 855 | Ga0495626_0076674 | 3300048091 | Bacteria | 1491 |
| 856 | Ga0496100_0020050 | 3300048903 | Bacteria | 4002 |
| 857 | Ga0496100_0071617 | 3300048903 | Bacteria | 2315 |
| 858 | Ga0496101_0001181 | 3300048904 | Bacteria | 15657 |
| 859 | Ga0496102_0000475 | 3300048905 | Bacteria | 44485 |
| 860 | Ga0496102_0026173 | 3300048905 | Bacteria | 5199 |
| 861 | Ga0496103_0001728 | 3300048906 | Bacteria | 14256 |
| 862 | Ga0496104_0296771 | 3300048907 | Bacteria | 1528 |
| 863 | Ga0496104_0341152 | 3300048907 | Bacteria | 1411 |
| 864 | Ga0496105_0034177 | 3300048908 | Bacteria | 4181 |
| 865 | Ga0496105_0252899 | 3300048908 | Bacteria | 1427 |
| 866 | Ga0496106_0001408 | 3300048909 | Bacteria | 18043 |
| 867 | Ga0496107_0025407 | 3300048910 | Bacteria | 4194 |
| 868 | Ga0496109_0093301 | 3300048912 | Bacteria | 2786 |
| 869 | Ga0496110_0137563 | 3300048913 | Bacteria | 2208 |
| 870 | Ga0496111_0010280 | 3300048914 | Bacteria | 6270 |
| 871 | Ga0496112_0092939 | 3300048915 | Bacteria | 2986 |
| 872 | Ga0496113_0007984 | 3300048916 | Bacteria | 6858 |
| 873 | Ga0496114_0001072 | 3300048917 | Bacteria | 20590 |
| 874 | Ga0496115_0110338 | 3300048918 | Bacteria | 2260 |
| 875 | Ga0496115_0145875 | 3300048918 | Bacteria | 1953 |
| 876 | Ga0496116_0000010 | 3300048919 | Bacteria | 665608 |
| 877 | Ga0496116_0000435 | 3300048919 | Bacteria | 58557 |
| 878 | Ga0496116_0000951 | 3300048919 | Bacteria | 35680 |
| 879 | Ga0496116_0011667 | 3300048919 | Bacteria | 7245 |
| 880 | Ga0496117_0001606 | 3300048920 | Bacteria | 31979 |
| 881 | Ga0496117_0002171 | 3300048920 | Bacteria | 25570 |
| 882 | Ga0496117_0007543 | 3300048920 | Bacteria | 10599 |
| 883 | Ga0496117_0009807 | 3300048920 | Bacteria | 8827 |
| 884 | Ga0496117_0014140 | 3300048920 | Bacteria | 6898 |
| 885 | Ga0496117_0021855 | 3300048920 | Bacteria | 5157 |
| 886 | Ga0496117_0094932 | 3300048920 | Bacteria | 1907 |
| 887 | Ga0496117_0212396 | 3300048920 | Bacteria | 1084 |
| 888 | Ga0496118_0000434 | 3300048921 | Bacteria | 69469 |
| 889 | Ga0496118_0003714 | 3300048921 | Bacteria | 18912 |
| 890 | Ga0496118_0005118 | 3300048921 | Bacteria | 15064 |
| 891 | Ga0496118_0008349 | 3300048921 | Bacteria | 10718 |
| 892 | Ga0496118_0068622 | 3300048921 | Bacteria | 2573 |
| 893 | Ga0496118_0246785 | 3300048921 | Bacteria | 1018 |
| 894 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 895 | Ga0496120_0000306 | 3300048923 | Bacteria | 81699 |
| 896 | Ga0496120_0002732 | 3300048923 | Bacteria | 17224 |
| 897 | Ga0496120_0130691 | 3300048923 | Bacteria | 1286 |
| 898 | Ga0496121_0000050 | 3300048924 | Bacteria | 318295 |
| 899 | Ga0496121_0002613 | 3300048924 | Bacteria | 27210 |
| 900 | Ga0496121_0009486 | 3300048924 | Bacteria | 11172 |
| 901 | Ga0496121_0010556 | 3300048924 | Bacteria | 10389 |
| 902 | Ga0496121_0103391 | 3300048924 | Bacteria | 2191 |
| 903 | Ga0496121_0265268 | 3300048924 | Bacteria | 1183 |
| 904 | Ga0496121_0282268 | 3300048924 | Bacteria | 1135 |
| 905 | Ga0496122_0000544 | 3300048925 | Bacteria | 78038 |
| 906 | Ga0496122_0004185 | 3300048925 | Bacteria | 18147 |
| 907 | Ga0496122_0074126 | 3300048925 | Bacteria | 2409 |
| 908 | Ga0496122_0095048 | 3300048925 | Bacteria | 2015 |
| 909 | Ga0496122_0113780 | 3300048925 | Bacteria | 1767 |
| 910 | Ga0496122_0219687 | 3300048925 | Bacteria | 1092 |
| 911 | Ga0496123_0001978 | 3300048926 | Bacteria | 26544 |
| 912 | Ga0496123_0002628 | 3300048926 | Bacteria | 21765 |
| 913 | Ga0496123_0023766 | 3300048926 | Bacteria | 4681 |
| 914 | Ga0496123_0043282 | 3300048926 | Bacteria | 3096 |
| 915 | Ga0496123_0065743 | 3300048926 | Bacteria | 2302 |
| 916 | Ga0496124_0000086 | 3300048927 | Bacteria | 202844 |
| 917 | Ga0496124_0003120 | 3300048927 | Bacteria | 20563 |
| 918 | Ga0496124_0012738 | 3300048927 | Bacteria | 8266 |
| 919 | Ga0496124_0020438 | 3300048927 | Bacteria | 6116 |
| 920 | Ga0496124_0068122 | 3300048927 | Bacteria | 2959 |
| 921 | Ga0496125_0000665 | 3300048928 | Bacteria | 57218 |
| 922 | Ga0496125_0003087 | 3300048928 | Bacteria | 20788 |
| 923 | Ga0496125_0004650 | 3300048928 | Bacteria | 15661 |
| 924 | Ga0496125_0007718 | 3300048928 | Bacteria | 11396 |
| 925 | Ga0496125_0010687 | 3300048928 | Bacteria | 9262 |
| 926 | Ga0496125_0022274 | 3300048928 | Bacteria | 5887 |
| 927 | Ga0496125_0025595 | 3300048928 | Bacteria | 5400 |
| 928 | Ga0496126_0007071 | 3300048929 | Bacteria | 12361 |
| 929 | Ga0496126_0058421 | 3300048929 | Bacteria | 3477 |
| 930 | Ga0496126_0251349 | 3300048929 | Bacteria | 1473 |
| 931 | Ga0495678_000255 | 3300049459 | Bacteria | 59619 |
| 932 | Ga0495678_001235 | 3300049459 | Bacteria | 20849 |
| 933 | Ga0495678_001291 | 3300049459 | Bacteria | 20231 |
| 934 | Ga0495678_002715 | 3300049459 | Bacteria | 11655 |
| 935 | Ga0495678_016381 | 3300049459 | Bacteria | 3391 |
| 936 | Ga0495678_043814 | 3300049459 | Bacteria | 1774 |
| 937 | Ga0495678_047972 | 3300049459 | Bacteria | 1668 |
| 938 | Ga0495678_059280 | 3300049459 | Bacteria | 1443 |
| 939 | Ga0495682_0000542 | 3300049460 | Bacteria | 26108 |
| 940 | Ga0495682_0000701 | 3300049460 | Bacteria | 21947 |
| 941 | Ga0495682_0005895 | 3300049460 | Bacteria | 5028 |
| 942 | Ga0495682_0090547 | 3300049460 | Bacteria | 1098 |
| 943 | Ga0501032_0044703 | 3300049569 | Bacteria | 2997 |
| 944 | Ga0501034_0091139 | 3300049571 | Bacteria | 3046 |
| 945 | Ga0501034_0392484 | 3300049571 | Bacteria | 1312 |
| 946 | Ga0501257_019127 | 3300049686 | Bacteria | 1601 |
| 947 | Ga0501241_000072 | 3300049758 | Bacteria | 23226 |
| 948 | nmdc:mga03683_182881_c1 | 3300050489 | Bacteria | 957 |
| 949 | nmdc:mga00v17_156239_c1 | 3300050491 | Bacteria | 1467 |
| 950 | nmdc:mga00v17_18917_c1 | 3300050491 | Bacteria | 3921 |
| 951 | nmdc:mga0k408_11123_c1 | 3300050493 | Bacteria | 3780 |
| 952 | nmdc:mga0k408_27900_c1 | 3300050493 | Bacteria | 3208 |
| 953 | nmdc:mga0k408_45834_c1 | 3300050493 | Bacteria | 2524 |
| 954 | nmdc:mga07m45_37398_c1 | 3300050496 | Bacteria | 2707 |
| 955 | nmdc:mga07m45_6970_c1 | 3300050496 | Bacteria | 5745 |
| 956 | nmdc:mga08y16_46313_c1 | 3300050511 | Bacteria | 4553 |
| 957 | Ga0500564_042495 | 3300053138 | Bacteria | 2090 |
| 958 | Ga0500619_008139 | 3300053154 | Bacteria | 2528 |
| 959 | Ga0590071_006398 | 3300059421 | Bacteria | 2805 |
| 960 | Ga0590075_063031 | 3300059424 | Bacteria | 956 |
| 961 | 2510312114 | 2510065058 | Bacteria | 5005894 |
| 962 | 2511255091 | 2511231004 | Bacteria | 6669789 |
| 963 | 2511263529 | 2511231006 | Bacteria | 6794709 |
| 964 | 2511270484 | 2511231007 | Bacteria | 6306603 |
| 965 | 2511278148 | 2511231008 | Bacteria | 6624100 |
| 966 | 2511292363 | 2511231010 | Bacteria | 6373152 |
| 967 | 2511296026 | 2511231011 | Bacteria | 6149768 |
| 968 | 2511302658 | 2511231012 | Bacteria | 6738011 |
| 969 | 2511313313 | 2511231014 | Bacteria | 6462302 |
| 970 | 2511320124 | 2511231015 | Bacteria | 6598026 |
| 971 | 2511328167 | 2511231016 | Bacteria | 6704427 |
| 972 | 2511334163 | 2511231017 | Bacteria | 6503007 |
| 973 | 2511339407 | 2511231018 | Bacteria | 6436256 |
| 974 | 2511342327 | 2511231019 | Bacteria | 6520662 |
| 975 | 2511352421 | 2511231020 | Bacteria | 6115223 |
| 976 | 2511365576 | 2511231022 | Bacteria | 6719296 |
| 977 | 2511369688 | 2511231023 | Bacteria | 6808468 |
| 978 | 2511372818 | 2511231024 | Bacteria | 5835885 |
| 979 | 2511412651 | 2511231031 | Bacteria | 6558529 |
| 980 | 2511824292 | 2511231156 | Bacteria | 6845832 |
| 981 | 2512328806 | 2512047018 | Bacteria | 6663241 |
| 982 | 2555670386 | 2554235341 | Bacteria | 6867980 |
| 983 | 2583792185 | 2582580891 | Bacteria | 6800976 |
| 984 | 2597858517 | 2597489887 | Bacteria | 6666321 |
| 985 | 2597864003 | 2597489888 | Bacteria | 6179543 |
| 986 | 2599352586 | 2599185160 | Bacteria | 6844013 |
| 987 | 2599358930 | 2599185161 | Bacteria | 6960462 |
| 988 | 2599365549 | 2599185162 | Bacteria | 6957254 |
| 989 | 2599371624 | 2599185163 | Bacteria | 6995158 |
| 990 | 2599377694 | 2599185164 | Bacteria | 6841688 |
| 991 | 2599384929 | 2599185165 | Bacteria | 6843250 |
| 992 | 2599390482 | 2599185166 | Bacteria | 6959206 |
| 993 | 2599398396 | 2599185167 | Bacteria | 6353609 |
| 994 | 2599402667 | 2599185168 | Bacteria | 6997636 |
| 995 | 2599450418 | 2599185179 | Bacteria | 6611171 |
| 996 | 2599459420 | 2599185181 | Bacteria | 6844519 |
| 997 | 2599466241 | 2599185182 | Bacteria | 6883168 |
| 998 | 2599486492 | 2599185185 | Bacteria | 6652270 |
| 999 | 2599488441 | 2599185186 | Bacteria | 6831633 |
| 1000 | 2599507300 | 2599185189 | Bacteria | 5862825 |
| 1001 | 2599512900 | 2599185190 | Bacteria | 6285678 |
| 1002 | 2599521748 | 2599185191 | Bacteria | 6297582 |
| 1003 | 2599611123 | 2599185212 | Bacteria | 6765997 |
| 1004 | 2599803114 | 2599185257 | Bacteria | 6492581 |
| 1005 | 2599881261 | 2599185288 | Bacteria | 6666191 |
| 1006 | 2599887377 | 2599185289 | Bacteria | 6778765 |
| 1007 | 2599891577 | 2599185290 | Bacteria | 6289611 |
| 1008 | 2599898458 | 2599185291 | Bacteria | 6775623 |
| 1009 | 2599946722 | 2599185303 | Bacteria | 6512725 |
| 1010 | 2599958917 | 2599185305 | Bacteria | 6748700 |
| 1011 | 2599968971 | 2599185306 | Bacteria | 6637356 |
| 1012 | 2599980228 | 2599185308 | Bacteria | 6621546 |
| 1013 | 2599994457 | 2599185311 | Bacteria | 6354990 |
| 1014 | 2600006089 | 2599185313 | Bacteria | 6658188 |
| 1015 | 2600009428 | 2599185314 | Bacteria | 6621749 |
| 1016 | 2600017239 | 2599185315 | Bacteria | 6771107 |
| 1017 | 2600028301 | 2599185317 | Bacteria | 6435722 |
| 1018 | 2600035699 | 2599185318 | Bacteria | 6961590 |
| 1019 | 2600044937 | 2599185319 | Bacteria | 6637840 |
| 1020 | 2600052062 | 2599185321 | Bacteria | 6764560 |
| 1021 | 2600057063 | 2599185322 | Bacteria | 6763055 |
| 1022 | 2600065012 | 2599185323 | Bacteria | 6688755 |
| 1023 | 2600069720 | 2599185324 | Bacteria | 6590677 |
| 1024 | 2600212025 | 2599185356 | Bacteria | 6843884 |
| 1025 | 2600357250 | 2600254930 | Bacteria | 6431253 |
| 1026 | 2600362645 | 2600254931 | Bacteria | 6734225 |
| 1027 | 2601691936 | 2600255296 | Bacteria | 5784754 |
| 1028 | 2601772193 | 2600255313 | Bacteria | 6842543 |
| 1029 | 2601798886 | 2600255318 | Bacteria | 6383414 |
| 1030 | 2606077781 | 2603880185 | Bacteria | 6379190 |
| 1031 | 2606130044 | 2603880199 | Bacteria | 6377649 |
| 1032 | 2624481001 | 2623620443 | Bacteria | 6427864 |
| 1033 | 2624492132 | 2623620446 | Bacteria | 6500345 |
| 1034 | 2643841518 | 2643221565 | Bacteria | 6216018 |
| 1035 | 2643874088 | 2643221571 | Bacteria | 6228673 |
| 1036 | 2643954253 | 2643221589 | Bacteria | 6250934 |
| 1037 | 2644023062 | 2643221602 | Bacteria | 6249926 |
| 1038 | 2644284768 | 2643221650 | Bacteria | 7029547 |
| 1039 | 2652546082 | 2651869719 | Bacteria | 6047974 |
| 1040 | 2671090950 | 2667528170 | Bacteria | 6786960 |
| 1041 | 2671095838 | 2667528171 | Bacteria | 6900659 |
| 1042 | 2671124736 | 2667528176 | Bacteria | 6724917 |
| 1043 | 2671769262 | 2671180172 | Bacteria | 6495783 |
| 1044 | 2677896488 | 2675903420 | Bacteria | 6247433 |
| 1045 | 2678263974 | 2675903515 | Bacteria | 6580491 |
| 1046 | 2715753042 | 2713897148 | Bacteria | 5883533 |
| 1047 | 2715757046 | 2713897149 | Bacteria | 6506249 |
| 1048 | 2723248785 | 2721755607 | Bacteria | 5841722 |
| 1049 | 2738806778 | 2738541294 | Bacteria | 6925949 |
| 1050 | 2738894138 | 2738541309 | Bacteria | 6926455 |
| 1051 | 2739199388 | 2738543004 | Bacteria | 6381073 |
| 1052 | 2739257124 | 2738543015 | Bacteria | 6750701 |
| 1053 | 2739314657 | 2738543025 | Bacteria | 6600348 |
| 1054 | 2743737966 | 2740892503 | Bacteria | 6855563 |
| 1055 | 2745004428 | 2744054620 | Bacteria | 6551379 |
| 1056 | 2774120490 | 2773857670 | Bacteria | 6407454 |
| 1057 | 2774131419 | 2773857672 | Bacteria | 4993178 |
| 1058 | 2774133965 | 2773857673 | Bacteria | 6513460 |
| 1059 | 2784264264 | 2784132063 | Bacteria | 6262788 |
| 1060 | 2784312963 | 2784132072 | Bacteria | 6596533 |
| 1061 | 2794597863 | 2791355520 | Bacteria | 5948615 |
| 1062 | 2808907353 | 2808606373 | Bacteria | 4423627 |
| 1063 | 2808956201 | 2808606382 | Bacteria | 6841132 |
| 1064 | 2809214701 | 2808606445 | Bacteria | 6057339 |
| 1065 | 2819613994 | 2818991449 | Bacteria | 5518009 |
| 1066 | 2819659527 | 2818991456 | Bacteria | 6123676 |
| 1067 | 2819700683 | 2818991464 | Bacteria | 6907494 |
| 1068 | 2825657246 | 2825651385 | Bacteria | 6715909 |
| 1069 | 2834034086 | 2834028612 | Bacteria | 6354979 |
| 1070 | 2837681595 | 2837678835 | Bacteria | 5252418 |
| 1071 | 2842827010 | 2842826826 | Bacteria | 5974129 |
| 1072 | 2842834932 | 2842832357 | Bacteria | 5959113 |
| 1073 | 2842839210 | 2842837860 | Bacteria | 6066181 |
| 1074 | 2842843865 | 2842843487 | Bacteria | 6004777 |
| 1075 | 2844670990 | 2844665904 | Bacteria | 6817974 |
| 1076 | 2852657650 | 2852657418 | Bacteria | 6472974 |
| 1077 | 2860342853 | 2860339153 | Bacteria | 6846989 |
| 1078 | 2860870676 | 2860867994 | Bacteria | 5645326 |
| 1079 | 2878032928 | 2878029506 | Bacteria | 6418441 |
| 1080 | 2904550385 | 2904550169 | Bacteria | 6221258 |
| 1081 | 2908449813 | 2908446538 | Bacteria | 6829095 |
| 1082 | 2913039183 | 2913036834 | Bacteria | 6704877 |
| 1083 | 2917074208 | 2917070673 | Bacteria | 6868303 |
| 1084 | 2917834283 | 2917832318 | Bacteria | 5346010 |
| 1085 | 2919064766 | 2919063839 | Bacteria | 6302690 |
| 1086 | 2919127835 | 2919125081 | Bacteria | 5385106 |
| 1087 | 2919157087 | 2919155634 | Bacteria | 4860545 |
| 1088 | 2919387244 | 2919385768 | Bacteria | 5897293 |
| 1089 | 2919491935 | 2919487758 | Bacteria | 5929766 |
| 1090 | 2919698316 | 2919697872 | Bacteria | 6553725 |
| 1091 | 2923157014 | 2923153595 | Bacteria | 6870622 |
| 1092 | 2923586664 | 2923586266 | Bacteria | 6565975 |
| 1093 | 2929146461 | 2929144301 | Bacteria | 6622272 |
| 1094 | 2929192672 | 2929189879 | Bacteria | 5930554 |
| 1095 | 2931369868 | 2931369376 | Bacteria | 6847892 |
| 1096 | 2931393938 | 2931390751 | Bacteria | 6273349 |
| 1097 | 2931401603 | 2931396565 | Bacteria | 7251677 |
| 1098 | 2935355727 | 2935353572 | Unclassified | 6955622 |
| 1099 | 2939639053 | 2939636861 | Bacteria | 6297853 |
| 1100 | 2945933523 | 2945928738 | Bacteria | 6053221 |
| 1101 | 2945963290 | 2945961074 | Bacteria | 7342064 |
| 1102 | 2946009711 | 2946006987 | Bacteria | 6705746 |
| 1103 | 2946030872 | 2946027586 | Bacteria | 6049274 |
| 1104 | 2947237903 | 2947233263 | Bacteria | 6439278 |
| 1105 | 2969307839 | 2969304461 | Bacteria | 6601805 |
| 1106 | 2974290675 | 2974289157 | Bacteria | 6080362 |
| 1107 | 2974298566 | 2974298342 | Bacteria | 4840922 |
| 1108 | 2984289061 | 2984286254 | Bacteria | 6702062 |
| 1109 | 2984500807 | 2984499530 | Bacteria | 5020881 |
| 1110 | 2998143133 | 2998139840 | Bacteria | 6073514 |
| 1111 | 3007254810 | 3007252601 | Bacteria | 4559114 |
| 1112 | 3007396433 | 3007395558 | Bacteria | 6755444 |
| 1113 | 3007514080 | 3007511990 | Bacteria | 6481491 |
| 1114 | 3007616037 | 3007614139 | Bacteria | 6053559 |
| 1115 | 3007625273 | 3007619802 | Bacteria | 6411688 |
| 1116 | 3007722539 | 3007718800 | Bacteria | 5971527 |
| 1117 | 3007857123 | 3007855910 | Bacteria | 5637581 |
| 1118 | 3007861863 | 3007861166 | Bacteria | 6045338 |
| 1119 | 3007869805 | 3007866637 | Bacteria | 5899198 |
| 1120 | 637320750 | 637000220 | Bacteria | 7074893 |
| 1121 | 639789006 | 639633007 | Bacteria | 4376040 |
| 1122 | 8015691258 | 8015687852 | Bacteria | 6613826 |
| 1123 | 8019772600 | 8019769354 | Bacteria | 6924660 |
| 1124 | 8019779255 | 8019775933 | Bacteria | 6858656 |
| 1125 | 8029997648 | 8029995093 | Bacteria | 5990776 |
| 1126 | 8054285869 | 8054285046 | Bacteria | 6919322 |
| 1127 | 8054352353 | 8054347763 | Bacteria | 5901107 |
| 1128 | 8054506431 | 8054503363 | Bacteria | 6101651 |
| 1129 | 8055774397 | 8055770955 | Bacteria | 6827675 |
| 1130 | 8055821183 | 8055817908 | Bacteria | 6609162 |
| 1131 | 8056118424 | 8056115690 | Bacteria | 5527654 |
| 1132 | 8056128643 | 8056125926 | Bacteria | 6228218 |
| 1133 | 8056150960 | 8056148874 | Bacteria | 6479865 |
| 1134 | 8056158871 | 8056155041 | Bacteria | 6486948 |
| 1135 | 8056166144 | 8056161164 | Bacteria | 6106669 |
| 1136 | 8056168048 | 8056166840 | Bacteria | 5820959 |
| 1137 | 8056174522 | 8056172158 | Bacteria | 6133900 |
| 1138 | 8056178019 | 8056177738 | Bacteria | 6748268 |
| 1139 | 8057800949 | 8057798959 | Bacteria | 6713499 |
| 1140 | Ga0070670_100070236 | |||
| 1141 | SwRhRL2b_contig_3815165 | |||
| 1142 | JGI24739J22299_10060794 | |||
| 1143 | JGI24735J21928_10008513 | |||
| 1144 | JGI24744J21845_10014316 | |||
| 1145 | JGI25162J39368_1000030 | |||
| 1146 | JGI25163J39215_1000059 | |||
| 1147 | JGI25164J39214_1000123 | |||
| 1148 | JGI25165J46597_1000056 | |||
| 1149 | rootL2_10116134 | |||
| 1150 | Ga0055538_1000007 | |||
| 1151 | Ga0055539_1000011 | |||
| 1152 | Ga0055533_1000014 | |||
| 1153 | Ga0055532_1000009 | |||
| 1154 | Ga0055525_1000016 | |||
| 1155 | Ga0055535_1008860 | |||
| 1156 | Ga0055537_1000060 | |||
| 1157 | Ga0055536_1000084 | |||
| 1158 | Ga0055536_1000262 | |||
| 1159 | Ga0055534_1000009 | |||
| 1160 | Ga0055528_1000012 | |||
| 1161 | Ga0055530_10000215 | |||
| 1162 | Ga0055530_10000402 | |||
| 1163 | Ga0055540_1000284 | |||
| 1164 | Ga0055540_1000358 | |||
| 1165 | Ga0055541_1000008 | |||
| 1166 | Ga0055543_1011074 | |||
| 1167 | Ga0065165_1000051 | |||
| 1168 | Ga0065714_10000049 | |||
| 1169 | Ga0065714_10003058 | |||
| 1170 | Ga0065714_10004477 | |||
| 1171 | Ga0065714_10006867 | |||
| 1172 | Ga0065714_10013213 | |||
| 1173 | Ga0065714_10065510 | |||
| 1174 | Ga0065714_10084625 | |||
| 1175 | Ga0065714_10084895 | |||
| 1176 | Ga0065714_10087062 | |||
| 1177 | Ga0065714_10088010 | |||
| 1178 | Ga0065704_10105196 | |||
| 1179 | Ga0065712_10068023 | |||
| 1180 | Ga0065712_10069803 | |||
| 1181 | Ga0065712_10079095 | |||
| 1182 | Ga0065715_10011768 | |||
| 1183 | Ga0065707_10010384 | |||
| 1184 | Ga0070670_100000473 | |||
| 1185 | Ga0068868_100067269 | |||
| 1186 | Ga0068868_100099803 | |||
| 1187 | Ga0070691_10158507 | |||
| 1188 | Ga0070661_100000175 | |||
| 1189 | Ga0070668_100013601 | |||
| 1190 | Ga0070669_100019700 | |||
| 1191 | Ga0070669_100024294 | |||
| 1192 | Ga0070669_100064670 | |||
| 1193 | Ga0070669_100149193 | |||
| 1194 | Ga0070671_100262229 | |||
| 1195 | Ga0070667_100201312 | |||
| 1196 | Ga0070700_100213559 | |||
| 1197 | Ga0070694_100189817 | |||
| 1198 | Ga0070663_100173065 | |||
| 1199 | Ga0070662_100030452 | |||
| 1200 | Ga0068867_100000066 | |||
| 1201 | Ga0070699_100491498 | |||
| 1202 | Ga0070672_100015840 | |||
| 1203 | Ga0070696_100083654 | |||
| 1204 | Ga0070665_100474986 | |||
| 1205 | Ga0070664_100000118 | |||
| 1206 | Ga0068857_100053499 | |||
| 1207 | Ga0068857_100120774 | |||
| 1208 | Ga0068854_100347685 | |||
| 1209 | Ga0068864_100000342 | |||
| 1210 | Ga0068864_100013403 | |||
| 1211 | Ga0068851_10000860 | |||
| 1212 | Ga0068870_10009177 | |||
| 1213 | Ga0068863_100000149 | |||
| 1214 | Ga0068863_100022849 | |||
| 1215 | Ga0068860_100061947 | |||
| 1216 | Ga0068862_100034456 | |||
| 1217 | Ga0075364_10028562 | |||
| 1218 | Ga0075364_10092729 | |||
| 1219 | Ga0075364_10147660 | |||
| 1220 | Ga0075432_10000920 | |||
| 1221 | Ga0075432_10006692 | |||
| 1222 | Ga0075432_10010219 | |||
| 1223 | Ga0075432_10048495 | |||
| 1224 | Ga0075432_10053979 | |||
| 1225 | Ga0075432_10058799 | |||
| 1226 | Ga0075432_10079751 | |||
| 1227 | Ga0075432_10092707 | |||
| 1228 | Ga0070716_100160138 | |||
| 1229 | Ga0075369_10081575 | |||
| 1230 | Ga0075366_10029325 | |||
| 1231 | Ga0075370_10005241 | |||
| 1232 | Ga0075370_10008666 | |||
| 1233 | Ga0068871_100609624 | |||
| 1234 | Ga0075430_100212588 | |||
| 1235 | Ga0075430_100354868 | |||
| 1236 | Ga0068865_100101956 | |||
| 1237 | Ga0075436_100111534 | |||
| 1238 | Ga0075436_100115478 | |||
| 1239 | Ga0079104_1000081 | |||
| 1240 | Ga0079104_1000435 | |||
| 1241 | Ga0079104_1008195 | |||
| 1242 | Ga0105251_10001130 | |||
| 1243 | Ga0105251_10005958 | |||
| 1244 | Ga0105251_10016388 | |||
| 1245 | Ga0105251_10030420 | |||
| 1246 | Ga0105251_10037071 | |||
| 1247 | Ga0105251_10047470 | |||
| 1248 | Ga0105251_10081030 | |||
| 1249 | Ga0105244_10000113 | |||
| 1250 | Ga0105244_10001018 | |||
| 1251 | Ga0105244_10002954 | |||
| 1252 | Ga0105244_10008244 | |||
| 1253 | Ga0105244_10024075 | |||
| 1254 | Ga0105244_10033139 | |||
| 1255 | Ga0105250_10000047 | |||
| 1256 | Ga0105250_10000393 | |||
| 1257 | Ga0105250_10015432 | |||
| 1258 | Ga0105250_10088088 | |||
| 1259 | Ga0111539_10111983 | |||
| 1260 | Ga0111539_10911049 | |||
| 1261 | Ga0105245_10002025 | |||
| 1262 | Ga0105247_10089659 | |||
| 1263 | Ga0105243_10000170 | |||
| 1264 | Ga0105243_10001782 | |||
| 1265 | Ga0105243_10003572 | |||
| 1266 | Ga0105243_10072319 | |||
| 1267 | Ga0105242_10000292 | |||
| 1268 | Ga0105242_10142126 | |||
| 1269 | Ga0105248_10293948 | |||
| 1270 | Ga0105237_10000618 | |||
| 1271 | Ga0105237_10312662 | |||
| 1272 | Ga0105237_10691288 | |||
| 1273 | Ga0105237_10787467 | |||
| 1274 | Ga0105246_10000014 | |||
| 1275 | Ga0105246_10000554 | |||
| 1276 | Ga0105246_10001405 | |||
| 1277 | Ga0105246_10017825 | |||
| 1278 | Ga0105246_10273528 | |||
| 1279 | Ga0105246_10285042 | |||
| 1280 | Ga0157345_1000014 | |||
| 1281 | Ga0157373_10001077 | |||
| 1282 | Ga0157373_10001889 | |||
| 1283 | Ga0157373_10002066 | |||
| 1284 | Ga0157373_10003646 | |||
| 1285 | Ga0157373_10004408 | |||
| 1286 | Ga0157373_10004797 | |||
| 1287 | Ga0157373_10008623 | |||
| 1288 | Ga0157373_10012916 | |||
| 1289 | Ga0157371_10001376 | |||
| 1290 | Ga0157371_10002377 | |||
| 1291 | Ga0157371_10002745 | |||
| 1292 | Ga0157371_10006783 | |||
| 1293 | Ga0157370_10008555 | |||
| 1294 | Ga0157370_10013939 | |||
| 1295 | Ga0157370_10023614 | |||
| 1296 | Ga0157370_10112239 | |||
| 1297 | Ga0157370_10142607 | |||
| 1298 | Ga0157370_10262510 | |||
| 1299 | Ga0157369_10000417 | |||
| 1300 | Ga0157369_10002624 | |||
| 1301 | Ga0157369_10003097 | |||
| 1302 | Ga0157369_10004453 | |||
| 1303 | Ga0157369_10006855 | |||
| 1304 | Ga0157369_10023766 | |||
| 1305 | Ga0157369_10024615 | |||
| 1306 | Ga0157369_10305490 | |||
| 1307 | Ga0157369_10561764 | |||
| 1308 | Ga0157374_10146229 | |||
| 1309 | Ga0163162_10000210 | |||
| 1310 | Ga0163162_10009619 | |||
| 1311 | Ga0163162_10720659 | |||
| 1312 | Ga0163162_11062961 | |||
| 1313 | Ga0163162_11062962 | |||
| 1314 | Ga0157372_10001195 | |||
| 1315 | Ga0157372_10002997 | |||
| 1316 | Ga0157372_10111748 | |||
| 1317 | Ga0157375_10002075 | |||
| 1318 | Ga0157375_10005652 | |||
| 1319 | Ga0182008_10000706 | |||
| 1320 | Ga0182008_10000752 | |||
| 1321 | Ga0182008_10002526 | |||
| 1322 | Ga0182008_10009319 | |||
| 1323 | Ga0182008_10034227 | |||
| 1324 | Ga0182008_10074084 | |||
| 1325 | Ga0157377_10000035 | |||
| 1326 | Ga0157379_10237890 | |||
| 1327 | Ga0182006_1001537 | |||
| 1328 | Ga0182006_1001539 | |||
| 1329 | Ga0182006_1002098 | |||
| 1330 | Ga0182006_1007073 | |||
| 1331 | Ga0182006_1016915 | |||
| 1332 | Ga0182006_1090149 | |||
| 1333 | Ga0182007_10000315 | |||
| 1334 | Ga0182007_10002696 | |||
| 1335 | Ga0182007_10010563 | |||
| 1336 | Ga0182005_1001275 | |||
| 1337 | Ga0182005_1002287 | |||
| 1338 | Ga0182005_1004539 | |||
| 1339 | Ga0163161_10000221 | |||
| 1340 | Ga0163161_10005118 | |||
| 1341 | Ga0163161_10007828 | |||
| 1342 | Ga0163161_10009285 | |||
| 1343 | Ga0163161_10023646 | |||
| 1344 | Ga0163161_10030414 | |||
| 1345 | Ga0163161_10041264 | |||
| 1346 | Ga0163161_10052937 | |||
| 1347 | Ga0163161_10070164 | |||
| 1348 | Ga0163161_10457172 | |||
| 1349 | Ga0209435_100778 | |||
| 1350 | Ga0209760_100016 | |||
| 1351 | Ga0209784_100023 | |||
| 1352 | Ga0209566_100019 | |||
| 1353 | Ga0209674_100034 | |||
| 1354 | Ga0209147_100027 | |||
| 1355 | Ga0209563_100037 | |||
| 1356 | Ga0209563_102231 | |||
| 1357 | Ga0207427_100022 | |||
| 1358 | Ga0209437_100002 | |||
| 1359 | Ga0209258_100166 | |||
| 1360 | Ga0209646_1000110 | |||
| 1361 | Ga0209677_100021 | |||
| 1362 | Ga0209759_1011401 | |||
| 1363 | Ga0209233_1000004 | |||
| 1364 | Ga0209565_1000015 | |||
| 1365 | Ga0209673_1000017 | |||
| 1366 | Ga0209130_1000063 | |||
| 1367 | Ga0209675_1000012 | |||
| 1368 | Ga0209676_1000003 | |||
| 1369 | Ga0209676_1000050 | |||
| 1370 | Ga0209676_1000777 | |||
| 1371 | Ga0209676_1013219 | |||
| 1372 | Ga0209676_1020135 | |||
| 1373 | Ga0209025_1000026 | |||
| 1374 | Ga0209564_1000016 | |||
| 1375 | Ga0209050_1000004 | |||
| 1376 | Ga0209050_1000009 | |||
| 1377 | Ga0209050_1001872 | |||
| 1378 | Ga0209256_1000346 | |||
| 1379 | Ga0207426_1002554 | |||
| 1380 | Ga0207426_1014840 | |||
| 1381 | Ga0209051_1000006 | |||
| 1382 | Ga0209051_1000438 | |||
| 1383 | Ga0209051_1004148 | |||
| 1384 | Ga0209257_1009378 | |||
| 1385 | Ga0207656_10001465 | |||
| 1386 | Ga0207696_1000002 | |||
| 1387 | Ga0207696_1000017 | |||
| 1388 | Ga0207696_1003966 | |||
| 1389 | Ga0207696_1033548 | |||
| 1390 | Ga0207696_1047711 | |||
| 1391 | Ga0207655_1000074 | |||
| 1392 | Ga0207655_1001619 | |||
| 1393 | Ga0207655_1002477 | |||
| 1394 | Ga0207655_1003770 | |||
| 1395 | Ga0207655_1012987 | |||
| 1396 | Ga0207655_1026761 | |||
| 1397 | Ga0207655_1037546 | |||
| 1398 | Ga0207655_1044996 | |||
| 1399 | Ga0207655_1075595 | |||
| 1400 | Ga0207713_1000369 | |||
| 1401 | Ga0207713_1000634 | |||
| 1402 | Ga0207713_1001110 | |||
| 1403 | Ga0207713_1005223 | |||
| 1404 | Ga0207713_1007056 | |||
| 1405 | Ga0207713_1054312 | |||
| 1406 | Ga0207713_1058575 | |||
| 1407 | Ga0207710_10075327 | |||
| 1408 | Ga0207647_10040798 | |||
| 1409 | Ga0207643_10041813 | |||
| 1410 | Ga0207695_10277586 | |||
| 1411 | Ga0207671_10000964 | |||
| 1412 | Ga0207649_10000146 | |||
| 1413 | Ga0207681_10047560 | |||
| 1414 | Ga0207681_10055629 | |||
| 1415 | Ga0207681_10164426 | |||
| 1416 | Ga0207694_10084412 | |||
| 1417 | Ga0207650_10000865 | |||
| 1418 | Ga0207687_10029261 | |||
| 1419 | Ga0207644_10028782 | |||
| 1420 | Ga0207706_10009548 | |||
| 1421 | Ga0207686_10020116 | |||
| 1422 | Ga0207709_10000004 | |||
| 1423 | Ga0207709_10000858 | |||
| 1424 | Ga0207709_10001664 | |||
| 1425 | Ga0207665_10083484 | |||
| 1426 | Ga0207691_10449838 | |||
| 1427 | Ga0207711_10349351 | |||
| 1428 | Ga0207689_10050466 | |||
| 1429 | Ga0207679_10000097 | |||
| 1430 | Ga0207668_10002267 | |||
| 1431 | Ga0207640_10554256 | |||
| 1432 | Ga0207641_10000120 | |||
| 1433 | Ga0207641_10025533 | |||
| 1434 | Ga0207648_10000040 | |||
| 1435 | Ga0207676_10000091 | |||
| 1436 | Ga0207674_10059129 | |||
| 1437 | Ga0207683_10243589 | |||
| 1438 | Ga0209281_1000011 | |||
| 1439 | Ga0209281_1000055 | |||
| 1440 | Ga0209281_1001921 | |||
| 1441 | Ga0209281_1003929 | |||
| 1442 | Ga0207428_10006877 | |||
| 1443 | Ga0207428_10052943 | |||
| 1444 | Ga0207428_10076459 | |||
| 1445 | Ga0207428_10112400 | |||
| 1446 | Ga0207428_10278645 | |||
| 1447 | Ga0268266_10412387 | |||
| 1448 | Ga0268266_10481636 | |||
| 1449 | Ga0268265_10013736 | |||
| 1450 | Ga0265319_1000177 | |||
| 1451 | Ga0265318_10000258 | |||
| 1452 | Ga0265336_10000013 | |||
| 1453 | Ga0307517_10190564 | |||
| 1454 | Ga0307515_10128455 | |||
| 1455 | Ga0265324_10000536 | |||
| 1456 | Ga0265324_10112891 | |||
| 1457 | Ga0307512_10030456 | |||
| 1458 | Ga0316178_1159482 | |||
| 1459 | Ga0265330_10000359 | |||
| 1460 | Ga0265332_10000138 | |||
| 1461 | Ga0265328_10002580 | |||
| 1462 | Ga0265328_10056884 | |||
| 1463 | Ga0265320_10002735 | |||
| 1464 | Ga0265325_10004955 | |||
| 1465 | Ga0265325_10048260 | |||
| 1466 | Ga0265329_10000076 | |||
| 1467 | Ga0265340_10000688 | |||
| 1468 | Ga0265339_10005622 | |||
| 1469 | Ga0265331_10001134 | |||
| 1470 | Ga0265331_10067422 | |||
| 1471 | Ga0265327_10000681 | |||
| 1472 | Ga0265327_10154522 | |||
| 1473 | Ga0265316_10000843 | |||
| 1474 | Ga0307509_10003432 | |||
| 1475 | Ga0307408_100008176 | |||
| 1476 | Ga0307408_100289878 | |||
| 1477 | Ga0265313_10000089 | |||
| 1478 | Ga0307514_10001667 | |||
| 1479 | Ga0307514_10139272 | |||
| 1480 | Ga0265314_10000211 | |||
| 1481 | Ga0265342_10000390 | |||
| 1482 | Ga0316576_10053093 | |||
| 1483 | Ga0316576_10062189 | |||
| 1484 | Ga0307412_10003248 | |||
| 1485 | Ga0307412_10030227 | |||
| 1486 | Ga0307409_100142661 | |||
| 1487 | Ga0307416_100147453 | |||
| 1488 | Ga0307416_100263493 | |||
| 1489 | Ga0307414_10415776 | |||
| 1490 | Ga0307411_10013877 | |||
| 1491 | Ga0316583_10002676 | |||
| 1492 | Ga0307510_10008022 | |||
| 1493 | Ga0307510_10031972 | |||
| 1494 | Ga0373931_0135990 | |||
| 1495 | Ga0373937_0042280 | |||
| 1496 | Ga0316584_0255742 | |||
| 1497 | Ga0395905_0029368 | |||
| 1498 | Ga0395905_0074385 | |||
| 1499 | Ga0439438_001790 | |||
| 1500 | Ga0439438_002060 | |||
| 1501 | Ga0439438_002339 | |||
| 1502 | Ga0439438_002391 | |||
| 1503 | Ga0439439_0058117 | |||
| 1504 | Ga0439447_000130 | |||
| 1505 | Ga0439447_001809 | |||
| 1506 | Ga0439447_002141 | |||
| 1507 | Ga0439447_002328 | |||
| 1508 | Ga0439447_003975 | |||
| 1509 | Ga0439447_027876 | |||
| 1510 | Ga0439466_0000227 | |||
| 1511 | Ga0439466_0000530 | |||
| 1512 | Ga0439466_0001072 | |||
| 1513 | Ga0439466_0001383 | |||
| 1514 | Ga0439466_0002138 | |||
| 1515 | Ga0439466_0020568 | |||
| 1516 | Ga0439466_0027583 | |||
| 1517 | Ga0439466_0106545 | |||
| 1518 | Ga0439432_000016 | |||
| 1519 | Ga0439432_000485 | |||
| 1520 | Ga0439432_002780 | |||
| 1521 | Ga0439432_006718 | |||
| 1522 | Ga0439432_025172 | |||
| 1523 | Ga0439449_0012448 | |||
| 1524 | Ga0439451_000475 | |||
| 1525 | Ga0439451_001556 | |||
| 1526 | Ga0439451_004521 | |||
| 1527 | Ga0439451_010667 | |||
| 1528 | Ga0439452_000123 | |||
| 1529 | Ga0439452_007770 | |||
| 1530 | Ga0439452_009774 | |||
| 1531 | Ga0439452_011180 | |||
| 1532 | Ga0439456_003216 | |||
| 1533 | Ga0439456_006054 | |||
| 1534 | Ga0439456_009637 | |||
| 1535 | Ga0439462_0004775 | |||
| 1536 | Ga0439463_006609 | |||
| 1537 | Ga0439463_050169 | |||
| 1538 | Ga0450911_000510 | |||
| 1539 | Ga0450911_002200 | |||
| 1540 | Ga0450911_006530 | |||
| 1541 | Ga0450922_001389 | |||
| 1542 | Ga0450903_002021 | |||
| 1543 | Ga0450903_017824 | |||
| 1544 | Ga0450906_002391 | |||
| 1545 | Ga0450907_000175 | |||
| 1546 | Ga0450907_000547 | |||
| 1547 | Ga0450910_000379 | |||
| 1548 | Ga0439446_0007494 | |||
| 1549 | Ga0439446_0015668 | |||
| 1550 | Ga0450908_000208 | |||
| 1551 | Ga0450909_000113 | |||
| 1552 | Ga0439460_0006502 | |||
| 1553 | Ga0439460_0063627 | |||
| 1554 | Ga0450918_009443 | |||
| 1555 | Ga0450901_000164 | |||
| 1556 | Ga0451577_0014108 | |||
| 1557 | Ga0451577_0015785 | |||
| 1558 | Ga0451577_0036966 | |||
| 1559 | Ga0451577_0038116 | |||
| 1560 | Ga0451577_0092220 | |||
| 1561 | Ga0439440_0001431 | |||
| 1562 | Ga0439440_0005906 | |||
| 1563 | Ga0466972_0010636 | |||
| 1564 | Ga0453683_0007327 | |||
| 1565 | Ga0453684_0000471 | |||
| 1566 | Ga0453684_0010999 | |||
| 1567 | Ga0453684_0011162 | |||
| 1568 | Ga0453684_0084631 | |||
| 1569 | Ga0453684_0121702 | |||
| 1570 | Ga0453684_0124832 | |||
| 1571 | Ga0451576_0000099 | |||
| 1572 | Ga0451576_0000320 | |||
| 1573 | Ga0451576_0001981 | |||
| 1574 | Ga0451576_0027118 | |||
| 1575 | Ga0451576_0039260 | |||
| 1576 | Ga0451576_0045983 | |||
| 1577 | Ga0451576_0124573 | |||
| 1578 | Ga0451576_0701431 | |||
| 1579 | Ga0495617_000074 | |||
| 1580 | Ga0495617_000231 | |||
| 1581 | Ga0495617_000317 | |||
| 1582 | Ga0495617_009615 | |||
| 1583 | Ga0495617_011812 | |||
| 1584 | Ga0495617_022513 | |||
| 1585 | Ga0495627_000369 | |||
| 1586 | Ga0495627_000894 | |||
| 1587 | Ga0495627_001104 | |||
| 1588 | Ga0495627_003083 | |||
| 1589 | Ga0495592_0000203 | |||
| 1590 | Ga0495603_0003212 | |||
| 1591 | Ga0495603_0020824 | |||
| 1592 | Ga0495590_0000178 | |||
| 1593 | Ga0495590_0000821 | |||
| 1594 | Ga0495590_0000839 | |||
| 1595 | Ga0495590_0021825 | |||
| 1596 | Ga0495590_0033343 | |||
| 1597 | Ga0495591_000086 | |||
| 1598 | Ga0495591_000177 | |||
| 1599 | Ga0495591_000949 | |||
| 1600 | Ga0495591_001101 | |||
| 1601 | Ga0495591_006794 | |||
| 1602 | Ga0495591_030944 | |||
| 1603 | Ga0495629_0000819 | |||
| 1604 | Ga0495629_0003181 | |||
| 1605 | Ga0495638_0001745 | |||
| 1606 | Ga0495638_0007263 | |||
| 1607 | Ga0495638_0021556 | |||
| 1608 | Ga0495638_0025561 | |||
| 1609 | Ga0495638_0033363 | |||
| 1610 | Ga0495638_0038025 | |||
| 1611 | Ga0495638_0057135 | |||
| 1612 | Ga0495638_0074178 | |||
| 1613 | Ga0495638_0097443 | |||
| 1614 | Ga0495638_0328016 | |||
| 1615 | Ga0495653_0000427 | |||
| 1616 | Ga0495653_0001253 | |||
| 1617 | Ga0495653_0054643 | |||
| 1618 | Ga0495653_0054793 | |||
| 1619 | Ga0495650_0000294 | |||
| 1620 | Ga0495650_0000522 | |||
| 1621 | Ga0495650_0003349 | |||
| 1622 | Ga0495650_0005875 | |||
| 1623 | Ga0495650_0008823 | |||
| 1624 | Ga0495650_0008974 | |||
| 1625 | Ga0495650_0009991 | |||
| 1626 | Ga0495650_0076093 | |||
| 1627 | Ga0495580_0038238 | |||
| 1628 | Ga0495582_0028869 | |||
| 1629 | Ga0495605_0000189 | |||
| 1630 | Ga0495605_0000585 | |||
| 1631 | Ga0495605_0004347 | |||
| 1632 | Ga0495605_0006681 | |||
| 1633 | Ga0495605_0006695 | |||
| 1634 | Ga0495605_0032805 | |||
| 1635 | Ga0495605_0061185 | |||
| 1636 | Ga0495639_0000002 | |||
| 1637 | Ga0495639_0036924 | |||
| 1638 | Ga0495662_0023017 | |||
| 1639 | Ga0495664_0035404 | |||
| 1640 | Ga0495664_0130985 | |||
| 1641 | Ga0495584_0000019 | |||
| 1642 | Ga0495584_0000084 | |||
| 1643 | Ga0495584_0000094 | |||
| 1644 | Ga0495584_0002625 | |||
| 1645 | Ga0495584_0007539 | |||
| 1646 | Ga0495584_0008888 | |||
| 1647 | Ga0495584_0009580 | |||
| 1648 | Ga0495584_0015470 | |||
| 1649 | Ga0495584_0032547 | |||
| 1650 | Ga0495584_0057247 | |||
| 1651 | Ga0495584_0081367 | |||
| 1652 | Ga0495584_0214834 | |||
| 1653 | Ga0495585_0000101 | |||
| 1654 | Ga0495585_0001655 | |||
| 1655 | Ga0495585_0002281 | |||
| 1656 | Ga0495585_0002474 | |||
| 1657 | Ga0495585_0004048 | |||
| 1658 | Ga0495585_0007440 | |||
| 1659 | Ga0495585_0008195 | |||
| 1660 | Ga0495585_0028489 | |||
| 1661 | Ga0495585_0035691 | |||
| 1662 | Ga0495585_0075756 | |||
| 1663 | Ga0495594_0188058 | |||
| 1664 | Ga0495596_0000027 | |||
| 1665 | Ga0495596_0009591 | |||
| 1666 | Ga0495596_0033339 | |||
| 1667 | Ga0495607_0000092 | |||
| 1668 | Ga0495607_0001404 | |||
| 1669 | Ga0495607_0002010 | |||
| 1670 | Ga0495607_0002682 | |||
| 1671 | Ga0495607_0005469 | |||
| 1672 | Ga0495607_0005513 | |||
| 1673 | Ga0495607_0007372 | |||
| 1674 | Ga0495607_0018207 | |||
| 1675 | Ga0495607_0030875 | |||
| 1676 | Ga0495607_0257608 | |||
| 1677 | Ga0495583_0000445 | |||
| 1678 | Ga0495583_0001410 | |||
| 1679 | Ga0495583_0001452 | |||
| 1680 | Ga0495583_0002185 | |||
| 1681 | Ga0495606_0000625 | |||
| 1682 | Ga0495606_0001005 | |||
| 1683 | Ga0495606_0001535 | |||
| 1684 | Ga0495606_0001830 | |||
| 1685 | Ga0495606_0008703 | |||
| 1686 | Ga0495606_0023245 | |||
| 1687 | Ga0495606_0029221 | |||
| 1688 | Ga0495606_0059497 | |||
| 1689 | Ga0495610_0000722 | |||
| 1690 | Ga0495610_0001435 | |||
| 1691 | Ga0495610_0001943 | |||
| 1692 | Ga0495610_0003870 | |||
| 1693 | Ga0495610_0004236 | |||
| 1694 | Ga0495610_0004286 | |||
| 1695 | Ga0495610_0004894 | |||
| 1696 | Ga0495610_0007190 | |||
| 1697 | Ga0495610_0011004 | |||
| 1698 | Ga0495610_0023294 | |||
| 1699 | Ga0495610_0023373 | |||
| 1700 | Ga0495610_0025696 | |||
| 1701 | Ga0495610_0088789 | |||
| 1702 | Ga0495616_0000079 | |||
| 1703 | Ga0495616_0000249 | |||
| 1704 | Ga0495616_0001332 | |||
| 1705 | Ga0495616_0002103 | |||
| 1706 | Ga0495616_0008289 | |||
| 1707 | Ga0495616_0034797 | |||
| 1708 | Ga0495616_0046726 | |||
| 1709 | Ga0495616_0125259 | |||
| 1710 | Ga0495620_0000106 | |||
| 1711 | Ga0495620_0002056 | |||
| 1712 | Ga0495620_0004913 | |||
| 1713 | Ga0495620_0005977 | |||
| 1714 | Ga0495620_0031462 | |||
| 1715 | Ga0495628_0002997 | |||
| 1716 | Ga0495630_0032152 | |||
| 1717 | Ga0495631_0000072 | |||
| 1718 | Ga0495631_0000824 | |||
| 1719 | Ga0495631_0111770 | |||
| 1720 | Ga0495631_0114888 | |||
| 1721 | Ga0495632_0000200 | |||
| 1722 | Ga0495632_0000204 | |||
| 1723 | Ga0495632_0000243 | |||
| 1724 | Ga0495632_0001300 | |||
| 1725 | Ga0495632_0002506 | |||
| 1726 | Ga0495632_0003289 | |||
| 1727 | Ga0495632_0015268 | |||
| 1728 | Ga0495632_0020383 | |||
| 1729 | Ga0495632_0026646 | |||
| 1730 | Ga0495632_0036592 | |||
| 1731 | Ga0495632_0068762 | |||
| 1732 | Ga0495637_0000256 | |||
| 1733 | Ga0495637_0000545 | |||
| 1734 | Ga0495637_0000847 | |||
| 1735 | Ga0495637_0001339 | |||
| 1736 | Ga0495637_0002416 | |||
| 1737 | Ga0495637_0002592 | |||
| 1738 | Ga0495637_0009604 | |||
| 1739 | Ga0495637_0023096 | |||
| 1740 | Ga0495637_0054432 | |||
| 1741 | Ga0495637_0057761 | |||
| 1742 | Ga0495637_0081881 | |||
| 1743 | Ga0495643_0002227 | |||
| 1744 | Ga0495643_0002647 | |||
| 1745 | Ga0495643_0002651 | |||
| 1746 | Ga0495643_0004175 | |||
| 1747 | Ga0495643_0021611 | |||
| 1748 | Ga0495643_0031498 | |||
| 1749 | Ga0495643_0065328 | |||
| 1750 | Ga0495644_0000022 | |||
| 1751 | Ga0495644_0000098 | |||
| 1752 | Ga0495644_0000932 | |||
| 1753 | Ga0495644_0088910 | |||
| 1754 | Ga0495648_0000396 | |||
| 1755 | Ga0495648_0000461 | |||
| 1756 | Ga0495648_0006863 | |||
| 1757 | Ga0495648_0009619 | |||
| 1758 | Ga0495648_0024609 | |||
| 1759 | Ga0495648_0047974 | |||
| 1760 | Ga0495648_0053370 | |||
| 1761 | Ga0495648_0104773 | |||
| 1762 | Ga0495648_0133070 | |||
| 1763 | Ga0495648_0194371 | |||
| 1764 | Ga0495666_0000015 | |||
| 1765 | Ga0495666_0018898 | |||
| 1766 | Ga0495666_0052621 | |||
| 1767 | Ga0495666_0107110 | |||
| 1768 | Ga0495642_0000043 | |||
| 1769 | Ga0495642_0000119 | |||
| 1770 | Ga0495642_0000575 | |||
| 1771 | Ga0495642_0002942 | |||
| 1772 | Ga0495642_0038533 | |||
| 1773 | Ga0495652_0002621 | |||
| 1774 | Ga0495654_0000239 | |||
| 1775 | Ga0495654_0000382 | |||
| 1776 | Ga0495654_0000560 | |||
| 1777 | Ga0495654_0000781 | |||
| 1778 | Ga0495654_0002354 | |||
| 1779 | Ga0495654_0008334 | |||
| 1780 | Ga0495654_0009503 | |||
| 1781 | Ga0495654_0010621 | |||
| 1782 | Ga0495654_0021065 | |||
| 1783 | Ga0495654_0021345 | |||
| 1784 | Ga0495654_0022158 | |||
| 1785 | Ga0495665_0000011 | |||
| 1786 | Ga0495665_0016754 | |||
| 1787 | Ga0495586_0011759 | |||
| 1788 | Ga0495586_0263805 | |||
| 1789 | Ga0495587_0001836 | |||
| 1790 | Ga0495587_0048545 | |||
| 1791 | Ga0495609_0000160 | |||
| 1792 | Ga0495609_0002853 | |||
| 1793 | Ga0495609_0003497 | |||
| 1794 | Ga0495609_0005248 | |||
| 1795 | Ga0495609_0097130 | |||
| 1796 | Ga0495597_0000776 | |||
| 1797 | Ga0495597_0001758 | |||
| 1798 | Ga0495597_0016121 | |||
| 1799 | Ga0495597_0042031 | |||
| 1800 | Ga0495597_0076094 | |||
| 1801 | Ga0495645_0006438 | |||
| 1802 | Ga0495645_0071074 | |||
| 1803 | Ga0495622_0000378 | |||
| 1804 | Ga0495622_0000411 | |||
| 1805 | Ga0495622_0003600 | |||
| 1806 | Ga0495622_0010921 | |||
| 1807 | Ga0495622_0051318 | |||
| 1808 | Ga0495633_0004863 | |||
| 1809 | Ga0495633_0015278 | |||
| 1810 | Ga0495667_0014469 | |||
| 1811 | Ga0495656_0051121 | |||
| 1812 | Ga0495668_0000281 | |||
| 1813 | Ga0495668_0001550 | |||
| 1814 | Ga0495668_0015324 | |||
| 1815 | Ga0495668_0025087 | |||
| 1816 | Ga0495634_0000218 | |||
| 1817 | Ga0495611_0000048 | |||
| 1818 | Ga0495611_0004661 | |||
| 1819 | Ga0495611_0024482 | |||
| 1820 | Ga0495625_0000790 | |||
| 1821 | Ga0495625_0003012 | |||
| 1822 | Ga0495625_0003190 | |||
| 1823 | Ga0495625_0004247 | |||
| 1824 | Ga0495625_0012811 | |||
| 1825 | Ga0495625_0014191 | |||
| 1826 | Ga0495625_0015309 | |||
| 1827 | Ga0495625_0020970 | |||
| 1828 | Ga0495625_0110067 | |||
| 1829 | Ga0495625_0276637 | |||
| 1830 | Ga0495635_0001815 | |||
| 1831 | Ga0495635_0005778 | |||
| 1832 | Ga0495635_0016161 | |||
| 1833 | Ga0495659_0000035 | |||
| 1834 | Ga0495659_0001278 | |||
| 1835 | Ga0495659_0003768 | |||
| 1836 | Ga0495661_0000011 | |||
| 1837 | Ga0495661_0001173 | |||
| 1838 | Ga0495661_0002752 | |||
| 1839 | Ga0495661_0004925 | |||
| 1840 | Ga0495661_0007307 | |||
| 1841 | Ga0495661_0010217 | |||
| 1842 | Ga0495661_0043912 | |||
| 1843 | Ga0495661_0061949 | |||
| 1844 | Ga0495661_0097042 | |||
| 1845 | Ga0495588_0000433 | |||
| 1846 | Ga0495623_0003360 | |||
| 1847 | Ga0495623_0006494 | |||
| 1848 | Ga0495646_0000777 | |||
| 1849 | Ga0495646_0001145 | |||
| 1850 | Ga0495646_0006387 | |||
| 1851 | Ga0495646_0007303 | |||
| 1852 | Ga0495646_0017436 | |||
| 1853 | Ga0495658_0043765 | |||
| 1854 | Ga0495669_0001494 | |||
| 1855 | Ga0495669_0010225 | |||
| 1856 | Ga0495669_0090569 | |||
| 1857 | Ga0495624_0000133 | |||
| 1858 | Ga0495624_0001440 | |||
| 1859 | Ga0495670_0000169 | |||
| 1860 | Ga0495670_0000280 | |||
| 1861 | Ga0495670_0023001 | |||
| 1862 | Ga0495670_0110925 | |||
| 1863 | Ga0495670_0127301 | |||
| 1864 | Ga0495671_0000136 | |||
| 1865 | Ga0495671_0001038 | |||
| 1866 | Ga0495671_0001847 | |||
| 1867 | Ga0495671_0005112 | |||
| 1868 | Ga0495671_0015228 | |||
| 1869 | Ga0495671_0025531 | |||
| 1870 | Ga0495671_0044501 | |||
| 1871 | Ga0495671_0080112 | |||
| 1872 | Ga0495671_0102923 | |||
| 1873 | Ga0495671_0116602 | |||
| 1874 | Ga0495649_0000083 | |||
| 1875 | Ga0495649_0000316 | |||
| 1876 | Ga0495649_0000430 | |||
| 1877 | Ga0495649_0000495 | |||
| 1878 | Ga0495649_0001099 | |||
| 1879 | Ga0495649_0008492 | |||
| 1880 | Ga0495649_0012954 | |||
| 1881 | Ga0495649_0013424 | |||
| 1882 | Ga0495649_0020775 | |||
| 1883 | Ga0495649_0023261 | |||
| 1884 | Ga0495649_0023527 | |||
| 1885 | Ga0495649_0042659 | |||
| 1886 | Ga0495589_0002311 | |||
| 1887 | Ga0495589_0004383 | |||
| 1888 | Ga0495589_0006414 | |||
| 1889 | Ga0495589_0011742 | |||
| 1890 | Ga0495589_0019791 | |||
| 1891 | Ga0495600_0007213 | |||
| 1892 | Ga0495600_0025616 | |||
| 1893 | Ga0495660_0000487 | |||
| 1894 | Ga0495660_0001546 | |||
| 1895 | Ga0495660_0003102 | |||
| 1896 | Ga0495660_0007904 | |||
| 1897 | Ga0495660_0009323 | |||
| 1898 | Ga0495660_0029073 | |||
| 1899 | Ga0495660_0046984 | |||
| 1900 | Ga0495660_0060109 | |||
| 1901 | Ga0495660_0157927 | |||
| 1902 | Ga0495581_0009537 | |||
| 1903 | Ga0495604_0001695 | |||
| 1904 | Ga0495604_0006676 | |||
| 1905 | Ga0495604_0026862 | |||
| 1906 | Ga0495636_0005171 | |||
| 1907 | Ga0495674_0012957 | |||
| 1908 | Ga0495674_0037134 | |||
| 1909 | Ga0495674_0104487 | |||
| 1910 | Ga0495672_0001626 | |||
| 1911 | Ga0495672_0001695 | |||
| 1912 | Ga0495672_0002779 | |||
| 1913 | Ga0495672_0006170 | |||
| 1914 | Ga0495672_0006897 | |||
| 1915 | Ga0495672_0007362 | |||
| 1916 | Ga0495672_0009071 | |||
| 1917 | Ga0495672_0011128 | |||
| 1918 | Ga0495672_0011198 | |||
| 1919 | Ga0495672_0060206 | |||
| 1920 | Ga0495672_0154326 | |||
| 1921 | Ga0495676_0000178 | |||
| 1922 | Ga0495676_0002539 | |||
| 1923 | Ga0495680_0000939 | |||
| 1924 | Ga0495680_0002463 | |||
| 1925 | Ga0495680_0003676 | |||
| 1926 | Ga0495680_0011267 | |||
| 1927 | Ga0495680_0018941 | |||
| 1928 | Ga0495680_0066668 | |||
| 1929 | Ga0495680_0226498 | |||
| 1930 | Ga0495680_0239683 | |||
| 1931 | Ga0495683_0001324 | |||
| 1932 | Ga0495683_0001705 | |||
| 1933 | Ga0495683_0004324 | |||
| 1934 | Ga0495683_0006186 | |||
| 1935 | Ga0495683_0067648 | |||
| 1936 | Ga0495683_0068104 | |||
| 1937 | Ga0495687_001541 | |||
| 1938 | Ga0495687_002798 | |||
| 1939 | Ga0495687_008086 | |||
| 1940 | Ga0495687_011380 | |||
| 1941 | Ga0495687_054899 | |||
| 1942 | Ga0495675_0001899 | |||
| 1943 | Ga0495677_0000425 | |||
| 1944 | Ga0495679_000224 | |||
| 1945 | Ga0495679_000550 | |||
| 1946 | Ga0495679_000801 | |||
| 1947 | Ga0495679_001151 | |||
| 1948 | Ga0495679_004735 | |||
| 1949 | Ga0495679_010182 | |||
| 1950 | Ga0495679_043309 | |||
| 1951 | Ga0495685_004329 | |||
| 1952 | Ga0495673_0000276 | |||
| 1953 | Ga0495673_0000479 | |||
| 1954 | Ga0495673_0000945 | |||
| 1955 | Ga0495673_0001202 | |||
| 1956 | Ga0495673_0001803 | |||
| 1957 | Ga0495673_0002783 | |||
| 1958 | Ga0495673_0004029 | |||
| 1959 | Ga0495673_0013477 | |||
| 1960 | Ga0495673_0037014 | |||
| 1961 | Ga0495673_0041120 | |||
| 1962 | Ga0495681_0000031 | |||
| 1963 | Ga0495681_0000377 | |||
| 1964 | Ga0495681_0001017 | |||
| 1965 | Ga0495681_0002674 | |||
| 1966 | Ga0495681_0003336 | |||
| 1967 | Ga0495681_0003348 | |||
| 1968 | Ga0495681_0004763 | |||
| 1969 | Ga0495681_0007992 | |||
| 1970 | Ga0495686_0002283 | |||
| 1971 | Ga0495686_0002866 | |||
| 1972 | Ga0495686_0015258 | |||
| 1973 | Ga0495686_0108371 | |||
| 1974 | Ga0495593_0000147 | |||
| 1975 | Ga0495593_0000378 | |||
| 1976 | Ga0495593_0007762 | |||
| 1977 | Ga0495593_0018168 | |||
| 1978 | Ga0495593_0022104 | |||
| 1979 | Ga0495593_0030627 | |||
| 1980 | Ga0495593_0109893 | |||
| 1981 | Ga0495602_0000644 | |||
| 1982 | Ga0495602_0001483 | |||
| 1983 | Ga0495602_0046370 | |||
| 1984 | Ga0495614_0122550 | |||
| 1985 | Ga0495626_0000077 | |||
| 1986 | Ga0495626_0000247 | |||
| 1987 | Ga0495626_0000277 | |||
| 1988 | Ga0495626_0000310 | |||
| 1989 | Ga0495626_0001215 | |||
| 1990 | Ga0495626_0001915 | |||
| 1991 | Ga0495626_0001995 | |||
| 1992 | Ga0495626_0008193 | |||
| 1993 | Ga0495626_0022754 | |||
| 1994 | Ga0495626_0076674 | |||
| 1995 | Ga0496100_0020050 | |||
| 1996 | Ga0496100_0071617 | |||
| 1997 | Ga0496101_0001181 | |||
| 1998 | Ga0496102_0000475 | |||
| 1999 | Ga0496102_0026173 | |||
| 2000 | Ga0496103_0001728 | |||
| 2001 | Ga0496104_0296771 | |||
| 2002 | Ga0496104_0341152 | |||
| 2003 | Ga0496105_0034177 | |||
| 2004 | Ga0496105_0252899 | |||
| 2005 | Ga0496106_0001408 | |||
| 2006 | Ga0496107_0025407 | |||
| 2007 | Ga0496109_0093301 | |||
| 2008 | Ga0496110_0137563 | |||
| 2009 | Ga0496111_0010280 | |||
| 2010 | Ga0496112_0092939 | |||
| 2011 | Ga0496113_0007984 | |||
| 2012 | Ga0496114_0001072 | |||
| 2013 | Ga0496115_0110338 | |||
| 2014 | Ga0496115_0145875 | |||
| 2015 | Ga0496116_0000010 | |||
| 2016 | Ga0496116_0000435 | |||
| 2017 | Ga0496116_0000951 | |||
| 2018 | Ga0496116_0011667 | |||
| 2019 | Ga0496117_0001606 | |||
| 2020 | Ga0496117_0002171 | |||
| 2021 | Ga0496117_0007543 | |||
| 2022 | Ga0496117_0009807 | |||
| 2023 | Ga0496117_0014140 | |||
| 2024 | Ga0496117_0021855 | |||
| 2025 | Ga0496117_0094932 | |||
| 2026 | Ga0496117_0212396 | |||
| 2027 | Ga0496118_0000434 | |||
| 2028 | Ga0496118_0003714 | |||
| 2029 | Ga0496118_0005118 | |||
| 2030 | Ga0496118_0008349 | |||
| 2031 | Ga0496118_0068622 | |||
| 2032 | Ga0496118_0246785 | |||
| 2033 | Ga0496119_0000011 | |||
| 2034 | Ga0496120_0000306 | |||
| 2035 | Ga0496120_0002732 | |||
| 2036 | Ga0496120_0130691 | |||
| 2037 | Ga0496121_0000050 | |||
| 2038 | Ga0496121_0002613 | |||
| 2039 | Ga0496121_0009486 | |||
| 2040 | Ga0496121_0010556 | |||
| 2041 | Ga0496121_0103391 | |||
| 2042 | Ga0496121_0265268 | |||
| 2043 | Ga0496121_0282268 | |||
| 2044 | Ga0496122_0000544 | |||
| 2045 | Ga0496122_0004185 | |||
| 2046 | Ga0496122_0074126 | |||
| 2047 | Ga0496122_0095048 | |||
| 2048 | Ga0496122_0113780 | |||
| 2049 | Ga0496122_0219687 | |||
| 2050 | Ga0496123_0001978 | |||
| 2051 | Ga0496123_0002628 | |||
| 2052 | Ga0496123_0023766 | |||
| 2053 | Ga0496123_0043282 | |||
| 2054 | Ga0496123_0065743 | |||
| 2055 | Ga0496124_0000086 | |||
| 2056 | Ga0496124_0003120 | |||
| 2057 | Ga0496124_0012738 | |||
| 2058 | Ga0496124_0020438 | |||
| 2059 | Ga0496124_0068122 | |||
| 2060 | Ga0496125_0000665 | |||
| 2061 | Ga0496125_0003087 | |||
| 2062 | Ga0496125_0004650 | |||
| 2063 | Ga0496125_0007718 | |||
| 2064 | Ga0496125_0010687 | |||
| 2065 | Ga0496125_0022274 | |||
| 2066 | Ga0496125_0025595 | |||
| 2067 | Ga0496126_0007071 | |||
| 2068 | Ga0496126_0058421 | |||
| 2069 | Ga0496126_0251349 | |||
| 2070 | Ga0495678_000255 | |||
| 2071 | Ga0495678_001235 | |||
| 2072 | Ga0495678_001291 | |||
| 2073 | Ga0495678_002715 | |||
| 2074 | Ga0495678_016381 | |||
| 2075 | Ga0495678_043814 | |||
| 2076 | Ga0495678_047972 | |||
| 2077 | Ga0495678_059280 | |||
| 2078 | Ga0495682_0000542 | |||
| 2079 | Ga0495682_0000701 | |||
| 2080 | Ga0495682_0005895 | |||
| 2081 | Ga0495682_0090547 | |||
| 2082 | Ga0501032_0044703 | |||
| 2083 | Ga0501034_0091139 | |||
| 2084 | Ga0501034_0392484 | |||
| 2085 | Ga0501257_019127 | |||
| 2086 | Ga0501241_000072 | |||
| 2087 | nmdc:mga03683_182881_c1 | |||
| 2088 | nmdc:mga00v17_156239_c1 | |||
| 2089 | nmdc:mga00v17_18917_c1 | |||
| 2090 | nmdc:mga0k408_11123_c1 | |||
| 2091 | nmdc:mga0k408_27900_c1 | |||
| 2092 | nmdc:mga0k408_45834_c1 | |||
| 2093 | nmdc:mga07m45_37398_c1 | |||
| 2094 | nmdc:mga07m45_6970_c1 | |||
| 2095 | nmdc:mga08y16_46313_c1 | |||
| 2096 | Ga0500564_042495 | |||
| 2097 | Ga0500619_008139 | |||
| 2098 | Ga0590071_006398 | |||
| 2099 | Ga0590075_063031 | |||
| 2100 | 2510312114 | |||
| 2101 | 2511255091 | |||
| 2102 | 2511263529 | |||
| 2103 | 2511270484 | |||
| 2104 | 2511278148 | |||
| 2105 | 2511292363 | |||
| 2106 | 2511296026 | |||
| 2107 | 2511302658 | |||
| 2108 | 2511313313 | |||
| 2109 | 2511320124 | |||
| 2110 | 2511328167 | |||
| 2111 | 2511334163 | |||
| 2112 | 2511339407 | |||
| 2113 | 2511342327 | |||
| 2114 | 2511352421 | |||
| 2115 | 2511365576 | |||
| 2116 | 2511369688 | |||
| 2117 | 2511372818 | |||
| 2118 | 2511412651 | |||
| 2119 | 2511824292 | |||
| 2120 | 2512328806 | |||
| 2121 | 2555670386 | |||
| 2122 | 2583792185 | |||
| 2123 | 2597858517 | |||
| 2124 | 2597864003 | |||
| 2125 | 2599352586 | |||
| 2126 | 2599358930 | |||
| 2127 | 2599365549 | |||
| 2128 | 2599371624 | |||
| 2129 | 2599377694 | |||
| 2130 | 2599384929 | |||
| 2131 | 2599390482 | |||
| 2132 | 2599398396 | |||
| 2133 | 2599402667 | |||
| 2134 | 2599450418 | |||
| 2135 | 2599459420 | |||
| 2136 | 2599466241 | |||
| 2137 | 2599486492 | |||
| 2138 | 2599488441 | |||
| 2139 | 2599507300 | |||
| 2140 | 2599512900 | |||
| 2141 | 2599521748 | |||
| 2142 | 2599611123 | |||
| 2143 | 2599803114 | |||
| 2144 | 2599881261 | |||
| 2145 | 2599887377 | |||
| 2146 | 2599891577 | |||
| 2147 | 2599898458 | |||
| 2148 | 2599946722 | |||
| 2149 | 2599958917 | |||
| 2150 | 2599968971 | |||
| 2151 | 2599980228 | |||
| 2152 | 2599994457 | |||
| 2153 | 2600006089 | |||
| 2154 | 2600009428 | |||
| 2155 | 2600017239 | |||
| 2156 | 2600028301 | |||
| 2157 | 2600035699 | |||
| 2158 | 2600044937 | |||
| 2159 | 2600052062 | |||
| 2160 | 2600057063 | |||
| 2161 | 2600065012 | |||
| 2162 | 2600069720 | |||
| 2163 | 2600212025 | |||
| 2164 | 2600357250 | |||
| 2165 | 2600362645 | |||
| 2166 | 2601691936 | |||
| 2167 | 2601772193 | |||
| 2168 | 2601798886 | |||
| 2169 | 2606077781 | |||
| 2170 | 2606130044 | |||
| 2171 | 2624481001 | |||
| 2172 | 2624492132 | |||
| 2173 | 2643841518 | |||
| 2174 | 2643874088 | |||
| 2175 | 2643954253 | |||
| 2176 | 2644023062 | |||
| 2177 | 2644284768 | |||
| 2178 | 2652546082 | |||
| 2179 | 2671090950 | |||
| 2180 | 2671095838 | |||
| 2181 | 2671124736 | |||
| 2182 | 2671769262 | |||
| 2183 | 2677896488 | |||
| 2184 | 2678263974 | |||
| 2185 | 2715753042 | |||
| 2186 | 2715757046 | |||
| 2187 | 2723248785 | |||
| 2188 | 2738806778 | |||
| 2189 | 2738894138 | |||
| 2190 | 2739199388 | |||
| 2191 | 2739257124 | |||
| 2192 | 2739314657 | |||
| 2193 | 2743737966 | |||
| 2194 | 2745004428 | |||
| 2195 | 2774120490 | |||
| 2196 | 2774131419 | |||
| 2197 | 2774133965 | |||
| 2198 | 2784264264 | |||
| 2199 | 2784312963 | |||
| 2200 | 2794597863 | |||
| 2201 | 2808907353 | |||
| 2202 | 2808956201 | |||
| 2203 | 2809214701 | |||
| 2204 | 2819613994 | |||
| 2205 | 2819659527 | |||
| 2206 | 2819700683 | |||
| 2207 | 2825657246 | |||
| 2208 | 2834034086 | |||
| 2209 | 2837681595 | |||
| 2210 | 2842827010 | |||
| 2211 | 2842834932 | |||
| 2212 | 2842839210 | |||
| 2213 | 2842843865 | |||
| 2214 | 2844670990 | |||
| 2215 | 2852657650 | |||
| 2216 | 2860342853 | |||
| 2217 | 2860870676 | |||
| 2218 | 2878032928 | |||
| 2219 | 2904550385 | |||
| 2220 | 2908449813 | |||
| 2221 | 2913039183 | |||
| 2222 | 2917074208 | |||
| 2223 | 2917834283 | |||
| 2224 | 2919064766 | |||
| 2225 | 2919127835 | |||
| 2226 | 2919157087 | |||
| 2227 | 2919387244 | |||
| 2228 | 2919491935 | |||
| 2229 | 2919698316 | |||
| 2230 | 2923157014 | |||
| 2231 | 2923586664 | |||
| 2232 | 2929146461 | |||
| 2233 | 2929192672 | |||
| 2234 | 2931369868 | |||
| 2235 | 2931393938 | |||
| 2236 | 2931401603 | |||
| 2237 | 2935355727 | |||
| 2238 | 2939639053 | |||
| 2239 | 2945933523 | |||
| 2240 | 2945963290 | |||
| 2241 | 2946009711 | |||
| 2242 | 2946030872 | |||
| 2243 | 2947237903 | |||
| 2244 | 2969307839 | |||
| 2245 | 2974290675 | |||
| 2246 | 2974298566 | |||
| 2247 | 2984289061 | |||
| 2248 | 2984500807 | |||
| 2249 | 2998143133 | |||
| 2250 | 3007254810 | |||
| 2251 | 3007396433 | |||
| 2252 | 3007514080 | |||
| 2253 | 3007616037 | |||
| 2254 | 3007625273 | |||
| 2255 | 3007722539 | |||
| 2256 | 3007857123 | |||
| 2257 | 3007861863 | |||
| 2258 | 3007869805 | |||
| 2259 | 637320750 | |||
| 2260 | 639789006 | |||
| 2261 | 8015691258 | |||
| 2262 | 8019772600 | |||
| 2263 | 8019779255 | |||
| 2264 | 8029997648 | |||
| 2265 | 8054285869 | |||
| 2266 | 8054352353 | |||
| 2267 | 8054506431 | |||
| 2268 | 8055774397 | |||
| 2269 | 8055821183 | |||
| 2270 | 8056118424 | |||
| 2271 | 8056128643 | |||
| 2272 | 8056150960 | |||
| 2273 | 8056158871 | |||
| 2274 | 8056166144 | |||
| 2275 | 8056168048 | |||
| 2276 | 8056174522 | |||
| 2277 | 8056178019 | |||
| 2278 | 8057800949 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7t50-assembly2.cif.gz_B | crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form | 0.9517 | 25 | 250 |
| 7t50-assembly2.cif.gz_B | crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form | 0.9437 | 25 | 250 |
| 1atg-assembly1.cif.gz_A | azotobacter vinelandii periplasmic molybdate-binding protein | 0.9401 | 25 | 250 |
| 1atg-assembly1.cif.gz_A | azotobacter vinelandii periplasmic molybdate-binding protein | 0.9168 | 25 | 250 |
| 7tav-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8562 | 21 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1atgA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9528 | 25 | 250 | 3.40.190.10 |
| 4rxlA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9525 | 25 | 250 | 3.40.190.10 |
| 1atgA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9501 | 105 | 210 | 3.40.190.10 |
| af_Q2FVX4_42_108_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.947 | 25 | 89 | 3.40.190.10 |
| 2h5yB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9271 | 21 | 101 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B3PKZ0-F1-model_v4 | Molybdate ABC transporter, periplasmic molybdate-binding protein | 0.9834 | 25 | 250 |
GO:0015689
GO:0030973 GO:0046872 |
| AF-A0A2E5YIN4-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9799 | 43 | 250 |
GO:0015689
GO:0030973 |
| AF-A0A1J4TKV7-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9793 | 69 | 249 |
GO:0015689
GO:0030973 |
| AF-A0A1B3PKZ0-F1-model_v4 | Molybdate ABC transporter, periplasmic molybdate-binding protein | 0.9749 | 25 | 250 |
GO:0015689
GO:0030973 GO:0046872 |
| AF-A0A2E5YIN4-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9662 | 43 | 250 |
GO:0015689
GO:0030973 |