F490693

General Info

Members Datasets Scaffolds Average Seq Length
1140 355 1140 80

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_101122012|Ga0070706_1011220121
Length 81
Sequence VSGFAFDPCARCEEMMQPYLDRDLSVEQMMEAEAHLDVCSHCRRRYRFEVSLRRYVRTVADEKQMPQELKAKLAVLRTPLH

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
119 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
120 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
238 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
239 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
240 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
241 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
242 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
248 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
350 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 6.32
Rhizosphere 92.19
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214741331 2209111006 Archaea 953
2 ARcpr5yngRDRAFT_c002676 3300000043 Unclassified 1831
3 ARSoilOldRDRAFT_c001729 3300000044 Unclassified 2003
4 JGI24747J21853_1050140 3300001978 Bacteria 508
5 JGI24739J22299_10043863 3300001989 Bacteria 1476
6 JGI24743J22301_10004517 3300001991 Bacteria 2274
7 JGI24743J22301_10058672 3300001991 Bacteria 791
8 JGI24743J22301_10095463 3300001991 Unclassified 637
9 JGI24738J21930_10025519 3300002075 Bacteria 1215
10 JGI24738J21930_10062747 3300002075 Bacteria 764
11 JGI24744J21845_10037088 3300002077 Bacteria 919
12 JGI24744J21845_10092072 3300002077 Bacteria 557
13 JGI24034J26672_10066300 3300002239 Bacteria 641
14 JGI24034J26672_10073220 3300002239 Bacteria 616
15 JGI24742J22300_10025285 3300002244 Bacteria 1026
16 JGI24742J22300_10120439 3300002244 Bacteria 518
17 JGI24751J29686_10078962 3300002459 Bacteria 682
18 JGI25406J46586_10025619 3300003203 Bacteria 2287
19 JGI25406J46586_10134316 3300003203 Bacteria 725
20 Ga0058863_10000400 3300004799 Bacteria 1171
21 Ga0058863_11966875 3300004799 Bacteria 905
22 Ga0058861_10036801 3300004800 Bacteria 944
23 Ga0058860_10162899 3300004801 Bacteria 892
24 Ga0058860_12210104 3300004801 Bacteria 841
25 Ga0058862_10098273 3300004803 Bacteria 881
26 Ga0070658_10012481 3300005327 Bacteria 6817
27 Ga0070658_10164960 3300005327 Bacteria 1859
28 Ga0070658_10983869 3300005327 Unclassified 734
29 Ga0070658_11186789 3300005327 Bacteria 664
30 Ga0070676_10120648 3300005328 Bacteria 1645
31 Ga0070676_10149159 3300005328 Bacteria 1495
32 Ga0070683_100018147 3300005329 Bacteria 6227
33 Ga0070683_100065183 3300005329 Bacteria 3392
34 Ga0070683_100120855 3300005329 Bacteria 2474
35 Ga0070683_100354697 3300005329 Unclassified 1397
36 Ga0070683_100520645 3300005329 Bacteria 1136
37 Ga0070683_100747945 3300005329 Bacteria 937
38 Ga0070690_100472279 3300005330 Bacteria 934
39 Ga0070670_100961684 3300005331 Bacteria 776
40 Ga0070670_101320500 3300005331 Unclassified 660
41 Ga0070670_101601209 3300005331 Bacteria 599
42 Ga0068869_100023368 3300005334 Bacteria 4268
43 Ga0068869_100269957 3300005334 Bacteria 1364
44 Ga0068869_100308655 3300005334 Unclassified 1280
45 Ga0068869_101838707 3300005334 Unclassified 542
46 Ga0068869_101874253 3300005334 Bacteria 537
47 Ga0070666_10204304 3300005335 Unclassified 1390
48 Ga0070680_100007895 3300005336 Bacteria 8115
49 Ga0070680_100147736 3300005336 Unclassified 1973
50 Ga0070680_100376973 3300005336 Bacteria 1208
51 Ga0070680_101030691 3300005336 Bacteria 711
52 Ga0070680_101272267 3300005336 Bacteria 637
53 Ga0070682_100005220 3300005337 Bacteria 7226
54 Ga0070682_100108336 3300005337 Unclassified 1847
55 Ga0070682_100471803 3300005337 Unclassified 966
56 Ga0070682_100523886 3300005337 Bacteria 922
57 Ga0070682_100630593 3300005337 Bacteria 851
58 Ga0070682_101825362 3300005337 Bacteria 531
59 Ga0068868_100110844 3300005338 Bacteria 2230
60 Ga0068868_100415272 3300005338 Bacteria 1164
61 Ga0068868_100529186 3300005338 Unclassified 1036
62 Ga0068868_100796543 3300005338 Bacteria 852
63 Ga0070660_100004686 3300005339 Bacteria 9468
64 Ga0070660_100063955 3300005339 Bacteria 2861
65 Ga0070660_100400628 3300005339 Unclassified 1135
66 Ga0070660_100405434 3300005339 Unclassified 1128
67 Ga0070660_101558565 3300005339 Bacteria 562
68 Ga0070689_100149218 3300005340 Bacteria 1885
69 Ga0070689_101462785 3300005340 Bacteria 618
70 Ga0070691_10001238 3300005341 Bacteria 10761
71 Ga0070691_10264948 3300005341 Bacteria 926
72 Ga0070691_10372810 3300005341 Bacteria 798
73 Ga0070691_10820831 3300005341 Unclassified 568
74 Ga0070691_10822967 3300005341 Unclassified 567
75 Ga0070687_100259899 3300005343 Bacteria 1083
76 Ga0070687_101357259 3300005343 Unclassified 530
77 Ga0070661_100014709 3300005344 Bacteria 5518
78 Ga0070661_100076821 3300005344 Bacteria 2461
79 Ga0070661_100313064 3300005344 Bacteria 1225
80 Ga0070661_100419923 3300005344 Bacteria 1060
81 Ga0070661_101766879 3300005344 Bacteria 524
82 Ga0070692_10012229 3300005345 Bacteria 3965
83 Ga0070692_10123571 3300005345 Bacteria 1446
84 Ga0070692_10240012 3300005345 Unclassified 1080
85 Ga0070692_10277631 3300005345 Bacteria 1014
86 Ga0070692_10862229 3300005345 Unclassified 623
87 Ga0070668_100097921 3300005347 Bacteria 2320
88 Ga0070668_101224370 3300005347 Bacteria 681
89 Ga0070668_101791386 3300005347 Bacteria 564
90 Ga0070669_100061755 3300005353 Bacteria 2754
91 Ga0070669_100110873 3300005353 Unclassified 2082
92 Ga0070669_100216640 3300005353 Bacteria 1513
93 Ga0070669_100316774 3300005353 Bacteria 1259
94 Ga0070675_100013979 3300005354 Bacteria 6319
95 Ga0070675_100066526 3300005354 Bacteria 2981
96 Ga0070675_100077897 3300005354 Bacteria 2760
97 Ga0070675_100331224 3300005354 Unclassified 1347
98 Ga0070671_100192672 3300005355 Bacteria 1728
99 Ga0070671_100568969 3300005355 Bacteria 978
100 Ga0070674_100024067 3300005356 Bacteria 3950
101 Ga0070674_100032596 3300005356 Bacteria 3460
102 Ga0070674_100066818 3300005356 Bacteria 2527
103 Ga0070674_100694487 3300005356 Bacteria 869
104 Ga0070674_101029289 3300005356 Bacteria 724
105 Ga0070674_101042143 3300005356 Bacteria 720
106 Ga0070674_101767873 3300005356 Unclassified 560
107 Ga0070673_100009358 3300005364 Bacteria 6574
108 Ga0070673_100052387 3300005364 Bacteria 3202
109 Ga0070673_100440169 3300005364 Unclassified 1171
110 Ga0070688_100020579 3300005365 Bacteria 3838
111 Ga0070688_100443056 3300005365 Bacteria 969
112 Ga0070688_100629724 3300005365 Bacteria 824
113 Ga0070659_100046848 3300005366 Bacteria 3390
114 Ga0070659_100055876 3300005366 Bacteria 3112
115 Ga0070659_100069351 3300005366 Unclassified 2798
116 Ga0070659_100134231 3300005366 Unclassified 2012
117 Ga0070659_101238669 3300005366 Unclassified 660
118 Ga0070667_101273894 3300005367 Bacteria 689
119 Ga0070667_101487235 3300005367 Unclassified 636
120 Ga0070703_10252828 3300005406 Bacteria 716
121 Ga0070701_10003360 3300005438 Bacteria 6318
122 Ga0070701_10165889 3300005438 Unclassified 1283
123 Ga0070701_10184858 3300005438 Bacteria 1223
124 Ga0070705_100057463 3300005440 Bacteria 2295
125 Ga0070700_100077418 3300005441 Bacteria 2138
126 Ga0070700_100135553 3300005441 Bacteria 1667
127 Ga0070700_100270932 3300005441 Unclassified 1226
128 Ga0070700_101191568 3300005441 Bacteria 635
129 Ga0070694_100413225 3300005444 Bacteria 1059
130 Ga0070694_100450391 3300005444 Unclassified 1016
131 Ga0070694_100594985 3300005444 Archaea 890
132 Ga0070694_101352627 3300005444 Bacteria 600
133 Ga0070708_100425083 3300005445 Unclassified 1253
134 Ga0070708_101340347 3300005445 Bacteria 668
135 Ga0070663_100303087 3300005455 Bacteria 1279
136 Ga0070663_101279227 3300005455 Unclassified 647
137 Ga0070663_101436932 3300005455 Bacteria 612
138 Ga0070678_100017141 3300005456 Bacteria 4654
139 Ga0070678_100048516 3300005456 Bacteria 3058
140 Ga0070678_100362420 3300005456 Bacteria 1249
141 Ga0070678_100911464 3300005456 Unclassified 804
142 Ga0070678_101533240 3300005456 Bacteria 624
143 Ga0070678_101980994 3300005456 Unclassified 551
144 Ga0070678_102185928 3300005456 Bacteria 525
145 Ga0070662_100016854 3300005457 Bacteria 4911
146 Ga0070662_100019166 3300005457 Bacteria 4642
147 Ga0070662_100048366 3300005457 Bacteria 3064
148 Ga0070662_100053146 3300005457 Bacteria 2931
149 Ga0070662_100865491 3300005457 Bacteria 770
150 Ga0070662_101905200 3300005457 Unclassified 514
151 Ga0070681_10072596 3300005458 Bacteria 3404
152 Ga0070681_10180469 3300005458 Unclassified 2032
153 Ga0070681_10274946 3300005458 Bacteria 1596
154 Ga0070681_10385000 3300005458 Bacteria 1313
155 Ga0068867_100073418 3300005459 Bacteria 2562
156 Ga0068867_100215413 3300005459 Bacteria 1545
157 Ga0068867_100505065 3300005459 Bacteria 1040
158 Ga0068867_100552932 3300005459 Bacteria 997
159 Ga0068867_100707492 3300005459 Unclassified 890
160 Ga0068867_101077312 3300005459 Bacteria 733
161 Ga0068867_101133090 3300005459 Unclassified 716
162 Ga0070685_10025373 3300005466 Bacteria 3263
163 Ga0070685_10051017 3300005466 Bacteria 2392
164 Ga0070685_10517617 3300005466 Unclassified 847
165 Ga0070706_100116655 3300005467 Bacteria 2487
166 Ga0070706_101122012 3300005467 Bacteria 724
167 Ga0070706_101633067 3300005467 Bacteria 588
168 Ga0070707_100212372 3300005468 Bacteria 1886
169 Ga0070707_100300165 3300005468 Bacteria 1561
170 Ga0070707_100538427 3300005468 Bacteria 1130
171 Ga0070707_100599964 3300005468 Bacteria 1064
172 Ga0070707_101071429 3300005468 Bacteria 772
173 Ga0070698_100422962 3300005471 Bacteria 1267
174 Ga0070698_100875197 3300005471 Bacteria 844
175 Ga0070699_100751143 3300005518 Bacteria 892
176 Ga0070679_100011289 3300005530 Bacteria 8517
177 Ga0070679_100037511 3300005530 Bacteria 4815
178 Ga0070679_100273839 3300005530 Bacteria 1641
179 Ga0070684_100030643 3300005535 Bacteria 4572
180 Ga0070684_100085253 3300005535 Bacteria 2801
181 Ga0070684_100108143 3300005535 Bacteria 2491
182 Ga0070684_100289579 3300005535 Bacteria 1501
183 Ga0070684_100346796 3300005535 Bacteria 1365
184 Ga0070684_100415153 3300005535 Bacteria 1242
185 Ga0070684_100670648 3300005535 Unclassified 966
186 Ga0070684_101292044 3300005535 Unclassified 687
187 Ga0068853_100014429 3300005539 Bacteria 6469
188 Ga0068853_100062964 3300005539 Bacteria 3212
189 Ga0068853_100167491 3300005539 Bacteria 1986
190 Ga0068853_101074489 3300005539 Unclassified 776
191 Ga0070672_100012820 3300005543 Bacteria 5903
192 Ga0070672_100123283 3300005543 Bacteria 2124
193 Ga0070672_100128796 3300005543 Bacteria 2078
194 Ga0070672_100872964 3300005543 Bacteria 794
195 Ga0070686_100029728 3300005544 Bacteria 3327
196 Ga0070686_100109964 3300005544 Unclassified 1876
197 Ga0070686_100628513 3300005544 Bacteria 849
198 Ga0070686_101093220 3300005544 Archaea 658
199 Ga0070695_101023736 3300005545 Bacteria 673
200 Ga0070696_100309973 3300005546 Bacteria 1211
201 Ga0070696_100507729 3300005546 Bacteria 960
202 Ga0070693_100045096 3300005547 Bacteria 2497
203 Ga0070693_100072121 3300005547 Bacteria 2036
204 Ga0070693_100441027 3300005547 Bacteria 912
205 Ga0070693_100603786 3300005547 Bacteria 792
206 Ga0070665_100194410 3300005548 Bacteria 2029
207 Ga0070665_100390657 3300005548 Unclassified 1399
208 Ga0070665_100447059 3300005548 Bacteria 1302
209 Ga0070665_100982496 3300005548 Bacteria 856
210 Ga0070704_100016961 3300005549 Bacteria 4618
211 Ga0070704_100073456 3300005549 Bacteria 2492
212 Ga0070704_100706319 3300005549 Bacteria 895
213 Ga0070704_100893734 3300005549 Bacteria 798
214 Ga0068855_100156199 3300005563 Bacteria 2591
215 Ga0068855_100345925 3300005563 Bacteria 1639
216 Ga0070664_100003869 3300005564 Bacteria 12088
217 Ga0070664_100010761 3300005564 Bacteria 7417
218 Ga0070664_100161931 3300005564 Unclassified 1980
219 Ga0070664_100169043 3300005564 Bacteria 1939
220 Ga0070664_100479900 3300005564 Unclassified 1144
221 Ga0070664_101377796 3300005564 Unclassified 666
222 Ga0070664_101507668 3300005564 Bacteria 636
223 Ga0068857_100071647 3300005577 Bacteria 3088
224 Ga0068857_102027130 3300005577 Unclassified 564
225 Ga0068854_100003667 3300005578 Bacteria 9604
226 Ga0068854_100888177 3300005578 Bacteria 783
227 Ga0068854_100915063 3300005578 Bacteria 772
228 Ga0068856_100179207 3300005614 Bacteria 2132
229 Ga0068856_100203070 3300005614 Bacteria 1997
230 Ga0068856_100407407 3300005614 Bacteria 1379
231 Ga0070702_100016434 3300005615 Bacteria 3797
232 Ga0070702_100025615 3300005615 Bacteria 3162
233 Ga0070702_101322173 3300005615 Unclassified 586
234 Ga0068852_100007373 3300005616 Bacteria 8022
235 Ga0068852_100043051 3300005616 Bacteria 3827
236 Ga0068852_100062908 3300005616 Bacteria 3229
237 Ga0068852_100247937 3300005616 Bacteria 1705
238 Ga0068852_100520762 3300005616 Unclassified 1186
239 Ga0068852_100653281 3300005616 Unclassified 1059
240 Ga0068859_100140109 3300005617 Bacteria 2492
241 Ga0068859_101434378 3300005617 Bacteria 762
242 Ga0068859_101462464 3300005617 Unclassified 754
243 Ga0068864_100015387 3300005618 Bacteria 6361
244 Ga0068864_100423296 3300005618 Unclassified 1269
245 Ga0068864_100659244 3300005618 Bacteria 1019
246 Ga0068864_101632593 3300005618 Bacteria 649
247 Ga0068866_10037817 3300005718 Bacteria 2372
248 Ga0068866_10130980 3300005718 Bacteria 1426
249 Ga0068866_10186024 3300005718 Unclassified 1230
250 Ga0068866_10496758 3300005718 Bacteria 806
251 Ga0068866_11162069 3300005718 Bacteria 556
252 Ga0068861_100682255 3300005719 Bacteria 953
253 Ga0068861_100791987 3300005719 Unclassified 889
254 Ga0068861_102317783 3300005719 Bacteria 539
255 Ga0068851_10135097 3300005834 Bacteria 1337
256 Ga0068851_10146037 3300005834 Bacteria 1290
257 Ga0068851_10330989 3300005834 Unclassified 882
258 Ga0068851_10785829 3300005834 Bacteria 591
259 Ga0068870_10047359 3300005840 Bacteria 2260
260 Ga0068870_10069276 3300005840 Unclassified 1919
261 Ga0068870_10176969 3300005840 Bacteria 1277
262 Ga0068870_10498032 3300005840 Unclassified 812
263 Ga0068870_10792203 3300005840 Bacteria 662
264 Ga0068863_100102857 3300005841 Bacteria 2716
265 Ga0068863_100319447 3300005841 Unclassified 1508
266 Ga0068858_100034435 3300005842 Bacteria 4698
267 Ga0068858_100387978 3300005842 Bacteria 1341
268 Ga0068860_100069094 3300005843 Bacteria 3357
269 Ga0068862_100503741 3300005844 Bacteria 1150
270 Ga0068862_100825068 3300005844 Unclassified 907
271 Ga0081455_10012612 3300005937 Bacteria 8421
272 Ga0081455_10026862 3300005937 Bacteria 5286
273 Ga0081455_10030348 3300005937 Bacteria 4911
274 Ga0081455_10197501 3300005937 Bacteria 1509
275 Ga0081455_10450052 3300005937 Unclassified 880
276 Ga0081539_10000890 3300005985 Bacteria 57132
277 Ga0081539_10000913 3300005985 Bacteria 55913
278 Ga0081539_10274747 3300005985 Bacteria 736
279 Ga0075365_10185597 3300006038 Bacteria 1455
280 Ga0075365_10215918 3300006038 Unclassified 1345
281 Ga0075368_10386016 3300006042 Bacteria 614
282 Ga0075363_100032780 3300006048 Bacteria 2701
283 Ga0075364_10555882 3300006051 Bacteria 784
284 Ga0075432_10002834 3300006058 Bacteria 5823
285 Ga0075432_10315263 3300006058 Unclassified 653
286 Ga0075367_10395143 3300006178 Bacteria 874
287 Ga0097621_100335071 3300006237 Bacteria 1342
288 Ga0097621_100518500 3300006237 Bacteria 1082
289 Ga0097621_100700064 3300006237 Bacteria 933
290 Ga0097621_101021418 3300006237 Bacteria 774
291 Ga0068871_100530762 3300006358 Bacteria 1064
292 Ga0068871_100594839 3300006358 Bacteria 1006
293 Ga0068871_100914323 3300006358 Bacteria 814
294 Ga0068871_100987398 3300006358 Bacteria 784
295 Ga0068871_101674327 3300006358 Unclassified 603
296 Ga0075428_100007037 3300006844 Bacteria 12475
297 Ga0075428_101504935 3300006844 Unclassified 705
298 Ga0075428_101748580 3300006844 Bacteria 648
299 Ga0075428_101769432 3300006844 Bacteria 644
300 Ga0075430_100069637 3300006846 Bacteria 2951
301 Ga0075430_100250350 3300006846 Bacteria 1468
302 Ga0075431_100222939 3300006847 Unclassified 1923
303 Ga0075431_101128770 3300006847 Bacteria 748
304 Ga0075433_10868588 3300006852 Bacteria 787
305 Ga0075434_100619594 3300006871 Bacteria 1101
306 Ga0075434_100763109 3300006871 Bacteria 984
307 Ga0075429_100015672 3300006880 Bacteria 6568
308 Ga0075429_101784490 3300006880 Bacteria 534
309 Ga0068865_100010600 3300006881 Bacteria 5744
310 Ga0068865_100028908 3300006881 Bacteria 3673
311 Ga0068865_100061189 3300006881 Bacteria 2638
312 Ga0068865_100251534 3300006881 Bacteria 1395
313 Ga0068865_100657094 3300006881 Bacteria 892
314 Ga0097620_100140117 3300006931 Bacteria 2492
315 Ga0097620_101434349 3300006931 Bacteria 762
316 Ga0097620_101462223 3300006931 Unclassified 754
317 Ga0075435_100281477 3300007076 Bacteria 1420
318 Ga0075435_100411961 3300007076 Unclassified 1163
319 Ga0105244_10413686 3300009036 Bacteria 620
320 Ga0111539_10048272 3300009094 Bacteria 5084
321 Ga0111539_10434001 3300009094 Bacteria 1529
322 Ga0111539_10673954 3300009094 Archaea 1204
323 Ga0111539_10920760 3300009094 Bacteria 1017
324 Ga0111539_12345987 3300009094 Bacteria 619
325 Ga0111539_12598296 3300009094 Bacteria 587
326 Ga0105245_10002458 3300009098 Bacteria 16754
327 Ga0105245_10037615 3300009098 Bacteria 4303
328 Ga0105245_10128207 3300009098 Bacteria 2377
329 Ga0105245_10340484 3300009098 Bacteria 1483
330 Ga0105245_10438691 3300009098 Bacteria 1312
331 Ga0105245_10587517 3300009098 Bacteria 1139
332 Ga0105245_10837010 3300009098 Unclassified 960
333 Ga0105245_11184800 3300009098 Bacteria 812
334 Ga0105245_11327525 3300009098 Archaea 768
335 Ga0105247_10016412 3300009101 Bacteria 4437
336 Ga0105247_10403972 3300009101 Unclassified 974
337 Ga0114129_10006579 3300009147 Bacteria 16496
338 Ga0114129_10054711 3300009147 Bacteria 5595
339 Ga0114129_10772526 3300009147 Unclassified 1228
340 Ga0114129_11131925 3300009147 Bacteria 978
341 Ga0114129_11260965 3300009147 Bacteria 918
342 Ga0114129_11773738 3300009147 Unclassified 751
343 Ga0114129_12557994 3300009147 Bacteria 610
344 Ga0105243_10005485 3300009148 Bacteria 9893
345 Ga0105243_10114175 3300009148 Bacteria 2266
346 Ga0105243_10155875 3300009148 Bacteria 1964
347 Ga0105243_10299389 3300009148 Bacteria 1457
348 Ga0105243_10341823 3300009148 Bacteria 1371
349 Ga0105243_10657490 3300009148 Bacteria 1016
350 Ga0105243_10881191 3300009148 Bacteria 889
351 Ga0105243_11125349 3300009148 Unclassified 795
352 Ga0105243_11488103 3300009148 Bacteria 700
353 Ga0105241_12182417 3300009174 Bacteria 549
354 Ga0105242_10004703 3300009176 Bacteria 10568
355 Ga0105242_10131180 3300009176 Bacteria 2163
356 Ga0105242_10147878 3300009176 Unclassified 2045
357 Ga0105242_10302863 3300009176 Bacteria 1460
358 Ga0105242_10360402 3300009176 Bacteria 1346
359 Ga0105242_12214428 3300009176 Bacteria 595
360 Ga0105248_10277459 3300009177 Bacteria 1887
361 Ga0105248_11035383 3300009177 Bacteria 927
362 Ga0105248_12646319 3300009177 Unclassified 572
363 Ga0105248_12667251 3300009177 Bacteria 570
364 Ga0105248_12926449 3300009177 Bacteria 544
365 Ga0105237_10362186 3300009545 Bacteria 1454
366 Ga0105238_10004615 3300009551 Bacteria 13633
367 Ga0105238_10655795 3300009551 Bacteria 1060
368 Ga0105238_11490411 3300009551 Unclassified 705
369 Ga0105249_10074040 3300009553 Bacteria 3151
370 Ga0105249_10129166 3300009553 Bacteria 2410
371 Ga0105249_10167696 3300009553 Bacteria 2127
372 Ga0105249_10791601 3300009553 Bacteria 1012
373 Ga0105239_10060383 3300010375 Bacteria 4161
374 Ga0105239_10173487 3300010375 Bacteria 2412
375 Ga0105239_10314495 3300010375 Bacteria 1765
376 Ga0105239_10493149 3300010375 Bacteria 1392
377 Ga0105239_10685042 3300010375 Bacteria 1172
378 Ga0105239_12667311 3300010375 Unclassified 583
379 Ga0105246_10073527 3300011119 Unclassified 2414
380 Ga0105246_10151414 3300011119 Bacteria 1756
381 Ga0105246_10196226 3300011119 Bacteria 1566
382 Ga0105246_10202032 3300011119 Bacteria 1546
383 Ga0105246_10251886 3300011119 Unclassified 1402
384 Ga0105246_10486262 3300011119 Bacteria 1045
385 Ga0105246_10619270 3300011119 Bacteria 938
386 Ga0105246_10916465 3300011119 Bacteria 787
387 Ga0105246_11066732 3300011119 Bacteria 736
388 Ga0157343_1011118 3300012488 Unclassified 693
389 Ga0157314_1028173 3300012500 Unclassified 616
390 Ga0157314_1036908 3300012500 Bacteria 574
391 Ga0157339_1067631 3300012505 Unclassified 509
392 Ga0157373_10475281 3300013100 Bacteria 901
393 Ga0157373_10577989 3300013100 Unclassified 817
394 Ga0157373_10865248 3300013100 Unclassified 669
395 Ga0157373_11094913 3300013100 Bacteria 597
396 Ga0157371_10195844 3300013102 Bacteria 1448
397 Ga0157371_10234896 3300013102 Bacteria 1318
398 Ga0157371_10325779 3300013102 Bacteria 1115
399 Ga0157370_10769753 3300013104 Bacteria 877
400 Ga0157370_10795452 3300013104 Bacteria 861
401 Ga0157369_10104309 3300013105 Bacteria 3019
402 Ga0157374_10141270 3300013296 Bacteria 2338
403 Ga0157374_10532139 3300013296 Bacteria 1182
404 Ga0157374_12846246 3300013296 Unclassified 511
405 Ga0157378_10223569 3300013297 Bacteria 1791
406 Ga0157378_10763532 3300013297 Unclassified 990
407 Ga0157378_10790326 3300013297 Bacteria 974
408 Ga0157378_11270294 3300013297 Bacteria 777
409 Ga0163162_10484589 3300013306 Unclassified 1368
410 Ga0163162_10821685 3300013306 Bacteria 1046
411 Ga0163162_11875234 3300013306 Bacteria 686
412 Ga0163162_11990492 3300013306 Bacteria 666
413 Ga0157372_10009445 3300013307 Bacteria 10376
414 Ga0157372_10105468 3300013307 Bacteria 3223
415 Ga0157372_10509020 3300013307 Archaea 1404
416 Ga0157375_10029312 3300013308 Bacteria 5173
417 Ga0157375_10041919 3300013308 Bacteria 4425
418 Ga0157375_10651885 3300013308 Bacteria 1209
419 Ga0157375_10960602 3300013308 Bacteria 996
420 Ga0157375_10974996 3300013308 Bacteria 988
421 Ga0157375_12548815 3300013308 Unclassified 611
422 Ga0163163_10199617 3300014325 Bacteria 2048
423 Ga0163163_10542539 3300014325 Unclassified 1225
424 Ga0163163_10587035 3300014325 Bacteria 1177
425 Ga0163163_11526590 3300014325 Bacteria 729
426 Ga0163163_11973199 3300014325 Unclassified 643
427 Ga0163163_12694173 3300014325 Bacteria 554
428 Ga0157380_10040382 3300014326 Bacteria 3634
429 Ga0157380_10049025 3300014326 Bacteria 3329
430 Ga0157380_10159646 3300014326 Bacteria 1958
431 Ga0157380_12047313 3300014326 Bacteria 635
432 Ga0157377_10001311 3300014745 Bacteria 10644
433 Ga0157377_10003506 3300014745 Bacteria 7100
434 Ga0157377_10063765 3300014745 Bacteria 2111
435 Ga0157377_10077178 3300014745 Bacteria 1939
436 Ga0157377_10163634 3300014745 Unclassified 1386
437 Ga0157377_10843662 3300014745 Bacteria 680
438 Ga0157377_11284666 3300014745 Bacteria 571
439 Ga0157377_11484705 3300014745 Unclassified 538
440 Ga0157379_10070862 3300014968 Unclassified 3119
441 Ga0157379_10075391 3300014968 Unclassified 3020
442 Ga0157379_12098590 3300014968 Bacteria 560
443 Ga0157376_10035152 3300014969 Bacteria 4052
444 Ga0157376_10131046 3300014969 Bacteria 2237
445 Ga0157376_10423087 3300014969 Bacteria 1293
446 Ga0163161_10017266 3300017792 Bacteria 5049
447 Ga0163161_10507902 3300017792 Unclassified 982
448 Ga0163161_10784000 3300017792 Bacteria 800
449 Ga0163161_11490969 3300017792 Unclassified 593
450 Ga0206356_10423462 3300020070 Bacteria 3473
451 Ga0206356_10715168 3300020070 Bacteria 1292
452 Ga0206351_10732071 3300020077 Bacteria 514
453 Ga0206352_10539032 3300020078 Bacteria 914
454 Ga0206350_10935077 3300020080 Bacteria 1231
455 Ga0206354_10785179 3300020081 Bacteria 1318
456 Ga0206354_11277640 3300020081 Bacteria 1610
457 Ga0224712_10070446 3300022467 Bacteria 1418
458 Ga0207656_10243534 3300025321 Unclassified 879
459 Ga0207653_10018400 3300025885 Bacteria 2200
460 Ga0207642_10086808 3300025899 Bacteria 1535
461 Ga0207642_10117534 3300025899 Bacteria 1366
462 Ga0207642_10769334 3300025899 Bacteria 611
463 Ga0207688_10013555 3300025901 Bacteria 4431
464 Ga0207688_10060772 3300025901 Bacteria 2129
465 Ga0207688_10111828 3300025901 Unclassified 1586
466 Ga0207688_10143489 3300025901 Unclassified 1406
467 Ga0207688_10550347 3300025901 Bacteria 725
468 Ga0207680_10086005 3300025903 Bacteria 1987
469 Ga0207647_10349319 3300025904 Bacteria 837
470 Ga0207645_10116806 3300025907 Bacteria 1730
471 Ga0207645_10227145 3300025907 Bacteria 1231
472 Ga0207643_10153252 3300025908 Bacteria 1383
473 Ga0207643_10206206 3300025908 Bacteria 1199
474 Ga0207643_10325628 3300025908 Bacteria 961
475 Ga0207643_10361395 3300025908 Bacteria 913
476 Ga0207643_10517390 3300025908 Bacteria 764
477 Ga0207705_10023479 3300025909 Bacteria 4399
478 Ga0207705_10890455 3300025909 Unclassified 690
479 Ga0207705_11230661 3300025909 Bacteria 574
480 Ga0207684_10152321 3300025910 Bacteria 1990
481 Ga0207684_10904603 3300025910 Bacteria 742
482 Ga0207654_10595001 3300025911 Bacteria 789
483 Ga0207654_11434169 3300025911 Unclassified 503
484 Ga0207707_10016045 3300025912 Bacteria 6531
485 Ga0207707_10178775 3300025912 Bacteria 1853
486 Ga0207707_10393042 3300025912 Unclassified 1191
487 Ga0207707_10671939 3300025912 Bacteria 872
488 Ga0207707_10805229 3300025912 Bacteria 782
489 Ga0207671_10718342 3300025914 Bacteria 794
490 Ga0207660_10017237 3300025917 Bacteria 4794
491 Ga0207660_10155820 3300025917 Bacteria 1758
492 Ga0207660_10168419 3300025917 Bacteria 1694
493 Ga0207662_10085898 3300025918 Bacteria 1927
494 Ga0207662_10636895 3300025918 Bacteria 744
495 Ga0207657_10003899 3300025919 Bacteria 15830
496 Ga0207657_10096050 3300025919 Bacteria 2465
497 Ga0207657_10194098 3300025919 Bacteria 1636
498 Ga0207657_10210994 3300025919 Bacteria 1559
499 Ga0207657_10583151 3300025919 Unclassified 873
500 Ga0207657_10999542 3300025919 Bacteria 642
501 Ga0207657_11190135 3300025919 Bacteria 580
502 Ga0207649_10006520 3300025920 Bacteria 6341
503 Ga0207649_10045143 3300025920 Bacteria 2700
504 Ga0207649_10300772 3300025920 Bacteria 1173
505 Ga0207649_11365178 3300025920 Bacteria 561
506 Ga0207652_10049961 3300025921 Bacteria 3582
507 Ga0207652_10131826 3300025921 Bacteria 2229
508 Ga0207652_10427981 3300025921 Unclassified 1194
509 Ga0207652_10675408 3300025921 Bacteria 923
510 Ga0207646_10188524 3300025922 Bacteria 1863
511 Ga0207646_10270563 3300025922 Unclassified 1536
512 Ga0207646_11830118 3300025922 Unclassified 519
513 Ga0207681_10124965 3300025923 Bacteria 1893
514 Ga0207681_10306574 3300025923 Bacteria 1258
515 Ga0207681_10348453 3300025923 Unclassified 1185
516 Ga0207681_10683881 3300025923 Unclassified 852
517 Ga0207681_10717210 3300025923 Unclassified 832
518 Ga0207694_10118485 3300025924 Bacteria 2112
519 Ga0207694_11682504 3300025924 Bacteria 534
520 Ga0207650_11468665 3300025925 Bacteria 580
521 Ga0207650_11523066 3300025925 Unclassified 568
522 Ga0207659_10050673 3300025926 Bacteria 2950
523 Ga0207659_10121009 3300025926 Bacteria 2006
524 Ga0207659_10126612 3300025926 Bacteria 1965
525 Ga0207659_10193288 3300025926 Bacteria 1620
526 Ga0207659_10701790 3300025926 Bacteria 866
527 Ga0207687_10012133 3300025927 Bacteria 5635
528 Ga0207687_10013736 3300025927 Bacteria 5288
529 Ga0207687_10190967 3300025927 Bacteria 1594
530 Ga0207687_10329199 3300025927 Unclassified 1239
531 Ga0207687_10926236 3300025927 Bacteria 746
532 Ga0207644_10645960 3300025931 Bacteria 880
533 Ga0207644_10960397 3300025931 Bacteria 717
534 Ga0207644_11097051 3300025931 Bacteria 669
535 Ga0207690_10037340 3300025932 Bacteria 3153
536 Ga0207690_10051083 3300025932 Bacteria 2763
537 Ga0207690_10263376 3300025932 Bacteria 1336
538 Ga0207706_10003040 3300025933 Bacteria 16170
539 Ga0207706_10018100 3300025933 Bacteria 6339
540 Ga0207706_10025020 3300025933 Bacteria 5353
541 Ga0207706_10209297 3300025933 Bacteria 1710
542 Ga0207706_10747880 3300025933 Bacteria 833
543 Ga0207686_10282224 3300025934 Bacteria 1226
544 Ga0207686_11247868 3300025934 Archaea 609
545 Ga0207709_10043199 3300025935 Unclassified 2716
546 Ga0207709_10074295 3300025935 Bacteria 2169
547 Ga0207709_10691128 3300025935 Bacteria 816
548 Ga0207670_10122359 3300025936 Unclassified 1894
549 Ga0207670_10400516 3300025936 Bacteria 1097
550 Ga0207669_10073407 3300025937 Bacteria 2158
551 Ga0207669_10111386 3300025937 Bacteria 1835
552 Ga0207669_10163492 3300025937 Bacteria 1575
553 Ga0207669_11194503 3300025937 Bacteria 644
554 Ga0207669_11354239 3300025937 Unclassified 605
555 Ga0207669_11560249 3300025937 Archaea 563
556 Ga0207704_10067422 3300025938 Bacteria 2251
557 Ga0207704_10242297 3300025938 Bacteria 1348
558 Ga0207704_10259544 3300025938 Unclassified 1309
559 Ga0207704_11797851 3300025938 Bacteria 527
560 Ga0207691_10006406 3300025940 Bacteria 11371
561 Ga0207691_10012064 3300025940 Bacteria 8290
562 Ga0207691_10136553 3300025940 Bacteria 2162
563 Ga0207691_10540916 3300025940 Bacteria 988
564 Ga0207691_11020508 3300025940 Bacteria 690
565 Ga0207711_10043749 3300025941 Bacteria 3821
566 Ga0207711_10215795 3300025941 Bacteria 1753
567 Ga0207711_11346223 3300025941 Bacteria 656
568 Ga0207689_10121142 3300025942 Bacteria 2152
569 Ga0207689_10868378 3300025942 Bacteria 761
570 Ga0207689_11530401 3300025942 Unclassified 556
571 Ga0207689_11558846 3300025942 Bacteria 550
572 Ga0207689_11633856 3300025942 Bacteria 535
573 Ga0207661_10000612 3300025944 Bacteria 22876
574 Ga0207661_10033009 3300025944 Bacteria 4015
575 Ga0207661_10036867 3300025944 Bacteria 3820
576 Ga0207661_10205708 3300025944 Bacteria 1733
577 Ga0207661_10277007 3300025944 Bacteria 1498
578 Ga0207661_10341501 3300025944 Unclassified 1349
579 Ga0207661_10377166 3300025944 Archaea 1283
580 Ga0207661_11334018 3300025944 Bacteria 659
581 Ga0207661_11720266 3300025944 Bacteria 572
582 Ga0207679_10117357 3300025945 Bacteria 2112
583 Ga0207679_10133330 3300025945 Bacteria 1996
584 Ga0207679_10217596 3300025945 Bacteria 1605
585 Ga0207679_10294743 3300025945 Unclassified 1396
586 Ga0207679_10710625 3300025945 Unclassified 912
587 Ga0207679_10741182 3300025945 Bacteria 893
588 Ga0207679_11340165 3300025945 Bacteria 657
589 Ga0207667_11344700 3300025949 Bacteria 689
590 Ga0207651_10184857 3300025960 Unclassified 1657
591 Ga0207651_11223308 3300025960 Bacteria 674
592 Ga0207712_10898689 3300025961 Bacteria 783
593 Ga0207668_10029857 3300025972 Bacteria 3578
594 Ga0207668_10718474 3300025972 Bacteria 879
595 Ga0207640_10074967 3300025981 Bacteria 2291
596 Ga0207640_10496448 3300025981 Archaea 1015
597 Ga0207640_11348832 3300025981 Unclassified 638
598 Ga0207640_11459965 3300025981 Bacteria 614
599 Ga0207658_10828041 3300025986 Bacteria 841
600 Ga0207677_10027716 3300026023 Bacteria 3573
601 Ga0207677_10315501 3300026023 Bacteria 1297
602 Ga0207677_10895731 3300026023 Bacteria 799
603 Ga0207677_11111706 3300026023 Bacteria 721
604 Ga0207677_11331989 3300026023 Archaea 660
605 Ga0207703_10051335 3300026035 Bacteria 3341
606 Ga0207703_10980027 3300026035 Bacteria 811
607 Ga0207639_10012338 3300026041 Bacteria 5950
608 Ga0207639_10519206 3300026041 Unclassified 1090
609 Ga0207639_11199777 3300026041 Unclassified 712
610 Ga0207639_11716654 3300026041 Bacteria 588
611 Ga0207678_10023034 3300026067 Bacteria 5450
612 Ga0207678_10177813 3300026067 Bacteria 1817
613 Ga0207678_10438064 3300026067 Bacteria 1135
614 Ga0207708_10015196 3300026075 Bacteria 5771
615 Ga0207708_10016992 3300026075 Bacteria 5477
616 Ga0207708_10060405 3300026075 Bacteria 2893
617 Ga0207708_10248364 3300026075 Bacteria 1433
618 Ga0207702_10074671 3300026078 Bacteria 2927
619 Ga0207702_10206917 3300026078 Bacteria 1822
620 Ga0207702_10417877 3300026078 Bacteria 1296
621 Ga0207641_10790612 3300026088 Bacteria 938
622 Ga0207648_10051981 3300026089 Bacteria 3582
623 Ga0207648_10125301 3300026089 Bacteria 2260
624 Ga0207648_10182488 3300026089 Bacteria 1858
625 Ga0207648_10185847 3300026089 Bacteria 1841
626 Ga0207648_10445614 3300026089 Bacteria 1178
627 Ga0207648_11628147 3300026089 Unclassified 607
628 Ga0207676_10276214 3300026095 Bacteria 1523
629 Ga0207676_10579641 3300026095 Bacteria 1075
630 Ga0207676_10960354 3300026095 Bacteria 841
631 Ga0207676_11662958 3300026095 Bacteria 637
632 Ga0207676_11736969 3300026095 Unclassified 622
633 Ga0207674_10031518 3300026116 Bacteria 5569
634 Ga0207674_10060638 3300026116 Bacteria 3824
635 Ga0207674_10431412 3300026116 Unclassified 1274
636 Ga0207674_11081827 3300026116 Bacteria 771
637 Ga0207674_11184008 3300026116 Bacteria 734
638 Ga0207675_100119742 3300026118 Bacteria 2490
639 Ga0207675_100647694 3300026118 Unclassified 1062
640 Ga0207683_10004422 3300026121 Bacteria 12149
641 Ga0207683_10025471 3300026121 Bacteria 5104
642 Ga0207683_10061101 3300026121 Bacteria 3315
643 Ga0207683_10115188 3300026121 Bacteria 2410
644 Ga0207683_10260174 3300026121 Bacteria 1584
645 Ga0207683_10833282 3300026121 Bacteria 856
646 Ga0207683_11157473 3300026121 Archaea 717
647 Ga0207683_11528163 3300026121 Bacteria 616
648 Ga0207698_10003410 3300026142 Bacteria 9566
649 Ga0207698_10052158 3300026142 Bacteria 3132
650 Ga0207698_10069554 3300026142 Bacteria 2784
651 Ga0207698_10096671 3300026142 Bacteria 2435
652 Ga0207698_10485231 3300026142 Bacteria 1200
653 Ga0207698_12233416 3300026142 Unclassified 560
654 Ga0209998_10052091 3300027717 Unclassified 949
655 Ga0209813_10469070 3300027866 Bacteria 518
656 Ga0209974_10158418 3300027876 Bacteria 820
657 Ga0207428_10002314 3300027907 Bacteria 19080
658 Ga0207428_10167268 3300027907 Bacteria 1667
659 Ga0207428_10175303 3300027907 Bacteria 1622
660 Ga0268266_10249643 3300028379 Bacteria 1641
661 Ga0268266_10510220 3300028379 Bacteria 1149
662 Ga0268266_10642900 3300028379 Bacteria 1021
663 Ga0268266_11364561 3300028379 Bacteria 684
664 Ga0268265_11237955 3300028380 Unclassified 745
665 Ga0268265_11550855 3300028380 Bacteria 667
666 Ga0268264_10036367 3300028381 Bacteria 4057
667 Ga0268264_10661439 3300028381 Unclassified 1035
668 Ga0307408_100885856 3300031548 Bacteria 816
669 Ga0307405_10730476 3300031731 Bacteria 823
670 Ga0307405_10804385 3300031731 Bacteria 788
671 Ga0326468_10084057 3300031889 Unclassified 556
672 Ga0307416_100149706 3300032002 Bacteria 2138
673 Ga0307416_100636788 3300032002 Bacteria 1150
674 Ga0307415_100459462 3300032126 Bacteria 1103
675 Ga0373948_0013703 3300034817 Bacteria 1468
676 Ga0373938_0136265 3300034957 Bacteria 644
677 Ga0373928_0035993 3300035084 Bacteria 1118
678 Ga0373949_0089257 3300035090 Bacteria 831
679 Ga0373951_0097676 3300035091 Bacteria 777
680 Ga0373941_0013948 3300035115 Bacteria 2136
681 Ga0373960_0093458 3300035121 Unclassified 965
682 Ga0373942_0199928 3300035207 Bacteria 662
683 Ga0373961_0081863 3300035241 Bacteria 1017
684 Ga0373962_0027361 3300035242 Bacteria 1542
685 Ga0373931_0072674 3300035691 Bacteria 1881
686 Ga0373931_0260963 3300035691 Unclassified 1057
687 Ga0373937_1789897 3300036401 Bacteria 561
688 Ga0395899_0053875 3300037312 Bacteria 2978
689 Ga0395900_0005363 3300037418 Bacteria 13437
690 Ga0395900_0056240 3300037418 Bacteria 4050
691 Ga0395900_0088732 3300037418 Bacteria 3179
692 Ga0395900_0193927 3300037418 Unclassified 2059
693 Ga0395900_0671501 3300037418 Bacteria 971
694 Ga0395898_0063334 3300037466 Bacteria 3589
695 Ga0395898_0071698 3300037466 Bacteria 3347
696 Ga0395898_0117909 3300037466 Bacteria 2543
697 Ga0395898_1628378 3300037466 Unclassified 569
698 Ga0395898_1693641 3300037466 Unclassified 555
699 Ga0395905_0006331 3300037471 Bacteria 11928
700 Ga0395905_0027035 3300037471 Bacteria 5411
701 Ga0395905_0062102 3300037471 Bacteria 3495
702 Ga0395905_0105649 3300037471 Bacteria 2644
703 Ga0395901_0013286 3300038443 Bacteria 8363
704 Ga0395901_0021597 3300038443 Bacteria 6595
705 Ga0395901_0030277 3300038443 Bacteria 5576
706 Ga0395901_0067669 3300038443 Bacteria 3720
707 Ga0395901_0083956 3300038443 Bacteria 3329
708 Ga0395901_0757946 3300038443 Bacteria 963
709 Ga0395901_0787498 3300038443 Bacteria 941
710 Ga0395901_1426352 3300038443 Bacteria 650
711 Ga0451787_144833 3300041441 Bacteria 581
712 Ga0451789_0067247 3300041443 Bacteria 630
713 Ga0451789_0622442 3300041443 Bacteria 1140
714 Ga0451793_0217906 3300041452 Unclassified 1348
715 Ga0451802_0539959 3300041460 Bacteria 1034
716 Ga0451802_2123391 3300041460 Bacteria 972
717 Ga0451807_1505927 3300041486 Bacteria 630
718 Ga0451835_0445768 3300041492 Bacteria 802
719 Ga0451837_1813209 3300041494 Bacteria 564
720 Ga0451853_3086998 3300041512 Unclassified 1193
721 Ga0450911_028724 3300042115 Bacteria 721
722 Ga0450920_002200 3300042122 Bacteria 3301
723 Ga0450923_039659 3300042125 Unclassified 986
724 Ga0450890_060459 3300042127 Bacteria 593
725 Ga0450898_090077 3300042134 Unclassified 632
726 Ga0450902_009145 3300042137 Unclassified 1558
727 Ga0450906_016580 3300042145 Bacteria 1332
728 Ga0450907_059315 3300042146 Bacteria 660
729 Ga0439458_0044625 3300042157 Unclassified 1083
730 Ga0450908_025444 3300042184 Bacteria 1034
731 Ga0450909_070273 3300042185 Bacteria 560
732 Ga0439464_0295073 3300042439 Bacteria 529
733 Ga0450916_034239 3300042530 Unclassified 751
734 Ga0450918_013958 3300042531 Bacteria 1397
735 Ga0439440_0232638 3300042993 Bacteria 556
736 Ga0466967_0350002 3300045976 Bacteria 1430
737 Ga0495603_0035069 3300046455 Bacteria 3015
738 Ga0495603_0264450 3300046455 Bacteria 990
739 Ga0495641_0270051 3300046461 Bacteria 765
740 Ga0495651_0500581 3300046462 Bacteria 778
741 Ga0495582_0443499 3300046473 Bacteria 749
742 Ga0495605_0138172 3300046474 Bacteria 1095
743 Ga0495584_0613625 3300046491 Bacteria 555
744 Ga0495585_0244741 3300046492 Bacteria 897
745 Ga0495596_0105550 3300046500 Bacteria 1094
746 Ga0495596_0405762 3300046500 Bacteria 531
747 Ga0495608_0138327 3300046511 Bacteria 1555
748 Ga0495616_0280749 3300046513 Bacteria 708
749 Ga0495618_0646578 3300046514 Bacteria 626
750 Ga0495620_0210159 3300046515 Bacteria 747
751 Ga0495628_0219470 3300046516 Bacteria 1428
752 Ga0495628_0777536 3300046516 Bacteria 671
753 Ga0495630_0143599 3300046517 Bacteria 1815
754 Ga0495644_0043043 3300046523 Unclassified 1700
755 Ga0495587_0709012 3300046536 Bacteria 551
756 Ga0495598_0259894 3300046537 Bacteria 646
757 Ga0495645_0347890 3300046543 Bacteria 956
758 Ga0495667_0957206 3300046559 Unclassified 523
759 Ga0495656_0172387 3300046615 Unclassified 1059
760 Ga0495656_0337502 3300046615 Bacteria 779
761 Ga0495656_0712993 3300046615 Bacteria 540
762 Ga0495634_0820110 3300046642 Bacteria 530
763 Ga0495611_0223513 3300046648 Bacteria 876
764 Ga0495635_0199282 3300046663 Bacteria 1358
765 Ga0495659_0102784 3300046664 Bacteria 1109
766 Ga0495588_0327785 3300046674 Bacteria 805
767 Ga0495658_0482207 3300046683 Bacteria 793
768 Ga0495658_0736409 3300046683 Bacteria 632
769 Ga0495658_0850368 3300046683 Unclassified 584
770 Ga0495624_0350387 3300046690 Bacteria 888
771 Ga0495624_0564779 3300046690 Bacteria 679
772 Ga0495670_0410725 3300046691 Bacteria 732
773 Ga0495671_0058339 3300046692 Bacteria 1910
774 Ga0495589_0045256 3300046794 Bacteria 2187
775 Ga0495600_0698996 3300046809 Bacteria 610
776 Ga0495660_0489572 3300046810 Bacteria 527
777 Ga0495581_0539635 3300047315 Bacteria 677
778 Ga0495604_0245016 3300047317 Bacteria 1224
779 Ga0495604_0589546 3300047317 Bacteria 714
780 Ga0495636_0087635 3300047318 Bacteria 1348
781 Ga0495674_0120853 3300047319 Bacteria 2213
782 Ga0495676_0336055 3300047321 Bacteria 1012
783 Ga0495676_1031363 3300047321 Unclassified 524
784 Ga0495675_0243476 3300047444 Bacteria 1082
785 Ga0495684_0605319 3300047471 Bacteria 739
786 Ga0496100_0432659 3300048903 Bacteria 1006
787 Ga0496100_0554901 3300048903 Bacteria 889
788 Ga0496100_0849718 3300048903 Bacteria 716
789 Ga0496100_1306091 3300048903 Bacteria 572
790 Ga0496101_0130884 3300048904 Bacteria 1905
791 Ga0496101_0138299 3300048904 Unclassified 1855
792 Ga0496101_0217352 3300048904 Bacteria 1482
793 Ga0496101_1157668 3300048904 Bacteria 607
794 Ga0496102_0234483 3300048905 Unclassified 1730
795 Ga0496102_0527928 3300048905 Bacteria 1103
796 Ga0496102_0615214 3300048905 Bacteria 1009
797 Ga0496102_0668846 3300048905 Bacteria 961
798 Ga0496102_1524458 3300048905 Archaea 587
799 Ga0496102_1729973 3300048905 Bacteria 543
800 Ga0496103_0160526 3300048906 Unclassified 1442
801 Ga0496104_0027875 3300048907 Bacteria 5230
802 Ga0496104_0230746 3300048907 Bacteria 1763
803 Ga0496104_0303765 3300048907 Unclassified 1508
804 Ga0496104_0382872 3300048907 Bacteria 1319
805 Ga0496104_1101567 3300048907 Bacteria 698
806 Ga0496104_1355928 3300048907 Bacteria 614
807 Ga0496104_1378047 3300048907 Bacteria 608
808 Ga0496105_0120951 3300048908 Bacteria 2159
809 Ga0496105_0215961 3300048908 Bacteria 1562
810 Ga0496105_0364671 3300048908 Bacteria 1152
811 Ga0496105_0584496 3300048908 Bacteria 868
812 Ga0496106_0025632 3300048909 Bacteria 4390
813 Ga0496107_0191368 3300048910 Bacteria 1520
814 Ga0496107_0429079 3300048910 Bacteria 983
815 Ga0496107_1337180 3300048910 Bacteria 512
816 Ga0496108_0019446 3300048911 Bacteria 5578
817 Ga0496108_0270465 3300048911 Bacteria 1479
818 Ga0496108_0652845 3300048911 Bacteria 914
819 Ga0496108_1463315 3300048911 Bacteria 569
820 Ga0496108_1568393 3300048911 Bacteria 546
821 Ga0496109_0002689 3300048912 Bacteria 14909
822 Ga0496109_0011202 3300048912 Bacteria 7696
823 Ga0496109_0084789 3300048912 Bacteria 2923
824 Ga0496109_0121469 3300048912 Unclassified 2434
825 Ga0496109_0522717 3300048912 Bacteria 1120
826 Ga0496109_1167443 3300048912 Bacteria 707
827 Ga0496109_1768708 3300048912 Archaea 551
828 Ga0496109_1882614 3300048912 Bacteria 531
829 Ga0496110_0030503 3300048913 Bacteria 4648
830 Ga0496110_0033633 3300048913 Bacteria 4436
831 Ga0496110_0831379 3300048913 Bacteria 828
832 Ga0496110_1686591 3300048913 Unclassified 544
833 Ga0496110_1730585 3300048913 Unclassified 535
834 Ga0496111_0003152 3300048914 Bacteria 10149
835 Ga0496111_0067911 3300048914 Bacteria 2590
836 Ga0496111_0259350 3300048914 Bacteria 1290
837 Ga0496111_0506762 3300048914 Unclassified 888
838 Ga0496112_0148129 3300048915 Bacteria 2315
839 Ga0496112_0218787 3300048915 Bacteria 1861
840 Ga0496113_0239154 3300048916 Bacteria 1449
841 Ga0496114_0127020 3300048917 Bacteria 2199
842 Ga0496114_0146112 3300048917 Bacteria 2050
843 Ga0496114_0217280 3300048917 Unclassified 1678
844 Ga0496114_0325870 3300048917 Bacteria 1358
845 Ga0496114_0336944 3300048917 Bacteria 1333
846 Ga0496114_0381691 3300048917 Bacteria 1247
847 Ga0496114_0445050 3300048917 Bacteria 1147
848 Ga0496114_0489201 3300048917 Bacteria 1088
849 Ga0496114_0513982 3300048917 Bacteria 1059
850 Ga0496114_1112719 3300048917 Bacteria 675
851 Ga0501031_0001754 3300049568 Bacteria 13605
852 Ga0501031_0152337 3300049568 Bacteria 1511
853 Ga0501031_0214057 3300049568 Bacteria 1255
854 Ga0501031_0609937 3300049568 Bacteria 702
855 Ga0501031_0748699 3300049568 Bacteria 627
856 Ga0501032_0014533 3300049569 Bacteria 5574
857 Ga0501032_0015883 3300049569 Bacteria 5304
858 Ga0501032_0143422 3300049569 Bacteria 1572
859 Ga0501032_0175329 3300049569 Bacteria 1405
860 Ga0501032_0352308 3300049569 Bacteria 948
861 Ga0501032_0594350 3300049569 Bacteria 704
862 Ga0501033_0021291 3300049570 Bacteria 4891
863 Ga0501033_0123752 3300049570 Bacteria 1875
864 Ga0501033_0224595 3300049570 Bacteria 1336
865 Ga0501034_0121208 3300049571 Bacteria 2602
866 Ga0501034_0207367 3300049571 Bacteria 1916
867 Ga0501036_0022147 3300049572 Bacteria 5345
868 Ga0501036_0036855 3300049572 Bacteria 4137
869 Ga0501036_0046920 3300049572 Bacteria 3658
870 Ga0501036_0054874 3300049572 Bacteria 3376
871 Ga0501036_0103525 3300049572 Bacteria 2407
872 Ga0501036_0331860 3300049572 Bacteria 1270
873 Ga0501036_0338754 3300049572 Bacteria 1256
874 Ga0501036_1579255 3300049572 Unclassified 530
875 Ga0501037_0001734 3300049573 Bacteria 15838
876 Ga0501037_0012017 3300049573 Bacteria 6379
877 Ga0501037_0076460 3300049573 Bacteria 2430
878 Ga0501037_0225254 3300049573 Bacteria 1318
879 Ga0501037_0258555 3300049573 Bacteria 1217
880 Ga0501038_0010491 3300049574 Bacteria 8472
881 Ga0501038_0020457 3300049574 Bacteria 5948
882 Ga0501038_0021628 3300049574 Bacteria 5771
883 Ga0501038_0046809 3300049574 Bacteria 3749
884 Ga0501038_0371394 3300049574 Bacteria 1111
885 Ga0501038_0925532 3300049574 Bacteria 643
886 Ga0501038_0971800 3300049574 Bacteria 624
887 Ga0501038_1013005 3300049574 Unclassified 609
888 Ga0501038_1200320 3300049574 Unclassified 551
889 Ga0501039_0013914 3300049575 Bacteria 6155
890 Ga0501039_0055895 3300049575 Bacteria 3058
891 Ga0501039_0067408 3300049575 Bacteria 2779
892 Ga0501039_0068069 3300049575 Bacteria 2765
893 Ga0501039_0110088 3300049575 Bacteria 2153
894 Ga0501039_0135629 3300049575 Bacteria 1932
895 Ga0501039_0198444 3300049575 Bacteria 1578
896 Ga0501039_0290168 3300049575 Bacteria 1286
897 Ga0501039_0328024 3300049575 Bacteria 1203
898 Ga0501040_0019285 3300049576 Bacteria 4536
899 Ga0501040_0022250 3300049576 Bacteria 4241
900 Ga0501040_0041611 3300049576 Bacteria 3129
901 Ga0501040_0052374 3300049576 Bacteria 2793
902 Ga0501040_0062134 3300049576 Bacteria 2570
903 Ga0501040_0112106 3300049576 Unclassified 1908
904 Ga0501040_0112614 3300049576 Unclassified 1904
905 Ga0501040_0117512 3300049576 Bacteria 1864
906 Ga0501040_0252341 3300049576 Bacteria 1258
907 Ga0501040_0435522 3300049576 Bacteria 943
908 Ga0501041_0006203 3300049577 Bacteria 6988
909 Ga0501041_0007256 3300049577 Bacteria 6505
910 Ga0501041_0028618 3300049577 Bacteria 3361
911 Ga0501041_0079270 3300049577 Bacteria 2021
912 Ga0501041_0392273 3300049577 Unclassified 879
913 Ga0501041_0501330 3300049577 Bacteria 772
914 Ga0501041_0597561 3300049577 Bacteria 704
915 Ga0501042_0006488 3300049578 Bacteria 7597
916 Ga0501042_0016796 3300049578 Bacteria 5033
917 Ga0501042_0058535 3300049578 Bacteria 2751
918 Ga0501042_0113882 3300049578 Bacteria 1947
919 Ga0501042_0242329 3300049578 Bacteria 1301
920 Ga0501042_0475668 3300049578 Bacteria 906
921 Ga0501042_1377111 3300049578 Unclassified 514
922 Ga0501043_0057097 3300049579 Bacteria 3065
923 Ga0501043_0081566 3300049579 Unclassified 2542
924 Ga0501043_0098803 3300049579 Bacteria 2294
925 Ga0501043_0329677 3300049579 Bacteria 1162
926 Ga0501043_0363906 3300049579 Bacteria 1097
927 Ga0501046_0003198 3300049580 Bacteria 15071
928 Ga0501046_0048035 3300049580 Bacteria 3381
929 Ga0501046_0063500 3300049580 Bacteria 2883
930 Ga0501046_0103819 3300049580 Bacteria 2178
931 Ga0501046_0138552 3300049580 Bacteria 1842
932 Ga0501046_0287854 3300049580 Unclassified 1202
933 Ga0501046_0769721 3300049580 Unclassified 676
934 Ga0501047_0513915 3300049581 Bacteria 1024
935 Ga0501048_0005712 3300049582 Bacteria 9456
936 Ga0501048_0016260 3300049582 Bacteria 5484
937 Ga0501048_0049671 3300049582 Bacteria 2989
938 Ga0501048_0057482 3300049582 Bacteria 2759
939 Ga0501048_0083215 3300049582 Bacteria 2257
940 Ga0501048_0092389 3300049582 Bacteria 2134
941 Ga0501048_0190743 3300049582 Bacteria 1452
942 Ga0501048_0455541 3300049582 Bacteria 916
943 Ga0501067_0029785 3300049583 Bacteria 3026
944 Ga0501067_0416262 3300049583 Unclassified 750
945 Ga0501067_0533503 3300049583 Bacteria 657
946 Ga0501068_0011157 3300049584 Bacteria 5063
947 Ga0501068_0011596 3300049584 Bacteria 4978
948 Ga0501068_0147984 3300049584 Bacteria 1475
949 Ga0501068_0186174 3300049584 Bacteria 1314
950 Ga0501068_0194918 3300049584 Bacteria 1284
951 Ga0501068_0245792 3300049584 Bacteria 1139
952 Ga0501068_0330909 3300049584 Bacteria 977
953 Ga0501069_0000404 3300049585 Bacteria 19543
954 Ga0501069_0005994 3300049585 Bacteria 6340
955 Ga0501069_0023246 3300049585 Bacteria 3378
956 Ga0501069_0071781 3300049585 Bacteria 1941
957 Ga0501069_0084634 3300049585 Bacteria 1789
958 Ga0501069_0104261 3300049585 Unclassified 1611
959 Ga0501069_0121787 3300049585 Bacteria 1490
960 Ga0501069_0451383 3300049585 Bacteria 764
961 Ga0501069_0956969 3300049585 Bacteria 522
962 Ga0501070_0038832 3300049586 Bacteria 3972
963 Ga0501070_0120293 3300049586 Bacteria 2170
964 Ga0501070_0142276 3300049586 Bacteria 1980
965 Ga0501070_0330457 3300049586 Bacteria 1239
966 Ga0501070_0980483 3300049586 Bacteria 656
967 Ga0501070_1474431 3300049586 Bacteria 515
968 Ga0501071_0007629 3300049587 Bacteria 7128
969 Ga0501071_0017219 3300049587 Bacteria 4981
970 Ga0501071_0023334 3300049587 Bacteria 4320
971 Ga0501071_0035205 3300049587 Bacteria 3566
972 Ga0501071_0054966 3300049587 Bacteria 2873
973 Ga0501071_0070959 3300049587 Bacteria 2539
974 Ga0501071_0128945 3300049587 Bacteria 1878
975 Ga0501071_0511580 3300049587 Bacteria 921
976 Ga0501071_1391546 3300049587 Bacteria 542
977 Ga0501072_0024283 3300049588 Bacteria 4714
978 Ga0501072_0031317 3300049588 Bacteria 4162
979 Ga0501072_0047202 3300049588 Bacteria 3391
980 Ga0501072_0141758 3300049588 Bacteria 1916
981 Ga0501072_0273398 3300049588 Bacteria 1344
982 Ga0501072_0589395 3300049588 Bacteria 877
983 Ga0501072_1221232 3300049588 Bacteria 584
984 Ga0501073_0027444 3300049589 Bacteria 4071
985 Ga0501073_0036973 3300049589 Bacteria 3468
986 Ga0501073_0045539 3300049589 Bacteria 3089
987 Ga0501074_0010424 3300049590 Bacteria 6744
988 Ga0501074_0035462 3300049590 Bacteria 3614
989 Ga0501074_0046674 3300049590 Bacteria 3132
990 Ga0501074_0075607 3300049590 Bacteria 2417
991 Ga0501074_0083713 3300049590 Bacteria 2287
992 Ga0501074_0191407 3300049590 Unclassified 1458
993 Ga0501074_0903316 3300049590 Bacteria 622
994 Ga0501074_0912687 3300049590 Unclassified 618
995 Ga0501075_0079617 3300049591 Bacteria 2479
996 Ga0501075_0086681 3300049591 Bacteria 2372
997 Ga0501075_0111997 3300049591 Bacteria 2075
998 Ga0501075_0213807 3300049591 Bacteria 1470
999 Ga0501075_0224889 3300049591 Bacteria 1431
1000 Ga0501075_0246283 3300049591 Bacteria 1362
1001 Ga0501075_0267587 3300049591 Bacteria 1302
1002 Ga0501075_0997239 3300049591 Bacteria 636
1003 Ga0501076_0001971 3300049592 Bacteria 14012
1004 Ga0501076_0030067 3300049592 Bacteria 4229
1005 Ga0501076_0040451 3300049592 Bacteria 3664
1006 Ga0501076_0062557 3300049592 Bacteria 2964
1007 Ga0501076_0071760 3300049592 Bacteria 2770
1008 Ga0501076_0077841 3300049592 Bacteria 2660
1009 Ga0501076_0129944 3300049592 Bacteria 2043
1010 Ga0501076_0134821 3300049592 Bacteria 2004
1011 Ga0501076_0154388 3300049592 Bacteria 1868
1012 Ga0501076_0160284 3300049592 Bacteria 1832
1013 Ga0501076_0357025 3300049592 Bacteria 1200
1014 Ga0501076_0720248 3300049592 Archaea 823
1015 Ga0501077_0011287 3300049593 Bacteria 5577
1016 Ga0501077_0023420 3300049593 Bacteria 3915
1017 Ga0501077_0061071 3300049593 Bacteria 2391
1018 Ga0501077_0100358 3300049593 Bacteria 1834
1019 Ga0501077_0109828 3300049593 Bacteria 1747
1020 Ga0501077_0221591 3300049593 Bacteria 1202
1021 Ga0501077_0361937 3300049593 Bacteria 926
1022 Ga0501077_0571907 3300049593 Bacteria 725
1023 Ga0501077_0939064 3300049593 Bacteria 556
1024 Ga0501079_0012614 3300049741 Bacteria 6453
1025 Ga0501079_0027218 3300049741 Bacteria 4383
1026 Ga0501079_0037136 3300049741 Bacteria 3753
1027 Ga0501079_0092603 3300049741 Unclassified 2341
1028 Ga0501079_0149866 3300049741 Bacteria 1818
1029 Ga0501079_0329425 3300049741 Bacteria 1196
1030 Ga0501079_0537722 3300049741 Bacteria 919
1031 Ga0501079_0579047 3300049741 Bacteria 883
1032 Ga0501079_1326048 3300049741 Bacteria 566
1033 Ga0501080_0009195 3300049742 Bacteria 9002
1034 Ga0501080_0010484 3300049742 Bacteria 8487
1035 Ga0501080_0054290 3300049742 Bacteria 3730
1036 Ga0501080_0079553 3300049742 Bacteria 3047
1037 Ga0501080_0097690 3300049742 Bacteria 2727
1038 Ga0501080_0195377 3300049742 Bacteria 1859
1039 Ga0501080_0279880 3300049742 Bacteria 1517
1040 Ga0501080_0287468 3300049742 Bacteria 1494
1041 Ga0501080_0357664 3300049742 Bacteria 1317
1042 Ga0501080_0505965 3300049742 Bacteria 1079
1043 Ga0501080_1230120 3300049742 Bacteria 643
1044 Ga0501081_0007559 3300049743 Bacteria 7047
1045 Ga0501081_0026901 3300049743 Bacteria 3881
1046 Ga0501081_0122242 3300049743 Bacteria 1855
1047 Ga0501081_0133582 3300049743 Bacteria 1774
1048 Ga0501081_0143009 3300049743 Bacteria 1715
1049 Ga0501081_0252163 3300049743 Bacteria 1288
1050 Ga0501081_0458080 3300049743 Bacteria 948
1051 Ga0501083_0006299 3300049744 Bacteria 8416
1052 Ga0501083_0009341 3300049744 Bacteria 6921
1053 Ga0501083_0029146 3300049744 Bacteria 3799
1054 Ga0501083_0311954 3300049744 Unclassified 1023
1055 Ga0501083_0394585 3300049744 Bacteria 900
1056 Ga0501083_0815682 3300049744 Bacteria 607
1057 Ga0501035_0026164 3300049822 Bacteria 5342
1058 Ga0501035_0034600 3300049822 Bacteria 4589
1059 Ga0501035_0110735 3300049822 Bacteria 2406
1060 Ga0501035_0111907 3300049822 Bacteria 2392
1061 Ga0501035_0508606 3300049822 Bacteria 991
1062 Ga0501035_0603218 3300049822 Bacteria 894
1063 Ga0501035_1191426 3300049822 Unclassified 591
1064 Ga0501044_0146738 3300049823 Bacteria 2344
1065 Ga0501044_0607539 3300049823 Bacteria 986
1066 Ga0501044_0773261 3300049823 Bacteria 841
1067 Ga0501045_0016648 3300049824 Bacteria 5223
1068 Ga0501045_0026675 3300049824 Bacteria 4157
1069 Ga0501045_0028937 3300049824 Bacteria 3999
1070 Ga0501045_0045530 3300049824 Bacteria 3194
1071 Ga0501045_0065278 3300049824 Bacteria 2672
1072 Ga0501045_0084664 3300049824 Bacteria 2339
1073 Ga0501045_0359545 3300049824 Archaea 1083
1074 Ga0501045_0529024 3300049824 Bacteria 875
1075 Ga0501045_1084983 3300049824 Bacteria 586
1076 nmdc:mga03n38_33083_c1 3300050490 Bacteria 2196
1077 nmdc:mga00v17_149210_c1 3300050491 Bacteria 1502
1078 nmdc:mga0yw44_686432_c1 3300050492 Unclassified 696
1079 nmdc:mga0yw44_95997_c1 3300050492 Bacteria 1881
1080 nmdc:mga04h51_141322_c1 3300050495 Bacteria 913
1081 nmdc:mga05p37_2048777_c1 3300050507 Unclassified 539
1082 nmdc:mga05p37_22081_c1 3300050507 Bacteria 7713
1083 nmdc:mga05p37_23743_c1 3300050507 Bacteria 7446
1084 nmdc:mga05p37_247142_c1 3300050507 Bacteria 2141
1085 nmdc:mga09592_1365894_c1 3300050508 Bacteria 580
1086 nmdc:mga09592_28987_c1 3300050508 Bacteria 4603
1087 nmdc:mga0qj67_99131_c1 3300050509 Bacteria 2347
1088 nmdc:mga06r32_1344820_c1 3300050510 Unclassified 657
1089 nmdc:mga06r32_840086_c1 3300050510 Bacteria 877
1090 nmdc:mga08y16_1169611_c1 3300050511 Bacteria 741
1091 nmdc:mga08y16_128631_c1 3300050511 Bacteria 2634
1092 nmdc:mga08y16_33557_c1 3300050511 Bacteria 5390
1093 nmdc:mga08y16_74927_c1 3300050511 Bacteria 3528
1094 nmdc:mga0n895_1074783_c1 3300050512 Unclassified 783
1095 nmdc:mga0n895_528034_c1 3300050512 Bacteria 1187
1096 nmdc:mga0n895_828617_c1 3300050512 Bacteria 914
1097 nmdc:mga0a205_368361_c1 3300050515 Bacteria 1303
1098 nmdc:mga0a205_788872_c1 3300050515 Bacteria 798
1099 nmdc:mga0a205_90715_c1 3300050515 Bacteria 2953
1100 Ga0495655_0230433 3300053083 Unclassified 616
1101 Ga0495595_0008836 3300053084 Bacteria 4149
1102 Ga0495595_0091108 3300053084 Bacteria 1463
1103 Ga0495595_0667404 3300053084 Bacteria 532
1104 Ga0495619_0264311 3300053085 Bacteria 1192
1105 Ga0501084_0025140 3300054114 Bacteria 4968
1106 Ga0501084_0026068 3300054114 Bacteria 4877
1107 Ga0501084_0045376 3300054114 Bacteria 3679
1108 Ga0501084_0045652 3300054114 Bacteria 3668
1109 Ga0501084_0106836 3300054114 Bacteria 2352
1110 Ga0501084_0291123 3300054114 Bacteria 1379
1111 Ga0501084_0402064 3300054114 Bacteria 1157
1112 Ga0501084_0442549 3300054114 Bacteria 1099
1113 Ga0501084_0653507 3300054114 Bacteria 888
1114 Ga0501084_0967622 3300054114 Bacteria 715
1115 Ga0501084_1209451 3300054114 Bacteria 634
1116 Ga0587069_088426 3300059642 Bacteria 615
1117 Ga0501082_0053681 3300060353 Bacteria 3473
1118 Ga0501082_0062549 3300060353 Bacteria 3204
1119 Ga0501082_0096947 3300060353 Bacteria 2549
1120 Ga0501082_0102354 3300060353 Bacteria 2478
1121 Ga0501082_0107066 3300060353 Bacteria 2418
1122 Ga0501082_0252782 3300060353 Bacteria 1533
1123 Ga0501082_0329875 3300060353 Bacteria 1329
1124 Ga0501082_0394861 3300060353 Bacteria 1207
1125 Ga0501082_0490962 3300060353 Bacteria 1073
1126 Ga0501082_0495401 3300060353 Bacteria 1068
1127 Ga0501082_1113355 3300060353 Bacteria 690
1128 Ga0530510_0020887 3300061734 Bacteria 4656
1129 Ga0530510_0063666 3300061734 Bacteria 2670
1130 Ga0530510_0080521 3300061734 Bacteria 2370
1131 Ga0530510_0084447 3300061734 Bacteria 2312
1132 Ga0530510_0095107 3300061734 Bacteria 2176
1133 Ga0530510_0096247 3300061734 Bacteria 2164
1134 Ga0530510_0097928 3300061734 Bacteria 2145
1135 Ga0530510_0303982 3300061734 Bacteria 1194
1136 Ga0530510_0341880 3300061734 Bacteria 1123
1137 Ga0530510_0362127 3300061734 Unclassified 1090
1138 Ga0530510_0426363 3300061734 Bacteria 1001
1139 Ga0530510_0530570 3300061734 Bacteria 893
1140 Ga0530510_1216469 3300061734 Bacteria 577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10657490 Ga0105243_106574902 64
2 3300046492 Ga0495585_0244741 Ga0495585_0244741_679_879 64
3 3300047318 Ga0495636_0087635 Ga0495636_0087635_73_273 64
4 3300005445 Ga0070708_101340347 Ga0070708_1013403472 65
5 3300037466 Ga0395898_1628378 Ga0395898_1628378_329_529 65
6 3300037466 Ga0395898_1693641 Ga0395898_1693641_274_477 65
7 3300041443 Ga0451789_0067247 Ga0451789_0067247_333_533 65
8 3300046615 Ga0495656_0712993 Ga0495656_0712993_282_485 65
9 3300005445 Ga0070708_100425083 Ga0070708_1004250832 66
10 3300005468 Ga0070707_100212372 Ga0070707_1002123724 66
11 3300025922 Ga0207646_10270563 Ga0207646_102705632 66
12 3300049573 Ga0501037_0225254 Ga0501037_0225254_397_603 67
13 3300005937 Ga0081455_10012612 Ga0081455_100126122 72
14 3300009147 Ga0114129_11260965 Ga0114129_112609652 72
15 3300049568 Ga0501031_0214057 Ga0501031_0214057_112_336 72
16 3300049569 Ga0501032_0352308 Ga0501032_0352308_460_684 72
17 3300049570 Ga0501033_0224595 Ga0501033_0224595_394_618 72
18 3300049572 Ga0501036_0054874 Ga0501036_0054874_1098_1322 72
19 3300049574 Ga0501038_0971800 Ga0501038_0971800_382_606 72
20 3300049575 Ga0501039_0068069 Ga0501039_0068069_305_529 72
21 3300049576 Ga0501040_0022250 Ga0501040_0022250_2374_2598 72
22 3300049577 Ga0501041_0028618 Ga0501041_0028618_1016_1240 72
23 3300049578 Ga0501042_0475668 Ga0501042_0475668_427_651 72
24 3300049580 Ga0501046_0048035 Ga0501046_0048035_709_933 72
25 3300049582 Ga0501048_0092389 Ga0501048_0092389_1277_1501 72
26 3300049585 Ga0501069_0451383 Ga0501069_0451383_104_328 72
27 3300049587 Ga0501071_0035205 Ga0501071_0035205_1049_1273 72
28 3300049590 Ga0501074_0046674 Ga0501074_0046674_2375_2599 72
29 3300049591 Ga0501075_0086681 Ga0501075_0086681_1589_1813 72
30 3300049592 Ga0501076_0160284 Ga0501076_0160284_1436_1660 72
31 3300049593 Ga0501077_0939064 Ga0501077_0939064_130_354 72
32 3300049741 Ga0501079_0149866 Ga0501079_0149866_189_413 72
33 3300049742 Ga0501080_0287468 Ga0501080_0287468_928_1152 72
34 3300049824 Ga0501045_0084664 Ga0501045_0084664_265_489 72
35 3300054114 Ga0501084_0291123 Ga0501084_0291123_61_285 72
36 3300060353 Ga0501082_0329875 Ga0501082_0329875_34_258 72
37 3300061734 Ga0530510_0095107 Ga0530510_0095107_1571_1795 72
38 3300038443 Ga0395901_1426352 Ga0395901_1426352_123_356 73
39 3300059642 Ga0587069_088426 Ga0587069_088426_352_582 73
40 3300049569 Ga0501032_0015883 Ga0501032_0015883_4839_5063 74
41 3300049572 Ga0501036_0046920 Ga0501036_0046920_114_338 74
42 3300049573 Ga0501037_0076460 Ga0501037_0076460_2106_2330 74
43 3300049574 Ga0501038_0021628 Ga0501038_0021628_5436_5660 74
44 3300049576 Ga0501040_0041611 Ga0501040_0041611_2773_2997 74
45 3300049577 Ga0501041_0006203 Ga0501041_0006203_102_326 74
46 3300049578 Ga0501042_0113882 Ga0501042_0113882_203_427 74
47 3300049579 Ga0501043_0329677 Ga0501043_0329677_817_1041 74
48 3300049580 Ga0501046_0103819 Ga0501046_0103819_1832_2056 74
49 3300049582 Ga0501048_0005712 Ga0501048_0005712_2072_2296 74
50 3300049585 Ga0501069_0005994 Ga0501069_0005994_5595_5819 74
51 3300049586 Ga0501070_0038832 Ga0501070_0038832_2932_3156 74
52 3300049590 Ga0501074_0010424 Ga0501074_0010424_4449_4673 74
53 3300049591 Ga0501075_0267587 Ga0501075_0267587_316_540 74
54 3300049592 Ga0501076_0062557 Ga0501076_0062557_95_319 74
55 3300049592 Ga0501076_0720248 Ga0501076_0720248_523_747 74
56 3300049593 Ga0501077_0011287 Ga0501077_0011287_4420_4644 74
57 3300049741 Ga0501079_0092603 Ga0501079_0092603_2040_2264 74
58 3300049742 Ga0501080_0079553 Ga0501080_0079553_178_402 74
59 3300049743 Ga0501081_0252163 Ga0501081_0252163_123_347 74
60 3300049744 Ga0501083_0029146 Ga0501083_0029146_3453_3677 74
61 3300049822 Ga0501035_0034600 Ga0501035_0034600_318_542 74
62 3300049824 Ga0501045_0065278 Ga0501045_0065278_1121_1345 74
63 3300060353 Ga0501082_0107066 Ga0501082_0107066_2072_2296 74
64 3300061734 Ga0530510_0020887 Ga0530510_0020887_195_419 74
65 3300005468 Ga0070707_100599964 Ga0070707_1005999642 75
66 3300009176 Ga0105242_12214428 Ga0105242_122144282 75
67 3300013297 Ga0157378_10790326 Ga0157378_107903262 75
68 3300025940 Ga0207691_11020508 Ga0207691_110205082 75
69 3300025972 Ga0207668_10718474 Ga0207668_107184742 75
70 3300025981 Ga0207640_11459965 Ga0207640_114599651 75
71 3300038443 Ga0395901_0757946 Ga0395901_0757946_82_324 75
72 3300042993 Ga0439440_0232638 Ga0439440_0232638_95_334 75
73 3300049568 Ga0501031_0001754 Ga0501031_0001754_1239_1478 75
74 3300049568 Ga0501031_0609937 Ga0501031_0609937_93_326 75
75 3300049569 Ga0501032_0014533 Ga0501032_0014533_4093_4332 75
76 3300049570 Ga0501033_0123752 Ga0501033_0123752_1237_1476 75
77 3300049571 Ga0501034_0207367 Ga0501034_0207367_514_753 75
78 3300049572 Ga0501036_0103525 Ga0501036_0103525_1357_1590 75
79 3300049572 Ga0501036_0331860 Ga0501036_0331860_981_1220 75
80 3300049573 Ga0501037_0001734 Ga0501037_0001734_14398_14637 75
81 3300049574 Ga0501038_0020457 Ga0501038_0020457_4480_4719 75
82 3300049574 Ga0501038_0371394 Ga0501038_0371394_99_332 75
83 3300049574 Ga0501038_0925532 Ga0501038_0925532_190_420 75
84 3300049575 Ga0501039_0055895 Ga0501039_0055895_1578_1817 75
85 3300049575 Ga0501039_0110088 Ga0501039_0110088_1855_2088 75
86 3300049575 Ga0501039_0328024 Ga0501039_0328024_346_576 75
87 3300049576 Ga0501040_0052374 Ga0501040_0052374_1578_1817 75
88 3300049576 Ga0501040_0435522 Ga0501040_0435522_598_828 75
89 3300049577 Ga0501041_0079270 Ga0501041_0079270_845_1084 75
90 3300049577 Ga0501041_0392273 Ga0501041_0392273_47_274 75
91 3300049578 Ga0501042_0016796 Ga0501042_0016796_3341_3574 75
92 3300049578 Ga0501042_0058535 Ga0501042_0058535_1263_1502 75
93 3300049578 Ga0501042_1377111 Ga0501042_1377111_218_445 75
94 3300049579 Ga0501043_0057097 Ga0501043_0057097_1577_1816 75
95 3300049580 Ga0501046_0063500 Ga0501046_0063500_1231_1470 75
96 3300049580 Ga0501046_0769721 Ga0501046_0769721_58_291 75
97 3300049581 Ga0501047_0513915 Ga0501047_0513915_305_544 75
98 3300049582 Ga0501048_0016260 Ga0501048_0016260_1227_1466 75
99 3300049582 Ga0501048_0057482 Ga0501048_0057482_1902_2135 75
100 3300049582 Ga0501048_0083215 Ga0501048_0083215_1182_1412 75
101 3300049584 Ga0501068_0245792 Ga0501068_0245792_49_288 75
102 3300049585 Ga0501069_0000404 Ga0501069_0000404_18063_18302 75
103 3300049586 Ga0501070_0142276 Ga0501070_0142276_553_792 75
104 3300049587 Ga0501071_0007629 Ga0501071_0007629_6176_6409 75
105 3300049587 Ga0501071_0054966 Ga0501071_0054966_179_418 75
106 3300049587 Ga0501071_0511580 Ga0501071_0511580_91_321 75
107 3300049588 Ga0501072_0141758 Ga0501072_0141758_21_260 75
108 3300049588 Ga0501072_0273398 Ga0501072_0273398_1051_1281 75
109 3300049588 Ga0501072_1221232 Ga0501072_1221232_182_415 75
110 3300049589 Ga0501073_0045539 Ga0501073_0045539_1573_1812 75
111 3300049590 Ga0501074_0075607 Ga0501074_0075607_938_1177 75
112 3300049591 Ga0501075_0111997 Ga0501075_0111997_1394_1621 75
113 3300049591 Ga0501075_0213807 Ga0501075_0213807_387_626 75
114 3300049591 Ga0501075_0997239 Ga0501075_0997239_390_623 75
115 3300049592 Ga0501076_0001971 Ga0501076_0001971_1566_1799 75
116 3300049592 Ga0501076_0077841 Ga0501076_0077841_1577_1816 75
117 3300049592 Ga0501076_0129944 Ga0501076_0129944_333_560 75
118 3300049592 Ga0501076_0154388 Ga0501076_0154388_1447_1677 75
119 3300049593 Ga0501077_0061071 Ga0501077_0061071_852_1091 75
120 3300049593 Ga0501077_0221591 Ga0501077_0221591_880_1113 75
121 3300049741 Ga0501079_0329425 Ga0501079_0329425_712_939 75
122 3300049741 Ga0501079_1326048 Ga0501079_1326048_149_388 75
123 3300049742 Ga0501080_0054290 Ga0501080_0054290_1270_1509 75
124 3300049742 Ga0501080_0505965 Ga0501080_0505965_83_316 75
125 3300049742 Ga0501080_1230120 Ga0501080_1230120_199_429 75
126 3300049743 Ga0501081_0133582 Ga0501081_0133582_1248_1487 75
127 3300049743 Ga0501081_0143009 Ga0501081_0143009_527_757 75
128 3300049743 Ga0501081_0458080 Ga0501081_0458080_95_328 75
129 3300049744 Ga0501083_0006299 Ga0501083_0006299_6934_7173 75
130 3300049744 Ga0501083_0815682 Ga0501083_0815682_322_555 75
131 3300049822 Ga0501035_0110735 Ga0501035_0110735_1230_1469 75
132 3300049822 Ga0501035_0508606 Ga0501035_0508606_122_355 75
133 3300049823 Ga0501044_0607539 Ga0501044_0607539_114_353 75
134 3300049824 Ga0501045_0026675 Ga0501045_0026675_2861_3094 75
135 3300049824 Ga0501045_1084983 Ga0501045_1084983_177_407 75
136 3300054114 Ga0501084_0026068 Ga0501084_0026068_3879_4106 75
137 3300054114 Ga0501084_0045652 Ga0501084_0045652_1108_1341 75
138 3300054114 Ga0501084_0967622 Ga0501084_0967622_426_665 75
139 3300054114 Ga0501084_1209451 Ga0501084_1209451_204_431 75
140 3300060353 Ga0501082_0252782 Ga0501082_0252782_1274_1513 75
141 3300060353 Ga0501082_0394861 Ga0501082_0394861_786_1013 75
142 3300060353 Ga0501082_1113355 Ga0501082_1113355_372_602 75
143 3300061734 Ga0530510_0096247 Ga0530510_0096247_342_575 75
144 3300061734 Ga0530510_0362127 Ga0530510_0362127_325_552 75
145 3300061734 Ga0530510_1216469 Ga0530510_1216469_288_527 75
146 3300003203 JGI25406J46586_10134316 JGI25406J46586_101343162 76
147 3300005467 Ga0070706_100116655 Ga0070706_1001166554 76
148 3300005467 Ga0070706_101122012 Ga0070706_1011220121 76
149 3300005467 Ga0070706_101633067 Ga0070706_1016330672 76
150 3300005468 Ga0070707_100300165 Ga0070707_1003001653 76
151 3300005468 Ga0070707_100538427 Ga0070707_1005384273 76
152 3300005471 Ga0070698_100422962 Ga0070698_1004229622 76
153 3300005471 Ga0070698_100875197 Ga0070698_1008751972 76
154 3300005546 Ga0070696_100507729 Ga0070696_1005077291 76
155 3300005549 Ga0070704_100893734 Ga0070704_1008937342 76
156 3300005985 Ga0081539_10000913 Ga0081539_1000091348 76
157 3300006844 Ga0075428_101504935 Ga0075428_1015049351 76
158 3300006846 Ga0075430_100069637 Ga0075430_1000696372 76
159 3300006871 Ga0075434_100619594 Ga0075434_1006195942 76
160 3300007076 Ga0075435_100281477 Ga0075435_1002814771 76
161 3300009147 Ga0114129_10054711 Ga0114129_100547117 76
162 3300009147 Ga0114129_11773738 Ga0114129_117737381 76
163 3300014745 Ga0157377_10843662 Ga0157377_108436622 76
164 3300025910 Ga0207684_10152321 Ga0207684_101523213 76
165 3300025910 Ga0207684_10904603 Ga0207684_109046032 76
166 3300025922 Ga0207646_10188524 Ga0207646_101885243 76
167 3300025922 Ga0207646_11830118 Ga0207646_118301181 76
168 3300025944 Ga0207661_11334018 Ga0207661_113340182 76
169 3300032002 Ga0307416_100149706 Ga0307416_1001497062 76
170 3300032126 Ga0307415_100459462 Ga0307415_1004594622 76
171 3300036401 Ga0373937_1789897 Ga0373937_1789897_241_486 76
172 3300037418 Ga0395900_0056240 Ga0395900_0056240_891_1133 76
173 3300037418 Ga0395900_0088732 Ga0395900_0088732_2560_2802 76
174 3300037418 Ga0395900_0193927 Ga0395900_0193927_1697_1942 76
175 3300037418 Ga0395900_0671501 Ga0395900_0671501_709_957 76
176 3300037466 Ga0395898_0063334 Ga0395898_0063334_939_1184 76
177 3300037466 Ga0395898_0117909 Ga0395898_0117909_602_844 76
178 3300037471 Ga0395905_0027035 Ga0395905_0027035_2453_2695 76
179 3300037471 Ga0395905_0062102 Ga0395905_0062102_1163_1408 76
180 3300037471 Ga0395905_0105649 Ga0395905_0105649_209_451 76
181 3300038443 Ga0395901_0021597 Ga0395901_0021597_1590_1838 76
182 3300038443 Ga0395901_0030277 Ga0395901_0030277_2772_3014 76
183 3300038443 Ga0395901_0067669 Ga0395901_0067669_3135_3377 76
184 3300038443 Ga0395901_0083956 Ga0395901_0083956_230_475 76
185 3300041494 Ga0451837_1813209 Ga0451837_1813209_112_342 76
186 3300042146 Ga0450907_059315 Ga0450907_059315_211_450 76
187 3300042184 Ga0450908_025444 Ga0450908_025444_527_766 76
188 3300042531 Ga0450918_013958 Ga0450918_013958_1013_1252 76
189 3300045976 Ga0466967_0350002 Ga0466967_0350002_1129_1371 76
190 3300046491 Ga0495584_0613625 Ga0495584_0613625_216_446 76
191 3300046514 Ga0495618_0646578 Ga0495618_0646578_29_271 76
192 3300046516 Ga0495628_0777536 Ga0495628_0777536_38_283 76
193 3300046559 Ga0495667_0957206 Ga0495667_0957206_96_338 76
194 3300046642 Ga0495634_0820110 Ga0495634_0820110_151_393 76
195 3300046664 Ga0495659_0102784 Ga0495659_0102784_257_487 76
196 3300046691 Ga0495670_0410725 Ga0495670_0410725_52_282 76
197 3300047317 Ga0495604_0589546 Ga0495604_0589546_18_260 76
198 3300048903 Ga0496100_0849718 Ga0496100_0849718_341_571 76
199 3300048917 Ga0496114_1112719 Ga0496114_1112719_254_484 76
200 3300050507 nmdc:mga05p37_23743_c1 nmdc:mga05p37_23743_c1_2109_2351 76
201 3300050509 nmdc:mga0qj67_99131_c1 nmdc:mga0qj67_99131_c1_512_751 76
202 3300050510 nmdc:mga06r32_840086_c1 nmdc:mga06r32_840086_c1_623_865 76
203 3300050512 nmdc:mga0n895_528034_c1 nmdc:mga0n895_528034_c1_313_555 76
204 3300053084 Ga0495595_0091108 Ga0495595_0091108_282_527 76
205 3300053084 Ga0495595_0667404 Ga0495595_0667404_90_332 76
206 3300005329 Ga0070683_100747945 Ga0070683_1007479451 77
207 3300005331 Ga0070670_100961684 Ga0070670_1009616842 77
208 3300005334 Ga0068869_101874253 Ga0068869_1018742532 77
209 3300005337 Ga0070682_100630593 Ga0070682_1006305931 77
210 3300005337 Ga0070682_101825362 Ga0070682_1018253621 77
211 3300005338 Ga0068868_100529186 Ga0068868_1005291861 77
212 3300005338 Ga0068868_100796543 Ga0068868_1007965432 77
213 3300005340 Ga0070689_101462785 Ga0070689_1014627851 77
214 3300005344 Ga0070661_101766879 Ga0070661_1017668792 77
215 3300005356 Ga0070674_100694487 Ga0070674_1006944872 77
216 3300005356 Ga0070674_101042143 Ga0070674_1010421432 77
217 3300005455 Ga0070663_101436932 Ga0070663_1014369321 77
218 3300005456 Ga0070678_100362420 Ga0070678_1003624202 77
219 3300005456 Ga0070678_102185928 Ga0070678_1021859282 77
220 3300005459 Ga0068867_100505065 Ga0068867_1005050652 77
221 3300005459 Ga0068867_100552932 Ga0068867_1005529322 77
222 3300005535 Ga0070684_100415153 Ga0070684_1004151533 77
223 3300005543 Ga0070672_100872964 Ga0070672_1008729642 77
224 3300005544 Ga0070686_101093220 Ga0070686_1010932202 77
225 3300005548 Ga0070665_100390657 Ga0070665_1003906572 77
226 3300005548 Ga0070665_100447059 Ga0070665_1004470593 77
227 3300005548 Ga0070665_100982496 Ga0070665_1009824962 77
228 3300005564 Ga0070664_101507668 Ga0070664_1015076682 77
229 3300005616 Ga0068852_100653281 Ga0068852_1006532813 77
230 3300005618 Ga0068864_101632593 Ga0068864_1016325932 77
231 3300005718 Ga0068866_10496758 Ga0068866_104967582 77
232 3300005719 Ga0068861_102317783 Ga0068861_1023177831 77
233 3300005937 Ga0081455_10026862 Ga0081455_100268624 77
234 3300005985 Ga0081539_10274747 Ga0081539_102747471 77
235 3300006237 Ga0097621_100700064 Ga0097621_1007000642 77
236 3300006358 Ga0068871_100530762 Ga0068871_1005307622 77
237 3300006358 Ga0068871_100914323 Ga0068871_1009143232 77
238 3300006846 Ga0075430_100250350 Ga0075430_1002503504 77
239 3300006852 Ga0075433_10868588 Ga0075433_108685883 77
240 3300006881 Ga0068865_100251534 Ga0068865_1002515343 77
241 3300007076 Ga0075435_100411961 Ga0075435_1004119611 77
242 3300009098 Ga0105245_10438691 Ga0105245_104386913 77
243 3300009098 Ga0105245_10587517 Ga0105245_105875172 77
244 3300009148 Ga0105243_10341823 Ga0105243_103418232 77
245 3300009148 Ga0105243_10881191 Ga0105243_108811912 77
246 3300009176 Ga0105242_10302863 Ga0105242_103028633 77
247 3300009176 Ga0105242_10360402 Ga0105242_103604022 77
248 3300009177 Ga0105248_12646319 Ga0105248_126463192 77
249 3300009177 Ga0105248_12926449 Ga0105248_129264492 77
250 3300009553 Ga0105249_10791601 Ga0105249_107916012 77
251 3300011119 Ga0105246_10486262 Ga0105246_104862622 77
252 3300011119 Ga0105246_10916465 Ga0105246_109164652 77
253 3300012500 Ga0157314_1036908 Ga0157314_10369081 77
254 3300013296 Ga0157374_10141270 Ga0157374_101412703 77
255 3300013296 Ga0157374_12846246 Ga0157374_128462462 77
256 3300013297 Ga0157378_11270294 Ga0157378_112702942 77
257 3300013306 Ga0163162_10484589 Ga0163162_104845891 77
258 3300013308 Ga0157375_10651885 Ga0157375_106518853 77
259 3300013308 Ga0157375_10974996 Ga0157375_109749962 77
260 3300014325 Ga0163163_11526590 Ga0163163_115265902 77
261 3300014325 Ga0163163_12694173 Ga0163163_126941732 77
262 3300014745 Ga0157377_11284666 Ga0157377_112846662 77
263 3300014968 Ga0157379_12098590 Ga0157379_120985902 77
264 3300014969 Ga0157376_10131046 Ga0157376_101310464 77
265 3300025909 Ga0207705_11230661 Ga0207705_112306611 77
266 3300025919 Ga0207657_10999542 Ga0207657_109995422 77
267 3300025920 Ga0207649_11365178 Ga0207649_113651782 77
268 3300025926 Ga0207659_10193288 Ga0207659_101932882 77
269 3300025927 Ga0207687_10190967 Ga0207687_101909674 77
270 3300025931 Ga0207644_10960397 Ga0207644_109603972 77
271 3300025931 Ga0207644_11097051 Ga0207644_110970512 77
272 3300025934 Ga0207686_10282224 Ga0207686_102822244 77
273 3300025934 Ga0207686_11247868 Ga0207686_112478682 77
274 3300025935 Ga0207709_10691128 Ga0207709_106911282 77
275 3300025937 Ga0207669_11194503 Ga0207669_111945032 77
276 3300025937 Ga0207669_11560249 Ga0207669_115602492 77
277 3300025938 Ga0207704_11797851 Ga0207704_117978512 77
278 3300025940 Ga0207691_10540916 Ga0207691_105409162 77
279 3300025941 Ga0207711_11346223 Ga0207711_113462232 77
280 3300025942 Ga0207689_10868378 Ga0207689_108683781 77
281 3300025944 Ga0207661_10205708 Ga0207661_102057082 77
282 3300026023 Ga0207677_10315501 Ga0207677_103155012 77
283 3300026023 Ga0207677_11111706 Ga0207677_111117062 77
284 3300026023 Ga0207677_11331989 Ga0207677_113319892 77
285 3300026067 Ga0207678_10177813 Ga0207678_101778134 77
286 3300026089 Ga0207648_10445614 Ga0207648_104456141 77
287 3300026095 Ga0207676_10960354 Ga0207676_109603542 77
288 3300026118 Ga0207675_100119742 Ga0207675_1001197424 77
289 3300026121 Ga0207683_10115188 Ga0207683_101151882 77
290 3300026121 Ga0207683_10260174 Ga0207683_102601743 77
291 3300026121 Ga0207683_10833282 Ga0207683_108332822 77
292 3300026121 Ga0207683_11157473 Ga0207683_111574732 77
293 3300026121 Ga0207683_11528163 Ga0207683_115281632 77
294 3300026142 Ga0207698_10485231 Ga0207698_104852312 77
295 3300028379 Ga0268266_10249643 Ga0268266_102496434 77
296 3300028379 Ga0268266_10510220 Ga0268266_105102202 77
297 3300028379 Ga0268266_10642900 Ga0268266_106429002 77
298 3300028380 Ga0268265_11550855 Ga0268265_115508552 77
299 3300031889 Ga0326468_10084057 Ga0326468_100840572 77
300 3300037312 Ga0395899_0053875 Ga0395899_0053875_1670_1909 77
301 3300037418 Ga0395900_0005363 Ga0395900_0005363_5440_5679 77
302 3300037466 Ga0395898_0071698 Ga0395898_0071698_2219_2458 77
303 3300037471 Ga0395905_0006331 Ga0395905_0006331_4074_4313 77
304 3300038443 Ga0395901_0013286 Ga0395901_0013286_6710_6949 77
305 3300041441 Ga0451787_144833 Ga0451787_144833_51_284 77
306 3300041452 Ga0451793_0217906 Ga0451793_0217906_808_1041 77
307 3300041460 Ga0451802_0539959 Ga0451802_0539959_162_395 77
308 3300041486 Ga0451807_1505927 Ga0451807_1505927_169_402 77
309 3300041512 Ga0451853_3086998 Ga0451853_3086998_637_870 77
310 3300046455 Ga0495603_0264450 Ga0495603_0264450_337_570 77
311 3300046461 Ga0495641_0270051 Ga0495641_0270051_456_689 77
312 3300046500 Ga0495596_0405762 Ga0495596_0405762_16_249 77
313 3300046515 Ga0495620_0210159 Ga0495620_0210159_370_603 77
314 3300046537 Ga0495598_0259894 Ga0495598_0259894_148_381 77
315 3300046683 Ga0495658_0482207 Ga0495658_0482207_271_504 77
316 3300046690 Ga0495624_0350387 Ga0495624_0350387_129_362 77
317 3300047321 Ga0495676_0336055 Ga0495676_0336055_677_910 77
318 3300048903 Ga0496100_0554901 Ga0496100_0554901_418_651 77
319 3300048904 Ga0496101_1157668 Ga0496101_1157668_116_349 77
320 3300048905 Ga0496102_0234483 Ga0496102_0234483_675_908 77
321 3300048905 Ga0496102_1524458 Ga0496102_1524458_185_418 77
322 3300048907 Ga0496104_1101567 Ga0496104_1101567_385_618 77
323 3300048907 Ga0496104_1378047 Ga0496104_1378047_52_285 77
324 3300048908 Ga0496105_0364671 Ga0496105_0364671_116_349 77
325 3300048910 Ga0496107_1337180 Ga0496107_1337180_71_304 77
326 3300048912 Ga0496109_0011202 Ga0496109_0011202_1409_1642 77
327 3300048912 Ga0496109_1167443 Ga0496109_1167443_143_376 77
328 3300048912 Ga0496109_1768708 Ga0496109_1768708_61_294 77
329 3300048913 Ga0496110_0831379 Ga0496110_0831379_361_594 77
330 3300048914 Ga0496111_0259350 Ga0496111_0259350_819_1052 77
331 3300048917 Ga0496114_0217280 Ga0496114_0217280_938_1171 77
332 3300048917 Ga0496114_0325870 Ga0496114_0325870_79_312 77
333 3300048917 Ga0496114_0445050 Ga0496114_0445050_800_1033 77
334 3300049576 Ga0501040_0112106 Ga0501040_0112106_14_250 77
335 3300049742 Ga0501080_0279880 Ga0501080_0279880_1203_1439 77
336 3300050515 nmdc:mga0a205_788872_c1 nmdc:mga0a205_788872_c1_464_697 77
337 3300053083 Ga0495655_0230433 Ga0495655_0230433_10_243 77
338 3300060353 Ga0501082_0495401 Ga0501082_0495401_548_784 77
339 3300048905 Ga0496102_1729973 Ga0496102_1729973_157_396 78
340 3300049583 Ga0501067_0416262 Ga0501067_0416262_193_429 78
341 3300049584 Ga0501068_0011596 Ga0501068_0011596_1493_1732 78
342 3300049584 Ga0501068_0194918 Ga0501068_0194918_890_1126 78
343 3300049585 Ga0501069_0023246 Ga0501069_0023246_454_690 78
344 3300049585 Ga0501069_0104261 Ga0501069_0104261_789_1028 78
345 3300049585 Ga0501069_0956969 Ga0501069_0956969_76_318 78
346 3300061734 Ga0530510_0063666 Ga0530510_0063666_1012_1248 78
347 3300061734 Ga0530510_0303982 Ga0530510_0303982_535_777 78
348 3300005331 Ga0070670_101601209 Ga0070670_1016012092 79
349 3300006844 Ga0075428_101748580 Ga0075428_1017485802 79
350 3300009094 Ga0111539_10920760 Ga0111539_109207602 79
351 3300014326 Ga0157380_10159646 Ga0157380_101596462 79
352 3300046615 Ga0495656_0337502 Ga0495656_0337502_345_584 79
353 3300049583 Ga0501067_0533503 Ga0501067_0533503_295_534 79
354 3300049590 Ga0501074_0903316 Ga0501074_0903316_202_441 79
355 3300001978 JGI24747J21853_1050140 JGI24747J21853_10501401 80
356 3300001989 JGI24739J22299_10043863 JGI24739J22299_100438632 80
357 3300001991 JGI24743J22301_10004517 JGI24743J22301_100045173 80
358 3300001991 JGI24743J22301_10058672 JGI24743J22301_100586722 80
359 3300002075 JGI24738J21930_10025519 JGI24738J21930_100255192 80
360 3300002075 JGI24738J21930_10062747 JGI24738J21930_100627472 80
361 3300002077 JGI24744J21845_10037088 JGI24744J21845_100370882 80
362 3300002077 JGI24744J21845_10092072 JGI24744J21845_100920722 80
363 3300002239 JGI24034J26672_10066300 JGI24034J26672_100663002 80
364 3300002239 JGI24034J26672_10073220 JGI24034J26672_100732202 80
365 3300002244 JGI24742J22300_10025285 JGI24742J22300_100252852 80
366 3300002244 JGI24742J22300_10120439 JGI24742J22300_101204392 80
367 3300002459 JGI24751J29686_10078962 JGI24751J29686_100789622 80
368 3300003203 JGI25406J46586_10025619 JGI25406J46586_100256192 80
369 3300004799 Ga0058863_11966875 Ga0058863_119668752 80
370 3300004801 Ga0058860_10162899 Ga0058860_101628991 80
371 3300004801 Ga0058860_12210104 Ga0058860_122101041 80
372 3300005327 Ga0070658_10012481 Ga0070658_100124816 80
373 3300005327 Ga0070658_11186789 Ga0070658_111867892 80
374 3300005328 Ga0070676_10120648 Ga0070676_101206481 80
375 3300005328 Ga0070676_10149159 Ga0070676_101491594 80
376 3300005329 Ga0070683_100018147 Ga0070683_1000181473 80
377 3300005329 Ga0070683_100354697 Ga0070683_1003546972 80
378 3300005329 Ga0070683_100520645 Ga0070683_1005206452 80
379 3300005330 Ga0070690_100472279 Ga0070690_1004722792 80
380 3300005331 Ga0070670_101320500 Ga0070670_1013205002 80
381 3300005334 Ga0068869_100023368 Ga0068869_1000233685 80
382 3300005334 Ga0068869_100269957 Ga0068869_1002699573 80
383 3300005335 Ga0070666_10204304 Ga0070666_102043044 80
384 3300005336 Ga0070680_100376973 Ga0070680_1003769732 80
385 3300005336 Ga0070680_101030691 Ga0070680_1010306912 80
386 3300005336 Ga0070680_101272267 Ga0070680_1012722672 80
387 3300005337 Ga0070682_100005220 Ga0070682_1000052205 80
388 3300005337 Ga0070682_100523886 Ga0070682_1005238862 80
389 3300005338 Ga0068868_100110844 Ga0068868_1001108444 80
390 3300005339 Ga0070660_100004686 Ga0070660_1000046866 80
391 3300005339 Ga0070660_100063955 Ga0070660_1000639554 80
392 3300005340 Ga0070689_100149218 Ga0070689_1001492182 80
393 3300005341 Ga0070691_10001238 Ga0070691_100012385 80
394 3300005341 Ga0070691_10264948 Ga0070691_102649482 80
395 3300005341 Ga0070691_10822967 Ga0070691_108229672 80
396 3300005343 Ga0070687_100259899 Ga0070687_1002598991 80
397 3300005344 Ga0070661_100076821 Ga0070661_1000768212 80
398 3300005344 Ga0070661_100313064 Ga0070661_1003130642 80
399 3300005345 Ga0070692_10012229 Ga0070692_100122295 80
400 3300005345 Ga0070692_10123571 Ga0070692_101235712 80
401 3300005345 Ga0070692_10862229 Ga0070692_108622292 80
402 3300005347 Ga0070668_100097921 Ga0070668_1000979213 80
403 3300005347 Ga0070668_101224370 Ga0070668_1012243702 80
404 3300005347 Ga0070668_101791386 Ga0070668_1017913861 80
405 3300005353 Ga0070669_100110873 Ga0070669_1001108732 80
406 3300005353 Ga0070669_100216640 Ga0070669_1002166402 80
407 3300005353 Ga0070669_100316774 Ga0070669_1003167742 80
408 3300005354 Ga0070675_100013979 Ga0070675_1000139792 80
409 3300005354 Ga0070675_100066526 Ga0070675_1000665262 80
410 3300005354 Ga0070675_100077897 Ga0070675_1000778972 80
411 3300005355 Ga0070671_100192672 Ga0070671_1001926722 80
412 3300005355 Ga0070671_100568969 Ga0070671_1005689691 80
413 3300005356 Ga0070674_100024067 Ga0070674_1000240673 80
414 3300005356 Ga0070674_100032596 Ga0070674_1000325964 80
415 3300005356 Ga0070674_100066818 Ga0070674_1000668182 80
416 3300005356 Ga0070674_101029289 Ga0070674_1010292891 80
417 3300005364 Ga0070673_100009358 Ga0070673_1000093586 80
418 3300005364 Ga0070673_100052387 Ga0070673_1000523872 80
419 3300005364 Ga0070673_100440169 Ga0070673_1004401692 80
420 3300005365 Ga0070688_100020579 Ga0070688_1000205795 80
421 3300005365 Ga0070688_100443056 Ga0070688_1004430562 80
422 3300005365 Ga0070688_100629724 Ga0070688_1006297242 80
423 3300005366 Ga0070659_100055876 Ga0070659_1000558764 80
424 3300005366 Ga0070659_101238669 Ga0070659_1012386692 80
425 3300005367 Ga0070667_101273894 Ga0070667_1012738942 80
426 3300005367 Ga0070667_101487235 Ga0070667_1014872352 80
427 3300005406 Ga0070703_10252828 Ga0070703_102528282 80
428 3300005438 Ga0070701_10003360 Ga0070701_100033605 80
429 3300005438 Ga0070701_10165889 Ga0070701_101658892 80
430 3300005438 Ga0070701_10184858 Ga0070701_101848583 80
431 3300005440 Ga0070705_100057463 Ga0070705_1000574634 80
432 3300005441 Ga0070700_100077418 Ga0070700_1000774184 80
433 3300005441 Ga0070700_100135553 Ga0070700_1001355532 80
434 3300005441 Ga0070700_101191568 Ga0070700_1011915682 80
435 3300005444 Ga0070694_100413225 Ga0070694_1004132253 80
436 3300005455 Ga0070663_100303087 Ga0070663_1003030872 80
437 3300005456 Ga0070678_100017141 Ga0070678_1000171412 80
438 3300005456 Ga0070678_100048516 Ga0070678_1000485163 80
439 3300005456 Ga0070678_100911464 Ga0070678_1009114642 80
440 3300005456 Ga0070678_101533240 Ga0070678_1015332402 80
441 3300005457 Ga0070662_100016854 Ga0070662_1000168545 80
442 3300005457 Ga0070662_100053146 Ga0070662_1000531464 80
443 3300005457 Ga0070662_100865491 Ga0070662_1008654912 80
444 3300005457 Ga0070662_101905200 Ga0070662_1019052001 80
445 3300005458 Ga0070681_10274946 Ga0070681_102749463 80
446 3300005458 Ga0070681_10385000 Ga0070681_103850002 80
447 3300005459 Ga0068867_100073418 Ga0068867_1000734182 80
448 3300005459 Ga0068867_100215413 Ga0068867_1002154132 80
449 3300005459 Ga0068867_101077312 Ga0068867_1010773122 80
450 3300005466 Ga0070685_10025373 Ga0070685_100253732 80
451 3300005466 Ga0070685_10051017 Ga0070685_100510174 80
452 3300005468 Ga0070707_101071429 Ga0070707_1010714292 80
453 3300005518 Ga0070699_100751143 Ga0070699_1007511432 80
454 3300005530 Ga0070679_100273839 Ga0070679_1002738392 80
455 3300005535 Ga0070684_100030643 Ga0070684_1000306435 80
456 3300005535 Ga0070684_100289579 Ga0070684_1002895792 80
457 3300005535 Ga0070684_100346796 Ga0070684_1003467963 80
458 3300005535 Ga0070684_100670648 Ga0070684_1006706482 80
459 3300005539 Ga0068853_100014429 Ga0068853_1000144295 80
460 3300005539 Ga0068853_100062964 Ga0068853_1000629642 80
461 3300005543 Ga0070672_100012820 Ga0070672_1000128204 80
462 3300005543 Ga0070672_100123283 Ga0070672_1001232834 80
463 3300005543 Ga0070672_100128796 Ga0070672_1001287964 80
464 3300005544 Ga0070686_100029728 Ga0070686_1000297281 80
465 3300005544 Ga0070686_100109964 Ga0070686_1001099641 80
466 3300005544 Ga0070686_100628513 Ga0070686_1006285132 80
467 3300005545 Ga0070695_101023736 Ga0070695_1010237361 80
468 3300005546 Ga0070696_100309973 Ga0070696_1003099732 80
469 3300005547 Ga0070693_100441027 Ga0070693_1004410272 80
470 3300005547 Ga0070693_100603786 Ga0070693_1006037862 80
471 3300005548 Ga0070665_100194410 Ga0070665_1001944104 80
472 3300005549 Ga0070704_100073456 Ga0070704_1000734564 80
473 3300005549 Ga0070704_100706319 Ga0070704_1007063192 80
474 3300005563 Ga0068855_100156199 Ga0068855_1001561995 80
475 3300005563 Ga0068855_100345925 Ga0068855_1003459252 80
476 3300005564 Ga0070664_100003869 Ga0070664_1000038691 80
477 3300005564 Ga0070664_100161931 Ga0070664_1001619314 80
478 3300005564 Ga0070664_101377796 Ga0070664_1013777962 80
479 3300005577 Ga0068857_102027130 Ga0068857_1020271302 80
480 3300005578 Ga0068854_100003667 Ga0068854_1000036679 80
481 3300005578 Ga0068854_100915063 Ga0068854_1009150631 80
482 3300005614 Ga0068856_100203070 Ga0068856_1002030702 80
483 3300005614 Ga0068856_100407407 Ga0068856_1004074071 80
484 3300005615 Ga0070702_100016434 Ga0070702_1000164341 80
485 3300005615 Ga0070702_100025615 Ga0070702_1000256155 80
486 3300005616 Ga0068852_100007373 Ga0068852_1000073738 80
487 3300005616 Ga0068852_100062908 Ga0068852_1000629084 80
488 3300005616 Ga0068852_100247937 Ga0068852_1002479371 80
489 3300005617 Ga0068859_100140109 Ga0068859_1001401094 80
490 3300005617 Ga0068859_101462464 Ga0068859_1014624642 80
491 3300005618 Ga0068864_100015387 Ga0068864_1000153876 80
492 3300005618 Ga0068864_100423296 Ga0068864_1004232961 80
493 3300005618 Ga0068864_100659244 Ga0068864_1006592442 80
494 3300005718 Ga0068866_10037817 Ga0068866_100378172 80
495 3300005718 Ga0068866_10130980 Ga0068866_101309802 80
496 3300005718 Ga0068866_10186024 Ga0068866_101860242 80
497 3300005718 Ga0068866_11162069 Ga0068866_111620692 80
498 3300005719 Ga0068861_100682255 Ga0068861_1006822552 80
499 3300005834 Ga0068851_10146037 Ga0068851_101460373 80
500 3300005834 Ga0068851_10785829 Ga0068851_107858292 80
501 3300005840 Ga0068870_10069276 Ga0068870_100692762 80
502 3300005840 Ga0068870_10176969 Ga0068870_101769692 80
503 3300005840 Ga0068870_10792203 Ga0068870_107922032 80
504 3300005841 Ga0068863_100102857 Ga0068863_1001028574 80
505 3300005841 Ga0068863_100319447 Ga0068863_1003194472 80
506 3300005842 Ga0068858_100034435 Ga0068858_1000344354 80
507 3300005842 Ga0068858_100387978 Ga0068858_1003879782 80
508 3300005843 Ga0068860_100069094 Ga0068860_1000690942 80
509 3300005844 Ga0068862_100503741 Ga0068862_1005037413 80
510 3300005937 Ga0081455_10450052 Ga0081455_104500522 80
511 3300005985 Ga0081539_10000890 Ga0081539_100008903 80
512 3300006038 Ga0075365_10185597 Ga0075365_101855972 80
513 3300006237 Ga0097621_100335071 Ga0097621_1003350712 80
514 3300006237 Ga0097621_100518500 Ga0097621_1005185002 80
515 3300006237 Ga0097621_101021418 Ga0097621_1010214182 80
516 3300006358 Ga0068871_100594839 Ga0068871_1005948392 80
517 3300006358 Ga0068871_100987398 Ga0068871_1009873981 80
518 3300006847 Ga0075431_101128770 Ga0075431_1011287702 80
519 3300006881 Ga0068865_100010600 Ga0068865_1000106004 80
520 3300006881 Ga0068865_100028908 Ga0068865_1000289083 80
521 3300006881 Ga0068865_100657094 Ga0068865_1006570942 80
522 3300006931 Ga0097620_100140117 Ga0097620_1001401174 80
523 3300006931 Ga0097620_101462223 Ga0097620_1014622232 80
524 3300009036 Ga0105244_10413686 Ga0105244_104136862 80
525 3300009094 Ga0111539_10048272 Ga0111539_100482725 80
526 3300009094 Ga0111539_10434001 Ga0111539_104340012 80
527 3300009094 Ga0111539_10673954 Ga0111539_106739543 80
528 3300009094 Ga0111539_12598296 Ga0111539_125982962 80
529 3300009098 Ga0105245_10037615 Ga0105245_100376155 80
530 3300009098 Ga0105245_10128207 Ga0105245_101282073 80
531 3300009098 Ga0105245_10340484 Ga0105245_103404842 80
532 3300009098 Ga0105245_11184800 Ga0105245_111848002 80
533 3300009098 Ga0105245_11327525 Ga0105245_113275251 80
534 3300009101 Ga0105247_10016412 Ga0105247_100164126 80
535 3300009101 Ga0105247_10403972 Ga0105247_104039722 80
536 3300009147 Ga0114129_10772526 Ga0114129_107725262 80
537 3300009147 Ga0114129_11131925 Ga0114129_111319252 80
538 3300009148 Ga0105243_10005485 Ga0105243_100054854 80
539 3300009148 Ga0105243_10114175 Ga0105243_101141753 80
540 3300009148 Ga0105243_10155875 Ga0105243_101558754 80
541 3300009148 Ga0105243_10299389 Ga0105243_102993892 80
542 3300009174 Ga0105241_12182417 Ga0105241_121824171 80
543 3300009176 Ga0105242_10004703 Ga0105242_1000470310 80
544 3300009176 Ga0105242_10131180 Ga0105242_101311804 80
545 3300009176 Ga0105242_10147878 Ga0105242_101478782 80
546 3300009177 Ga0105248_10277459 Ga0105248_102774594 80
547 3300009177 Ga0105248_11035383 Ga0105248_110353832 80
548 3300009177 Ga0105248_12667251 Ga0105248_126672512 80
549 3300009545 Ga0105237_10362186 Ga0105237_103621864 80
550 3300009551 Ga0105238_10004615 Ga0105238_1000461515 80
551 3300009551 Ga0105238_10655795 Ga0105238_106557952 80
552 3300009551 Ga0105238_11490411 Ga0105238_114904112 80
553 3300009553 Ga0105249_10074040 Ga0105249_100740405 80
554 3300009553 Ga0105249_10129166 Ga0105249_101291664 80
555 3300010375 Ga0105239_10060383 Ga0105239_100603835 80
556 3300010375 Ga0105239_10173487 Ga0105239_101734872 80
557 3300010375 Ga0105239_10314495 Ga0105239_103144953 80
558 3300010375 Ga0105239_10685042 Ga0105239_106850422 80
559 3300011119 Ga0105246_10073527 Ga0105246_100735274 80
560 3300011119 Ga0105246_10151414 Ga0105246_101514142 80
561 3300011119 Ga0105246_10202032 Ga0105246_102020322 80
562 3300011119 Ga0105246_11066732 Ga0105246_110667322 80
563 3300012505 Ga0157339_1067631 Ga0157339_10676311 80
564 3300013100 Ga0157373_10475281 Ga0157373_104752812 80
565 3300013100 Ga0157373_10865248 Ga0157373_108652481 80
566 3300013100 Ga0157373_11094913 Ga0157373_110949132 80
567 3300013102 Ga0157371_10234896 Ga0157371_102348962 80
568 3300013102 Ga0157371_10325779 Ga0157371_103257792 80
569 3300013104 Ga0157370_10769753 Ga0157370_107697532 80
570 3300013296 Ga0157374_10532139 Ga0157374_105321392 80
571 3300013297 Ga0157378_10223569 Ga0157378_102235692 80
572 3300013297 Ga0157378_10763532 Ga0157378_107635322 80
573 3300013306 Ga0163162_10821685 Ga0163162_108216852 80
574 3300013306 Ga0163162_11875234 Ga0163162_118752341 80
575 3300013306 Ga0163162_11990492 Ga0163162_119904922 80
576 3300013307 Ga0157372_10009445 Ga0157372_100094455 80
577 3300013307 Ga0157372_10509020 Ga0157372_105090203 80
578 3300013308 Ga0157375_10029312 Ga0157375_100293125 80
579 3300013308 Ga0157375_10041919 Ga0157375_100419195 80
580 3300013308 Ga0157375_10960602 Ga0157375_109606022 80
581 3300014325 Ga0163163_10199617 Ga0163163_101996172 80
582 3300014325 Ga0163163_10542539 Ga0163163_105425393 80
583 3300014326 Ga0157380_10040382 Ga0157380_100403824 80
584 3300014326 Ga0157380_10049025 Ga0157380_100490254 80
585 3300014326 Ga0157380_12047313 Ga0157380_120473132 80
586 3300014745 Ga0157377_10003506 Ga0157377_100035065 80
587 3300014745 Ga0157377_10063765 Ga0157377_100637654 80
588 3300014745 Ga0157377_10077178 Ga0157377_100771784 80
589 3300014745 Ga0157377_11484705 Ga0157377_114847052 80
590 3300014968 Ga0157379_10070862 Ga0157379_100708624 80
591 3300014968 Ga0157379_10075391 Ga0157379_100753913 80
592 3300014969 Ga0157376_10035152 Ga0157376_100351524 80
593 3300014969 Ga0157376_10423087 Ga0157376_104230872 80
594 3300017792 Ga0163161_10017266 Ga0163161_100172666 80
595 3300017792 Ga0163161_10507902 Ga0163161_105079022 80
596 3300017792 Ga0163161_10784000 Ga0163161_107840002 80
597 3300020070 Ga0206356_10715168 Ga0206356_107151682 80
598 3300020077 Ga0206351_10732071 Ga0206351_107320712 80
599 3300020081 Ga0206354_10785179 Ga0206354_107851793 80
600 3300025885 Ga0207653_10018400 Ga0207653_100184006 80
601 3300025899 Ga0207642_10086808 Ga0207642_100868084 80
602 3300025899 Ga0207642_10117534 Ga0207642_101175342 80
603 3300025899 Ga0207642_10769334 Ga0207642_107693342 80
604 3300025901 Ga0207688_10013555 Ga0207688_100135553 80
605 3300025901 Ga0207688_10060772 Ga0207688_100607724 80
606 3300025901 Ga0207688_10143489 Ga0207688_101434894 80
607 3300025901 Ga0207688_10550347 Ga0207688_105503471 80
608 3300025903 Ga0207680_10086005 Ga0207680_100860052 80
609 3300025904 Ga0207647_10349319 Ga0207647_103493192 80
610 3300025907 Ga0207645_10116806 Ga0207645_101168064 80
611 3300025907 Ga0207645_10227145 Ga0207645_102271452 80
612 3300025908 Ga0207643_10153252 Ga0207643_101532522 80
613 3300025908 Ga0207643_10206206 Ga0207643_102062063 80
614 3300025908 Ga0207643_10517390 Ga0207643_105173902 80
615 3300025909 Ga0207705_10023479 Ga0207705_100234793 80
616 3300025911 Ga0207654_10595001 Ga0207654_105950012 80
617 3300025912 Ga0207707_10671939 Ga0207707_106719392 80
618 3300025912 Ga0207707_10805229 Ga0207707_108052292 80
619 3300025914 Ga0207671_10718342 Ga0207671_107183422 80
620 3300025917 Ga0207660_10168419 Ga0207660_101684194 80
621 3300025918 Ga0207662_10085898 Ga0207662_100858983 80
622 3300025918 Ga0207662_10636895 Ga0207662_106368952 80
623 3300025919 Ga0207657_10003899 Ga0207657_100038997 80
624 3300025919 Ga0207657_10583151 Ga0207657_105831512 80
625 3300025919 Ga0207657_11190135 Ga0207657_111901352 80
626 3300025920 Ga0207649_10045143 Ga0207649_100451434 80
627 3300025920 Ga0207649_10300772 Ga0207649_103007722 80
628 3300025921 Ga0207652_10675408 Ga0207652_106754082 80
629 3300025923 Ga0207681_10124965 Ga0207681_101249654 80
630 3300025923 Ga0207681_10306574 Ga0207681_103065742 80
631 3300025923 Ga0207681_10683881 Ga0207681_106838812 80
632 3300025924 Ga0207694_10118485 Ga0207694_101184852 80
633 3300025924 Ga0207694_11682504 Ga0207694_116825042 80
634 3300025925 Ga0207650_11468665 Ga0207650_114686652 80
635 3300025925 Ga0207650_11523066 Ga0207650_115230662 80
636 3300025926 Ga0207659_10050673 Ga0207659_100506733 80
637 3300025926 Ga0207659_10121009 Ga0207659_101210092 80
638 3300025926 Ga0207659_10126612 Ga0207659_101266124 80
639 3300025927 Ga0207687_10013736 Ga0207687_100137366 80
640 3300025927 Ga0207687_10329199 Ga0207687_103291993 80
641 3300025927 Ga0207687_10926236 Ga0207687_109262362 80
642 3300025931 Ga0207644_10645960 Ga0207644_106459602 80
643 3300025932 Ga0207690_10037340 Ga0207690_100373402 80
644 3300025933 Ga0207706_10025020 Ga0207706_100250206 80
645 3300025933 Ga0207706_10209297 Ga0207706_102092972 80
646 3300025933 Ga0207706_10747880 Ga0207706_107478802 80
647 3300025935 Ga0207709_10043199 Ga0207709_100431994 80
648 3300025935 Ga0207709_10074295 Ga0207709_100742952 80
649 3300025936 Ga0207670_10122359 Ga0207670_101223593 80
650 3300025936 Ga0207670_10400516 Ga0207670_104005162 80
651 3300025937 Ga0207669_10073407 Ga0207669_100734074 80
652 3300025937 Ga0207669_10111386 Ga0207669_101113862 80
653 3300025937 Ga0207669_10163492 Ga0207669_101634923 80
654 3300025937 Ga0207669_11354239 Ga0207669_113542392 80
655 3300025938 Ga0207704_10067422 Ga0207704_100674223 80
656 3300025938 Ga0207704_10242297 Ga0207704_102422973 80
657 3300025940 Ga0207691_10006406 Ga0207691_100064063 80
658 3300025940 Ga0207691_10012064 Ga0207691_100120645 80
659 3300025940 Ga0207691_10136553 Ga0207691_101365534 80
660 3300025941 Ga0207711_10043749 Ga0207711_100437494 80
661 3300025941 Ga0207711_10215795 Ga0207711_102157954 80
662 3300025942 Ga0207689_10121142 Ga0207689_101211423 80
663 3300025942 Ga0207689_11558846 Ga0207689_115588461 80
664 3300025942 Ga0207689_11633856 Ga0207689_116338561 80
665 3300025944 Ga0207661_10033009 Ga0207661_100330092 80
666 3300025944 Ga0207661_10341501 Ga0207661_103415012 80
667 3300025944 Ga0207661_11720266 Ga0207661_117202662 80
668 3300025945 Ga0207679_10133330 Ga0207679_101333302 80
669 3300025945 Ga0207679_10294743 Ga0207679_102947432 80
670 3300025945 Ga0207679_10741182 Ga0207679_107411821 80
671 3300025949 Ga0207667_11344700 Ga0207667_113447002 80
672 3300025960 Ga0207651_10184857 Ga0207651_101848573 80
673 3300025960 Ga0207651_11223308 Ga0207651_112233081 80
674 3300025961 Ga0207712_10898689 Ga0207712_108986892 80
675 3300025981 Ga0207640_10074967 Ga0207640_100749673 80
676 3300025986 Ga0207658_10828041 Ga0207658_108280412 80
677 3300026023 Ga0207677_10027716 Ga0207677_100277165 80
678 3300026035 Ga0207703_10051335 Ga0207703_100513354 80
679 3300026035 Ga0207703_10980027 Ga0207703_109800271 80
680 3300026041 Ga0207639_10012338 Ga0207639_100123385 80
681 3300026041 Ga0207639_11716654 Ga0207639_117166541 80
682 3300026067 Ga0207678_10023034 Ga0207678_100230346 80
683 3300026075 Ga0207708_10016992 Ga0207708_100169924 80
684 3300026075 Ga0207708_10060405 Ga0207708_100604051 80
685 3300026075 Ga0207708_10248364 Ga0207708_102483642 80
686 3300026078 Ga0207702_10206917 Ga0207702_102069174 80
687 3300026078 Ga0207702_10417877 Ga0207702_104178772 80
688 3300026088 Ga0207641_10790612 Ga0207641_107906122 80
689 3300026089 Ga0207648_10051981 Ga0207648_100519816 80
690 3300026089 Ga0207648_10125301 Ga0207648_101253013 80
691 3300026089 Ga0207648_10182488 Ga0207648_101824883 80
692 3300026095 Ga0207676_10276214 Ga0207676_102762144 80
693 3300026095 Ga0207676_10579641 Ga0207676_105796412 80
694 3300026095 Ga0207676_11736969 Ga0207676_117369692 80
695 3300026116 Ga0207674_10431412 Ga0207674_104314122 80
696 3300026116 Ga0207674_11081827 Ga0207674_110818272 80
697 3300026116 Ga0207674_11184008 Ga0207674_111840082 80
698 3300026118 Ga0207675_100647694 Ga0207675_1006476942 80
699 3300026121 Ga0207683_10004422 Ga0207683_100044225 80
700 3300026121 Ga0207683_10025471 Ga0207683_100254714 80
701 3300026121 Ga0207683_10061101 Ga0207683_100611014 80
702 3300026142 Ga0207698_10003410 Ga0207698_100034106 80
703 3300027876 Ga0209974_10158418 Ga0209974_101584182 80
704 3300027907 Ga0207428_10175303 Ga0207428_101753033 80
705 3300028379 Ga0268266_11364561 Ga0268266_113645612 80
706 3300028381 Ga0268264_10036367 Ga0268264_100363672 80
707 3300028381 Ga0268264_10661439 Ga0268264_106614392 80
708 3300034817 Ga0373948_0013703 Ga0373948_0013703_302_544 80
709 3300034957 Ga0373938_0136265 Ga0373938_0136265_174_416 80
710 3300035084 Ga0373928_0035993 Ga0373928_0035993_523_765 80
711 3300035090 Ga0373949_0089257 Ga0373949_0089257_312_554 80
712 3300035091 Ga0373951_0097676 Ga0373951_0097676_254_496 80
713 3300035115 Ga0373941_0013948 Ga0373941_0013948_45_287 80
714 3300035121 Ga0373960_0093458 Ga0373960_0093458_53_295 80
715 3300035207 Ga0373942_0199928 Ga0373942_0199928_184_426 80
716 3300035242 Ga0373962_0027361 Ga0373962_0027361_276_518 80
717 3300035691 Ga0373931_0072674 Ga0373931_0072674_1129_1371 80
718 3300038443 Ga0395901_0787498 Ga0395901_0787498_283_525 80
719 3300041443 Ga0451789_0622442 Ga0451789_0622442_629_871 80
720 3300041460 Ga0451802_2123391 Ga0451802_2123391_533_775 80
721 3300041492 Ga0451835_0445768 Ga0451835_0445768_33_275 80
722 3300042115 Ga0450911_028724 Ga0450911_028724_450_695 80
723 3300042127 Ga0450890_060459 Ga0450890_060459_241_483 80
724 3300042185 Ga0450909_070273 Ga0450909_070273_301_546 80
725 3300046455 Ga0495603_0035069 Ga0495603_0035069_2223_2465 80
726 3300046473 Ga0495582_0443499 Ga0495582_0443499_11_253 80
727 3300046474 Ga0495605_0138172 Ga0495605_0138172_604_846 80
728 3300046500 Ga0495596_0105550 Ga0495596_0105550_45_287 80
729 3300046513 Ga0495616_0280749 Ga0495616_0280749_416_658 80
730 3300046523 Ga0495644_0043043 Ga0495644_0043043_439_681 80
731 3300046615 Ga0495656_0172387 Ga0495656_0172387_11_253 80
732 3300046648 Ga0495611_0223513 Ga0495611_0223513_475_717 80
733 3300046674 Ga0495588_0327785 Ga0495588_0327785_367_609 80
734 3300046692 Ga0495671_0058339 Ga0495671_0058339_587_829 80
735 3300046794 Ga0495589_0045256 Ga0495589_0045256_339_581 80
736 3300046810 Ga0495660_0489572 Ga0495660_0489572_41_283 80
737 3300047315 Ga0495581_0539635 Ga0495581_0539635_356_598 80
738 3300048903 Ga0496100_0432659 Ga0496100_0432659_273_515 80
739 3300048903 Ga0496100_1306091 Ga0496100_1306091_179_421 80
740 3300048904 Ga0496101_0130884 Ga0496101_0130884_1076_1318 80
741 3300048904 Ga0496101_0138299 Ga0496101_0138299_261_503 80
742 3300048904 Ga0496101_0217352 Ga0496101_0217352_789_1031 80
743 3300048905 Ga0496102_0615214 Ga0496102_0615214_366_608 80
744 3300048905 Ga0496102_0668846 Ga0496102_0668846_374_616 80
745 3300048907 Ga0496104_0303765 Ga0496104_0303765_1080_1322 80
746 3300048907 Ga0496104_0382872 Ga0496104_0382872_395_637 80
747 3300048908 Ga0496105_0215961 Ga0496105_0215961_673_915 80
748 3300048908 Ga0496105_0584496 Ga0496105_0584496_532_774 80
749 3300048909 Ga0496106_0025632 Ga0496106_0025632_2103_2345 80
750 3300048910 Ga0496107_0191368 Ga0496107_0191368_950_1192 80
751 3300048911 Ga0496108_0270465 Ga0496108_0270465_1136_1378 80
752 3300048911 Ga0496108_0652845 Ga0496108_0652845_548_790 80
753 3300048911 Ga0496108_1463315 Ga0496108_1463315_167_409 80
754 3300048912 Ga0496109_0084789 Ga0496109_0084789_386_628 80
755 3300048912 Ga0496109_0121469 Ga0496109_0121469_1274_1516 80
756 3300048913 Ga0496110_0030503 Ga0496110_0030503_2633_2875 80
757 3300048913 Ga0496110_1686591 Ga0496110_1686591_77_319 80
758 3300048913 Ga0496110_1730585 Ga0496110_1730585_154_396 80
759 3300048914 Ga0496111_0067911 Ga0496111_0067911_1022_1264 80
760 3300048914 Ga0496111_0506762 Ga0496111_0506762_175_417 80
761 3300048915 Ga0496112_0218787 Ga0496112_0218787_1462_1704 80
762 3300048916 Ga0496113_0239154 Ga0496113_0239154_925_1167 80
763 3300048917 Ga0496114_0146112 Ga0496114_0146112_1564_1806 80
764 3300048917 Ga0496114_0336944 Ga0496114_0336944_284_526 80
765 3300048917 Ga0496114_0381691 Ga0496114_0381691_153_395 80
766 3300049568 Ga0501031_0748699 Ga0501031_0748699_35_280 80
767 3300049569 Ga0501032_0143422 Ga0501032_0143422_470_712 80
768 3300049569 Ga0501032_0594350 Ga0501032_0594350_254_496 80
769 3300049570 Ga0501033_0021291 Ga0501033_0021291_3380_3622 80
770 3300049571 Ga0501034_0121208 Ga0501034_0121208_604_846 80
771 3300049572 Ga0501036_0022147 Ga0501036_0022147_2661_2903 80
772 3300049572 Ga0501036_0036855 Ga0501036_0036855_1131_1373 80
773 3300049572 Ga0501036_1579255 Ga0501036_1579255_146_391 80
774 3300049573 Ga0501037_0012017 Ga0501037_0012017_1948_2190 80
775 3300049573 Ga0501037_0258555 Ga0501037_0258555_604_846 80
776 3300049574 Ga0501038_0010491 Ga0501038_0010491_6645_6887 80
777 3300049574 Ga0501038_0046809 Ga0501038_0046809_2183_2425 80
778 3300049574 Ga0501038_1200320 Ga0501038_1200320_210_455 80
779 3300049575 Ga0501039_0013914 Ga0501039_0013914_2942_3184 80
780 3300049575 Ga0501039_0135629 Ga0501039_0135629_70_312 80
781 3300049575 Ga0501039_0198444 Ga0501039_0198444_710_952 80
782 3300049576 Ga0501040_0019285 Ga0501040_0019285_1106_1348 80
783 3300049576 Ga0501040_0062134 Ga0501040_0062134_193_438 80
784 3300049576 Ga0501040_0112614 Ga0501040_0112614_621_866 80
785 3300049576 Ga0501040_0252341 Ga0501040_0252341_411_653 80
786 3300049577 Ga0501041_0007256 Ga0501041_0007256_2691_2933 80
787 3300049577 Ga0501041_0501330 Ga0501041_0501330_17_259 80
788 3300049578 Ga0501042_0006488 Ga0501042_0006488_2373_2615 80
789 3300049579 Ga0501043_0081566 Ga0501043_0081566_82_324 80
790 3300049579 Ga0501043_0098803 Ga0501043_0098803_2013_2255 80
791 3300049580 Ga0501046_0003198 Ga0501046_0003198_3588_3830 80
792 3300049580 Ga0501046_0138552 Ga0501046_0138552_303_545 80
793 3300049582 Ga0501048_0049671 Ga0501048_0049671_2036_2278 80
794 3300049582 Ga0501048_0455541 Ga0501048_0455541_361_603 80
795 3300049583 Ga0501067_0029785 Ga0501067_0029785_1843_2085 80
796 3300049584 Ga0501068_0011157 Ga0501068_0011157_4617_4859 80
797 3300049584 Ga0501068_0330909 Ga0501068_0330909_104_346 80
798 3300049585 Ga0501069_0071781 Ga0501069_0071781_801_1043 80
799 3300049585 Ga0501069_0121787 Ga0501069_0121787_982_1224 80
800 3300049586 Ga0501070_0120293 Ga0501070_0120293_1742_1984 80
801 3300049586 Ga0501070_0980483 Ga0501070_0980483_390_632 80
802 3300049586 Ga0501070_1474431 Ga0501070_1474431_168_410 80
803 3300049587 Ga0501071_0017219 Ga0501071_0017219_96_338 80
804 3300049587 Ga0501071_0023334 Ga0501071_0023334_1024_1266 80
805 3300049587 Ga0501071_0070959 Ga0501071_0070959_2101_2346 80
806 3300049587 Ga0501071_1391546 Ga0501071_1391546_52_297 80
807 3300049588 Ga0501072_0031317 Ga0501072_0031317_2171_2413 80
808 3300049588 Ga0501072_0047202 Ga0501072_0047202_335_577 80
809 3300049588 Ga0501072_0589395 Ga0501072_0589395_231_485 80
810 3300049589 Ga0501073_0027444 Ga0501073_0027444_3798_4040 80
811 3300049589 Ga0501073_0036973 Ga0501073_0036973_810_1052 80
812 3300049590 Ga0501074_0035462 Ga0501074_0035462_998_1240 80
813 3300049590 Ga0501074_0191407 Ga0501074_0191407_596_838 80
814 3300049591 Ga0501075_0079617 Ga0501075_0079617_24_266 80
815 3300049591 Ga0501075_0224889 Ga0501075_0224889_953_1195 80
816 3300049592 Ga0501076_0030067 Ga0501076_0030067_846_1088 80
817 3300049592 Ga0501076_0071760 Ga0501076_0071760_64_306 80
818 3300049592 Ga0501076_0357025 Ga0501076_0357025_724_969 80
819 3300049593 Ga0501077_0100358 Ga0501077_0100358_606_848 80
820 3300049593 Ga0501077_0109828 Ga0501077_0109828_621_863 80
821 3300049741 Ga0501079_0012614 Ga0501079_0012614_5343_5585 80
822 3300049741 Ga0501079_0037136 Ga0501079_0037136_3187_3429 80
823 3300049741 Ga0501079_0537722 Ga0501079_0537722_439_684 80
824 3300049741 Ga0501079_0579047 Ga0501079_0579047_376_630 80
825 3300049742 Ga0501080_0009195 Ga0501080_0009195_3964_4206 80
826 3300049742 Ga0501080_0010484 Ga0501080_0010484_7384_7626 80
827 3300049742 Ga0501080_0195377 Ga0501080_0195377_1462_1704 80
828 3300049743 Ga0501081_0007559 Ga0501081_0007559_5782_6024 80
829 3300049743 Ga0501081_0026901 Ga0501081_0026901_385_627 80
830 3300049744 Ga0501083_0009341 Ga0501083_0009341_2306_2548 80
831 3300049744 Ga0501083_0394585 Ga0501083_0394585_440_682 80
832 3300049822 Ga0501035_0026164 Ga0501035_0026164_1093_1335 80
833 3300049822 Ga0501035_0111907 Ga0501035_0111907_945_1187 80
834 3300049823 Ga0501044_0146738 Ga0501044_0146738_912_1154 80
835 3300049824 Ga0501045_0016648 Ga0501045_0016648_2885_3127 80
836 3300049824 Ga0501045_0028937 Ga0501045_0028937_2896_3138 80
837 3300049824 Ga0501045_0529024 Ga0501045_0529024_367_621 80
838 3300050492 nmdc:mga0yw44_95997_c1 nmdc:mga0yw44_95997_c1_534_776 80
839 3300050507 nmdc:mga05p37_2048777_c1 nmdc:mga05p37_2048777_c1_16_258 80
840 3300050511 nmdc:mga08y16_128631_c1 nmdc:mga08y16_128631_c1_1626_1868 80
841 3300050511 nmdc:mga08y16_33557_c1 nmdc:mga08y16_33557_c1_4047_4289 80
842 3300050512 nmdc:mga0n895_828617_c1 nmdc:mga0n895_828617_c1_21_263 80
843 3300050515 nmdc:mga0a205_368361_c1 nmdc:mga0a205_368361_c1_944_1186 80
844 3300054114 Ga0501084_0025140 Ga0501084_0025140_4703_4945 80
845 3300054114 Ga0501084_0045376 Ga0501084_0045376_3324_3566 80
846 3300054114 Ga0501084_0106836 Ga0501084_0106836_1690_1935 80
847 3300054114 Ga0501084_0442549 Ga0501084_0442549_417_671 80
848 3300054114 Ga0501084_0653507 Ga0501084_0653507_188_430 80
849 3300060353 Ga0501082_0053681 Ga0501082_0053681_2127_2369 80
850 3300060353 Ga0501082_0062549 Ga0501082_0062549_2101_2343 80
851 3300060353 Ga0501082_0102354 Ga0501082_0102354_1484_1738 80
852 3300060353 Ga0501082_0490962 Ga0501082_0490962_571_816 80
853 3300061734 Ga0530510_0084447 Ga0530510_0084447_170_412 80
854 3300061734 Ga0530510_0097928 Ga0530510_0097928_1037_1279 80
855 3300061734 Ga0530510_0426363 Ga0530510_0426363_606_848 80
856 3300061734 Ga0530510_0530570 Ga0530510_0530570_608_862 80
857 3300031731 Ga0307405_10730476 Ga0307405_107304762 81
858 3300032002 Ga0307416_100636788 Ga0307416_1006367882 81
859 3300046462 Ga0495651_0500581 Ga0495651_0500581_140_391 81
860 3300046511 Ga0495608_0138327 Ga0495608_0138327_290_541 81
861 3300046516 Ga0495628_0219470 Ga0495628_0219470_1110_1361 81
862 3300046517 Ga0495630_0143599 Ga0495630_0143599_882_1133 81
863 3300046536 Ga0495587_0709012 Ga0495587_0709012_195_446 81
864 3300046543 Ga0495645_0347890 Ga0495645_0347890_538_789 81
865 3300046663 Ga0495635_0199282 Ga0495635_0199282_452_703 81
866 3300046683 Ga0495658_0736409 Ga0495658_0736409_289_540 81
867 3300046683 Ga0495658_0850368 Ga0495658_0850368_52_303 81
868 3300046690 Ga0495624_0564779 Ga0495624_0564779_359_610 81
869 3300046809 Ga0495600_0698996 Ga0495600_0698996_251_502 81
870 3300047317 Ga0495604_0245016 Ga0495604_0245016_674_925 81
871 3300047319 Ga0495674_0120853 Ga0495674_0120853_914_1165 81
872 3300047321 Ga0495676_1031363 Ga0495676_1031363_11_262 81
873 3300047444 Ga0495675_0243476 Ga0495675_0243476_359_610 81
874 3300047471 Ga0495684_0605319 Ga0495684_0605319_229_480 81
875 3300048907 Ga0496104_0230746 Ga0496104_0230746_164_415 81
876 3300048908 Ga0496105_0120951 Ga0496105_0120951_145_396 81
877 3300048917 Ga0496114_0513982 Ga0496114_0513982_625_876 81
878 3300049572 Ga0501036_0338754 Ga0501036_0338754_165_410 81
879 3300049575 Ga0501039_0290168 Ga0501039_0290168_965_1210 81
880 3300049577 Ga0501041_0597561 Ga0501041_0597561_165_410 81
881 3300049584 Ga0501068_0186174 Ga0501068_0186174_918_1163 81
882 3300049590 Ga0501074_0912687 Ga0501074_0912687_170_415 81
883 3300049592 Ga0501076_0040451 Ga0501076_0040451_40_285 81
884 3300049593 Ga0501077_0571907 Ga0501077_0571907_423_668 81
885 3300049742 Ga0501080_0097690 Ga0501080_0097690_2327_2572 81
886 3300049822 Ga0501035_1191426 Ga0501035_1191426_17_262 81
887 3300049824 Ga0501045_0359545 Ga0501045_0359545_171_416 81
888 3300053084 Ga0495595_0008836 Ga0495595_0008836_1509_1760 81
889 3300053085 Ga0495619_0264311 Ga0495619_0264311_208_459 81
890 3300061734 Ga0530510_0341880 Ga0530510_0341880_60_305 81
891 2209111006 2214741331 2213749271 82
892 3300000043 ARcpr5yngRDRAFT_c002676 ARcpr5yngRDRAFT_0026762 82
893 3300000044 ARSoilOldRDRAFT_c001729 ARSoilOldRDRAFT_0017294 82
894 3300001991 JGI24743J22301_10095463 JGI24743J22301_100954631 82
895 3300004799 Ga0058863_10000400 Ga0058863_100004002 82
896 3300004800 Ga0058861_10036801 Ga0058861_100368011 82
897 3300004803 Ga0058862_10098273 Ga0058862_100982732 82
898 3300005327 Ga0070658_10164960 Ga0070658_101649602 82
899 3300005327 Ga0070658_10983869 Ga0070658_109838691 82
900 3300005329 Ga0070683_100065183 Ga0070683_1000651832 82
901 3300005329 Ga0070683_100120855 Ga0070683_1001208554 82
902 3300005334 Ga0068869_100308655 Ga0068869_1003086552 82
903 3300005334 Ga0068869_101838707 Ga0068869_1018387072 82
904 3300005336 Ga0070680_100007895 Ga0070680_1000078959 82
905 3300005336 Ga0070680_100147736 Ga0070680_1001477364 82
906 3300005337 Ga0070682_100108336 Ga0070682_1001083364 82
907 3300005337 Ga0070682_100471803 Ga0070682_1004718032 82
908 3300005338 Ga0068868_100415272 Ga0068868_1004152722 82
909 3300005339 Ga0070660_100400628 Ga0070660_1004006281 82
910 3300005339 Ga0070660_100405434 Ga0070660_1004054342 82
911 3300005339 Ga0070660_101558565 Ga0070660_1015585651 82
912 3300005341 Ga0070691_10372810 Ga0070691_103728102 82
913 3300005341 Ga0070691_10820831 Ga0070691_108208311 82
914 3300005343 Ga0070687_101357259 Ga0070687_1013572591 82
915 3300005344 Ga0070661_100014709 Ga0070661_1000147096 82
916 3300005344 Ga0070661_100419923 Ga0070661_1004199231 82
917 3300005345 Ga0070692_10240012 Ga0070692_102400122 82
918 3300005345 Ga0070692_10277631 Ga0070692_102776312 82
919 3300005353 Ga0070669_100061755 Ga0070669_1000617554 82
920 3300005354 Ga0070675_100331224 Ga0070675_1003312241 82
921 3300005356 Ga0070674_101767873 Ga0070674_1017678731 82
922 3300005366 Ga0070659_100046848 Ga0070659_1000468483 82
923 3300005366 Ga0070659_100069351 Ga0070659_1000693514 82
924 3300005366 Ga0070659_100134231 Ga0070659_1001342312 82
925 3300005441 Ga0070700_100270932 Ga0070700_1002709321 82
926 3300005444 Ga0070694_100450391 Ga0070694_1004503911 82
927 3300005444 Ga0070694_100594985 Ga0070694_1005949851 82
928 3300005444 Ga0070694_101352627 Ga0070694_1013526272 82
929 3300005455 Ga0070663_101279227 Ga0070663_1012792271 82
930 3300005456 Ga0070678_101980994 Ga0070678_1019809942 82
931 3300005457 Ga0070662_100019166 Ga0070662_1000191665 82
932 3300005457 Ga0070662_100048366 Ga0070662_1000483662 82
933 3300005458 Ga0070681_10072596 Ga0070681_100725964 82
934 3300005458 Ga0070681_10180469 Ga0070681_101804692 82
935 3300005459 Ga0068867_100707492 Ga0068867_1007074922 82
936 3300005459 Ga0068867_101133090 Ga0068867_1011330902 82
937 3300005466 Ga0070685_10517617 Ga0070685_105176172 82
938 3300005530 Ga0070679_100011289 Ga0070679_1000112892 82
939 3300005530 Ga0070679_100037511 Ga0070679_1000375114 82
940 3300005535 Ga0070684_100085253 Ga0070684_1000852532 82
941 3300005535 Ga0070684_100108143 Ga0070684_1001081433 82
942 3300005535 Ga0070684_101292044 Ga0070684_1012920442 82
943 3300005539 Ga0068853_100167491 Ga0068853_1001674914 82
944 3300005539 Ga0068853_101074489 Ga0068853_1010744892 82
945 3300005547 Ga0070693_100045096 Ga0070693_1000450964 82
946 3300005547 Ga0070693_100072121 Ga0070693_1000721214 82
947 3300005549 Ga0070704_100016961 Ga0070704_1000169614 82
948 3300005564 Ga0070664_100010761 Ga0070664_1000107613 82
949 3300005564 Ga0070664_100169043 Ga0070664_1001690433 82
950 3300005564 Ga0070664_100479900 Ga0070664_1004799002 82
951 3300005577 Ga0068857_100071647 Ga0068857_1000716475 82
952 3300005578 Ga0068854_100888177 Ga0068854_1008881772 82
953 3300005614 Ga0068856_100179207 Ga0068856_1001792074 82
954 3300005615 Ga0070702_101322173 Ga0070702_1013221732 82
955 3300005616 Ga0068852_100043051 Ga0068852_1000430515 82
956 3300005616 Ga0068852_100520762 Ga0068852_1005207622 82
957 3300005617 Ga0068859_101434378 Ga0068859_1014343782 82
958 3300005719 Ga0068861_100791987 Ga0068861_1007919872 82
959 3300005834 Ga0068851_10135097 Ga0068851_101350971 82
960 3300005834 Ga0068851_10330989 Ga0068851_103309893 82
961 3300005840 Ga0068870_10047359 Ga0068870_100473593 82
962 3300005840 Ga0068870_10498032 Ga0068870_104980322 82
963 3300005844 Ga0068862_100825068 Ga0068862_1008250682 82
964 3300005937 Ga0081455_10030348 Ga0081455_100303485 82
965 3300005937 Ga0081455_10197501 Ga0081455_101975013 82
966 3300006038 Ga0075365_10215918 Ga0075365_102159182 82
967 3300006042 Ga0075368_10386016 Ga0075368_103860162 82
968 3300006048 Ga0075363_100032780 Ga0075363_1000327803 82
969 3300006051 Ga0075364_10555882 Ga0075364_105558822 82
970 3300006058 Ga0075432_10002834 Ga0075432_100028345 82
971 3300006058 Ga0075432_10315263 Ga0075432_103152632 82
972 3300006178 Ga0075367_10395143 Ga0075367_103951432 82
973 3300006358 Ga0068871_101674327 Ga0068871_1016743272 82
974 3300006844 Ga0075428_100007037 Ga0075428_1000070374 82
975 3300006844 Ga0075428_101769432 Ga0075428_1017694322 82
976 3300006847 Ga0075431_100222939 Ga0075431_1002229393 82
977 3300006871 Ga0075434_100763109 Ga0075434_1007631092 82
978 3300006880 Ga0075429_100015672 Ga0075429_1000156725 82
979 3300006880 Ga0075429_101784490 Ga0075429_1017844902 82
980 3300006881 Ga0068865_100061189 Ga0068865_1000611892 82
981 3300006931 Ga0097620_101434349 Ga0097620_1014343492 82
982 3300009094 Ga0111539_12345987 Ga0111539_123459872 82
983 3300009098 Ga0105245_10002458 Ga0105245_100024589 82
984 3300009098 Ga0105245_10837010 Ga0105245_108370102 82
985 3300009147 Ga0114129_10006579 Ga0114129_100065795 82
986 3300009147 Ga0114129_12557994 Ga0114129_125579942 82
987 3300009148 Ga0105243_11125349 Ga0105243_111253492 82
988 3300009148 Ga0105243_11488103 Ga0105243_114881031 82
989 3300009553 Ga0105249_10167696 Ga0105249_101676964 82
990 3300010375 Ga0105239_10493149 Ga0105239_104931492 82
991 3300010375 Ga0105239_12667311 Ga0105239_126673111 82
992 3300011119 Ga0105246_10196226 Ga0105246_101962262 82
993 3300011119 Ga0105246_10251886 Ga0105246_102518863 82
994 3300011119 Ga0105246_10619270 Ga0105246_106192702 82
995 3300012488 Ga0157343_1011118 Ga0157343_10111182 82
996 3300012500 Ga0157314_1028173 Ga0157314_10281732 82
997 3300013100 Ga0157373_10577989 Ga0157373_105779892 82
998 3300013102 Ga0157371_10195844 Ga0157371_101958442 82
999 3300013104 Ga0157370_10795452 Ga0157370_107954522 82
1000 3300013105 Ga0157369_10104309 Ga0157369_101043094 82
1001 3300013307 Ga0157372_10105468 Ga0157372_101054681 82
1002 3300013308 Ga0157375_12548815 Ga0157375_125488152 82
1003 3300014325 Ga0163163_10587035 Ga0163163_105870351 82
1004 3300014325 Ga0163163_11973199 Ga0163163_119731992 82
1005 3300014745 Ga0157377_10001311 Ga0157377_1000131110 82
1006 3300014745 Ga0157377_10163634 Ga0157377_101636341 82
1007 3300017792 Ga0163161_11490969 Ga0163161_114909692 82
1008 3300020070 Ga0206356_10423462 Ga0206356_104234624 82
1009 3300020078 Ga0206352_10539032 Ga0206352_105390322 82
1010 3300020080 Ga0206350_10935077 Ga0206350_109350772 82
1011 3300020081 Ga0206354_11277640 Ga0206354_112776403 82
1012 3300022467 Ga0224712_10070446 Ga0224712_100704463 82
1013 3300025321 Ga0207656_10243534 Ga0207656_102435342 82
1014 3300025901 Ga0207688_10111828 Ga0207688_101118282 82
1015 3300025908 Ga0207643_10325628 Ga0207643_103256282 82
1016 3300025908 Ga0207643_10361395 Ga0207643_103613952 82
1017 3300025909 Ga0207705_10890455 Ga0207705_108904551 82
1018 3300025911 Ga0207654_11434169 Ga0207654_114341692 82
1019 3300025912 Ga0207707_10016045 Ga0207707_100160455 82
1020 3300025912 Ga0207707_10178775 Ga0207707_101787754 82
1021 3300025912 Ga0207707_10393042 Ga0207707_103930422 82
1022 3300025917 Ga0207660_10017237 Ga0207660_100172377 82
1023 3300025917 Ga0207660_10155820 Ga0207660_101558202 82
1024 3300025919 Ga0207657_10096050 Ga0207657_100960502 82
1025 3300025919 Ga0207657_10194098 Ga0207657_101940983 82
1026 3300025919 Ga0207657_10210994 Ga0207657_102109942 82
1027 3300025920 Ga0207649_10006520 Ga0207649_100065207 82
1028 3300025921 Ga0207652_10049961 Ga0207652_100499615 82
1029 3300025921 Ga0207652_10131826 Ga0207652_101318262 82
1030 3300025921 Ga0207652_10427981 Ga0207652_104279812 82
1031 3300025923 Ga0207681_10348453 Ga0207681_103484532 82
1032 3300025923 Ga0207681_10717210 Ga0207681_107172102 82
1033 3300025926 Ga0207659_10701790 Ga0207659_107017902 82
1034 3300025927 Ga0207687_10012133 Ga0207687_100121335 82
1035 3300025932 Ga0207690_10051083 Ga0207690_100510835 82
1036 3300025932 Ga0207690_10263376 Ga0207690_102633762 82
1037 3300025933 Ga0207706_10003040 Ga0207706_100030406 82
1038 3300025933 Ga0207706_10018100 Ga0207706_100181004 82
1039 3300025938 Ga0207704_10259544 Ga0207704_102595442 82
1040 3300025942 Ga0207689_11530401 Ga0207689_115304012 82
1041 3300025944 Ga0207661_10000612 Ga0207661_1000061213 82
1042 3300025944 Ga0207661_10036867 Ga0207661_100368676 82
1043 3300025944 Ga0207661_10277007 Ga0207661_102770072 82
1044 3300025944 Ga0207661_10377166 Ga0207661_103771661 82
1045 3300025945 Ga0207679_10117357 Ga0207679_101173573 82
1046 3300025945 Ga0207679_10217596 Ga0207679_102175962 82
1047 3300025945 Ga0207679_10710625 Ga0207679_107106252 82
1048 3300025945 Ga0207679_11340165 Ga0207679_113401651 82
1049 3300025972 Ga0207668_10029857 Ga0207668_100298571 82
1050 3300025981 Ga0207640_10496448 Ga0207640_104964482 82
1051 3300025981 Ga0207640_11348832 Ga0207640_113488322 82
1052 3300026023 Ga0207677_10895731 Ga0207677_108957311 82
1053 3300026041 Ga0207639_10519206 Ga0207639_105192062 82
1054 3300026041 Ga0207639_11199777 Ga0207639_111997772 82
1055 3300026067 Ga0207678_10438064 Ga0207678_104380642 82
1056 3300026075 Ga0207708_10015196 Ga0207708_100151963 82
1057 3300026078 Ga0207702_10074671 Ga0207702_100746714 82
1058 3300026089 Ga0207648_10185847 Ga0207648_101858472 82
1059 3300026089 Ga0207648_11628147 Ga0207648_116281472 82
1060 3300026095 Ga0207676_11662958 Ga0207676_116629582 82
1061 3300026116 Ga0207674_10031518 Ga0207674_100315182 82
1062 3300026116 Ga0207674_10060638 Ga0207674_100606382 82
1063 3300026142 Ga0207698_10052158 Ga0207698_100521585 82
1064 3300026142 Ga0207698_10069554 Ga0207698_100695546 82
1065 3300026142 Ga0207698_10096671 Ga0207698_100966712 82
1066 3300026142 Ga0207698_12233416 Ga0207698_122334162 82
1067 3300027717 Ga0209998_10052091 Ga0209998_100520912 82
1068 3300027866 Ga0209813_10469070 Ga0209813_104690702 82
1069 3300027907 Ga0207428_10002314 Ga0207428_1000231420 82
1070 3300027907 Ga0207428_10167268 Ga0207428_101672684 82
1071 3300028380 Ga0268265_11237955 Ga0268265_112379552 82
1072 3300031548 Ga0307408_100885856 Ga0307408_1008858562 82
1073 3300031731 Ga0307405_10804385 Ga0307405_108043852 82
1074 3300035241 Ga0373961_0081863 Ga0373961_0081863_604_852 82
1075 3300035691 Ga0373931_0260963 Ga0373931_0260963_334_582 82
1076 3300042122 Ga0450920_002200 Ga0450920_002200_2207_2455 82
1077 3300042125 Ga0450923_039659 Ga0450923_039659_106_354 82
1078 3300042134 Ga0450898_090077 Ga0450898_090077_374_622 82
1079 3300042137 Ga0450902_009145 Ga0450902_009145_337_585 82
1080 3300042145 Ga0450906_016580 Ga0450906_016580_1021_1269 82
1081 3300042157 Ga0439458_0044625 Ga0439458_0044625_207_455 82
1082 3300042439 Ga0439464_0295073 Ga0439464_0295073_134_382 82
1083 3300042530 Ga0450916_034239 Ga0450916_034239_57_305 82
1084 3300048905 Ga0496102_0527928 Ga0496102_0527928_63_311 82
1085 3300048906 Ga0496103_0160526 Ga0496103_0160526_10_258 82
1086 3300048907 Ga0496104_0027875 Ga0496104_0027875_345_593 82
1087 3300048907 Ga0496104_1355928 Ga0496104_1355928_19_267 82
1088 3300048910 Ga0496107_0429079 Ga0496107_0429079_408_656 82
1089 3300048911 Ga0496108_0019446 Ga0496108_0019446_500_748 82
1090 3300048911 Ga0496108_1568393 Ga0496108_1568393_169_417 82
1091 3300048912 Ga0496109_0002689 Ga0496109_0002689_3401_3649 82
1092 3300048912 Ga0496109_0522717 Ga0496109_0522717_363_611 82
1093 3300048912 Ga0496109_1882614 Ga0496109_1882614_13_261 82
1094 3300048913 Ga0496110_0033633 Ga0496110_0033633_2720_2968 82
1095 3300048914 Ga0496111_0003152 Ga0496111_0003152_4357_4605 82
1096 3300048915 Ga0496112_0148129 Ga0496112_0148129_1131_1379 82
1097 3300048917 Ga0496114_0127020 Ga0496114_0127020_1542_1790 82
1098 3300048917 Ga0496114_0489201 Ga0496114_0489201_536_784 82
1099 3300049568 Ga0501031_0152337 Ga0501031_0152337_743_991 82
1100 3300049569 Ga0501032_0175329 Ga0501032_0175329_713_961 82
1101 3300049574 Ga0501038_1013005 Ga0501038_1013005_343_591 82
1102 3300049575 Ga0501039_0067408 Ga0501039_0067408_1330_1578 82
1103 3300049576 Ga0501040_0117512 Ga0501040_0117512_1283_1531 82
1104 3300049578 Ga0501042_0242329 Ga0501042_0242329_39_287 82
1105 3300049579 Ga0501043_0363906 Ga0501043_0363906_592_840 82
1106 3300049580 Ga0501046_0287854 Ga0501046_0287854_911_1159 82
1107 3300049582 Ga0501048_0190743 Ga0501048_0190743_648_896 82
1108 3300049584 Ga0501068_0147984 Ga0501068_0147984_334_582 82
1109 3300049585 Ga0501069_0084634 Ga0501069_0084634_1049_1297 82
1110 3300049586 Ga0501070_0330457 Ga0501070_0330457_184_432 82
1111 3300049587 Ga0501071_0128945 Ga0501071_0128945_884_1132 82
1112 3300049588 Ga0501072_0024283 Ga0501072_0024283_4253_4501 82
1113 3300049590 Ga0501074_0083713 Ga0501074_0083713_1133_1381 82
1114 3300049591 Ga0501075_0246283 Ga0501075_0246283_772_1020 82
1115 3300049592 Ga0501076_0134821 Ga0501076_0134821_1526_1774 82
1116 3300049593 Ga0501077_0023420 Ga0501077_0023420_3478_3726 82
1117 3300049593 Ga0501077_0361937 Ga0501077_0361937_431_679 82
1118 3300049741 Ga0501079_0027218 Ga0501079_0027218_1559_1807 82
1119 3300049742 Ga0501080_0357664 Ga0501080_0357664_435_683 82
1120 3300049743 Ga0501081_0122242 Ga0501081_0122242_931_1179 82
1121 3300049744 Ga0501083_0311954 Ga0501083_0311954_743_991 82
1122 3300049822 Ga0501035_0603218 Ga0501035_0603218_454_702 82
1123 3300049823 Ga0501044_0773261 Ga0501044_0773261_117_365 82
1124 3300049824 Ga0501045_0045530 Ga0501045_0045530_226_474 82
1125 3300050490 nmdc:mga03n38_33083_c1 nmdc:mga03n38_33083_c1_887_1135 82
1126 3300050491 nmdc:mga00v17_149210_c1 nmdc:mga00v17_149210_c1_443_691 82
1127 3300050492 nmdc:mga0yw44_686432_c1 nmdc:mga0yw44_686432_c1_331_579 82
1128 3300050495 nmdc:mga04h51_141322_c1 nmdc:mga04h51_141322_c1_262_510 82
1129 3300050507 nmdc:mga05p37_22081_c1 nmdc:mga05p37_22081_c1_3063_3311 82
1130 3300050507 nmdc:mga05p37_247142_c1 nmdc:mga05p37_247142_c1_1737_1985 82
1131 3300050508 nmdc:mga09592_1365894_c1 nmdc:mga09592_1365894_c1_107_355 82
1132 3300050508 nmdc:mga09592_28987_c1 nmdc:mga09592_28987_c1_171_419 82
1133 3300050510 nmdc:mga06r32_1344820_c1 nmdc:mga06r32_1344820_c1_268_516 82
1134 3300050511 nmdc:mga08y16_1169611_c1 nmdc:mga08y16_1169611_c1_167_415 82
1135 3300050511 nmdc:mga08y16_74927_c1 nmdc:mga08y16_74927_c1_332_580 82
1136 3300050512 nmdc:mga0n895_1074783_c1 nmdc:mga0n895_1074783_c1_81_329 82
1137 3300050515 nmdc:mga0a205_90715_c1 nmdc:mga0a205_90715_c1_1012_1260 82
1138 3300054114 Ga0501084_0402064 Ga0501084_0402064_663_911 82
1139 3300060353 Ga0501082_0096947 Ga0501082_0096947_595_843 82
1140 3300061734 Ga0530510_0080521 Ga0530510_0080521_171_419 82

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

9

43

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wr6-assembly4.cif.gz_D crystal structure of gga3 gat domain in complex with ubiquitin 0.6136 4 41
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.5911 7 71
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.5843 8 72
5vr3-assembly1.cif.gz_A crystal structure of the brs domain of braf 0.5703 3 44
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.551 7 71
ID Description Score Start End Superfamily
af_A0A0R4ISY9_209_303_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6204 4 41 1.20.58.160
af_Q91XE8_17_119_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6105 5 50 1.20.120.550
af_Q9VJH8_36_256_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5853 1 29 3.40.50.2000
af_Q59LF3_2_249_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5448 5 49 1.20.1270.60
af_A0A1D6GCT6_95_259_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5436 4 45 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A5Q4ET84-F1-model_v4 HEAT repeat domain-containing protein 0.6209 4 78
AF-A0A127SLD7-F1-model_v4 Putative zinc-finger 0.6057 4 73
AF-A0A7V5P3K1-F1-model_v4 Zf-HC2 domain-containing protein 0.587 3 73 GO:0016020
AF-A0A127SLD7-F1-model_v4 Putative zinc-finger 0.5854 4 73
AF-A0A654E1M7-F1-model_v4 Mycothiol system anti-sigma-R factor 0.5842 2 75

Feature Viewer

pLDDT pTM Quality
82.68 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map