F490686

General Info

Members Datasets Scaffolds Average Seq Length
1139 491 2278 286

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0000630|Ga0501038_0000630_6854_7861
Length 335
Sequence MSCPIVAGVGRRPDIALTVPDAGRWPIAGYSPYKAEDGRRKMDAGMGALANHAFSKMNGIGNEIVVVDLRDSAATVTAEEARAIASPAGVPYDQLMVLQPPLTPRTEAFVRIYNNDGSEANACGNGMRCVARQVFEATGKTVLTFETRAGLLNCWRGSTHGFYTVDMGLPKFDWRDIPLAEEFRDTRYIELQVGPIEKPVLHSPSVVSMGNPHAIFWVDDVNAYDLERFGPLLENHPIFPERANITLAHIVDRDHIVMRTWERGVGLTKACGSAACATAVAAARLKRTNRTVEMLLPGGGLTIEWCEHGDHVMMTGPAVFEYAGRFDPALFTPVA

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
291 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
347 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
402 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
403 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
407 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
411 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
412 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
413 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
414 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
415 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
416 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
417 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
421 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
422 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
423 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
424 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
425 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
426 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
427 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
428 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
429 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
437 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
438 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
439 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
440 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
441 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
442 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
443 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
444 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
445 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
446 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
447 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
448 2643221651 Afipia sp. Root123D2 Isolate Unclassified
449 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
450 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
451 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
452 2791355199
453 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
454 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
455 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
456 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
457 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
458 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
459 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
460 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
461 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
462 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
463 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
464 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
465 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
466 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
467 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
468 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
469 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
470 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
471 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
472 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
473 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
474 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
475 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
476 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
477 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
478 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
479 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
480 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
481 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
482 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
483 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
484 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
485 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
486 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
487 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
488 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
489 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
490 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
491 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.34
Metatranscriptomes 0.09
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 2.63
Rhizoplane 4.74
Rhizosphere 76.82
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0000630 3300049574 Bacteria 31329
2 JGI24740J21852_10006878 3300001979 Bacteria 4670
3 JGI24737J22298_10015483 3300001990 Bacteria 2469
4 JGI24744J21845_10026309 3300002077 Bacteria 1130
5 JGI25153J46596_10043278 3300003215 Bacteria 1365
6 JGI25160J50197_1007581 3300003354 Bacteria 4232
7 JGI25404J52841_10001804 3300003659 Bacteria 3886
8 JGI25404J52841_10008798 3300003659 Unclassified 2156
9 JGI25404J52841_10017513 3300003659 Bacteria 1553
10 Ga0070658_10377518 3300005327 Bacteria 1216
11 Ga0070683_100070525 3300005329 Bacteria 3260
12 Ga0070690_100081395 3300005330 Bacteria 2119
13 Ga0070670_100179008 3300005331 Bacteria 1840
14 Ga0068869_100044714 3300005334 Bacteria 3185
15 Ga0070680_100022603 3300005336 Bacteria 5011
16 Ga0070680_100046810 3300005336 Bacteria 3519
17 Ga0070680_100098721 3300005336 Bacteria 2423
18 Ga0070682_100001898 3300005337 Bacteria 11671
19 Ga0068868_100016512 3300005338 Bacteria 5484
20 Ga0070660_100008345 3300005339 Bacteria 7242
21 Ga0070660_100265323 3300005339 Bacteria 1403
22 Ga0070660_100301020 3300005339 Bacteria 1315
23 Ga0070691_10003421 3300005341 Bacteria 7133
24 Ga0070691_10038245 3300005341 Bacteria 2265
25 Ga0070668_100134018 3300005347 Bacteria 1990
26 Ga0070668_100187291 3300005347 Bacteria 1693
27 Ga0070669_100040796 3300005353 Bacteria 3374
28 Ga0070675_100142137 3300005354 Bacteria 2052
29 Ga0070671_100073962 3300005355 Bacteria 2846
30 Ga0070674_100154706 3300005356 Bacteria 1734
31 Ga0070673_100218483 3300005364 Bacteria 1649
32 Ga0070673_100277068 3300005364 Bacteria 1470
33 Ga0070659_100038851 3300005366 Bacteria 3713
34 Ga0070659_100039277 3300005366 Bacteria 3694
35 Ga0070667_100624676 3300005367 Bacteria 994
36 Ga0070667_100660470 3300005367 Bacteria 966
37 Ga0070709_10014835 3300005434 Bacteria 4417
38 Ga0070709_10056369 3300005434 Bacteria 2484
39 Ga0070714_100011934 3300005435 Bacteria 6911
40 Ga0070714_100112182 3300005435 Bacteria 2416
41 Ga0070713_100003576 3300005436 Bacteria 10269
42 Ga0070713_100016739 3300005436 Bacteria 5520
43 Ga0070713_100020074 3300005436 Bacteria 5115
44 Ga0070713_100103980 3300005436 Bacteria 2465
45 Ga0070710_10001532 3300005437 Bacteria 10922
46 Ga0070710_10003996 3300005437 Bacteria 6992
47 Ga0070710_10024153 3300005437 Bacteria 3204
48 Ga0070710_10035594 3300005437 Bacteria 2716
49 Ga0070711_100008302 3300005439 Bacteria 6355
50 Ga0070711_100009673 3300005439 Bacteria 5940
51 Ga0070711_100012351 3300005439 Bacteria 5332
52 Ga0070711_100072636 3300005439 Bacteria 2428
53 Ga0070711_100102931 3300005439 Bacteria 2080
54 Ga0070711_100179985 3300005439 Bacteria 1618
55 Ga0070705_100077274 3300005440 Bacteria 2033
56 Ga0070700_100017526 3300005441 Bacteria 4099
57 Ga0070663_100026672 3300005455 Bacteria 3915
58 Ga0070663_100199834 3300005455 Bacteria 1559
59 Ga0070663_100206617 3300005455 Bacteria 1535
60 Ga0070663_100361217 3300005455 Bacteria 1178
61 Ga0070678_100034660 3300005456 Bacteria 3517
62 Ga0070662_100262216 3300005457 Bacteria 1392
63 Ga0070681_10002937 3300005458 Bacteria 15801
64 Ga0070681_10277524 3300005458 Bacteria 1587
65 Ga0070681_10306009 3300005458 Bacteria 1499
66 Ga0068867_100423905 3300005459 Bacteria 1128
67 Ga0070706_100082929 3300005467 Bacteria 2970
68 Ga0070698_100321192 3300005471 Bacteria 1479
69 Ga0070679_100002400 3300005530 Bacteria 16984
70 Ga0070679_100003447 3300005530 Bacteria 14478
71 Ga0070679_100030485 3300005530 Bacteria 5324
72 Ga0070679_100561122 3300005530 Bacteria 1085
73 Ga0070684_100025298 3300005535 Bacteria 4988
74 Ga0070684_100043767 3300005535 Bacteria 3869
75 Ga0070697_100099077 3300005536 Bacteria 2419
76 Ga0068853_100000639 3300005539 Bacteria 23990
77 Ga0068853_100003310 3300005539 Bacteria 12327
78 Ga0068853_100038170 3300005539 Bacteria 4090
79 Ga0068853_100039338 3300005539 Bacteria 4033
80 Ga0068853_100059209 3300005539 Bacteria 3308
81 Ga0068853_100190008 3300005539 Bacteria 1865
82 Ga0070695_100120591 3300005545 Bacteria 1793
83 Ga0070696_100026887 3300005546 Bacteria 3916
84 Ga0070693_100034913 3300005547 Bacteria 2785
85 Ga0070665_100029471 3300005548 Bacteria 5524
86 Ga0070665_100031667 3300005548 Bacteria 5322
87 Ga0070665_100091913 3300005548 Bacteria 3039
88 Ga0070704_100336465 3300005549 Bacteria 1270
89 Ga0068855_100026317 3300005563 Bacteria 6959
90 Ga0068855_100030888 3300005563 Bacteria 6402
91 Ga0068855_100053234 3300005563 Bacteria 4763
92 Ga0068855_100060155 3300005563 Bacteria 4443
93 Ga0068855_100112279 3300005563 Bacteria 3127
94 Ga0068855_100112294 3300005563 Bacteria 3127
95 Ga0068855_100153539 3300005563 Bacteria 2617
96 Ga0070664_100227804 3300005564 Bacteria 1670
97 Ga0068857_100001037 3300005577 Bacteria 21487
98 Ga0068857_100033794 3300005577 Bacteria 4522
99 Ga0068857_100037870 3300005577 Bacteria 4273
100 Ga0068857_100443105 3300005577 Bacteria 1213
101 Ga0068854_100001597 3300005578 Bacteria 13790
102 Ga0068854_100019432 3300005578 Bacteria 4578
103 Ga0068854_100102280 3300005578 Bacteria 2149
104 Ga0068854_100178383 3300005578 Bacteria 1658
105 Ga0068854_100223513 3300005578 Bacteria 1491
106 Ga0068856_100000883 3300005614 Bacteria 32112
107 Ga0068856_100012184 3300005614 Bacteria 8332
108 Ga0068856_100155809 3300005614 Bacteria 2294
109 Ga0068856_100488926 3300005614 Bacteria 1252
110 Ga0068852_100030003 3300005616 Bacteria 4472
111 Ga0068852_100116544 3300005616 Bacteria 2437
112 Ga0068859_100047861 3300005617 Bacteria 4296
113 Ga0068859_100379973 3300005617 Bacteria 1508
114 Ga0068859_100667026 3300005617 Bacteria 1131
115 Ga0068864_100033808 3300005618 Bacteria 4347
116 Ga0068861_100037920 3300005719 Bacteria 3584
117 Ga0068861_100052285 3300005719 Bacteria 3104
118 Ga0068861_100141285 3300005719 Bacteria 1965
119 Ga0068861_100368396 3300005719 Bacteria 1265
120 Ga0068861_100637789 3300005719 Bacteria 982
121 Ga0068851_10000558 3300005834 Bacteria 16219
122 Ga0068851_10015981 3300005834 Bacteria 3584
123 Ga0068870_10053768 3300005840 Bacteria 2140
124 Ga0068858_100069349 3300005842 Bacteria 3268
125 Ga0068858_100178809 3300005842 Bacteria 2002
126 Ga0068858_100297313 3300005842 Bacteria 1540
127 Ga0068860_100000477 3300005843 Bacteria 49839
128 Ga0068862_100040785 3300005844 Bacteria 3947
129 Ga0068862_100094520 3300005844 Bacteria 2607
130 Ga0068862_100102424 3300005844 Bacteria 2506
131 Ga0081455_10000209 3300005937 Bacteria 74597
132 Ga0081455_10005086 3300005937 Bacteria 14513
133 Ga0081455_10007370 3300005937 Bacteria 11598
134 Ga0081455_10007381 3300005937 Bacteria 11587
135 Ga0081455_10109474 3300005937 Bacteria 2198
136 Ga0081455_10354979 3300005937 Bacteria 1033
137 Ga0081538_10074134 3300005981 Bacteria 1854
138 Ga0081540_1000064 3300005983 Bacteria 119429
139 Ga0081540_1003488 3300005983 Bacteria 12411
140 Ga0081540_1008854 3300005983 Bacteria 6988
141 Ga0081540_1012184 3300005983 Bacteria 5686
142 Ga0081540_1048845 3300005983 Bacteria 2116
143 Ga0081539_10018659 3300005985 Bacteria 4799
144 Ga0070717_10016786 3300006028 Bacteria 5683
145 Ga0070717_10041403 3300006028 Bacteria 3755
146 Ga0070717_10119310 3300006028 Bacteria 2258
147 Ga0070717_10231831 3300006028 Bacteria 1626
148 Ga0075365_10106354 3300006038 Bacteria 1925
149 Ga0075368_10064243 3300006042 Bacteria 1473
150 Ga0075368_10088191 3300006042 Bacteria 1267
151 Ga0075363_100004174 3300006048 Bacteria 6275
152 Ga0075363_100082345 3300006048 Bacteria 1761
153 Ga0075363_100123090 3300006048 Bacteria 1450
154 Ga0075364_10018451 3300006051 Bacteria 4367
155 Ga0075364_10034501 3300006051 Bacteria 3265
156 Ga0075364_10057410 3300006051 Bacteria 2549
157 Ga0075432_10048537 3300006058 Bacteria 1494
158 Ga0070715_10000275 3300006163 Bacteria 12448
159 Ga0070715_10009900 3300006163 Bacteria 3378
160 Ga0070715_10090401 3300006163 Bacteria 1408
161 Ga0070715_10213345 3300006163 Bacteria 988
162 Ga0070716_100007369 3300006173 Bacteria 5411
163 Ga0070716_100218767 3300006173 Bacteria 1278
164 Ga0070716_100227526 3300006173 Bacteria 1257
165 Ga0070712_100002530 3300006175 Bacteria 11286
166 Ga0070712_100034544 3300006175 Bacteria 3427
167 Ga0070712_100065297 3300006175 Bacteria 2583
168 Ga0070712_100102723 3300006175 Bacteria 2118
169 Ga0070712_100146083 3300006175 Bacteria 1810
170 Ga0075362_10020405 3300006177 Bacteria 2768
171 Ga0075362_10041956 3300006177 Bacteria 2020
172 Ga0075367_10005424 3300006178 Bacteria 6332
173 Ga0075367_10049481 3300006178 Bacteria 2478
174 Ga0075367_10110837 3300006178 Bacteria 1684
175 Ga0075369_10009037 3300006186 Bacteria 3857
176 Ga0097621_100339564 3300006237 Bacteria 1334
177 Ga0097621_100451914 3300006237 Bacteria 1158
178 Ga0075370_10022430 3300006353 Bacteria 3468
179 Ga0075370_10102322 3300006353 Bacteria 1659
180 Ga0075428_100003141 3300006844 Bacteria 18043
181 Ga0075428_100128112 3300006844 Bacteria 2761
182 Ga0075428_100532983 3300006844 Bacteria 1256
183 Ga0075431_100000568 3300006847 Bacteria 31187
184 Ga0075431_100001629 3300006847 Bacteria 20981
185 Ga0075431_100266627 3300006847 Bacteria 1737
186 Ga0075433_10004977 3300006852 Bacteria 10404
187 Ga0075433_10045558 3300006852 Bacteria 3813
188 Ga0075433_10250376 3300006852 Bacteria 1572
189 Ga0075434_100028319 3300006871 Bacteria 5503
190 Ga0075434_100040930 3300006871 Bacteria 4588
191 Ga0075434_100056552 3300006871 Bacteria 3898
192 Ga0075434_100072031 3300006871 Bacteria 3448
193 Ga0075429_100003175 3300006880 Bacteria 13972
194 Ga0068865_100292659 3300006881 Bacteria 1300
195 Ga0075436_100068860 3300006914 Bacteria 2445
196 Ga0097620_100047862 3300006931 Bacteria 4296
197 Ga0097620_100379954 3300006931 Bacteria 1508
198 Ga0097620_100666967 3300006931 Bacteria 1131
199 Ga0075435_100051643 3300007076 Bacteria 3312
200 Ga0075435_100076669 3300007076 Bacteria 2740
201 Ga0075435_100078601 3300007076 Bacteria 2706
202 Ga0075435_100518438 3300007076 Bacteria 1031
203 Ga0099794_10001485 3300007265 Bacteria 8212
204 Ga0099794_10036912 3300007265 Bacteria 2312
205 Ga0099795_10080197 3300007788 Bacteria 1247
206 Ga0105240_10002459 3300009093 Bacteria 29768
207 Ga0105240_10062589 3300009093 Bacteria 4632
208 Ga0105240_10087076 3300009093 Bacteria 3825
209 Ga0105240_10170354 3300009093 Bacteria 2579
210 Ga0111539_10001515 3300009094 Bacteria 31011
211 Ga0111539_10066626 3300009094 Bacteria 4253
212 Ga0111539_10091971 3300009094 Bacteria 3564
213 Ga0111539_10246033 3300009094 Bacteria 2082
214 Ga0111539_10254754 3300009094 Bacteria 2044
215 Ga0111539_10311410 3300009094 Bacteria 1832
216 Ga0105245_10189575 3300009098 Bacteria 1969
217 Ga0105247_10265102 3300009101 Bacteria 1179
218 Ga0114129_10000692 3300009147 Bacteria 42533
219 Ga0114129_10065672 3300009147 Bacteria 5063
220 Ga0114129_10092485 3300009147 Bacteria 4190
221 Ga0114129_10126694 3300009147 Bacteria 3510
222 Ga0114129_10293883 3300009147 Bacteria 2167
223 Ga0105243_10377080 3300009148 Bacteria 1311
224 Ga0105241_10000249 3300009174 Bacteria 40643
225 Ga0105241_10109783 3300009174 Bacteria 2206
226 Ga0105242_10099724 3300009176 Bacteria 2459
227 Ga0105248_10156900 3300009177 Bacteria 2568
228 Ga0105248_10385572 3300009177 Bacteria 1578
229 Ga0105237_10067599 3300009545 Bacteria 3567
230 Ga0105237_10133597 3300009545 Bacteria 2476
231 Ga0105237_10168759 3300009545 Bacteria 2188
232 Ga0105237_10286091 3300009545 Bacteria 1651
233 Ga0105238_10001235 3300009551 Bacteria 25716
234 Ga0105238_10014511 3300009551 Bacteria 7966
235 Ga0105238_10038587 3300009551 Bacteria 4850
236 Ga0105249_10044828 3300009553 Bacteria 4021
237 Ga0105249_10746958 3300009553 Bacteria 1040
238 Ga0105249_10840241 3300009553 Bacteria 983
239 Ga0099796_10020835 3300010159 Bacteria 2010
240 Ga0105239_10032291 3300010375 Bacteria 5754
241 Ga0105239_10061707 3300010375 Bacteria 4114
242 Ga0105239_10158333 3300010375 Bacteria 2530
243 Ga0105239_10227921 3300010375 Bacteria 2090
244 Ga0157373_10050479 3300013100 Bacteria 2962
245 Ga0157373_10131755 3300013100 Bacteria 1758
246 Ga0157370_10008510 3300013104 Bacteria 11064
247 Ga0157370_10015855 3300013104 Bacteria 7646
248 Ga0157370_10376246 3300013104 Bacteria 1308
249 Ga0157369_10052065 3300013105 Bacteria 4430
250 Ga0157372_10443094 3300013307 Bacteria 1514
251 Ga0157375_10139921 3300013308 Bacteria 2547
252 Ga0157375_10187578 3300013308 Bacteria 2222
253 Ga0163163_10064343 3300014325 Bacteria 3639
254 Ga0163163_10220639 3300014325 Bacteria 1944
255 Ga0163163_10475090 3300014325 Bacteria 1311
256 Ga0157380_10163035 3300014326 Bacteria 1940
257 Ga0157380_10303924 3300014326 Bacteria 1471
258 Ga0157380_10382047 3300014326 Bacteria 1329
259 Ga0157377_10078649 3300014745 Bacteria 1923
260 Ga0157379_10270345 3300014968 Bacteria 1546
261 Ga0163161_10070039 3300017792 Bacteria 2565
262 Ga0206353_11234579 3300020082 Bacteria 1782
263 Ga0213872_10140105 3300021361 Bacteria 1062
264 Ga0213874_10002095 3300021377 Bacteria 4228
265 Ga0213876_10005453 3300021384 Bacteria 6994
266 Ga0213876_10125669 3300021384 Bacteria 1362
267 Ga0213876_10131901 3300021384 Bacteria 1328
268 Ga0213876_10234387 3300021384 Bacteria 976
269 Ga0213871_10021333 3300021441 Bacteria 1613
270 Ga0209758_1001918 3300025297 Bacteria 22622
271 Ga0209758_1004128 3300025297 Bacteria 12418
272 Ga0209758_1048464 3300025297 Bacteria 1510
273 Ga0207426_1001156 3300025302 Bacteria 23697
274 Ga0207656_10003400 3300025321 Bacteria 5466
275 Ga0207656_10020096 3300025321 Bacteria 2650
276 Ga0207692_10000565 3300025898 Bacteria 13191
277 Ga0207692_10052384 3300025898 Bacteria 2074
278 Ga0207642_10135499 3300025899 Bacteria 1291
279 Ga0207710_10014866 3300025900 Bacteria 3287
280 Ga0207688_10058536 3300025901 Bacteria 2168
281 Ga0207688_10087080 3300025901 Bacteria 1790
282 Ga0207688_10107952 3300025901 Bacteria 1613
283 Ga0207647_10009887 3300025904 Bacteria 6756
284 Ga0207647_10092600 3300025904 Bacteria 1802
285 Ga0207685_10009621 3300025905 Bacteria 2815
286 Ga0207685_10023455 3300025905 Bacteria 2101
287 Ga0207685_10078961 3300025905 Bacteria 1356
288 Ga0207699_10219749 3300025906 Bacteria 1296
289 Ga0207645_10220582 3300025907 Bacteria 1250
290 Ga0207643_10084567 3300025908 Bacteria 1842
291 Ga0207705_10241570 3300025909 Bacteria 1376
292 Ga0207684_10002963 3300025910 Bacteria 16822
293 Ga0207684_10051004 3300025910 Bacteria 3510
294 Ga0207654_10069399 3300025911 Bacteria 2088
295 Ga0207707_10007389 3300025912 Bacteria 9570
296 Ga0207707_10008266 3300025912 Bacteria 9034
297 Ga0207707_10128117 3300025912 Bacteria 2219
298 Ga0207707_10232942 3300025912 Bacteria 1602
299 Ga0207695_10000148 3300025913 Bacteria 208344
300 Ga0207695_10000387 3300025913 Bacteria 99734
301 Ga0207695_10092643 3300025913 Bacteria 3032
302 Ga0207695_10136588 3300025913 Bacteria 2405
303 Ga0207695_10177135 3300025913 Bacteria 2054
304 Ga0207695_10241252 3300025913 Bacteria 1709
305 Ga0207671_10003051 3300025914 Bacteria 17147
306 Ga0207671_10026208 3300025914 Bacteria 4370
307 Ga0207671_10034623 3300025914 Bacteria 3752
308 Ga0207671_10114074 3300025914 Bacteria 2059
309 Ga0207693_10001168 3300025915 Bacteria 23417
310 Ga0207693_10003777 3300025915 Bacteria 12900
311 Ga0207693_10021801 3300025915 Bacteria 5094
312 Ga0207693_10042386 3300025915 Bacteria 3583
313 Ga0207693_10187477 3300025915 Bacteria 1628
314 Ga0207663_10004750 3300025916 Bacteria 6785
315 Ga0207663_10037861 3300025916 Bacteria 2911
316 Ga0207663_10042175 3300025916 Bacteria 2787
317 Ga0207663_10050996 3300025916 Bacteria 2575
318 Ga0207663_10294081 3300025916 Bacteria 1211
319 Ga0207660_10015897 3300025917 Bacteria 4975
320 Ga0207660_10062767 3300025917 Bacteria 2677
321 Ga0207660_10089142 3300025917 Bacteria 2283
322 Ga0207657_10009668 3300025919 Bacteria 9676
323 Ga0207657_10024873 3300025919 Bacteria 5535
324 Ga0207652_10007807 3300025921 Bacteria 8595
325 Ga0207652_10060204 3300025921 Bacteria 3276
326 Ga0207652_10069014 3300025921 Bacteria 3068
327 Ga0207694_10000121 3300025924 Bacteria 83123
328 Ga0207694_10015653 3300025924 Bacteria 5721
329 Ga0207694_10049243 3300025924 Bacteria 3261
330 Ga0207694_10287278 3300025924 Bacteria 1352
331 Ga0207650_10002929 3300025925 Bacteria 11773
332 Ga0207687_10014891 3300025927 Bacteria 5094
333 Ga0207700_10010887 3300025928 Bacteria 5772
334 Ga0207700_10036983 3300025928 Bacteria 3531
335 Ga0207700_10073901 3300025928 Bacteria 2635
336 Ga0207700_10092831 3300025928 Bacteria 2387
337 Ga0207700_10208805 3300025928 Bacteria 1650
338 Ga0207664_10012301 3300025929 Bacteria 6114
339 Ga0207664_10146411 3300025929 Bacteria 2003
340 Ga0207664_10217097 3300025929 Bacteria 1657
341 Ga0207644_10050991 3300025931 Bacteria 2968
342 Ga0207644_10135617 3300025931 Bacteria 1889
343 Ga0207690_10340721 3300025932 Bacteria 1183
344 Ga0207706_10044297 3300025933 Bacteria 3944
345 Ga0207706_10111603 3300025933 Bacteria 2405
346 Ga0207709_10052061 3300025935 Bacteria 2512
347 Ga0207709_10073008 3300025935 Bacteria 2185
348 Ga0207670_10229635 3300025936 Bacteria 1425
349 Ga0207669_10025452 3300025937 Bacteria 3199
350 Ga0207669_10082593 3300025937 Bacteria 2063
351 Ga0207665_10000883 3300025939 Bacteria 20232
352 Ga0207665_10112997 3300025939 Bacteria 1910
353 Ga0207665_10363057 3300025939 Bacteria 1095
354 Ga0207691_10253519 3300025940 Bacteria 1518
355 Ga0207691_10477779 3300025940 Bacteria 1059
356 Ga0207711_10029240 3300025941 Bacteria 4645
357 Ga0207711_10219501 3300025941 Bacteria 1738
358 Ga0207689_10289799 3300025942 Bacteria 1356
359 Ga0207689_10371073 3300025942 Bacteria 1191
360 Ga0207661_10002867 3300025944 Bacteria 11914
361 Ga0207661_10056017 3300025944 Bacteria 3164
362 Ga0207661_10380521 3300025944 Bacteria 1277
363 Ga0207667_10007656 3300025949 Bacteria 12939
364 Ga0207667_10016003 3300025949 Bacteria 8492
365 Ga0207667_10054033 3300025949 Bacteria 4225
366 Ga0207667_10137555 3300025949 Bacteria 2515
367 Ga0207667_10178423 3300025949 Bacteria 2182
368 Ga0207667_10316090 3300025949 Bacteria 1595
369 Ga0207667_10538213 3300025949 Bacteria 1182
370 Ga0207712_10187413 3300025961 Bacteria 1630
371 Ga0207668_10145485 3300025972 Bacteria 1828
372 Ga0207640_10005594 3300025981 Bacteria 6850
373 Ga0207640_10055934 3300025981 Bacteria 2587
374 Ga0207658_10301124 3300025986 Bacteria 1381
375 Ga0207703_10014932 3300026035 Bacteria 6060
376 Ga0207703_10077871 3300026035 Bacteria 2753
377 Ga0207639_10014436 3300026041 Bacteria 5556
378 Ga0207639_10016223 3300026041 Bacteria 5265
379 Ga0207639_10308765 3300026041 Bacteria 1400
380 Ga0207678_10007286 3300026067 Bacteria 9804
381 Ga0207678_10044075 3300026067 Bacteria 3860
382 Ga0207678_10232539 3300026067 Bacteria 1578
383 Ga0207678_10297876 3300026067 Bacteria 1386
384 Ga0207678_10304985 3300026067 Bacteria 1369
385 Ga0207678_10567390 3300026067 Bacteria 993
386 Ga0207708_10172435 3300026075 Bacteria 1714
387 Ga0207708_10419736 3300026075 Bacteria 1109
388 Ga0207702_10000004 3300026078 Bacteria 422182
389 Ga0207702_10000318 3300026078 Bacteria 55209
390 Ga0207702_10051367 3300026078 Bacteria 3483
391 Ga0207702_10055681 3300026078 Bacteria 3355
392 Ga0207702_10325607 3300026078 Bacteria 1465
393 Ga0207648_10120914 3300026089 Bacteria 2303
394 Ga0207676_10088633 3300026095 Bacteria 2533
395 Ga0207676_10205751 3300026095 Bacteria 1742
396 Ga0207674_10005964 3300026116 Bacteria 14418
397 Ga0207674_10006033 3300026116 Bacteria 14333
398 Ga0207674_10012348 3300026116 Bacteria 9549
399 Ga0207674_10079008 3300026116 Bacteria 3295
400 Ga0207674_10122866 3300026116 Bacteria 2562
401 Ga0207675_100026733 3300026118 Bacteria 5371
402 Ga0207675_100044501 3300026118 Bacteria 4149
403 Ga0207675_100051099 3300026118 Bacteria 3857
404 Ga0207675_100175437 3300026118 Bacteria 2050
405 Ga0207675_100237438 3300026118 Bacteria 1760
406 Ga0207683_10028337 3300026121 Bacteria 4842
407 Ga0207683_10066450 3300026121 Bacteria 3180
408 Ga0207683_10360374 3300026121 Bacteria 1335
409 Ga0207698_10013415 3300026142 Bacteria 5406
410 Ga0207698_10329898 3300026142 Bacteria 1433
411 Ga0209179_1016514 3300027512 Bacteria 1386
412 Ga0209588_1053255 3300027671 Bacteria 1309
413 Ga0209813_10013142 3300027866 Bacteria 2204
414 Ga0207428_10002337 3300027907 Bacteria 18975
415 Ga0207428_10046668 3300027907 Bacteria 3483
416 Ga0207428_10311886 3300027907 Bacteria 1163
417 Ga0268266_10001906 3300028379 Bacteria 23472
418 Ga0268266_10649913 3300028379 Bacteria 1015
419 Ga0268265_10122027 3300028380 Bacteria 2148
420 Ga0268264_10000062 3300028381 Bacteria 302110
421 Ga0268264_10470329 3300028381 Bacteria 1221
422 Ga0265337_1001354 3300028556 Bacteria 12087
423 Ga0265334_10089935 3300028573 Bacteria 1121
424 Ga0307517_10000175 3300028786 Bacteria 105567
425 Ga0307515_10099000 3300028794 Bacteria 3544
426 Ga0307515_10236976 3300028794 Bacteria 1604
427 Ga0307511_10054505 3300030521 Bacteria 3151
428 Ga0265330_10038896 3300031235 Bacteria 2114
429 Ga0265325_10025732 3300031241 Bacteria 3193
430 Ga0265340_10017518 3300031247 Bacteria 3706
431 Ga0265339_10000738 3300031249 Bacteria 25301
432 Ga0265339_10117155 3300031249 Bacteria 1373
433 Ga0265331_10171233 3300031250 Bacteria 982
434 Ga0307513_10212321 3300031456 Bacteria 1765
435 Ga0307509_10006160 3300031507 Bacteria 16260
436 Ga0307508_10000045 3300031616 Bacteria 142824
437 Ga0307508_10034088 3300031616 Bacteria 4591
438 Ga0265314_10014911 3300031711 Bacteria 6190
439 Ga0265314_10168340 3300031711 Bacteria 1326
440 Ga0265342_10168724 3300031712 Bacteria 1206
441 Ga0307516_10049470 3300031730 Bacteria 4131
442 Ga0307516_10098273 3300031730 Bacteria 2746
443 Ga0307516_10161987 3300031730 Bacteria 1986
444 Ga0307516_10406943 3300031730 Bacteria 1019
445 Ga0307406_10454913 3300031901 Bacteria 1028
446 Ga0307407_10163740 3300031903 Bacteria 1458
447 Ga0307411_10150769 3300032005 Bacteria 1727
448 Ga0307415_100207760 3300032126 Bacteria 1559
449 Ga0307507_10110502 3300033179 Bacteria 2249
450 Ga0307510_10042915 3300033180 Bacteria 4922
451 Ga0373930_0045829 3300034816 Bacteria 943
452 Ga0373926_0094737 3300035083 Bacteria 1113
453 Ga0373934_0014812 3300035086 Bacteria 2953
454 Ga0373934_0065091 3300035086 Bacteria 1455
455 Ga0373940_0003839 3300035088 Bacteria 3115
456 Ga0373949_0007155 3300035090 Bacteria 2447
457 Ga0373923_0038708 3300035111 Bacteria 1955
458 Ga0373936_0003919 3300035113 Bacteria 5605
459 Ga0373936_0023840 3300035113 Bacteria 2387
460 Ga0373936_0028148 3300035113 Bacteria 2208
461 Ga0373936_0030004 3300035113 Bacteria 2144
462 Ga0373941_0009142 3300035115 Bacteria 2487
463 Ga0373956_0004385 3300035119 Bacteria 5652
464 Ga0373957_0007126 3300035120 Bacteria 3562
465 Ga0373960_0001356 3300035121 Bacteria 5400
466 Ga0373960_0011395 3300035121 Bacteria 2190
467 Ga0373943_0003409 3300035170 Bacteria 7239
468 Ga0373943_0005484 3300035170 Bacteria 5707
469 Ga0373943_0025075 3300035170 Bacteria 2785
470 Ga0373946_0002063 3300035171 Bacteria 7056
471 Ga0373946_0016589 3300035171 Bacteria 2808
472 Ga0373946_0025554 3300035171 Bacteria 2323
473 Ga0373946_0138036 3300035171 Bacteria 1128
474 Ga0373955_0000224 3300035172 Bacteria 23923
475 Ga0373955_0011330 3300035172 Bacteria 4245
476 Ga0373955_0030936 3300035172 Bacteria 2800
477 Ga0373955_0094738 3300035172 Bacteria 1706
478 Ga0373961_0002623 3300035241 Bacteria 4626
479 Ga0373962_0127877 3300035242 Bacteria 815
480 Ga0316574_0014984 3300035398 Bacteria 4490
481 Ga0373924_0011255 3300035410 Bacteria 3318
482 Ga0373931_0002391 3300035691 Bacteria 8312
483 Ga0373931_0006320 3300035691 Bacteria 5528
484 Ga0373931_0029681 3300035691 Bacteria 2809
485 Ga0373935_0000011 3300035692 Bacteria 89873
486 Ga0373935_0014539 3300035692 Bacteria 4749
487 Ga0373935_0097097 3300035692 Bacteria 1937
488 Ga0373935_0219253 3300035692 Bacteria 1321
489 Ga0373927_0001064 3300035695 Bacteria 20972
490 Ga0373927_0003727 3300035695 Bacteria 10831
491 Ga0373927_0004599 3300035695 Bacteria 9620
492 Ga0373927_0048569 3300035695 Bacteria 2745
493 Ga0373927_0114622 3300035695 Bacteria 1757
494 Ga0373927_0201880 3300035695 Bacteria 1305
495 Ga0373933_0000315 3300035724 Bacteria 31397
496 Ga0373933_0000885 3300035724 Bacteria 18316
497 Ga0373933_0009041 3300035724 Bacteria 5435
498 Ga0373933_0012657 3300035724 Bacteria 4662
499 Ga0373933_0146323 3300035724 Bacteria 1494
500 Ga0373933_0171054 3300035724 Bacteria 1382
501 Ga0373947_0006319 3300035725 Bacteria 6885
502 Ga0373947_0021592 3300035725 Bacteria 3727
503 Ga0373947_0236599 3300035725 Bacteria 1204
504 Ga0373937_0000019 3300036401 Bacteria 138568
505 Ga0373937_0008940 3300036401 Bacteria 8693
506 Ga0373937_0017394 3300036401 Bacteria 6403
507 Ga0373937_0022449 3300036401 Bacteria 5674
508 Ga0373937_0029705 3300036401 Bacteria 4952
509 Ga0373937_0099501 3300036401 Bacteria 2697
510 Ga0373937_0211596 3300036401 Bacteria 1824
511 Ga0373937_0214019 3300036401 Bacteria 1814
512 Ga0373937_0288660 3300036401 Bacteria 1550
513 Ga0316584_0012076 3300036712 Bacteria 6083
514 Ga0316584_0034275 3300036712 Bacteria 3764
515 Ga0373925_0000026 3300037068 Bacteria 154713
516 Ga0373925_0007638 3300037068 Bacteria 7875
517 Ga0373925_0012102 3300037068 Bacteria 6246
518 Ga0373925_0054728 3300037068 Bacteria 2985
519 Ga0373925_0079834 3300037068 Bacteria 2486
520 Ga0373925_0106664 3300037068 Bacteria 2160
521 Ga0373925_0107949 3300037068 Bacteria 2147
522 Ga0373925_0297317 3300037068 Bacteria 1303
523 Ga0373925_0384790 3300037068 Bacteria 1143
524 Ga0395899_0006366 3300037312 Bacteria 9143
525 Ga0395900_0009214 3300037418 Bacteria 10119
526 Ga0395900_0030391 3300037418 Bacteria 5547
527 Ga0395900_0089045 3300037418 Bacteria 3173
528 Ga0395900_0183174 3300037418 Bacteria 2127
529 Ga0395898_0041823 3300037466 Bacteria 4524
530 Ga0395898_0063279 3300037466 Bacteria 3590
531 Ga0395898_0085558 3300037466 Bacteria 3039
532 Ga0395898_0134131 3300037466 Bacteria 2371
533 Ga0395905_0070559 3300037471 Bacteria 3274
534 Ga0395905_0096286 3300037471 Bacteria 2779
535 Ga0436364_0004111 3300037853 Bacteria 1822
536 Ga0436364_0452492 3300037853 Bacteria 1408
537 Ga0395901_0021536 3300038443 Bacteria 6606
538 Ga0395901_0077817 3300038443 Bacteria 3462
539 Ga0436365_0172137 3300039437 Bacteria 9592
540 Ga0436365_0734530 3300039437 Bacteria 1401
541 Ga0436365_0903245 3300039437 Bacteria 1963
542 Ga0436365_0992472 3300039437 Bacteria 4820
543 Ga0436365_1607953 3300039437 Bacteria 2022
544 Ga0436360_0831213 3300039438 Bacteria 2465
545 Ga0436361_0000238 3300039447 Bacteria 2150
546 Ga0436361_0274303 3300039447 Bacteria 1172
547 Ga0436361_0416951 3300039447 Bacteria 2702
548 Ga0436361_0642711 3300039447 Bacteria 2476
549 Ga0436361_1209439 3300039447 Bacteria 1251
550 Ga0436363_0407324 3300039450 Bacteria 1418
551 Ga0436363_0576644 3300039450 Bacteria 6088
552 Ga0436362_0233201 3300039453 Bacteria 1686
553 Ga0451789_0781606 3300041443 Bacteria 975
554 Ga0466966_0030392 3300044684 Bacteria 3508
555 Ga0466963_0043770 3300044694 Bacteria 2946
556 Ga0466963_0054350 3300044694 Bacteria 2661
557 Ga0466971_0058502 3300044719 Bacteria 1740
558 Ga0466968_0118017 3300044735 Bacteria 1199
559 Ga0466959_0029672 3300045049 Bacteria 4053
560 Ga0466959_0074305 3300045049 Bacteria 2458
561 Ga0466967_0024550 3300045976 Bacteria 4959
562 Ga0466967_0111496 3300045976 Bacteria 2514
563 Ga0466967_0280836 3300045976 Bacteria 1598
564 Ga0495617_012208 3300046452 Bacteria 2926
565 Ga0495592_0000017 3300046454 Bacteria 142442
566 Ga0495592_0020736 3300046454 Bacteria 5000
567 Ga0495592_0047510 3300046454 Bacteria 3196
568 Ga0495592_0096467 3300046454 Bacteria 2113
569 Ga0495592_0260135 3300046454 Bacteria 1143
570 Ga0495603_0003128 3300046455 Bacteria 9841
571 Ga0495603_0003728 3300046455 Bacteria 9063
572 Ga0495603_0045407 3300046455 Bacteria 2620
573 Ga0495603_0087718 3300046455 Bacteria 1821
574 Ga0495603_0088181 3300046455 Bacteria 1815
575 Ga0495603_0172051 3300046455 Bacteria 1254
576 Ga0495590_0043598 3300046457 Bacteria 1564
577 Ga0495629_0001107 3300046459 Bacteria 21326
578 Ga0495629_0002872 3300046459 Bacteria 13167
579 Ga0495629_0012976 3300046459 Bacteria 6025
580 Ga0495629_0188349 3300046459 Bacteria 1429
581 Ga0495638_0042429 3300046460 Bacteria 2873
582 Ga0495638_0145578 3300046460 Bacteria 1379
583 Ga0495638_0213480 3300046460 Bacteria 1082
584 Ga0495641_0004022 3300046461 Bacteria 10651
585 Ga0495641_0050540 3300046461 Bacteria 1900
586 Ga0495641_0112770 3300046461 Bacteria 1213
587 Ga0495651_0000923 3300046462 Bacteria 22782
588 Ga0495651_0044155 3300046462 Bacteria 3455
589 Ga0495653_0000033 3300046463 Bacteria 131680
590 Ga0495653_0029817 3300046463 Bacteria 4350
591 Ga0495650_0113452 3300046471 Bacteria 1004
592 Ga0495580_0001546 3300046472 Bacteria 20242
593 Ga0495580_0126051 3300046472 Bacteria 1777
594 Ga0495582_0000855 3300046473 Bacteria 16906
595 Ga0495582_0105319 3300046473 Bacteria 1581
596 Ga0495639_0000072 3300046475 Bacteria 46904
597 Ga0495639_0022066 3300046475 Bacteria 2791
598 Ga0495639_0035724 3300046475 Bacteria 2224
599 Ga0495662_0002403 3300046476 Bacteria 9407
600 Ga0495662_0014466 3300046476 Bacteria 3836
601 Ga0495664_0000008 3300046477 Bacteria 307158
602 Ga0495664_0001402 3300046477 Bacteria 12752
603 Ga0495664_0200600 3300046477 Bacteria 1209
604 Ga0495584_0112632 3300046491 Bacteria 1377
605 Ga0495584_0130516 3300046491 Bacteria 1275
606 Ga0495585_0054506 3300046492 Bacteria 2210
607 Ga0495585_0114167 3300046492 Bacteria 1434
608 Ga0495585_0132400 3300046492 Bacteria 1311
609 Ga0495594_0278809 3300046499 Bacteria 952
610 Ga0495607_0108264 3300046501 Bacteria 1477
611 Ga0495606_0000831 3300046507 Bacteria 46699
612 Ga0495608_0000014 3300046511 Bacteria 221042
613 Ga0495608_0020001 3300046511 Bacteria 4603
614 Ga0495608_0035508 3300046511 Bacteria 3362
615 Ga0495610_0062504 3300046512 Bacteria 1766
616 Ga0495616_0063169 3300046513 Bacteria 1811
617 Ga0495618_0000013 3300046514 Bacteria 168671
618 Ga0495618_0035721 3300046514 Bacteria 3120
619 Ga0495628_0000008 3300046516 Bacteria 284313
620 Ga0495628_0003465 3300046516 Bacteria 14119
621 Ga0495628_0086586 3300046516 Bacteria 2429
622 Ga0495630_0000797 3300046517 Bacteria 22206
623 Ga0495630_0003448 3300046517 Bacteria 10991
624 Ga0495630_0096430 3300046517 Bacteria 2236
625 Ga0495632_0083372 3300046519 Bacteria 1522
626 Ga0495637_0022738 3300046520 Bacteria 2857
627 Ga0495644_0027753 3300046523 Bacteria 2144
628 Ga0495644_0075459 3300046523 Bacteria 1269
629 Ga0495648_0003200 3300046524 Bacteria 14540
630 Ga0495648_0063981 3300046524 Bacteria 2169
631 Ga0495663_0030584 3300046525 Bacteria 1596
632 Ga0495666_0008781 3300046526 Bacteria 5064
633 Ga0495642_0059322 3300046528 Bacteria 1586
634 Ga0495652_0000005 3300046529 Bacteria 524368
635 Ga0495652_0069920 3300046529 Bacteria 2936
636 Ga0495652_0100862 3300046529 Bacteria 2341
637 Ga0495654_0073393 3300046530 Bacteria 1618
638 Ga0495665_0000128 3300046531 Bacteria 36043
639 Ga0495665_0070590 3300046531 Bacteria 1841
640 Ga0495665_0071946 3300046531 Bacteria 1821
641 Ga0495665_0095389 3300046531 Bacteria 1562
642 Ga0495640_0000017 3300046533 Bacteria 138688
643 Ga0495640_0010120 3300046533 Bacteria 7310
644 Ga0495640_0011467 3300046533 Bacteria 6821
645 Ga0495640_0047940 3300046533 Bacteria 2955
646 Ga0495587_0000005 3300046536 Bacteria 358412
647 Ga0495587_0018828 3300046536 Bacteria 4280
648 Ga0495587_0062786 3300046536 Bacteria 2174
649 Ga0495598_0080433 3300046537 Bacteria 1044
650 Ga0495621_0089462 3300046539 Bacteria 1159
651 Ga0495645_0000007 3300046543 Bacteria 376299
652 Ga0495645_0010485 3300046543 Bacteria 6499
653 Ga0495645_0014817 3300046543 Bacteria 5539
654 Ga0495622_0005892 3300046557 Bacteria 5692
655 Ga0495622_0017286 3300046557 Bacteria 3358
656 Ga0495633_0116803 3300046558 Bacteria 1236
657 Ga0495667_0000012 3300046559 Bacteria 220967
658 Ga0495667_0007798 3300046559 Bacteria 7249
659 Ga0495667_0050257 3300046559 Bacteria 2753
660 Ga0495656_0002973 3300046615 Bacteria 5691
661 Ga0495656_0015117 3300046615 Bacteria 2907
662 Ga0495668_0050768 3300046616 Bacteria 2298
663 Ga0495634_0000070 3300046642 Bacteria 79664
664 Ga0495634_0021038 3300046642 Bacteria 4619
665 Ga0495634_0035544 3300046642 Bacteria 3411
666 Ga0495634_0099675 3300046642 Bacteria 1878
667 Ga0495625_0163978 3300046660 Bacteria 1487
668 Ga0495625_0189714 3300046660 Bacteria 1362
669 Ga0495625_0206843 3300046660 Bacteria 1292
670 Ga0495635_0000010 3300046663 Bacteria 246385
671 Ga0495635_0000564 3300046663 Bacteria 23651
672 Ga0495635_0001868 3300046663 Bacteria 14260
673 Ga0495635_0168155 3300046663 Bacteria 1491
674 Ga0495659_0006735 3300046664 Bacteria 3630
675 Ga0495661_0040977 3300046665 Bacteria 2868
676 Ga0495661_0147899 3300046665 Bacteria 1271
677 Ga0495588_0031903 3300046674 Bacteria 2654
678 Ga0495657_0000178 3300046675 Bacteria 57139
679 Ga0495657_0008385 3300046675 Bacteria 7909
680 Ga0495657_0104274 3300046675 Bacteria 1803
681 Ga0495599_0000015 3300046678 Bacteria 175055
682 Ga0495599_0020349 3300046678 Bacteria 4132
683 Ga0495623_0000054 3300046679 Bacteria 70217
684 Ga0495623_0025208 3300046679 Bacteria 3830
685 Ga0495623_0067334 3300046679 Bacteria 2235
686 Ga0495646_0000012 3300046680 Bacteria 185805
687 Ga0495646_0003182 3300046680 Bacteria 10197
688 Ga0495646_0024986 3300046680 Bacteria 3759
689 Ga0495646_0033708 3300046680 Bacteria 3183
690 Ga0495647_0001214 3300046681 Bacteria 7949
691 Ga0495647_0015891 3300046681 Bacteria 2643
692 Ga0495658_0000707 3300046683 Bacteria 18088
693 Ga0495658_0061593 3300046683 Bacteria 2154
694 Ga0495658_0163531 3300046683 Bacteria 1374
695 Ga0495669_0146084 3300046684 Bacteria 1118
696 Ga0495613_0001986 3300046689 Bacteria 15542
697 Ga0495613_0064597 3300046689 Bacteria 2676
698 Ga0495613_0067323 3300046689 Bacteria 2614
699 Ga0495613_0116928 3300046689 Bacteria 1917
700 Ga0495613_0350029 3300046689 Bacteria 1015
701 Ga0495624_0004889 3300046690 Bacteria 9730
702 Ga0495624_0049435 3300046690 Bacteria 2667
703 Ga0495670_0030236 3300046691 Bacteria 2690
704 Ga0495671_0072016 3300046692 Bacteria 1697
705 Ga0495600_0000031 3300046809 Bacteria 85535
706 Ga0495600_0017842 3300046809 Bacteria 4517
707 Ga0495600_0095483 3300046809 Bacteria 1938
708 Ga0495581_0000030 3300047315 Bacteria 53487
709 Ga0495581_0156249 3300047315 Bacteria 1333
710 Ga0495581_0197803 3300047315 Bacteria 1176
711 Ga0495581_0253545 3300047315 Bacteria 1029
712 Ga0495604_0000001 3300047317 Bacteria 708627
713 Ga0495604_0006243 3300047317 Bacteria 9452
714 Ga0495604_0071809 3300047317 Bacteria 2617
715 Ga0495604_0217284 3300047317 Bacteria 1318
716 Ga0495604_0239433 3300047317 Bacteria 1242
717 Ga0495636_0033052 3300047318 Bacteria 2123
718 Ga0495636_0119699 3300047318 Bacteria 1164
719 Ga0495674_0000012 3300047319 Bacteria 270651
720 Ga0495674_0001230 3300047319 Bacteria 24837
721 Ga0495674_0024652 3300047319 Bacteria 5522
722 Ga0495674_0085620 3300047319 Bacteria 2699
723 Ga0495674_0133635 3300047319 Bacteria 2089
724 Ga0495672_0010170 3300047320 Bacteria 6724
725 Ga0495672_0077919 3300047320 Bacteria 1856
726 Ga0495672_0078951 3300047320 Bacteria 1839
727 Ga0495672_0102901 3300047320 Bacteria 1546
728 Ga0495672_0135313 3300047320 Bacteria 1293
729 Ga0495672_0160184 3300047320 Bacteria 1158
730 Ga0495676_0063006 3300047321 Bacteria 2892
731 Ga0495676_0162663 3300047321 Bacteria 1578
732 Ga0495676_0300500 3300047321 Bacteria 1082
733 Ga0495680_0003950 3300047322 Bacteria 14337
734 Ga0495680_0015081 3300047322 Bacteria 6673
735 Ga0495680_0081343 3300047322 Bacteria 2446
736 Ga0495680_0083270 3300047322 Bacteria 2412
737 Ga0495680_0192032 3300047322 Bacteria 1469
738 Ga0495675_0005364 3300047444 Bacteria 7811
739 Ga0495675_0013920 3300047444 Bacteria 5087
740 Ga0495675_0044709 3300047444 Bacteria 2821
741 Ga0495673_0030759 3300047469 Bacteria 2519
742 Ga0495684_0000021 3300047471 Bacteria 144901
743 Ga0495684_0006597 3300047471 Bacteria 9001
744 Ga0495684_0042816 3300047471 Bacteria 3467
745 Ga0495686_0045908 3300047472 Bacteria 2763
746 Ga0495593_0000387 3300047673 Bacteria 24410
747 Ga0495593_0000470 3300047673 Bacteria 22684
748 Ga0495593_0003761 3300047673 Bacteria 9064
749 Ga0495602_0000031 3300048088 Bacteria 141518
750 Ga0495602_0096494 3300048088 Bacteria 2438
751 Ga0495602_0182433 3300048088 Bacteria 1617
752 Ga0495614_0049441 3300048089 Bacteria 1803
753 Ga0496100_0268489 3300048903 Bacteria 1268
754 Ga0496100_0404708 3300048903 Bacteria 1040
755 Ga0496100_0561996 3300048903 Bacteria 883
756 Ga0496101_0342882 3300048904 Bacteria 1174
757 Ga0496102_0097615 3300048905 Bacteria 2725
758 Ga0496102_0139695 3300048905 Bacteria 2271
759 Ga0496102_0162570 3300048905 Bacteria 2100
760 Ga0496102_0211652 3300048905 Bacteria 1827
761 Ga0496103_0077661 3300048906 Bacteria 2084
762 Ga0496104_0041991 3300048907 Bacteria 4289
763 Ga0496104_0052663 3300048907 Bacteria 3845
764 Ga0496104_0280762 3300048907 Bacteria 1578
765 Ga0496105_0062063 3300048908 Bacteria 3084
766 Ga0496105_0066881 3300048908 Bacteria 2967
767 Ga0496105_0237832 3300048908 Bacteria 1479
768 Ga0496106_0001644 3300048909 Bacteria 16771
769 Ga0496106_0001943 3300048909 Bacteria 15501
770 Ga0496106_0061971 3300048909 Bacteria 2839
771 Ga0496106_0115487 3300048909 Bacteria 2093
772 Ga0496107_0008009 3300048910 Bacteria 7293
773 Ga0496108_0000927 3300048911 Bacteria 22857
774 Ga0496108_0003076 3300048911 Bacteria 13407
775 Ga0496108_0104573 3300048911 Bacteria 2416
776 Ga0496108_0205946 3300048911 Bacteria 1707
777 Ga0496109_0000229 3300048912 Bacteria 54733
778 Ga0496109_0000404 3300048912 Bacteria 38842
779 Ga0496109_0061506 3300048912 Bacteria 3433
780 Ga0496109_0095536 3300048912 Bacteria 2752
781 Ga0496109_0104428 3300048912 Bacteria 2631
782 Ga0496110_0004921 3300048913 Bacteria 10430
783 Ga0496110_0255688 3300048913 Bacteria 1594
784 Ga0496110_0364261 3300048913 Bacteria 1317
785 Ga0496111_0001539 3300048914 Bacteria 13254
786 Ga0496111_0030535 3300048914 Bacteria 3833
787 Ga0496111_0175050 3300048914 Bacteria 1595
788 Ga0496111_0213341 3300048914 Bacteria 1434
789 Ga0496112_0000018 3300048915 Bacteria 188820
790 Ga0496112_0001343 3300048915 Bacteria 18708
791 Ga0496112_0001354 3300048915 Bacteria 18644
792 Ga0496112_0022495 3300048915 Bacteria 6008
793 Ga0496112_0074138 3300048915 Bacteria 3365
794 Ga0496112_0075729 3300048915 Bacteria 3328
795 Ga0496112_0089343 3300048915 Bacteria 3049
796 Ga0496112_0320058 3300048915 Bacteria 1495
797 Ga0496113_0001624 3300048916 Bacteria 12662
798 Ga0496113_0017066 3300048916 Bacteria 5031
799 Ga0496113_0131252 3300048916 Bacteria 1966
800 Ga0496114_0014977 3300048917 Bacteria 6234
801 Ga0496114_0274275 3300048917 Bacteria 1486
802 Ga0496115_0210589 3300048918 Bacteria 1606
803 Ga0496115_0374258 3300048918 Bacteria 1159
804 Ga0496115_0388261 3300048918 Bacteria 1134
805 Ga0496116_0009681 3300048919 Bacteria 8194
806 Ga0496117_0046301 3300048920 Bacteria 3130
807 Ga0496117_0110810 3300048920 Bacteria 1710
808 Ga0496118_0023464 3300048921 Bacteria 5357
809 Ga0496118_0108992 3300048921 Bacteria 1844
810 Ga0496118_0165108 3300048921 Bacteria 1362
811 Ga0496119_0033208 3300048922 Bacteria 3426
812 Ga0496119_0118990 3300048922 Bacteria 1455
813 Ga0496120_0040754 3300048923 Bacteria 2726
814 Ga0496121_0000278 3300048924 Bacteria 106838
815 Ga0496121_0000654 3300048924 Bacteria 64945
816 Ga0496121_0001257 3300048924 Bacteria 43906
817 Ga0496121_0004075 3300048924 Bacteria 20070
818 Ga0496121_0010674 3300048924 Bacteria 10312
819 Ga0496121_0025719 3300048924 Bacteria 5575
820 Ga0496121_0055934 3300048924 Bacteria 3282
821 Ga0496121_0076724 3300048924 Bacteria 2664
822 Ga0496121_0089434 3300048924 Bacteria 2410
823 Ga0496121_0145334 3300048924 Bacteria 1753
824 Ga0496121_0186152 3300048924 Bacteria 1493
825 Ga0496122_0058926 3300048925 Bacteria 2838
826 Ga0496122_0063658 3300048925 Bacteria 2689
827 Ga0496124_0053161 3300048927 Bacteria 3436
828 Ga0496124_0251121 3300048927 Bacteria 1308
829 Ga0496125_0000869 3300048928 Bacteria 48286
830 Ga0496125_0003929 3300048928 Bacteria 17533
831 Ga0496125_0009814 3300048928 Bacteria 9755
832 Ga0496125_0033842 3300048928 Bacteria 4514
833 Ga0496125_0055518 3300048928 Bacteria 3226
834 Ga0496125_0075698 3300048928 Bacteria 2603
835 Ga0496126_0005056 3300048929 Bacteria 15313
836 Ga0496126_0013259 3300048929 Bacteria 8398
837 Ga0496126_0021739 3300048929 Bacteria 6258
838 Ga0496126_0039419 3300048929 Bacteria 4384
839 Ga0496126_0065601 3300048929 Bacteria 3248
840 Ga0496126_0127720 3300048929 Bacteria 2199
841 Ga0496126_0137045 3300048929 Bacteria 2110
842 Ga0496126_0476798 3300048929 Bacteria 1000
843 Ga0501031_0000207 3300049568 Bacteria 33573
844 Ga0501031_0000674 3300049568 Bacteria 20357
845 Ga0501031_0042550 3300049568 Bacteria 2964
846 Ga0501031_0174922 3300049568 Bacteria 1402
847 Ga0501032_0000252 3300049569 Bacteria 44619
848 Ga0501032_0002975 3300049569 Bacteria 13153
849 Ga0501032_0004147 3300049569 Bacteria 10979
850 Ga0501032_0175449 3300049569 Bacteria 1404
851 Ga0501032_0210542 3300049569 Bacteria 1267
852 Ga0501032_0228662 3300049569 Bacteria 1209
853 Ga0501033_0000082 3300049570 Bacteria 89837
854 Ga0501033_0006748 3300049570 Bacteria 8965
855 Ga0501033_0056363 3300049570 Bacteria 2904
856 Ga0501033_0059881 3300049570 Bacteria 2811
857 Ga0501033_0174315 3300049570 Bacteria 1544
858 Ga0501033_0243491 3300049570 Bacteria 1275
859 Ga0501034_0000198 3300049571 Bacteria 113672
860 Ga0501034_0066295 3300049571 Bacteria 3623
861 Ga0501034_0069806 3300049571 Bacteria 3524
862 Ga0501034_0076480 3300049571 Bacteria 3354
863 Ga0501034_0137996 3300049571 Bacteria 2419
864 Ga0501034_0166621 3300049571 Bacteria 2172
865 Ga0501034_0331406 3300049571 Bacteria 1453
866 Ga0501034_0370474 3300049571 Bacteria 1358
867 Ga0501034_0376168 3300049571 Bacteria 1346
868 Ga0501034_0473470 3300049571 Bacteria 1168
869 Ga0501036_0001281 3300049572 Bacteria 19291
870 Ga0501036_0041485 3300049572 Bacteria 3893
871 Ga0501036_0070087 3300049572 Bacteria 2964
872 Ga0501036_0089653 3300049572 Bacteria 2598
873 Ga0501036_0153984 3300049572 Bacteria 1939
874 Ga0501036_0296825 3300049572 Bacteria 1352
875 Ga0501037_0000050 3300049573 Bacteria 112824
876 Ga0501037_0001896 3300049573 Bacteria 15199
877 Ga0501037_0013075 3300049573 Bacteria 6119
878 Ga0501037_0065242 3300049573 Bacteria 2652
879 Ga0501037_0126416 3300049573 Bacteria 1835
880 Ga0501037_0210375 3300049573 Bacteria 1372
881 Ga0501038_0000538 3300049574 Bacteria 33271
882 Ga0501038_0021325 3300049574 Bacteria 5815
883 Ga0501038_0069455 3300049574 Bacteria 2992
884 Ga0501038_0108190 3300049574 Bacteria 2305
885 Ga0501038_0184478 3300049574 Bacteria 1682
886 Ga0501039_0000366 3300049575 Bacteria 32333
887 Ga0501039_0042730 3300049575 Bacteria 3501
888 Ga0501039_0207574 3300049575 Bacteria 1540
889 Ga0501039_0209073 3300049575 Bacteria 1534
890 Ga0501041_0105409 3300049577 Bacteria 1747
891 Ga0501042_0017539 3300049578 Bacteria 4939
892 Ga0501042_0042451 3300049578 Bacteria 3237
893 Ga0501043_0002344 3300049579 Bacteria 16056
894 Ga0501043_0003664 3300049579 Bacteria 12616
895 Ga0501043_0061870 3300049579 Bacteria 2939
896 Ga0501043_0087805 3300049579 Bacteria 2443
897 Ga0501043_0143520 3300049579 Bacteria 1869
898 Ga0501043_0217731 3300049579 Bacteria 1478
899 Ga0501046_0000434 3300049580 Bacteria 41950
900 Ga0501046_0030471 3300049580 Bacteria 4378
901 Ga0501046_0049305 3300049580 Bacteria 3331
902 Ga0501046_0410447 3300049580 Bacteria 977
903 Ga0501047_0000131 3300049581 Bacteria 91079
904 Ga0501047_0054290 3300049581 Bacteria 3875
905 Ga0501047_0092774 3300049581 Bacteria 2898
906 Ga0501047_0095805 3300049581 Bacteria 2846
907 Ga0501047_0183102 3300049581 Bacteria 1961
908 Ga0501047_0268941 3300049581 Bacteria 1551
909 Ga0501047_0399434 3300049581 Bacteria 1207
910 Ga0501047_0510484 3300049581 Bacteria 1028
911 Ga0501048_0000531 3300049582 Bacteria 26809
912 Ga0501048_0020580 3300049582 Bacteria 4835
913 Ga0501067_0000628 3300049583 Bacteria 18974
914 Ga0501067_0001606 3300049583 Bacteria 12379
915 Ga0501067_0004783 3300049583 Bacteria 7508
916 Ga0501067_0048760 3300049583 Bacteria 2349
917 Ga0501067_0422368 3300049583 Bacteria 744
918 Ga0501068_0011209 3300049584 Bacteria 5054
919 Ga0501069_0001211 3300049585 Bacteria 12577
920 Ga0501069_0256429 3300049585 Bacteria 1021
921 Ga0501070_0005971 3300049586 Bacteria 10376
922 Ga0501070_0039960 3300049586 Bacteria 3912
923 Ga0501070_0117589 3300049586 Bacteria 2196
924 Ga0501070_0260973 3300049586 Bacteria 1416
925 Ga0501070_0473042 3300049586 Bacteria 1009
926 Ga0501071_0051598 3300049587 Bacteria 2965
927 Ga0501072_0000378 3300049588 Bacteria 31856
928 Ga0501072_0203018 3300049588 Bacteria 1580
929 Ga0501073_0029767 3300049589 Bacteria 3902
930 Ga0501073_0095171 3300049589 Bacteria 2069
931 Ga0501073_0103023 3300049589 Bacteria 1981
932 Ga0501074_0003814 3300049590 Bacteria 10720
933 Ga0501074_0018155 3300049590 Bacteria 5109
934 Ga0501074_0018479 3300049590 Bacteria 5065
935 Ga0501074_0070660 3300049590 Bacteria 2510
936 Ga0501074_0231359 3300049590 Bacteria 1316
937 Ga0501075_0103633 3300049591 Bacteria 2162
938 Ga0501076_0015425 3300049592 Bacteria 5773
939 Ga0501077_0015351 3300049593 Bacteria 4822
940 Ga0501077_0134539 3300049593 Bacteria 1568
941 Ga0501079_0001399 3300049741 Bacteria 17010
942 Ga0501079_0003847 3300049741 Bacteria 11077
943 Ga0501080_0009398 3300049742 Bacteria 8917
944 Ga0501080_0064626 3300049742 Bacteria 3403
945 Ga0501081_0001105 3300049743 Bacteria 16197
946 Ga0501083_0000341 3300049744 Bacteria 29641
947 Ga0501083_0060526 3300049744 Bacteria 2529
948 Ga0501035_0000123 3300049822 Bacteria 93734
949 Ga0501035_0005862 3300049822 Bacteria 11577
950 Ga0501035_0093321 3300049822 Bacteria 2648
951 Ga0501035_0173882 3300049822 Bacteria 1859
952 Ga0501035_0180926 3300049822 Bacteria 1816
953 Ga0501035_0206075 3300049822 Bacteria 1684
954 Ga0501044_0000100 3300049823 Bacteria 106729
955 Ga0501044_0039767 3300049823 Bacteria 4904
956 Ga0501044_0113578 3300049823 Bacteria 2715
957 Ga0501044_0195559 3300049823 Bacteria 1983
958 Ga0501044_0214949 3300049823 Bacteria 1875
959 Ga0501044_0253318 3300049823 Bacteria 1701
960 Ga0501044_0281237 3300049823 Bacteria 1597
961 Ga0501045_0009959 3300049824 Bacteria 6649
962 Ga0501045_0022359 3300049824 Bacteria 4528
963 Ga0501045_0022970 3300049824 Bacteria 4470
964 nmdc:mga00v17_257025_c1 3300050491 Bacteria 1133
965 nmdc:mga00v17_63096_c1 3300050491 Bacteria 2281
966 nmdc:mga00v17_90644_c1 3300050491 Bacteria 1920
967 nmdc:mga0yw44_153826_c1 3300050492 Bacteria 1502
968 nmdc:mga0yw44_66131_c1 3300050492 Bacteria 2230
969 nmdc:mga0yw44_73561_c1 3300050492 Bacteria 2126
970 nmdc:mga0k408_130449_c1 3300050493 Bacteria 1492
971 nmdc:mga0k408_63841_c2 3300050493 Bacteria 1500
972 nmdc:mga06z11_177617_c1 3300050494 Bacteria 1226
973 nmdc:mga06z11_3772_c1 3300050494 Bacteria 5895
974 nmdc:mga04h51_11839_c1 3300050495 Bacteria 2433
975 nmdc:mga04h51_42469_c1 3300050495 Bacteria 1491
976 nmdc:mga07m45_119498_c1 3300050496 Bacteria 1522
977 nmdc:mga07m45_143090_c1 3300050496 Bacteria 1385
978 nmdc:mga07m45_215146_c1 3300050496 Bacteria 1118
979 nmdc:mga07m45_3103_c1 3300050496 Bacteria 7739
980 nmdc:mga05p37_255873_c1 3300050507 Bacteria 2098
981 nmdc:mga05p37_427_c1 3300050507 Bacteria 45535
982 nmdc:mga05p37_6551_c1 3300050507 Bacteria 13728
983 nmdc:mga09592_248881_c1 3300050508 Bacteria 1540
984 nmdc:mga09592_2873_c1 3300050508 Bacteria 13959
985 nmdc:mga0qj67_124283_c1 3300050509 Bacteria 2088
986 nmdc:mga0qj67_460427_c1 3300050509 Bacteria 1024
987 nmdc:mga0qj67_51727_c2 3300050509 Bacteria 2120
988 nmdc:mga06r32_109361_c1 3300050510 Bacteria 2718
989 nmdc:mga06r32_2417_c1 3300050510 Bacteria 16706
990 nmdc:mga06r32_306343_c1 3300050510 Bacteria 1574
991 nmdc:mga06r32_6619_c1 3300050510 Bacteria 10413
992 nmdc:mga08y16_102725_c1 3300050511 Bacteria 2976
993 nmdc:mga08y16_199419_c1 3300050511 Bacteria 2074
994 nmdc:mga08y16_263247_c1 3300050511 Bacteria 1781
995 nmdc:mga08y16_42067_c1 3300050511 Bacteria 4785
996 nmdc:mga08y16_90_c1 3300050511 Bacteria 76458
997 nmdc:mga0n895_131467_c1 3300050512 Bacteria 2528
998 nmdc:mga0n895_399422_c1 3300050512 Bacteria 1390
999 nmdc:mga0rr50_195263_c1 3300050513 Bacteria 1661
1000 nmdc:mga0rr50_41439_c1 3300050513 Bacteria 3355
1001 nmdc:mga0rr50_42984_c1 3300050513 Bacteria 3303
1002 nmdc:mga0rr50_99236_c1 3300050513 Bacteria 2284
1003 nmdc:mga08x19_105709_c1 3300050514 Bacteria 1872
1004 nmdc:mga0a205_30941_c1 3300050515 Bacteria 5127
1005 nmdc:mga0a205_3895_c1 3300050515 Bacteria 13360
1006 nmdc:mga0sz30_19967_c1 3300050516 Bacteria 2699
1007 Ga0495601_0000011 3300053077 Bacteria 264937
1008 Ga0495601_0000392 3300053077 Bacteria 23195
1009 Ga0495601_0004077 3300053077 Bacteria 8426
1010 Ga0495601_0006579 3300053077 Bacteria 6798
1011 Ga0495601_0026481 3300053077 Bacteria 3581
1012 Ga0495601_0098431 3300053077 Bacteria 1888
1013 Ga0495612_0000006 3300053078 Bacteria 269278
1014 Ga0495612_0008409 3300053078 Bacteria 4186
1015 Ga0495612_0037724 3300053078 Bacteria 1963
1016 Ga0495612_0062897 3300053078 Bacteria 1539
1017 Ga0500635_0004048 3300053080 Bacteria 3744
1018 Ga0500635_0067662 3300053080 Bacteria 1260
1019 Ga0495655_0058021 3300053083 Bacteria 1047
1020 Ga0495595_0000021 3300053084 Bacteria 115921
1021 Ga0495595_0006005 3300053084 Bacteria 4932
1022 Ga0495595_0020342 3300053084 Bacteria 2888
1023 Ga0495595_0170332 3300053084 Bacteria 1077
1024 Ga0495619_0000013 3300053085 Bacteria 264865
1025 Ga0495619_0017632 3300053085 Bacteria 4523
1026 Ga0495619_0028554 3300053085 Bacteria 3599
1027 Ga0495619_0055926 3300053085 Bacteria 2615
1028 Ga0495619_0113072 3300053085 Bacteria 1856
1029 Ga0500646_0087203 3300053090 Bacteria 961
1030 Ga0500583_0100611 3300053092 Bacteria 1415
1031 Ga0500651_0069761 3300053093 Bacteria 2188
1032 Ga0500651_0128499 3300053093 Bacteria 1534
1033 Ga0500566_0000107 3300053094 Bacteria 42130
1034 Ga0500566_0006857 3300053094 Bacteria 6745
1035 Ga0500566_0016736 3300053094 Bacteria 4304
1036 Ga0500566_0088729 3300053094 Bacteria 1711
1037 Ga0500650_0050150 3300053098 Bacteria 1937
1038 Ga0500650_0146655 3300053098 Bacteria 1093
1039 Ga0500554_005159 3300053102 Bacteria 2824
1040 Ga0500555_057288 3300053103 Bacteria 1055
1041 Ga0500569_001078 3300053109 Bacteria 4973
1042 Ga0500595_001968 3300053119 Bacteria 10552
1043 Ga0500595_002686 3300053119 Bacteria 8636
1044 Ga0500595_007413 3300053119 Bacteria 4553
1045 Ga0500595_019639 3300053119 Bacteria 2449
1046 Ga0500595_026838 3300053119 Bacteria 1979
1047 Ga0500595_041070 3300053119 Bacteria 1488
1048 Ga0500595_042387 3300053119 Bacteria 1456
1049 Ga0500607_069800 3300053121 Bacteria 1817
1050 Ga0500608_000949 3300053122 Bacteria 10352
1051 Ga0500618_005453 3300053125 Bacteria 3865
1052 Ga0500642_0000042 3300053130 Bacteria 86476
1053 Ga0500642_0058519 3300053130 Bacteria 1723
1054 Ga0500559_0000106 3300053136 Bacteria 65670
1055 Ga0500559_0040338 3300053136 Bacteria 2032
1056 Ga0500559_0138116 3300053136 Bacteria 1140
1057 Ga0500559_0172991 3300053136 Bacteria 1016
1058 Ga0500568_0139346 3300053139 Bacteria 899
1059 Ga0500577_0009194 3300053142 Bacteria 2858
1060 Ga0500577_0150528 3300053142 Bacteria 987
1061 Ga0500588_0100585 3300053146 Bacteria 996
1062 Ga0500589_079745 3300053147 Bacteria 1464
1063 Ga0500590_026483 3300053148 Bacteria 3008
1064 Ga0500590_054115 3300053148 Bacteria 2033
1065 Ga0500603_013476 3300053150 Bacteria 1896
1066 Ga0500604_0019202 3300053151 Bacteria 1911
1067 Ga0500604_0044976 3300053151 Bacteria 1346
1068 Ga0500616_0000227 3300053153 Bacteria 88098
1069 Ga0500630_049983 3300053159 Bacteria 2023
1070 Ga0500633_0138491 3300053160 Bacteria 910
1071 Ga0500638_002787 3300053162 Bacteria 6242
1072 Ga0500638_140299 3300053162 Bacteria 1086
1073 Ga0500636_0236835 3300053177 Bacteria 940
1074 Ga0500637_0000180 3300053178 Bacteria 23612
1075 Ga0500637_0011782 3300053178 Bacteria 4534
1076 Ga0500637_0052147 3300053178 Bacteria 2332
1077 Ga0500645_047381 3300053730 Bacteria 1260
1078 Ga0500609_007813 3300053731 Bacteria 1444
1079 Ga0501084_0003563 3300054114 Bacteria 12638
1080 Ga0501084_0019061 3300054114 Bacteria 5714
1081 Ga0501084_0135809 3300054114 Bacteria 2070
1082 Ga0501082_0001776 3300060353 Bacteria 18967
1083 Ga0501082_0014075 3300060353 Bacteria 6880
1084 Ga0501082_0022020 3300060353 Bacteria 5495
1085 Ga0466962_0034341 3300061719 Bacteria 2428
1086 Ga0530510_0151565 3300061734 Bacteria 1712
1087 2509152157 2508501128 Bacteria 8613869
1088 2513695264 2513237101 Bacteria 7952346
1089 2513873373 2513237139 Bacteria 8737671
1090 2513888602 2513237141 Bacteria 8496279
1091 2514014703 2513237161 Bacteria 8871253
1092 2523468649 2523231067 Bacteria 5230452
1093 2524438844 2524023205 Bacteria 8918781
1094 2603858355 2602042107 Bacteria 6226103
1095 2617352084 2617270735 Bacteria 9163226
1096 2644291070 2643221651 Bacteria 4798932
1097 2671694952 2671180139 Bacteria 4196045
1098 2723841793 2721755755 Bacteria 8322773
1099 2739349855 2738543031 Bacteria 5769731
1100 2793078332
1101 2805920721 2802429603 Bacteria 8777136
1102 2824609015 2824600985 Bacteria 8488197
1103 2824617719 2824609381 Bacteria 8672835
1104 2824661008 2824653114 Bacteria 8493680
1105 2824702630 2824696289 Bacteria 8335049
1106 2824780868 2824773399 Bacteria 8360218
1107 2838124672 2838122688 Bacteria 8803140
1108 2841945364 2841941048 Bacteria 8688029
1109 2841952149 2841949485 Bacteria 8680857
1110 2841970463 2841966195 Bacteria 8673214
1111 2841981711 2841974524 Bacteria 8931498
1112 2841984992 2841983080 Bacteria 8395090
1113 2847942315 2847939898 Bacteria 8606328
1114 2857526545 2857524615 Bacteria 6615449
1115 2876814212 2876808645 Bacteria 8824342
1116 2879113337 2879110137 Bacteria 8907982
1117 2885369359 2885366525 Bacteria 8326213
1118 2888420148 2888419890 Bacteria 7857137
1119 2889035328 2889033259 Bacteria 9099371
1120 2893067207 2893066018 Bacteria 6158120
1121 2904691029 2904690495 Bacteria 9412302
1122 2906628533 2906626472 Bacteria 8826946
1123 2908757087 2908756301 Bacteria 8864324
1124 2917554972 2917554339 Bacteria 4987857
1125 2919073635 2919073203 Bacteria 6531949
1126 2922363183 2922361189 Bacteria 7436256
1127 2922388512 2922386360 Bacteria 7017218
1128 2922400051 2922393267 Bacteria 8285685
1129 2935615545 2935608549 Bacteria 8203142
1130 2935825654 2935819856 Bacteria 8261050
1131 2935853418 2935847175 Bacteria 8228321
1132 2935966745 2935959822 Bacteria 7869783
1133 2936060254 2936055302 Bacteria 8785755
1134 3005509005 3005506211 Bacteria 6943378
1135 8006967612 8006964411 Bacteria 8966052
1136 8006991082 8006984368 Bacteria 9651211
1137 8007000411 8006994254 Bacteria 8309700
1138 8016586268 8016583857 Bacteria 10421953
1139 8056691120 8056689827 Bacteria 6712655
1140 Ga0501038_0000630
1141 JGI24740J21852_10006878
1142 JGI24737J22298_10015483
1143 JGI24744J21845_10026309
1144 JGI25153J46596_10043278
1145 JGI25160J50197_1007581
1146 JGI25404J52841_10001804
1147 JGI25404J52841_10008798
1148 JGI25404J52841_10017513
1149 Ga0070658_10377518
1150 Ga0070683_100070525
1151 Ga0070690_100081395
1152 Ga0070670_100179008
1153 Ga0068869_100044714
1154 Ga0070680_100022603
1155 Ga0070680_100046810
1156 Ga0070680_100098721
1157 Ga0070682_100001898
1158 Ga0068868_100016512
1159 Ga0070660_100008345
1160 Ga0070660_100265323
1161 Ga0070660_100301020
1162 Ga0070691_10003421
1163 Ga0070691_10038245
1164 Ga0070668_100134018
1165 Ga0070668_100187291
1166 Ga0070669_100040796
1167 Ga0070675_100142137
1168 Ga0070671_100073962
1169 Ga0070674_100154706
1170 Ga0070673_100218483
1171 Ga0070673_100277068
1172 Ga0070659_100038851
1173 Ga0070659_100039277
1174 Ga0070667_100624676
1175 Ga0070667_100660470
1176 Ga0070709_10014835
1177 Ga0070709_10056369
1178 Ga0070714_100011934
1179 Ga0070714_100112182
1180 Ga0070713_100003576
1181 Ga0070713_100016739
1182 Ga0070713_100020074
1183 Ga0070713_100103980
1184 Ga0070710_10001532
1185 Ga0070710_10003996
1186 Ga0070710_10024153
1187 Ga0070710_10035594
1188 Ga0070711_100008302
1189 Ga0070711_100009673
1190 Ga0070711_100012351
1191 Ga0070711_100072636
1192 Ga0070711_100102931
1193 Ga0070711_100179985
1194 Ga0070705_100077274
1195 Ga0070700_100017526
1196 Ga0070663_100026672
1197 Ga0070663_100199834
1198 Ga0070663_100206617
1199 Ga0070663_100361217
1200 Ga0070678_100034660
1201 Ga0070662_100262216
1202 Ga0070681_10002937
1203 Ga0070681_10277524
1204 Ga0070681_10306009
1205 Ga0068867_100423905
1206 Ga0070706_100082929
1207 Ga0070698_100321192
1208 Ga0070679_100002400
1209 Ga0070679_100003447
1210 Ga0070679_100030485
1211 Ga0070679_100561122
1212 Ga0070684_100025298
1213 Ga0070684_100043767
1214 Ga0070697_100099077
1215 Ga0068853_100000639
1216 Ga0068853_100003310
1217 Ga0068853_100038170
1218 Ga0068853_100039338
1219 Ga0068853_100059209
1220 Ga0068853_100190008
1221 Ga0070695_100120591
1222 Ga0070696_100026887
1223 Ga0070693_100034913
1224 Ga0070665_100029471
1225 Ga0070665_100031667
1226 Ga0070665_100091913
1227 Ga0070704_100336465
1228 Ga0068855_100026317
1229 Ga0068855_100030888
1230 Ga0068855_100053234
1231 Ga0068855_100060155
1232 Ga0068855_100112279
1233 Ga0068855_100112294
1234 Ga0068855_100153539
1235 Ga0070664_100227804
1236 Ga0068857_100001037
1237 Ga0068857_100033794
1238 Ga0068857_100037870
1239 Ga0068857_100443105
1240 Ga0068854_100001597
1241 Ga0068854_100019432
1242 Ga0068854_100102280
1243 Ga0068854_100178383
1244 Ga0068854_100223513
1245 Ga0068856_100000883
1246 Ga0068856_100012184
1247 Ga0068856_100155809
1248 Ga0068856_100488926
1249 Ga0068852_100030003
1250 Ga0068852_100116544
1251 Ga0068859_100047861
1252 Ga0068859_100379973
1253 Ga0068859_100667026
1254 Ga0068864_100033808
1255 Ga0068861_100037920
1256 Ga0068861_100052285
1257 Ga0068861_100141285
1258 Ga0068861_100368396
1259 Ga0068861_100637789
1260 Ga0068851_10000558
1261 Ga0068851_10015981
1262 Ga0068870_10053768
1263 Ga0068858_100069349
1264 Ga0068858_100178809
1265 Ga0068858_100297313
1266 Ga0068860_100000477
1267 Ga0068862_100040785
1268 Ga0068862_100094520
1269 Ga0068862_100102424
1270 Ga0081455_10000209
1271 Ga0081455_10005086
1272 Ga0081455_10007370
1273 Ga0081455_10007381
1274 Ga0081455_10109474
1275 Ga0081455_10354979
1276 Ga0081538_10074134
1277 Ga0081540_1000064
1278 Ga0081540_1003488
1279 Ga0081540_1008854
1280 Ga0081540_1012184
1281 Ga0081540_1048845
1282 Ga0081539_10018659
1283 Ga0070717_10016786
1284 Ga0070717_10041403
1285 Ga0070717_10119310
1286 Ga0070717_10231831
1287 Ga0075365_10106354
1288 Ga0075368_10064243
1289 Ga0075368_10088191
1290 Ga0075363_100004174
1291 Ga0075363_100082345
1292 Ga0075363_100123090
1293 Ga0075364_10018451
1294 Ga0075364_10034501
1295 Ga0075364_10057410
1296 Ga0075432_10048537
1297 Ga0070715_10000275
1298 Ga0070715_10009900
1299 Ga0070715_10090401
1300 Ga0070715_10213345
1301 Ga0070716_100007369
1302 Ga0070716_100218767
1303 Ga0070716_100227526
1304 Ga0070712_100002530
1305 Ga0070712_100034544
1306 Ga0070712_100065297
1307 Ga0070712_100102723
1308 Ga0070712_100146083
1309 Ga0075362_10020405
1310 Ga0075362_10041956
1311 Ga0075367_10005424
1312 Ga0075367_10049481
1313 Ga0075367_10110837
1314 Ga0075369_10009037
1315 Ga0097621_100339564
1316 Ga0097621_100451914
1317 Ga0075370_10022430
1318 Ga0075370_10102322
1319 Ga0075428_100003141
1320 Ga0075428_100128112
1321 Ga0075428_100532983
1322 Ga0075431_100000568
1323 Ga0075431_100001629
1324 Ga0075431_100266627
1325 Ga0075433_10004977
1326 Ga0075433_10045558
1327 Ga0075433_10250376
1328 Ga0075434_100028319
1329 Ga0075434_100040930
1330 Ga0075434_100056552
1331 Ga0075434_100072031
1332 Ga0075429_100003175
1333 Ga0068865_100292659
1334 Ga0075436_100068860
1335 Ga0097620_100047862
1336 Ga0097620_100379954
1337 Ga0097620_100666967
1338 Ga0075435_100051643
1339 Ga0075435_100076669
1340 Ga0075435_100078601
1341 Ga0075435_100518438
1342 Ga0099794_10001485
1343 Ga0099794_10036912
1344 Ga0099795_10080197
1345 Ga0105240_10002459
1346 Ga0105240_10062589
1347 Ga0105240_10087076
1348 Ga0105240_10170354
1349 Ga0111539_10001515
1350 Ga0111539_10066626
1351 Ga0111539_10091971
1352 Ga0111539_10246033
1353 Ga0111539_10254754
1354 Ga0111539_10311410
1355 Ga0105245_10189575
1356 Ga0105247_10265102
1357 Ga0114129_10000692
1358 Ga0114129_10065672
1359 Ga0114129_10092485
1360 Ga0114129_10126694
1361 Ga0114129_10293883
1362 Ga0105243_10377080
1363 Ga0105241_10000249
1364 Ga0105241_10109783
1365 Ga0105242_10099724
1366 Ga0105248_10156900
1367 Ga0105248_10385572
1368 Ga0105237_10067599
1369 Ga0105237_10133597
1370 Ga0105237_10168759
1371 Ga0105237_10286091
1372 Ga0105238_10001235
1373 Ga0105238_10014511
1374 Ga0105238_10038587
1375 Ga0105249_10044828
1376 Ga0105249_10746958
1377 Ga0105249_10840241
1378 Ga0099796_10020835
1379 Ga0105239_10032291
1380 Ga0105239_10061707
1381 Ga0105239_10158333
1382 Ga0105239_10227921
1383 Ga0157373_10050479
1384 Ga0157373_10131755
1385 Ga0157370_10008510
1386 Ga0157370_10015855
1387 Ga0157370_10376246
1388 Ga0157369_10052065
1389 Ga0157372_10443094
1390 Ga0157375_10139921
1391 Ga0157375_10187578
1392 Ga0163163_10064343
1393 Ga0163163_10220639
1394 Ga0163163_10475090
1395 Ga0157380_10163035
1396 Ga0157380_10303924
1397 Ga0157380_10382047
1398 Ga0157377_10078649
1399 Ga0157379_10270345
1400 Ga0163161_10070039
1401 Ga0206353_11234579
1402 Ga0213872_10140105
1403 Ga0213874_10002095
1404 Ga0213876_10005453
1405 Ga0213876_10125669
1406 Ga0213876_10131901
1407 Ga0213876_10234387
1408 Ga0213871_10021333
1409 Ga0209758_1001918
1410 Ga0209758_1004128
1411 Ga0209758_1048464
1412 Ga0207426_1001156
1413 Ga0207656_10003400
1414 Ga0207656_10020096
1415 Ga0207692_10000565
1416 Ga0207692_10052384
1417 Ga0207642_10135499
1418 Ga0207710_10014866
1419 Ga0207688_10058536
1420 Ga0207688_10087080
1421 Ga0207688_10107952
1422 Ga0207647_10009887
1423 Ga0207647_10092600
1424 Ga0207685_10009621
1425 Ga0207685_10023455
1426 Ga0207685_10078961
1427 Ga0207699_10219749
1428 Ga0207645_10220582
1429 Ga0207643_10084567
1430 Ga0207705_10241570
1431 Ga0207684_10002963
1432 Ga0207684_10051004
1433 Ga0207654_10069399
1434 Ga0207707_10007389
1435 Ga0207707_10008266
1436 Ga0207707_10128117
1437 Ga0207707_10232942
1438 Ga0207695_10000148
1439 Ga0207695_10000387
1440 Ga0207695_10092643
1441 Ga0207695_10136588
1442 Ga0207695_10177135
1443 Ga0207695_10241252
1444 Ga0207671_10003051
1445 Ga0207671_10026208
1446 Ga0207671_10034623
1447 Ga0207671_10114074
1448 Ga0207693_10001168
1449 Ga0207693_10003777
1450 Ga0207693_10021801
1451 Ga0207693_10042386
1452 Ga0207693_10187477
1453 Ga0207663_10004750
1454 Ga0207663_10037861
1455 Ga0207663_10042175
1456 Ga0207663_10050996
1457 Ga0207663_10294081
1458 Ga0207660_10015897
1459 Ga0207660_10062767
1460 Ga0207660_10089142
1461 Ga0207657_10009668
1462 Ga0207657_10024873
1463 Ga0207652_10007807
1464 Ga0207652_10060204
1465 Ga0207652_10069014
1466 Ga0207694_10000121
1467 Ga0207694_10015653
1468 Ga0207694_10049243
1469 Ga0207694_10287278
1470 Ga0207650_10002929
1471 Ga0207687_10014891
1472 Ga0207700_10010887
1473 Ga0207700_10036983
1474 Ga0207700_10073901
1475 Ga0207700_10092831
1476 Ga0207700_10208805
1477 Ga0207664_10012301
1478 Ga0207664_10146411
1479 Ga0207664_10217097
1480 Ga0207644_10050991
1481 Ga0207644_10135617
1482 Ga0207690_10340721
1483 Ga0207706_10044297
1484 Ga0207706_10111603
1485 Ga0207709_10052061
1486 Ga0207709_10073008
1487 Ga0207670_10229635
1488 Ga0207669_10025452
1489 Ga0207669_10082593
1490 Ga0207665_10000883
1491 Ga0207665_10112997
1492 Ga0207665_10363057
1493 Ga0207691_10253519
1494 Ga0207691_10477779
1495 Ga0207711_10029240
1496 Ga0207711_10219501
1497 Ga0207689_10289799
1498 Ga0207689_10371073
1499 Ga0207661_10002867
1500 Ga0207661_10056017
1501 Ga0207661_10380521
1502 Ga0207667_10007656
1503 Ga0207667_10016003
1504 Ga0207667_10054033
1505 Ga0207667_10137555
1506 Ga0207667_10178423
1507 Ga0207667_10316090
1508 Ga0207667_10538213
1509 Ga0207712_10187413
1510 Ga0207668_10145485
1511 Ga0207640_10005594
1512 Ga0207640_10055934
1513 Ga0207658_10301124
1514 Ga0207703_10014932
1515 Ga0207703_10077871
1516 Ga0207639_10014436
1517 Ga0207639_10016223
1518 Ga0207639_10308765
1519 Ga0207678_10007286
1520 Ga0207678_10044075
1521 Ga0207678_10232539
1522 Ga0207678_10297876
1523 Ga0207678_10304985
1524 Ga0207678_10567390
1525 Ga0207708_10172435
1526 Ga0207708_10419736
1527 Ga0207702_10000004
1528 Ga0207702_10000318
1529 Ga0207702_10051367
1530 Ga0207702_10055681
1531 Ga0207702_10325607
1532 Ga0207648_10120914
1533 Ga0207676_10088633
1534 Ga0207676_10205751
1535 Ga0207674_10005964
1536 Ga0207674_10006033
1537 Ga0207674_10012348
1538 Ga0207674_10079008
1539 Ga0207674_10122866
1540 Ga0207675_100026733
1541 Ga0207675_100044501
1542 Ga0207675_100051099
1543 Ga0207675_100175437
1544 Ga0207675_100237438
1545 Ga0207683_10028337
1546 Ga0207683_10066450
1547 Ga0207683_10360374
1548 Ga0207698_10013415
1549 Ga0207698_10329898
1550 Ga0209179_1016514
1551 Ga0209588_1053255
1552 Ga0209813_10013142
1553 Ga0207428_10002337
1554 Ga0207428_10046668
1555 Ga0207428_10311886
1556 Ga0268266_10001906
1557 Ga0268266_10649913
1558 Ga0268265_10122027
1559 Ga0268264_10000062
1560 Ga0268264_10470329
1561 Ga0265337_1001354
1562 Ga0265334_10089935
1563 Ga0307517_10000175
1564 Ga0307515_10099000
1565 Ga0307515_10236976
1566 Ga0307511_10054505
1567 Ga0265330_10038896
1568 Ga0265325_10025732
1569 Ga0265340_10017518
1570 Ga0265339_10000738
1571 Ga0265339_10117155
1572 Ga0265331_10171233
1573 Ga0307513_10212321
1574 Ga0307509_10006160
1575 Ga0307508_10000045
1576 Ga0307508_10034088
1577 Ga0265314_10014911
1578 Ga0265314_10168340
1579 Ga0265342_10168724
1580 Ga0307516_10049470
1581 Ga0307516_10098273
1582 Ga0307516_10161987
1583 Ga0307516_10406943
1584 Ga0307406_10454913
1585 Ga0307407_10163740
1586 Ga0307411_10150769
1587 Ga0307415_100207760
1588 Ga0307507_10110502
1589 Ga0307510_10042915
1590 Ga0373930_0045829
1591 Ga0373926_0094737
1592 Ga0373934_0014812
1593 Ga0373934_0065091
1594 Ga0373940_0003839
1595 Ga0373949_0007155
1596 Ga0373923_0038708
1597 Ga0373936_0003919
1598 Ga0373936_0023840
1599 Ga0373936_0028148
1600 Ga0373936_0030004
1601 Ga0373941_0009142
1602 Ga0373956_0004385
1603 Ga0373957_0007126
1604 Ga0373960_0001356
1605 Ga0373960_0011395
1606 Ga0373943_0003409
1607 Ga0373943_0005484
1608 Ga0373943_0025075
1609 Ga0373946_0002063
1610 Ga0373946_0016589
1611 Ga0373946_0025554
1612 Ga0373946_0138036
1613 Ga0373955_0000224
1614 Ga0373955_0011330
1615 Ga0373955_0030936
1616 Ga0373955_0094738
1617 Ga0373961_0002623
1618 Ga0373962_0127877
1619 Ga0316574_0014984
1620 Ga0373924_0011255
1621 Ga0373931_0002391
1622 Ga0373931_0006320
1623 Ga0373931_0029681
1624 Ga0373935_0000011
1625 Ga0373935_0014539
1626 Ga0373935_0097097
1627 Ga0373935_0219253
1628 Ga0373927_0001064
1629 Ga0373927_0003727
1630 Ga0373927_0004599
1631 Ga0373927_0048569
1632 Ga0373927_0114622
1633 Ga0373927_0201880
1634 Ga0373933_0000315
1635 Ga0373933_0000885
1636 Ga0373933_0009041
1637 Ga0373933_0012657
1638 Ga0373933_0146323
1639 Ga0373933_0171054
1640 Ga0373947_0006319
1641 Ga0373947_0021592
1642 Ga0373947_0236599
1643 Ga0373937_0000019
1644 Ga0373937_0008940
1645 Ga0373937_0017394
1646 Ga0373937_0022449
1647 Ga0373937_0029705
1648 Ga0373937_0099501
1649 Ga0373937_0211596
1650 Ga0373937_0214019
1651 Ga0373937_0288660
1652 Ga0316584_0012076
1653 Ga0316584_0034275
1654 Ga0373925_0000026
1655 Ga0373925_0007638
1656 Ga0373925_0012102
1657 Ga0373925_0054728
1658 Ga0373925_0079834
1659 Ga0373925_0106664
1660 Ga0373925_0107949
1661 Ga0373925_0297317
1662 Ga0373925_0384790
1663 Ga0395899_0006366
1664 Ga0395900_0009214
1665 Ga0395900_0030391
1666 Ga0395900_0089045
1667 Ga0395900_0183174
1668 Ga0395898_0041823
1669 Ga0395898_0063279
1670 Ga0395898_0085558
1671 Ga0395898_0134131
1672 Ga0395905_0070559
1673 Ga0395905_0096286
1674 Ga0436364_0004111
1675 Ga0436364_0452492
1676 Ga0395901_0021536
1677 Ga0395901_0077817
1678 Ga0436365_0172137
1679 Ga0436365_0734530
1680 Ga0436365_0903245
1681 Ga0436365_0992472
1682 Ga0436365_1607953
1683 Ga0436360_0831213
1684 Ga0436361_0000238
1685 Ga0436361_0274303
1686 Ga0436361_0416951
1687 Ga0436361_0642711
1688 Ga0436361_1209439
1689 Ga0436363_0407324
1690 Ga0436363_0576644
1691 Ga0436362_0233201
1692 Ga0451789_0781606
1693 Ga0466966_0030392
1694 Ga0466963_0043770
1695 Ga0466963_0054350
1696 Ga0466971_0058502
1697 Ga0466968_0118017
1698 Ga0466959_0029672
1699 Ga0466959_0074305
1700 Ga0466967_0024550
1701 Ga0466967_0111496
1702 Ga0466967_0280836
1703 Ga0495617_012208
1704 Ga0495592_0000017
1705 Ga0495592_0020736
1706 Ga0495592_0047510
1707 Ga0495592_0096467
1708 Ga0495592_0260135
1709 Ga0495603_0003128
1710 Ga0495603_0003728
1711 Ga0495603_0045407
1712 Ga0495603_0087718
1713 Ga0495603_0088181
1714 Ga0495603_0172051
1715 Ga0495590_0043598
1716 Ga0495629_0001107
1717 Ga0495629_0002872
1718 Ga0495629_0012976
1719 Ga0495629_0188349
1720 Ga0495638_0042429
1721 Ga0495638_0145578
1722 Ga0495638_0213480
1723 Ga0495641_0004022
1724 Ga0495641_0050540
1725 Ga0495641_0112770
1726 Ga0495651_0000923
1727 Ga0495651_0044155
1728 Ga0495653_0000033
1729 Ga0495653_0029817
1730 Ga0495650_0113452
1731 Ga0495580_0001546
1732 Ga0495580_0126051
1733 Ga0495582_0000855
1734 Ga0495582_0105319
1735 Ga0495639_0000072
1736 Ga0495639_0022066
1737 Ga0495639_0035724
1738 Ga0495662_0002403
1739 Ga0495662_0014466
1740 Ga0495664_0000008
1741 Ga0495664_0001402
1742 Ga0495664_0200600
1743 Ga0495584_0112632
1744 Ga0495584_0130516
1745 Ga0495585_0054506
1746 Ga0495585_0114167
1747 Ga0495585_0132400
1748 Ga0495594_0278809
1749 Ga0495607_0108264
1750 Ga0495606_0000831
1751 Ga0495608_0000014
1752 Ga0495608_0020001
1753 Ga0495608_0035508
1754 Ga0495610_0062504
1755 Ga0495616_0063169
1756 Ga0495618_0000013
1757 Ga0495618_0035721
1758 Ga0495628_0000008
1759 Ga0495628_0003465
1760 Ga0495628_0086586
1761 Ga0495630_0000797
1762 Ga0495630_0003448
1763 Ga0495630_0096430
1764 Ga0495632_0083372
1765 Ga0495637_0022738
1766 Ga0495644_0027753
1767 Ga0495644_0075459
1768 Ga0495648_0003200
1769 Ga0495648_0063981
1770 Ga0495663_0030584
1771 Ga0495666_0008781
1772 Ga0495642_0059322
1773 Ga0495652_0000005
1774 Ga0495652_0069920
1775 Ga0495652_0100862
1776 Ga0495654_0073393
1777 Ga0495665_0000128
1778 Ga0495665_0070590
1779 Ga0495665_0071946
1780 Ga0495665_0095389
1781 Ga0495640_0000017
1782 Ga0495640_0010120
1783 Ga0495640_0011467
1784 Ga0495640_0047940
1785 Ga0495587_0000005
1786 Ga0495587_0018828
1787 Ga0495587_0062786
1788 Ga0495598_0080433
1789 Ga0495621_0089462
1790 Ga0495645_0000007
1791 Ga0495645_0010485
1792 Ga0495645_0014817
1793 Ga0495622_0005892
1794 Ga0495622_0017286
1795 Ga0495633_0116803
1796 Ga0495667_0000012
1797 Ga0495667_0007798
1798 Ga0495667_0050257
1799 Ga0495656_0002973
1800 Ga0495656_0015117
1801 Ga0495668_0050768
1802 Ga0495634_0000070
1803 Ga0495634_0021038
1804 Ga0495634_0035544
1805 Ga0495634_0099675
1806 Ga0495625_0163978
1807 Ga0495625_0189714
1808 Ga0495625_0206843
1809 Ga0495635_0000010
1810 Ga0495635_0000564
1811 Ga0495635_0001868
1812 Ga0495635_0168155
1813 Ga0495659_0006735
1814 Ga0495661_0040977
1815 Ga0495661_0147899
1816 Ga0495588_0031903
1817 Ga0495657_0000178
1818 Ga0495657_0008385
1819 Ga0495657_0104274
1820 Ga0495599_0000015
1821 Ga0495599_0020349
1822 Ga0495623_0000054
1823 Ga0495623_0025208
1824 Ga0495623_0067334
1825 Ga0495646_0000012
1826 Ga0495646_0003182
1827 Ga0495646_0024986
1828 Ga0495646_0033708
1829 Ga0495647_0001214
1830 Ga0495647_0015891
1831 Ga0495658_0000707
1832 Ga0495658_0061593
1833 Ga0495658_0163531
1834 Ga0495669_0146084
1835 Ga0495613_0001986
1836 Ga0495613_0064597
1837 Ga0495613_0067323
1838 Ga0495613_0116928
1839 Ga0495613_0350029
1840 Ga0495624_0004889
1841 Ga0495624_0049435
1842 Ga0495670_0030236
1843 Ga0495671_0072016
1844 Ga0495600_0000031
1845 Ga0495600_0017842
1846 Ga0495600_0095483
1847 Ga0495581_0000030
1848 Ga0495581_0156249
1849 Ga0495581_0197803
1850 Ga0495581_0253545
1851 Ga0495604_0000001
1852 Ga0495604_0006243
1853 Ga0495604_0071809
1854 Ga0495604_0217284
1855 Ga0495604_0239433
1856 Ga0495636_0033052
1857 Ga0495636_0119699
1858 Ga0495674_0000012
1859 Ga0495674_0001230
1860 Ga0495674_0024652
1861 Ga0495674_0085620
1862 Ga0495674_0133635
1863 Ga0495672_0010170
1864 Ga0495672_0077919
1865 Ga0495672_0078951
1866 Ga0495672_0102901
1867 Ga0495672_0135313
1868 Ga0495672_0160184
1869 Ga0495676_0063006
1870 Ga0495676_0162663
1871 Ga0495676_0300500
1872 Ga0495680_0003950
1873 Ga0495680_0015081
1874 Ga0495680_0081343
1875 Ga0495680_0083270
1876 Ga0495680_0192032
1877 Ga0495675_0005364
1878 Ga0495675_0013920
1879 Ga0495675_0044709
1880 Ga0495673_0030759
1881 Ga0495684_0000021
1882 Ga0495684_0006597
1883 Ga0495684_0042816
1884 Ga0495686_0045908
1885 Ga0495593_0000387
1886 Ga0495593_0000470
1887 Ga0495593_0003761
1888 Ga0495602_0000031
1889 Ga0495602_0096494
1890 Ga0495602_0182433
1891 Ga0495614_0049441
1892 Ga0496100_0268489
1893 Ga0496100_0404708
1894 Ga0496100_0561996
1895 Ga0496101_0342882
1896 Ga0496102_0097615
1897 Ga0496102_0139695
1898 Ga0496102_0162570
1899 Ga0496102_0211652
1900 Ga0496103_0077661
1901 Ga0496104_0041991
1902 Ga0496104_0052663
1903 Ga0496104_0280762
1904 Ga0496105_0062063
1905 Ga0496105_0066881
1906 Ga0496105_0237832
1907 Ga0496106_0001644
1908 Ga0496106_0001943
1909 Ga0496106_0061971
1910 Ga0496106_0115487
1911 Ga0496107_0008009
1912 Ga0496108_0000927
1913 Ga0496108_0003076
1914 Ga0496108_0104573
1915 Ga0496108_0205946
1916 Ga0496109_0000229
1917 Ga0496109_0000404
1918 Ga0496109_0061506
1919 Ga0496109_0095536
1920 Ga0496109_0104428
1921 Ga0496110_0004921
1922 Ga0496110_0255688
1923 Ga0496110_0364261
1924 Ga0496111_0001539
1925 Ga0496111_0030535
1926 Ga0496111_0175050
1927 Ga0496111_0213341
1928 Ga0496112_0000018
1929 Ga0496112_0001343
1930 Ga0496112_0001354
1931 Ga0496112_0022495
1932 Ga0496112_0074138
1933 Ga0496112_0075729
1934 Ga0496112_0089343
1935 Ga0496112_0320058
1936 Ga0496113_0001624
1937 Ga0496113_0017066
1938 Ga0496113_0131252
1939 Ga0496114_0014977
1940 Ga0496114_0274275
1941 Ga0496115_0210589
1942 Ga0496115_0374258
1943 Ga0496115_0388261
1944 Ga0496116_0009681
1945 Ga0496117_0046301
1946 Ga0496117_0110810
1947 Ga0496118_0023464
1948 Ga0496118_0108992
1949 Ga0496118_0165108
1950 Ga0496119_0033208
1951 Ga0496119_0118990
1952 Ga0496120_0040754
1953 Ga0496121_0000278
1954 Ga0496121_0000654
1955 Ga0496121_0001257
1956 Ga0496121_0004075
1957 Ga0496121_0010674
1958 Ga0496121_0025719
1959 Ga0496121_0055934
1960 Ga0496121_0076724
1961 Ga0496121_0089434
1962 Ga0496121_0145334
1963 Ga0496121_0186152
1964 Ga0496122_0058926
1965 Ga0496122_0063658
1966 Ga0496124_0053161
1967 Ga0496124_0251121
1968 Ga0496125_0000869
1969 Ga0496125_0003929
1970 Ga0496125_0009814
1971 Ga0496125_0033842
1972 Ga0496125_0055518
1973 Ga0496125_0075698
1974 Ga0496126_0005056
1975 Ga0496126_0013259
1976 Ga0496126_0021739
1977 Ga0496126_0039419
1978 Ga0496126_0065601
1979 Ga0496126_0127720
1980 Ga0496126_0137045
1981 Ga0496126_0476798
1982 Ga0501031_0000207
1983 Ga0501031_0000674
1984 Ga0501031_0042550
1985 Ga0501031_0174922
1986 Ga0501032_0000252
1987 Ga0501032_0002975
1988 Ga0501032_0004147
1989 Ga0501032_0175449
1990 Ga0501032_0210542
1991 Ga0501032_0228662
1992 Ga0501033_0000082
1993 Ga0501033_0006748
1994 Ga0501033_0056363
1995 Ga0501033_0059881
1996 Ga0501033_0174315
1997 Ga0501033_0243491
1998 Ga0501034_0000198
1999 Ga0501034_0066295
2000 Ga0501034_0069806
2001 Ga0501034_0076480
2002 Ga0501034_0137996
2003 Ga0501034_0166621
2004 Ga0501034_0331406
2005 Ga0501034_0370474
2006 Ga0501034_0376168
2007 Ga0501034_0473470
2008 Ga0501036_0001281
2009 Ga0501036_0041485
2010 Ga0501036_0070087
2011 Ga0501036_0089653
2012 Ga0501036_0153984
2013 Ga0501036_0296825
2014 Ga0501037_0000050
2015 Ga0501037_0001896
2016 Ga0501037_0013075
2017 Ga0501037_0065242
2018 Ga0501037_0126416
2019 Ga0501037_0210375
2020 Ga0501038_0000538
2021 Ga0501038_0021325
2022 Ga0501038_0069455
2023 Ga0501038_0108190
2024 Ga0501038_0184478
2025 Ga0501039_0000366
2026 Ga0501039_0042730
2027 Ga0501039_0207574
2028 Ga0501039_0209073
2029 Ga0501041_0105409
2030 Ga0501042_0017539
2031 Ga0501042_0042451
2032 Ga0501043_0002344
2033 Ga0501043_0003664
2034 Ga0501043_0061870
2035 Ga0501043_0087805
2036 Ga0501043_0143520
2037 Ga0501043_0217731
2038 Ga0501046_0000434
2039 Ga0501046_0030471
2040 Ga0501046_0049305
2041 Ga0501046_0410447
2042 Ga0501047_0000131
2043 Ga0501047_0054290
2044 Ga0501047_0092774
2045 Ga0501047_0095805
2046 Ga0501047_0183102
2047 Ga0501047_0268941
2048 Ga0501047_0399434
2049 Ga0501047_0510484
2050 Ga0501048_0000531
2051 Ga0501048_0020580
2052 Ga0501067_0000628
2053 Ga0501067_0001606
2054 Ga0501067_0004783
2055 Ga0501067_0048760
2056 Ga0501067_0422368
2057 Ga0501068_0011209
2058 Ga0501069_0001211
2059 Ga0501069_0256429
2060 Ga0501070_0005971
2061 Ga0501070_0039960
2062 Ga0501070_0117589
2063 Ga0501070_0260973
2064 Ga0501070_0473042
2065 Ga0501071_0051598
2066 Ga0501072_0000378
2067 Ga0501072_0203018
2068 Ga0501073_0029767
2069 Ga0501073_0095171
2070 Ga0501073_0103023
2071 Ga0501074_0003814
2072 Ga0501074_0018155
2073 Ga0501074_0018479
2074 Ga0501074_0070660
2075 Ga0501074_0231359
2076 Ga0501075_0103633
2077 Ga0501076_0015425
2078 Ga0501077_0015351
2079 Ga0501077_0134539
2080 Ga0501079_0001399
2081 Ga0501079_0003847
2082 Ga0501080_0009398
2083 Ga0501080_0064626
2084 Ga0501081_0001105
2085 Ga0501083_0000341
2086 Ga0501083_0060526
2087 Ga0501035_0000123
2088 Ga0501035_0005862
2089 Ga0501035_0093321
2090 Ga0501035_0173882
2091 Ga0501035_0180926
2092 Ga0501035_0206075
2093 Ga0501044_0000100
2094 Ga0501044_0039767
2095 Ga0501044_0113578
2096 Ga0501044_0195559
2097 Ga0501044_0214949
2098 Ga0501044_0253318
2099 Ga0501044_0281237
2100 Ga0501045_0009959
2101 Ga0501045_0022359
2102 Ga0501045_0022970
2103 nmdc:mga00v17_257025_c1
2104 nmdc:mga00v17_63096_c1
2105 nmdc:mga00v17_90644_c1
2106 nmdc:mga0yw44_153826_c1
2107 nmdc:mga0yw44_66131_c1
2108 nmdc:mga0yw44_73561_c1
2109 nmdc:mga0k408_130449_c1
2110 nmdc:mga0k408_63841_c2
2111 nmdc:mga06z11_177617_c1
2112 nmdc:mga06z11_3772_c1
2113 nmdc:mga04h51_11839_c1
2114 nmdc:mga04h51_42469_c1
2115 nmdc:mga07m45_119498_c1
2116 nmdc:mga07m45_143090_c1
2117 nmdc:mga07m45_215146_c1
2118 nmdc:mga07m45_3103_c1
2119 nmdc:mga05p37_255873_c1
2120 nmdc:mga05p37_427_c1
2121 nmdc:mga05p37_6551_c1
2122 nmdc:mga09592_248881_c1
2123 nmdc:mga09592_2873_c1
2124 nmdc:mga0qj67_124283_c1
2125 nmdc:mga0qj67_460427_c1
2126 nmdc:mga0qj67_51727_c2
2127 nmdc:mga06r32_109361_c1
2128 nmdc:mga06r32_2417_c1
2129 nmdc:mga06r32_306343_c1
2130 nmdc:mga06r32_6619_c1
2131 nmdc:mga08y16_102725_c1
2132 nmdc:mga08y16_199419_c1
2133 nmdc:mga08y16_263247_c1
2134 nmdc:mga08y16_42067_c1
2135 nmdc:mga08y16_90_c1
2136 nmdc:mga0n895_131467_c1
2137 nmdc:mga0n895_399422_c1
2138 nmdc:mga0rr50_195263_c1
2139 nmdc:mga0rr50_41439_c1
2140 nmdc:mga0rr50_42984_c1
2141 nmdc:mga0rr50_99236_c1
2142 nmdc:mga08x19_105709_c1
2143 nmdc:mga0a205_30941_c1
2144 nmdc:mga0a205_3895_c1
2145 nmdc:mga0sz30_19967_c1
2146 Ga0495601_0000011
2147 Ga0495601_0000392
2148 Ga0495601_0004077
2149 Ga0495601_0006579
2150 Ga0495601_0026481
2151 Ga0495601_0098431
2152 Ga0495612_0000006
2153 Ga0495612_0008409
2154 Ga0495612_0037724
2155 Ga0495612_0062897
2156 Ga0500635_0004048
2157 Ga0500635_0067662
2158 Ga0495655_0058021
2159 Ga0495595_0000021
2160 Ga0495595_0006005
2161 Ga0495595_0020342
2162 Ga0495595_0170332
2163 Ga0495619_0000013
2164 Ga0495619_0017632
2165 Ga0495619_0028554
2166 Ga0495619_0055926
2167 Ga0495619_0113072
2168 Ga0500646_0087203
2169 Ga0500583_0100611
2170 Ga0500651_0069761
2171 Ga0500651_0128499
2172 Ga0500566_0000107
2173 Ga0500566_0006857
2174 Ga0500566_0016736
2175 Ga0500566_0088729
2176 Ga0500650_0050150
2177 Ga0500650_0146655
2178 Ga0500554_005159
2179 Ga0500555_057288
2180 Ga0500569_001078
2181 Ga0500595_001968
2182 Ga0500595_002686
2183 Ga0500595_007413
2184 Ga0500595_019639
2185 Ga0500595_026838
2186 Ga0500595_041070
2187 Ga0500595_042387
2188 Ga0500607_069800
2189 Ga0500608_000949
2190 Ga0500618_005453
2191 Ga0500642_0000042
2192 Ga0500642_0058519
2193 Ga0500559_0000106
2194 Ga0500559_0040338
2195 Ga0500559_0138116
2196 Ga0500559_0172991
2197 Ga0500568_0139346
2198 Ga0500577_0009194
2199 Ga0500577_0150528
2200 Ga0500588_0100585
2201 Ga0500589_079745
2202 Ga0500590_026483
2203 Ga0500590_054115
2204 Ga0500603_013476
2205 Ga0500604_0019202
2206 Ga0500604_0044976
2207 Ga0500616_0000227
2208 Ga0500630_049983
2209 Ga0500633_0138491
2210 Ga0500638_002787
2211 Ga0500638_140299
2212 Ga0500636_0236835
2213 Ga0500637_0000180
2214 Ga0500637_0011782
2215 Ga0500637_0052147
2216 Ga0500645_047381
2217 Ga0500609_007813
2218 Ga0501084_0003563
2219 Ga0501084_0019061
2220 Ga0501084_0135809
2221 Ga0501082_0001776
2222 Ga0501082_0014075
2223 Ga0501082_0022020
2224 Ga0466962_0034341
2225 Ga0530510_0151565
2226 2509152157
2227 2513695264
2228 2513873373
2229 2513888602
2230 2514014703
2231 2523468649
2232 2524438844
2233 2603858355
2234 2617352084
2235 2644291070
2236 2671694952
2237 2723841793
2238 2739349855
2239 2793078332
2240 2805920721
2241 2824609015
2242 2824617719
2243 2824661008
2244 2824702630
2245 2824780868
2246 2838124672
2247 2841945364
2248 2841952149
2249 2841970463
2250 2841981711
2251 2841984992
2252 2847942315
2253 2857526545
2254 2876814212
2255 2879113337
2256 2885369359
2257 2888420148
2258 2889035328
2259 2893067207
2260 2904691029
2261 2906628533
2262 2908757087
2263 2917554972
2264 2919073635
2265 2922363183
2266 2922388512
2267 2922400051
2268 2935615545
2269 2935825654
2270 2935853418
2271 2935966745
2272 2936060254
2273 3005509005
2274 8006967612
2275 8006991082
2276 8007000411
2277 8016586268
2278 8056691120

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

205

321

0.97

PF01678

DAP_epimerase

Diaminopimelate epimerase

54

172

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.9157 7 271
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8742 5 273
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8595 7 271
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8422 5 273
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8335 7 278
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9433 158 261 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8992 9 113 3.10.310.10
3ejxD01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8852 7 122 3.10.310.10
2q9jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8824 8 113 3.10.310.10
3ejxA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8791 7 108 3.10.310.10
ID Description Score Start End GO Terms
AF-Q1QHJ3-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9887 1 282 GO:0005829
GO:0008837
GO:0009089
AF-Q1QHJ3-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9852 1 282 GO:0005829
GO:0008837
GO:0009089
AF-A4YKA5-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9773 1 282 GO:0005829
GO:0008837
GO:0009089
AF-Q13DT7-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9764 1 281 GO:0005829
GO:0008837
GO:0009089
AF-A4YKA5-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9739 1 282 GO:0005829
GO:0008837
GO:0009089

Map