F490700

General Info

Members Datasets Scaffolds Average Seq Length
1140 428 2280 346

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10003270|Ga0207652_1000327012
Length 407
Sequence MSVFPHKNGTASLLPIHSNRRFALNVCEQSCARSRRDLWEQDGVIGIKNGVFCILACSQRSYSEAMYNAKAFSAASATSPLASTTIARRDPTETDVQIEILFCGICHSDLHQVRNEWSGVMPTVYPCIPGHEIVGRVTSVGSAVTKFKAGDLAAVGCMVDSDGTCPECKAGFEQFCPNMTLTYNFPDKHTGGVTYGGYSDSVVVDERFVLKVPSNLDLAGAAPLLCAGITTYSPMHHWGVTKGNKVGIVKFAHALGAHTVLFTTSPNKVEDALRLGADEVVLSRDANQMAKHAGSFDFILDAVSADHDINALLGLLRRDGNLCLVGAPEKPLAVSAFNLLFGRRSLSGSPIGGIAETQEMLDFCGQHNLTADVEVIAIQQVNEAYERLLKADVKYRFSIDMASLKSA

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
270 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
275 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
276 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
279 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
280 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
281 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
282 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
283 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
353 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
376 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
377 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
378 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
379 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
385 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
386 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
400 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
403 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
404 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
405 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
414 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
415 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
425 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
426 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
427 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
428 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 1.67
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 3.33
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10003270 3300025921 Bacteria 13425
2 ARcpr5yngRDRAFT_c001556 3300000043 Archaea 2514
3 ARSoilOldRDRAFT_c000399 3300000044 Archaea 5337
4 LJNas_1001054 3300000546 Bacteria 4318
5 JGI24034J26672_10000002 3300002239 Bacteria 925353
6 JGI24751J29686_10000233 3300002459 Bacteria 22750
7 JGI24751J29686_10008629 3300002459 Bacteria 2087
8 JGI25156J39149_1006441 3300002705 Bacteria 3207
9 JGI25157J39369_1003469 3300002741 Bacteria 3207
10 JGI25406J46586_10000065 3300003203 Bacteria 48566
11 JGI25406J46586_10002954 3300003203 Bacteria 8019
12 rootH2_10060039 3300003320 Bacteria 4067
13 JGI26144J50225_100489 3300003380 Bacteria 1484
14 JGI25404J52841_10002499 3300003659 Bacteria 3488
15 Ga0055529_1004004 3300003763 Bacteria 2311
16 Ga0058863_11511870 3300004799 Bacteria 1596
17 Ga0058862_12777708 3300004803 Bacteria 1814
18 Ga0065716_1000318 3300005277 Bacteria 3780
19 Ga0065714_10064426 3300005288 Bacteria 186606
20 Ga0065704_10007764 3300005289 Bacteria 2527
21 Ga0065712_10067732 3300005290 Bacteria 130748
22 Ga0065712_10075433 3300005290 Bacteria 3864
23 Ga0065712_10094064 3300005290 Bacteria 2269
24 Ga0065712_10116389 3300005290 Bacteria 1736
25 Ga0065712_10200756 3300005290 Bacteria 1109
26 Ga0065715_10089198 3300005293 Bacteria 12701
27 Ga0065715_10142034 3300005293 Bacteria 1839
28 Ga0065707_10022085 3300005295 Bacteria 3331
29 Ga0065707_10140090 3300005295 Bacteria 1785
30 Ga0065707_10187479 3300005295 Bacteria 1370
31 Ga0070658_10004860 3300005327 Bacteria 10942
32 Ga0070658_10126546 3300005327 Bacteria 2127
33 Ga0070676_10068868 3300005328 Bacteria 2119
34 Ga0070676_10089491 3300005328 Bacteria 1883
35 Ga0070683_100000031 3300005329 Bacteria 150779
36 Ga0070683_100008679 3300005329 Bacteria 8640
37 Ga0070683_100022911 3300005329 Bacteria 5583
38 Ga0070683_100234141 3300005329 Bacteria 1746
39 Ga0070683_100253829 3300005329 Bacteria 1672
40 Ga0070690_100026972 3300005330 Bacteria 3548
41 Ga0070690_100073932 3300005330 Bacteria 2218
42 Ga0070690_100088229 3300005330 Bacteria 2038
43 Ga0070690_100170826 3300005330 Bacteria 1496
44 Ga0070670_100000688 3300005331 Bacteria 26251
45 Ga0070670_100038640 3300005331 Bacteria 4104
46 Ga0070670_100092794 3300005331 Bacteria 2596
47 Ga0070670_100180189 3300005331 Bacteria 1834
48 Ga0070666_10001918 3300005335 Bacteria 12652
49 Ga0070666_10010934 3300005335 Bacteria 5687
50 Ga0070666_10020033 3300005335 Bacteria 4322
51 Ga0070666_10066056 3300005335 Bacteria 2454
52 Ga0070682_100000347 3300005337 Bacteria 31681
53 Ga0070682_100030096 3300005337 Bacteria 3274
54 Ga0070682_100177012 3300005337 Bacteria 1487
55 Ga0068868_100159430 3300005338 Bacteria 1862
56 Ga0068868_100236221 3300005338 Bacteria 1535
57 Ga0070660_100059320 3300005339 Bacteria 2967
58 Ga0070660_100153588 3300005339 Bacteria 1852
59 Ga0070660_100207527 3300005339 Bacteria 1590
60 Ga0070689_100088810 3300005340 Bacteria 2434
61 Ga0070689_100125832 3300005340 Bacteria 2051
62 Ga0070687_100124091 3300005343 Bacteria 1481
63 Ga0070661_100000055 3300005344 Bacteria 88266
64 Ga0070661_100006128 3300005344 Bacteria 8278
65 Ga0070661_100018950 3300005344 Bacteria 4901
66 Ga0070692_10038710 3300005345 Bacteria 2432
67 Ga0070668_100190282 3300005347 Bacteria 1680
68 Ga0070668_100360656 3300005347 Bacteria 1232
69 Ga0070669_100000023 3300005353 Bacteria 174496
70 Ga0070669_100025331 3300005353 Bacteria 4260
71 Ga0070669_100187896 3300005353 Bacteria 1619
72 Ga0070669_100207706 3300005353 Bacteria 1543
73 Ga0070675_100011925 3300005354 Bacteria 6810
74 Ga0070675_100122582 3300005354 Bacteria 2209
75 Ga0070675_100133244 3300005354 Bacteria 2119
76 Ga0070671_100009139 3300005355 Bacteria 7958
77 Ga0070671_100021272 3300005355 Bacteria 5299
78 Ga0070671_100049868 3300005355 Bacteria 3482
79 Ga0070671_100127440 3300005355 Bacteria 2143
80 Ga0070671_100287862 3300005355 Bacteria 1398
81 Ga0070674_100008654 3300005356 Bacteria 6067
82 Ga0070673_100000385 3300005364 Bacteria 23206
83 Ga0070659_100023815 3300005366 Bacteria 4688
84 Ga0070659_100328874 3300005366 Bacteria 1279
85 Ga0070667_100100475 3300005367 Bacteria 2498
86 Ga0070667_100100873 3300005367 Bacteria 2493
87 Ga0070667_100191618 3300005367 Bacteria 1811
88 Ga0070667_100206793 3300005367 Bacteria 1743
89 Ga0070667_100242939 3300005367 Bacteria 1608
90 Ga0070667_100258595 3300005367 Bacteria 1558
91 Ga0070703_10000798 3300005406 Bacteria 10311
92 Ga0070709_10000039 3300005434 Bacteria 108771
93 Ga0070709_10011466 3300005434 Archaea 4941
94 Ga0070709_10029380 3300005434 Bacteria 3288
95 Ga0070709_10112178 3300005434 Bacteria 1834
96 Ga0070714_100007032 3300005435 Bacteria 8721
97 Ga0070714_100013704 3300005435 Bacteria 6502
98 Ga0070714_100054675 3300005435 Bacteria 3411
99 Ga0070713_100001464 3300005436 Bacteria 15081
100 Ga0070713_100002736 3300005436 Bacteria 11521
101 Ga0070713_100075736 3300005436 Bacteria 2855
102 Ga0070713_100114361 3300005436 Bacteria 2358
103 Ga0070713_100172970 3300005436 Bacteria 1936
104 Ga0070713_100204404 3300005436 Bacteria 1785
105 Ga0070713_100254169 3300005436 Bacteria 1604
106 Ga0070713_100374186 3300005436 Bacteria 1326
107 Ga0070713_100430557 3300005436 Bacteria 1236
108 Ga0070710_10022157 3300005437 Archaea 3320
109 Ga0070710_10024129 3300005437 Bacteria 3205
110 Ga0070710_10099253 3300005437 Bacteria 1731
111 Ga0070711_100000225 3300005439 Bacteria 29822
112 Ga0070711_100080116 3300005439 Bacteria 2324
113 Ga0070711_100115172 3300005439 Archaea 1979
114 Ga0070711_100124959 3300005439 Bacteria 1908
115 Ga0070711_100128224 3300005439 Bacteria 1886
116 Ga0070705_100036058 3300005440 Bacteria 2777
117 Ga0070705_100066479 3300005440 Bacteria 2162
118 Ga0070705_100115458 3300005440 Bacteria 1724
119 Ga0070700_100059212 3300005441 Bacteria 2410
120 Ga0070694_100072569 3300005444 Bacteria 2375
121 Ga0070708_100009638 3300005445 Bacteria 7789
122 Ga0070708_100038650 3300005445 Bacteria 4170
123 Ga0070708_100407723 3300005445 Bacteria 1282
124 Ga0070663_100006248 3300005455 Bacteria 7142
125 Ga0070663_100069213 3300005455 Bacteria 2563
126 Ga0070678_100002567 3300005456 Bacteria 9973
127 Ga0070678_100081635 3300005456 Bacteria 2452
128 Ga0070678_100085922 3300005456 Bacteria 2398
129 Ga0070678_100157094 3300005456 Bacteria 1838
130 Ga0070678_100233803 3300005456 Bacteria 1534
131 Ga0070662_100313278 3300005457 Bacteria 1278
132 Ga0070681_10074222 3300005458 Bacteria 3362
133 Ga0070681_10261553 3300005458 Bacteria 1642
134 Ga0070685_10010854 3300005466 Bacteria 4747
135 Ga0070685_10051395 3300005466 Archaea 2383
136 Ga0070706_100000131 3300005467 Bacteria 92723
137 Ga0070706_100018749 3300005467 Bacteria 6380
138 Ga0070706_100028059 3300005467 Bacteria 5180
139 Ga0070706_100053627 3300005467 Bacteria 3721
140 Ga0070706_100289634 3300005467 Bacteria 1528
141 Ga0070698_100007615 3300005471 Bacteria 11719
142 Ga0070698_100010085 3300005471 Bacteria 10090
143 Ga0070698_100016313 3300005471 Bacteria 7842
144 Ga0070699_100000009 3300005518 Bacteria 272902
145 Ga0070699_100033175 3300005518 Bacteria 4460
146 Ga0070699_100047435 3300005518 Bacteria 3717
147 Ga0070679_100004900 3300005530 Bacteria 12345
148 Ga0070679_100325805 3300005530 Bacteria 1485
149 Ga0070679_100371267 3300005530 Bacteria 1378
150 Ga0070684_100000030 3300005535 Bacteria 107248
151 Ga0070684_100010128 3300005535 Bacteria 7454
152 Ga0070684_100019042 3300005535 Archaea 5672
153 Ga0070684_100259344 3300005535 Bacteria 1590
154 Ga0070697_100010791 3300005536 Bacteria 7134
155 Ga0070697_100076502 3300005536 Bacteria 2753
156 Ga0070697_100143626 3300005536 Bacteria 2008
157 Ga0070697_100342648 3300005536 Bacteria 1290
158 Ga0068853_100000108 3300005539 Bacteria 55985
159 Ga0068853_100000635 3300005539 Bacteria 24029
160 Ga0070672_100001906 3300005543 Bacteria 13072
161 Ga0070672_100018779 3300005543 Bacteria 5007
162 Ga0070672_100025876 3300005543 Bacteria 4359
163 Ga0070672_100113429 3300005543 Bacteria 2212
164 Ga0070672_100351734 3300005543 Bacteria 1256
165 Ga0070695_100014494 3300005545 Bacteria 4752
166 Ga0070696_100000136 3300005546 Bacteria 39907
167 Ga0070696_100024739 3300005546 Bacteria 4081
168 Ga0070696_100181736 3300005546 Bacteria 1561
169 Ga0070693_100010008 3300005547 Bacteria 4732
170 Ga0070693_100287697 3300005547 Bacteria 1103
171 Ga0070665_100027074 3300005548 Bacteria 5774
172 Ga0070665_100147492 3300005548 Bacteria 2355
173 Ga0070665_100193326 3300005548 Bacteria 2035
174 Ga0070665_100531735 3300005548 Bacteria 1187
175 Ga0068855_100003669 3300005563 Bacteria 18779
176 Ga0068855_100004022 3300005563 Bacteria 17947
177 Ga0068855_100012713 3300005563 Bacteria 10153
178 Ga0068855_100018921 3300005563 Bacteria 8278
179 Ga0068855_100028545 3300005563 Bacteria 6675
180 Ga0068855_100043088 3300005563 Bacteria 5347
181 Ga0068855_100089705 3300005563 Bacteria 3549
182 Ga0068855_100106728 3300005563 Bacteria 3218
183 Ga0068857_100016940 3300005577 Bacteria 6385
184 Ga0068857_100017552 3300005577 Bacteria 6274
185 Ga0068857_100035636 3300005577 Bacteria 4407
186 Ga0068854_100099374 3300005578 Bacteria 2179
187 Ga0068856_100000408 3300005614 Bacteria 47282
188 Ga0068856_100003746 3300005614 Bacteria 15243
189 Ga0068856_100012673 3300005614 Bacteria 8163
190 Ga0068856_100013228 3300005614 Bacteria 7992
191 Ga0068856_100111800 3300005614 Bacteria 2729
192 Ga0070702_100052249 3300005615 Bacteria 2343
193 Ga0068852_100000234 3300005616 Bacteria 37575
194 Ga0068852_100000599 3300005616 Bacteria 23630
195 Ga0068852_100084244 3300005616 Bacteria 2829
196 Ga0068852_100094164 3300005616 Bacteria 2686
197 Ga0068859_100000016 3300005617 Bacteria 261719
198 Ga0068859_100024921 3300005617 Bacteria 6004
199 Ga0068859_100025105 3300005617 Bacteria 5981
200 Ga0068859_100121876 3300005617 Bacteria 2674
201 Ga0068859_100153608 3300005617 Bacteria 2378
202 Ga0068859_100215522 3300005617 Bacteria 2007
203 Ga0068859_100281856 3300005617 Bacteria 1755
204 Ga0068864_100006197 3300005618 Bacteria 9805
205 Ga0068864_100009787 3300005618 Bacteria 7904
206 Ga0068864_100078445 3300005618 Bacteria 2890
207 Ga0068864_100105441 3300005618 Bacteria 2505
208 Ga0068864_100123187 3300005618 Bacteria 2321
209 Ga0068864_100140689 3300005618 Bacteria 2176
210 Ga0068864_100245975 3300005618 Bacteria 1659
211 Ga0068866_10073156 3300005718 Bacteria 1818
212 Ga0068861_100062317 3300005719 Bacteria 2864
213 Ga0068851_10003565 3300005834 Bacteria 6933
214 Ga0068851_10008995 3300005834 Bacteria 4634
215 Ga0068851_10048224 3300005834 Bacteria 2159
216 Ga0068863_100031542 3300005841 Bacteria 5056
217 Ga0068863_100046447 3300005841 Bacteria 4121
218 Ga0068863_100141855 3300005841 Bacteria 2297
219 Ga0068863_100160866 3300005841 Bacteria 2151
220 Ga0068863_100162014 3300005841 Bacteria 2143
221 Ga0068863_100195773 3300005841 Bacteria 1943
222 Ga0068863_100244694 3300005841 Bacteria 1732
223 Ga0068863_100262960 3300005841 Bacteria 1668
224 Ga0068863_100280606 3300005841 Bacteria 1614
225 Ga0068863_100386836 3300005841 Bacteria 1366
226 Ga0068858_100000008 3300005842 Bacteria 238361
227 Ga0068858_100050397 3300005842 Bacteria 3854
228 Ga0068858_100078741 3300005842 Bacteria 3062
229 Ga0068858_100085695 3300005842 Bacteria 2931
230 Ga0068858_100100162 3300005842 Bacteria 2702
231 Ga0068858_100151613 3300005842 Bacteria 2180
232 Ga0068858_100215275 3300005842 Bacteria 1819
233 Ga0068858_100247213 3300005842 Bacteria 1694
234 Ga0068858_100253899 3300005842 Bacteria 1670
235 Ga0068860_100017093 3300005843 Bacteria 7071
236 Ga0068860_100122386 3300005843 Bacteria 2492
237 Ga0068860_100401371 3300005843 Bacteria 1356
238 Ga0068862_100000425 3300005844 Bacteria 45885
239 Ga0068862_100036013 3300005844 Bacteria 4192
240 Ga0068862_100095758 3300005844 Bacteria 2590
241 Ga0068862_100371831 3300005844 Bacteria 1331
242 Ga0081455_10009500 3300005937 Bacteria 9994
243 Ga0081455_10050949 3300005937 Bacteria 3555
244 Ga0081455_10149124 3300005937 Bacteria 1805
245 Ga0081540_1000560 3300005983 Bacteria 36099
246 Ga0081540_1050005 3300005983 Bacteria 2080
247 Ga0081539_10000647 3300005985 Bacteria 70112
248 Ga0081539_10001121 3300005985 Bacteria 48615
249 Ga0070717_10001781 3300006028 Bacteria 15018
250 Ga0070717_10019574 3300006028 Bacteria 5311
251 Ga0070717_10020888 3300006028 Bacteria 5155
252 Ga0070717_10046477 3300006028 Bacteria 3552
253 Ga0070717_10098598 3300006028 Bacteria 2477
254 Ga0070717_10157615 3300006028 Bacteria 1968
255 Ga0070715_10010166 3300006163 Bacteria 3345
256 Ga0070715_10045941 3300006163 Bacteria 1854
257 Ga0070716_100018244 3300006173 Bacteria 3652
258 Ga0070716_100041273 3300006173 Archaea 2570
259 Ga0070716_100075652 3300006173 Bacteria 1993
260 Ga0070712_100001263 3300006175 Bacteria 15280
261 Ga0070712_100006323 3300006175 Bacteria 7344
262 Ga0070712_100107766 3300006175 Bacteria 2073
263 Ga0097621_100016407 3300006237 Bacteria 5600
264 Ga0097621_100022381 3300006237 Bacteria 4906
265 Ga0097621_100343149 3300006237 Bacteria 1326
266 Ga0068871_100030665 3300006358 Bacteria 4237
267 Ga0068871_100048940 3300006358 Bacteria 3414
268 Ga0068871_100135326 3300006358 Bacteria 2092
269 Ga0075428_100071511 3300006844 Archaea 3791
270 Ga0075428_100193412 3300006844 Bacteria 2200
271 Ga0075430_100002212 3300006846 Bacteria 16123
272 Ga0075430_100031247 3300006846 Bacteria 4519
273 Ga0075430_100129829 3300006846 Bacteria 2100
274 Ga0075430_100167609 3300006846 Archaea 1827
275 Ga0075431_100035241 3300006847 Archaea 5152
276 Ga0075431_100127325 3300006847 Bacteria 2628
277 Ga0075431_100190758 3300006847 Bacteria 2100
278 Ga0075433_10024007 3300006852 Bacteria 5140
279 Ga0075434_100177251 3300006871 Bacteria 2151
280 Ga0075434_100296961 3300006871 Bacteria 1636
281 Ga0075429_100009967 3300006880 Bacteria 8235
282 Ga0075429_100071950 3300006880 Archaea 3011
283 Ga0075436_100021577 3300006914 Bacteria 4421
284 Ga0097620_100000016 3300006931 Bacteria 261719
285 Ga0097620_100024921 3300006931 Bacteria 6004
286 Ga0097620_100025106 3300006931 Bacteria 5981
287 Ga0097620_100121876 3300006931 Bacteria 2674
288 Ga0097620_100153613 3300006931 Bacteria 2378
289 Ga0097620_100215524 3300006931 Bacteria 2007
290 Ga0097620_100281875 3300006931 Bacteria 1755
291 Ga0099794_10053035 3300007265 Bacteria 1955
292 Ga0105240_10000060 3300009093 Bacteria 219839
293 Ga0105240_10000166 3300009093 Bacteria 134735
294 Ga0105240_10004201 3300009093 Bacteria 22030
295 Ga0105240_10013037 3300009093 Bacteria 11442
296 Ga0105240_10045314 3300009093 Bacteria 5580
297 Ga0105240_10098903 3300009093 Bacteria 3552
298 Ga0105240_10204825 3300009093 Bacteria 2310
299 Ga0105240_10243846 3300009093 Bacteria 2082
300 Ga0111539_10008568 3300009094 Bacteria 12983
301 Ga0111539_10091985 3300009094 Bacteria 3564
302 Ga0111539_10105841 3300009094 Bacteria 3300
303 Ga0111539_10120853 3300009094 Plasmid 3069
304 Ga0111539_10248974 3300009094 Bacteria 2069
305 Ga0105245_10007338 3300009098 Bacteria 9654
306 Ga0105245_10026955 3300009098 Bacteria 5060
307 Ga0105245_10079682 3300009098 Bacteria 2991
308 Ga0105245_10216712 3300009098 Bacteria 1845
309 Ga0105247_10000001 3300009101 Bacteria 739726
310 Ga0105247_10031476 3300009101 Bacteria 3219
311 Ga0105247_10298087 3300009101 Bacteria 1117
312 Ga0114129_10017754 3300009147 Bacteria 10131
313 Ga0114129_10025752 3300009147 Bacteria 8333
314 Ga0114129_10042110 3300009147 Bacteria 6431
315 Ga0114129_10164202 3300009147 Archaea 3032
316 Ga0114129_10509965 3300009147 Bacteria 1569
317 Ga0105243_10000344 3300009148 Bacteria 50059
318 Ga0105243_10136167 3300009148 Bacteria 2090
319 Ga0105241_10000383 3300009174 Bacteria 33616
320 Ga0105241_10012596 3300009174 Bacteria 6204
321 Ga0105241_10019513 3300009174 Bacteria 4999
322 Ga0105241_10027715 3300009174 Bacteria 4218
323 Ga0105242_10001266 3300009176 Bacteria 19956
324 Ga0105242_10007464 3300009176 Bacteria 8416
325 Ga0105242_10403251 3300009176 Bacteria 1277
326 Ga0105248_10000003 3300009177 Bacteria 1019601
327 Ga0105248_10005255 3300009177 Bacteria 14254
328 Ga0105248_10028964 3300009177 Bacteria 6173
329 Ga0105248_10034308 3300009177 Bacteria 5672
330 Ga0105248_10036829 3300009177 Bacteria 5472
331 Ga0105248_10042745 3300009177 Bacteria 5082
332 Ga0105248_10064342 3300009177 Bacteria 4118
333 Ga0105237_10000163 3300009545 Bacteria 94679
334 Ga0105237_10139725 3300009545 Bacteria 2416
335 Ga0105237_10196891 3300009545 Bacteria 2015
336 Ga0105238_10000710 3300009551 Bacteria 34798
337 Ga0105238_10001915 3300009551 Bacteria 20880
338 Ga0105238_10004919 3300009551 Bacteria 13224
339 Ga0105238_10015258 3300009551 Bacteria 7778
340 Ga0105238_10042251 3300009551 Bacteria 4617
341 Ga0105238_10142273 3300009551 Bacteria 2375
342 Ga0105238_10166809 3300009551 Bacteria 2178
343 Ga0105238_10325243 3300009551 Bacteria 1524
344 Ga0105249_10010647 3300009553 Bacteria 8078
345 Ga0105249_10011728 3300009553 Bacteria 7707
346 Ga0105249_10106798 3300009553 Bacteria 2642
347 Ga0105249_10125511 3300009553 Bacteria 2443
348 Ga0105249_10152117 3300009553 Bacteria 2229
349 Ga0105239_10007680 3300010375 Bacteria 12350
350 Ga0105239_10014324 3300010375 Bacteria 8798
351 Ga0105239_10017583 3300010375 Bacteria 7908
352 Ga0105239_10022558 3300010375 Bacteria 6941
353 Ga0105239_10028637 3300010375 Bacteria 6124
354 Ga0105246_10006614 3300011119 Bacteria 7083
355 Ga0105246_10218498 3300011119 Bacteria 1492
356 Ga0105246_10266065 3300011119 Bacteria 1368
357 Ga0105246_10346656 3300011119 Bacteria 1216
358 Ga0157373_10017490 3300013100 Bacteria 5221
359 Ga0157371_10199480 3300013102 Bacteria 1434
360 Ga0157371_10254448 3300013102 Bacteria 1265
361 Ga0157370_10000139 3300013104 Bacteria 87840
362 Ga0157370_10027580 3300013104 Bacteria 5599
363 Ga0157370_10131507 3300013104 Bacteria 2334
364 Ga0157369_10000079 3300013105 Bacteria 134893
365 Ga0157369_10002833 3300013105 Bacteria 20696
366 Ga0157369_10005321 3300013105 Bacteria 14997
367 Ga0157369_10005381 3300013105 Bacteria 14906
368 Ga0157369_10014871 3300013105 Bacteria 8784
369 Ga0157369_10016614 3300013105 Bacteria 8274
370 Ga0157369_10021389 3300013105 Bacteria 7236
371 Ga0157369_10024091 3300013105 Bacteria 6774
372 Ga0157369_10060830 3300013105 Bacteria 4072
373 Ga0157369_10102224 3300013105 Bacteria 3054
374 Ga0157369_10519835 3300013105 Bacteria 1231
375 Ga0157374_10002079 3300013296 Bacteria 16850
376 Ga0157374_10002768 3300013296 Bacteria 14718
377 Ga0157374_10010430 3300013296 Bacteria 7988
378 Ga0157374_10011582 3300013296 Bacteria 7644
379 Ga0157374_10015604 3300013296 Bacteria 6667
380 Ga0157374_10059851 3300013296 Bacteria 3563
381 Ga0157374_10076509 3300013296 Bacteria 3165
382 Ga0157374_10127327 3300013296 Bacteria 2462
383 Ga0157374_10433572 3300013296 Bacteria 1314
384 Ga0157378_10000019 3300013297 Bacteria 132704
385 Ga0157378_10003965 3300013297 Bacteria 13078
386 Ga0157378_10015715 3300013297 Bacteria 6629
387 Ga0157378_10027554 3300013297 Bacteria 5012
388 Ga0157378_10042866 3300013297 Bacteria 4017
389 Ga0157378_10078813 3300013297 Bacteria 2973
390 Ga0157378_10200127 3300013297 Bacteria 1889
391 Ga0157378_10224682 3300013297 Bacteria 1786
392 Ga0157378_10381486 3300013297 Bacteria 1384
393 Ga0163162_10010125 3300013306 Bacteria 9163
394 Ga0163162_10013020 3300013306 Bacteria 8118
395 Ga0163162_10075653 3300013306 Bacteria 3427
396 Ga0163162_10218628 3300013306 Bacteria 2035
397 Ga0163162_10407171 3300013306 Bacteria 1493
398 Ga0163162_10535788 3300013306 Bacteria 1300
399 Ga0157372_10000101 3300013307 Bacteria 89344
400 Ga0157372_10013100 3300013307 Bacteria 8847
401 Ga0157372_10015595 3300013307 Bacteria 8147
402 Ga0157372_10016255 3300013307 Bacteria 7986
403 Ga0157372_10017037 3300013307 Bacteria 7800
404 Ga0157372_10022915 3300013307 Bacteria 6763
405 Ga0157372_10036318 3300013307 Bacteria 5430
406 Ga0157372_10041549 3300013307 Bacteria 5085
407 Ga0157372_10051907 3300013307 Bacteria 4564
408 Ga0157372_10144086 3300013307 Bacteria 2747
409 Ga0157375_10000560 3300013308 Bacteria 33418
410 Ga0157375_10005673 3300013308 Bacteria 10862
411 Ga0157375_10011769 3300013308 Bacteria 7736
412 Ga0157375_10038820 3300013308 Bacteria 4576
413 Ga0157375_10043115 3300013308 Bacteria 4373
414 Ga0157375_10057446 3300013308 Bacteria 3847
415 Ga0157375_10079346 3300013308 Bacteria 3318
416 Ga0157375_10086066 3300013308 Bacteria 3193
417 Ga0157375_10092613 3300013308 Bacteria 3086
418 Ga0157375_10172709 3300013308 Bacteria 2310
419 Ga0157375_10224438 3300013308 Bacteria 2038
420 Ga0157375_10464062 3300013308 Bacteria 1432
421 Ga0157375_10565792 3300013308 Bacteria 1297
422 Ga0163163_10010210 3300014325 Bacteria 8431
423 Ga0163163_10053291 3300014325 Bacteria 3993
424 Ga0163163_10072035 3300014325 Bacteria 3444
425 Ga0163163_10081964 3300014325 Bacteria 3229
426 Ga0163163_10084728 3300014325 Bacteria 3176
427 Ga0163163_10104549 3300014325 Bacteria 2857
428 Ga0163163_10139706 3300014325 Bacteria 2464
429 Ga0163163_10314985 3300014325 Bacteria 1618
430 Ga0157380_10035473 3300014326 Bacteria 3853
431 Ga0157380_10116764 3300014326 Bacteria 2253
432 Ga0157377_10063295 3300014745 Archaea 2119
433 Ga0157379_10006136 3300014968 Bacteria 10347
434 Ga0157379_10079767 3300014968 Bacteria 2932
435 Ga0157379_10115265 3300014968 Bacteria 2416
436 Ga0157376_10017159 3300014969 Bacteria 5514
437 Ga0157376_10036766 3300014969 Bacteria 3969
438 Ga0157376_10051476 3300014969 Bacteria 3421
439 Ga0157376_10149393 3300014969 Bacteria 2105
440 Ga0182006_1020509 3300015261 Bacteria 2769
441 Ga0182005_1046605 3300015265 Bacteria 1178
442 Ga0163161_10018993 3300017792 Bacteria 4818
443 Ga0163161_10024906 3300017792 Bacteria 4230
444 Ga0197907_10810373 3300020069 Bacteria 1232
445 Ga0206356_11558599 3300020070 Bacteria 1599
446 Ga0206355_1032423 3300020076 Bacteria 1220
447 Ga0206354_10360414 3300020081 Bacteria 1156
448 Ga0213872_10008858 3300021361 Bacteria 4846
449 Ga0213876_10010940 3300021384 Bacteria 4860
450 Ga0213871_10004892 3300021441 Bacteria 2720
451 Ga0228598_1005083 3300024227 Bacteria 2763
452 Ga0207672_1001192 3300025223 Bacteria 2255
453 Ga0209026_1000158 3300025250 Bacteria 106333
454 Ga0209026_1002284 3300025250 Bacteria 7326
455 Ga0209759_1011628 3300025256 Bacteria 2489
456 Ga0209455_1000218 3300025272 Bacteria 79966
457 Ga0207697_10001233 3300025315 Bacteria 14016
458 Ga0207697_10004903 3300025315 Bacteria 6309
459 Ga0207697_10005583 3300025315 Bacteria 5826
460 Ga0207697_10010998 3300025315 Bacteria 3842
461 Ga0207656_10014248 3300025321 Bacteria 3058
462 Ga0207656_10036147 3300025321 Bacteria 2072
463 Ga0207653_10000070 3300025885 Bacteria 76652
464 Ga0207692_10017016 3300025898 Bacteria 3234
465 Ga0207710_10000003 3300025900 Bacteria 1071597
466 Ga0207710_10003349 3300025900 Bacteria 7163
467 Ga0207710_10089493 3300025900 Bacteria 1439
468 Ga0207680_10000062 3300025903 Bacteria 48850
469 Ga0207680_10001509 3300025903 Bacteria 10961
470 Ga0207647_10006978 3300025904 Bacteria 8186
471 Ga0207647_10039344 3300025904 Bacteria 2984
472 Ga0207647_10040783 3300025904 Bacteria 2922
473 Ga0207685_10008205 3300025905 Bacteria 2959
474 Ga0207685_10021792 3300025905 Archaea 2154
475 Ga0207685_10031441 3300025905 Bacteria 1901
476 Ga0207699_10000023 3300025906 Bacteria 172262
477 Ga0207699_10023506 3300025906 Bacteria 3355
478 Ga0207699_10052630 3300025906 Bacteria 2411
479 Ga0207699_10086410 3300025906 Bacteria 1959
480 Ga0207699_10186581 3300025906 Bacteria 1397
481 Ga0207699_10257162 3300025906 Bacteria 1206
482 Ga0207645_10001695 3300025907 Bacteria 17900
483 Ga0207645_10078565 3300025907 Bacteria 2114
484 Ga0207643_10019602 3300025908 Bacteria 3708
485 Ga0207705_10006079 3300025909 Bacteria 8985
486 Ga0207705_10018618 3300025909 Bacteria 4965
487 Ga0207705_10043759 3300025909 Bacteria 3217
488 Ga0207705_10096983 3300025909 Bacteria 2165
489 Ga0207705_10102189 3300025909 Bacteria 2110
490 Ga0207684_10000102 3300025910 Bacteria 162120
491 Ga0207684_10000186 3300025910 Bacteria 98342
492 Ga0207684_10001595 3300025910 Bacteria 24099
493 Ga0207684_10199384 3300025910 Bacteria 1727
494 Ga0207684_10332854 3300025910 Bacteria 1308
495 Ga0207654_10000731 3300025911 Bacteria 18271
496 Ga0207654_10031820 3300025911 Bacteria 2909
497 Ga0207654_10097857 3300025911 Bacteria 1802
498 Ga0207707_10037611 3300025912 Bacteria 4230
499 Ga0207695_10000025 3300025913 Bacteria 627211
500 Ga0207695_10000028 3300025913 Bacteria 551835
501 Ga0207695_10000637 3300025913 Bacteria 70175
502 Ga0207695_10002224 3300025913 Bacteria 29144
503 Ga0207695_10004845 3300025913 Bacteria 18166
504 Ga0207695_10017985 3300025913 Bacteria 8185
505 Ga0207695_10045150 3300025913 Bacteria 4680
506 Ga0207695_10061340 3300025913 Bacteria 3886
507 Ga0207695_10072590 3300025913 Bacteria 3510
508 Ga0207695_10183972 3300025913 Bacteria 2009
509 Ga0207671_10000582 3300025914 Bacteria 48826
510 Ga0207671_10000935 3300025914 Bacteria 36496
511 Ga0207671_10006120 3300025914 Bacteria 10822
512 Ga0207693_10000262 3300025915 Bacteria 48422
513 Ga0207693_10000734 3300025915 Bacteria 29569
514 Ga0207693_10003119 3300025915 Bacteria 14270
515 Ga0207693_10027230 3300025915 Bacteria 4520
516 Ga0207693_10054645 3300025915 Bacteria 3132
517 Ga0207693_10073547 3300025915 Unclassified 2676
518 Ga0207663_10000553 3300025916 Bacteria 16492
519 Ga0207663_10043276 3300025916 Bacteria 2756
520 Ga0207663_10087055 3300025916 Bacteria 2062
521 Ga0207657_10023837 3300025919 Bacteria 5687
522 Ga0207649_10031041 3300025920 Bacteria 3171
523 Ga0207649_10188954 3300025920 Bacteria 1447
524 Ga0207649_10344200 3300025920 Bacteria 1102
525 Ga0207652_10237450 3300025921 Bacteria 1643
526 Ga0207652_10309757 3300025921 Bacteria 1425
527 Ga0207646_10187635 3300025922 Bacteria 1867
528 Ga0207681_10000004 3300025923 Bacteria 559005
529 Ga0207681_10020058 3300025923 Bacteria 4232
530 Ga0207694_10000249 3300025924 Bacteria 51431
531 Ga0207694_10001221 3300025924 Bacteria 22261
532 Ga0207694_10003221 3300025924 Bacteria 13003
533 Ga0207694_10022238 3300025924 Bacteria 4809
534 Ga0207694_10029722 3300025924 Bacteria 4171
535 Ga0207694_10329467 3300025924 Bacteria 1261
536 Ga0207650_10000570 3300025925 Bacteria 29776
537 Ga0207650_10026870 3300025925 Bacteria 4112
538 Ga0207650_10145993 3300025925 Bacteria 1863
539 Ga0207650_10191481 3300025925 Bacteria 1634
540 Ga0207650_10263471 3300025925 Bacteria 1399
541 Ga0207650_10269628 3300025925 Bacteria 1383
542 Ga0207659_10140489 3300025926 Bacteria 1874
543 Ga0207687_10006671 3300025927 Bacteria 7612
544 Ga0207687_10013607 3300025927 Bacteria 5311
545 Ga0207687_10063563 3300025927 Bacteria 2614
546 Ga0207700_10003181 3300025928 Bacteria 9483
547 Ga0207700_10005575 3300025928 Bacteria 7553
548 Ga0207700_10010940 3300025928 Bacteria 5759
549 Ga0207700_10071596 3300025928 Bacteria 2670
550 Ga0207700_10105364 3300025928 Bacteria 2258
551 Ga0207700_10161288 3300025928 Bacteria 1862
552 Ga0207664_10091429 3300025929 Bacteria 2496
553 Ga0207664_10136065 3300025929 Bacteria 2073
554 Ga0207664_10194032 3300025929 Bacteria 1750
555 Ga0207644_10000031 3300025931 Bacteria 134402
556 Ga0207644_10122052 3300025931 Bacteria 1984
557 Ga0207644_10199048 3300025931 Bacteria 1579
558 Ga0207706_10021238 3300025933 Bacteria 5832
559 Ga0207706_10022300 3300025933 Bacteria 5681
560 Ga0207706_10243359 3300025933 Bacteria 1572
561 Ga0207686_10000777 3300025934 Bacteria 19590
562 Ga0207686_10174065 3300025934 Bacteria 1520
563 Ga0207670_10077436 3300025936 Bacteria 2317
564 Ga0207669_10001072 3300025937 Bacteria 11671
565 Ga0207704_10307034 3300025938 Archaea 1218
566 Ga0207665_10006615 3300025939 Bacteria 7689
567 Ga0207665_10053885 3300025939 Bacteria 2711
568 Ga0207665_10066925 3300025939 Bacteria 2446
569 Ga0207691_10004834 3300025940 Bacteria 13030
570 Ga0207691_10011167 3300025940 Archaea 8620
571 Ga0207691_10014258 3300025940 Bacteria 7582
572 Ga0207691_10019641 3300025940 Bacteria 6392
573 Ga0207691_10071999 3300025940 Bacteria 3118
574 Ga0207691_10091098 3300025940 Bacteria 2732
575 Ga0207711_10000012 3300025941 Bacteria 515147
576 Ga0207711_10001298 3300025941 Bacteria 23674
577 Ga0207711_10014531 3300025941 Bacteria 6544
578 Ga0207711_10019311 3300025941 Bacteria 5676
579 Ga0207711_10032837 3300025941 Bacteria 4390
580 Ga0207711_10308784 3300025941 Bacteria 1460
581 Ga0207689_10027664 3300025942 Bacteria 4746
582 Ga0207661_10000012 3300025944 Bacteria 354345
583 Ga0207661_10011022 3300025944 Bacteria 6533
584 Ga0207661_10015140 3300025944 Bacteria 5669
585 Ga0207661_10030159 3300025944 Bacteria 4174
586 Ga0207661_10237215 3300025944 Bacteria 1617
587 Ga0207667_10001916 3300025949 Bacteria 26137
588 Ga0207667_10002211 3300025949 Bacteria 24417
589 Ga0207667_10004385 3300025949 Bacteria 17283
590 Ga0207667_10032351 3300025949 Bacteria 5638
591 Ga0207667_10300354 3300025949 Bacteria 1640
592 Ga0207667_10530194 3300025949 Bacteria 1192
593 Ga0207651_10000243 3300025960 Bacteria 23595
594 Ga0207712_10000665 3300025961 Bacteria 26689
595 Ga0207712_10008830 3300025961 Bacteria 6373
596 Ga0207712_10116035 3300025961 Bacteria 2017
597 Ga0207668_10113241 3300025972 Bacteria 2039
598 Ga0207658_10021940 3300025986 Bacteria 4439
599 Ga0207658_10273239 3300025986 Bacteria 1445
600 Ga0207677_10131626 3300026023 Bacteria 1900
601 Ga0207677_10199277 3300026023 Bacteria 1590
602 Ga0207703_10000109 3300026035 Bacteria 97743
603 Ga0207703_10001882 3300026035 Bacteria 18650
604 Ga0207703_10015204 3300026035 Bacteria 6005
605 Ga0207703_10189299 3300026035 Bacteria 1821
606 Ga0207639_10000127 3300026041 Bacteria 56027
607 Ga0207639_10001341 3300026041 Bacteria 16626
608 Ga0207678_10007664 3300026067 Bacteria 9535
609 Ga0207678_10093204 3300026067 Bacteria 2574
610 Ga0207702_10000809 3300026078 Bacteria 33188
611 Ga0207702_10001049 3300026078 Bacteria 28307
612 Ga0207702_10008988 3300026078 Bacteria 8415
613 Ga0207702_10056864 3300026078 Bacteria 3322
614 Ga0207702_10076091 3300026078 Bacteria 2901
615 Ga0207702_10296989 3300026078 Bacteria 1532
616 Ga0207641_10015238 3300026088 Bacteria 6299
617 Ga0207641_10115442 3300026088 Bacteria 2387
618 Ga0207641_10148957 3300026088 Bacteria 2118
619 Ga0207641_10192700 3300026088 Bacteria 1874
620 Ga0207676_10001214 3300026095 Bacteria 19239
621 Ga0207676_10065857 3300026095 Bacteria 2886
622 Ga0207676_10163011 3300026095 Bacteria 1934
623 Ga0207676_10351490 3300026095 Bacteria 1363
624 Ga0207676_10372142 3300026095 Bacteria 1327
625 Ga0207674_10000675 3300026116 Bacteria 44298
626 Ga0207674_10001753 3300026116 Bacteria 27749
627 Ga0207674_10232453 3300026116 Bacteria 1791
628 Ga0207675_100002039 3300026118 Bacteria 20154
629 Ga0207675_100133918 3300026118 Bacteria 2350
630 Ga0207683_10008786 3300026121 Bacteria 8625
631 Ga0207683_10009704 3300026121 Bacteria 8208
632 Ga0207683_10020934 3300026121 Bacteria 5598
633 Ga0207683_10155051 3300026121 Bacteria 2068
634 Ga0207683_10183725 3300026121 Bacteria 1897
635 Ga0207683_10334699 3300026121 Bacteria 1388
636 Ga0207698_10000623 3300026142 Bacteria 20591
637 Ga0207698_10000895 3300026142 Bacteria 17319
638 Ga0207698_10014938 3300026142 Bacteria 5183
639 Ga0207698_10118541 3300026142 Bacteria 2235
640 Ga0209967_1001744 3300027364 Bacteria 2800
641 Ga0210000_1000015 3300027462 Bacteria 30974
642 Ga0209968_1002263 3300027526 Bacteria 2909
643 Ga0209999_1000452 3300027543 Bacteria 6333
644 Ga0209970_1006825 3300027614 Bacteria 1875
645 Ga0209966_1002410 3300027695 Bacteria 3119
646 Ga0209966_1018816 3300027695 Bacteria 1326
647 Ga0207428_10012376 3300027907 Archaea 7497
648 Ga0265354_1000204 3300028016 Bacteria 10905
649 Ga0265354_1004108 3300028016 Bacteria 1555
650 Ga0268266_10034222 3300028379 Bacteria 4321
651 Ga0268266_10059930 3300028379 Bacteria 3279
652 Ga0268266_10062500 3300028379 Bacteria 3214
653 Ga0268266_10304023 3300028379 Bacteria 1489
654 Ga0268266_10340734 3300028379 Bacteria 1407
655 Ga0268265_10000046 3300028380 Bacteria 179361
656 Ga0268264_10000879 3300028381 Bacteria 31672
657 Ga0268264_10004546 3300028381 Bacteria 11817
658 Ga0268264_10015871 3300028381 Bacteria 6168
659 Ga0268264_10044443 3300028381 Bacteria 3685
660 Ga0268264_10052522 3300028381 Bacteria 3398
661 Ga0268264_10318016 3300028381 Bacteria 1471
662 Ga0268264_10400795 3300028381 Bacteria 1318
663 Ga0265326_10000443 3300028558 Bacteria 16256
664 Ga0265334_10046880 3300028573 Bacteria 1669
665 Ga0265318_10014358 3300028577 Bacteria 3327
666 Ga0265323_10002666 3300028653 Bacteria 8060
667 Ga0265323_10026857 3300028653 Bacteria 2168
668 Ga0265336_10002094 3300028666 Bacteria 8476
669 Ga0265338_10002061 3300028800 Bacteria 31057
670 Ga0265338_10018503 3300028800 Bacteria 7456
671 Ga0265338_10022912 3300028800 Bacteria 6443
672 Ga0265338_10024815 3300028800 Bacteria 6109
673 Ga0265338_10037490 3300028800 Bacteria 4613
674 Ga0265338_10052369 3300028800 Bacteria 3662
675 Ga0265338_10156561 3300028800 Bacteria 1764
676 Ga0265338_10235210 3300028800 Bacteria 1360
677 Ga0265770_1001690 3300030878 Bacteria 3022
678 Ga0265760_10002054 3300031090 Bacteria 5928
679 Ga0265760_10002624 3300031090 Bacteria 5257
680 Ga0265760_10012599 3300031090 Bacteria 2419
681 Ga0265330_10000183 3300031235 Bacteria 48463
682 Ga0265320_10002070 3300031240 Bacteria 14123
683 Ga0265320_10005985 3300031240 Bacteria 7728
684 Ga0265325_10001847 3300031241 Bacteria 14626
685 Ga0265325_10007361 3300031241 Bacteria 6594
686 Ga0265325_10079272 3300031241 Bacteria 1634
687 Ga0265329_10010196 3300031242 Bacteria 3463
688 Ga0265340_10008168 3300031247 Bacteria 5659
689 Ga0265339_10000017 3300031249 Bacteria 185084
690 Ga0265339_10000196 3300031249 Bacteria 49860
691 Ga0265331_10000851 3300031250 Bacteria 24815
692 Ga0265331_10004840 3300031250 Bacteria 8293
693 Ga0265331_10013839 3300031250 Bacteria 4322
694 Ga0265327_10000307 3300031251 Bacteria 95145
695 Ga0265327_10012262 3300031251 Bacteria 5806
696 Ga0265327_10024684 3300031251 Bacteria 3523
697 Ga0265316_10000604 3300031344 Bacteria 40036
698 Ga0265316_10005921 3300031344 Bacteria 11774
699 Ga0265316_10010560 3300031344 Bacteria 8408
700 Ga0265316_10010808 3300031344 Bacteria 8292
701 Ga0265316_10025120 3300031344 Bacteria 4976
702 Ga0265316_10031939 3300031344 Bacteria 4302
703 Ga0265316_10032762 3300031344 Bacteria 4239
704 Ga0265316_10039642 3300031344 Bacteria 3782
705 Ga0265316_10051179 3300031344 Bacteria 3245
706 Ga0265316_10110789 3300031344 Bacteria 2079
707 Ga0307408_100000053 3300031548 Bacteria 147370
708 Ga0307408_100009298 3300031548 Bacteria 6479
709 Ga0307408_100016884 3300031548 Bacteria 4880
710 Ga0307408_100048127 3300031548 Bacteria 3057
711 Ga0307408_100174886 3300031548 Bacteria 1717
712 Ga0307408_100399411 3300031548 Bacteria 1180
713 Ga0265313_10000823 3300031595 Bacteria 31314
714 Ga0307508_10003602 3300031616 Bacteria 15569
715 Ga0265314_10000764 3300031711 Bacteria 38414
716 Ga0265314_10001769 3300031711 Bacteria 23305
717 Ga0265314_10002441 3300031711 Bacteria 19044
718 Ga0265314_10007673 3300031711 Bacteria 9328
719 Ga0265314_10012428 3300031711 Bacteria 6946
720 Ga0265314_10037430 3300031711 Bacteria 3516
721 Ga0265314_10120439 3300031711 Bacteria 1653
722 Ga0265314_10143389 3300031711 Bacteria 1474
723 Ga0265314_10164819 3300031711 Bacteria 1344
724 Ga0265342_10002491 3300031712 Bacteria 15853
725 Ga0265342_10004192 3300031712 Bacteria 11471
726 Ga0316578_10198269 3300031728 Bacteria 1209
727 Ga0307516_10001545 3300031730 Bacteria 31640
728 Ga0307516_10003925 3300031730 Bacteria 18740
729 Ga0307516_10172953 3300031730 Bacteria 1899
730 Ga0307405_10053208 3300031731 Bacteria 2521
731 Ga0307405_10216007 3300031731 Bacteria 1404
732 Ga0307413_10030509 3300031824 Bacteria 3030
733 Ga0307413_10095086 3300031824 Bacteria 1952
734 Ga0307410_10000005 3300031852 Bacteria 100475
735 Ga0307410_10007730 3300031852 Bacteria 5903
736 Ga0307410_10156523 3300031852 Bacteria 1702
737 Ga0307410_10242807 3300031852 Bacteria 1396
738 Ga0307406_10007849 3300031901 Bacteria 5938
739 Ga0307406_10036789 3300031901 Bacteria 3018
740 Ga0307407_10051016 3300031903 Bacteria 2370
741 Ga0307412_10002920 3300031911 Bacteria 9483
742 Ga0307412_10012973 3300031911 Bacteria 4871
743 Ga0307412_10128596 3300031911 Bacteria 1836
744 Ga0307412_10351826 3300031911 Bacteria 1183
745 Ga0307409_100000679 3300031995 Bacteria 15090
746 Ga0307409_100231683 3300031995 Bacteria 1675
747 Ga0307416_100000056 3300032002 Bacteria 107434
748 Ga0307416_100020411 3300032002 Bacteria 4727
749 Ga0307416_100082732 3300032002 Bacteria 2720
750 Ga0307416_100429524 3300032002 Bacteria 1368
751 Ga0307414_10043448 3300032004 Bacteria 3061
752 Ga0307414_10082959 3300032004 Bacteria 2352
753 Ga0307411_10003475 3300032005 Bacteria 7318
754 Ga0307411_10008180 3300032005 Bacteria 5397
755 Ga0307411_10038223 3300032005 Bacteria 3025
756 Ga0307411_10056154 3300032005 Bacteria 2594
757 Ga0307411_10233625 3300032005 Bacteria 1435
758 Ga0307415_100052612 3300032126 Bacteria 2770
759 Ga0307415_100076281 3300032126 Bacteria 2376
760 Ga0307415_100330169 3300032126 Bacteria 1276
761 Ga0307415_100370387 3300032126 Bacteria 1213
762 Ga0373928_0031329 3300035084 Bacteria 1180
763 Ga0373923_0015310 3300035111 Bacteria 2894
764 Ga0373932_0012612 3300035112 Bacteria 2084
765 Ga0373945_0075272 3300035116 Bacteria 1285
766 Ga0373957_0082634 3300035120 Bacteria 1270
767 Ga0373943_0017367 3300035170 Bacteria 3292
768 Ga0373955_0133206 3300035172 Bacteria 1452
769 Ga0373962_0042950 3300035242 Bacteria 1280
770 Ga0316574_0138456 3300035398 Bacteria 1568
771 Ga0373924_0008676 3300035410 Bacteria 3704
772 Ga0373924_0026442 3300035410 Bacteria 2302
773 Ga0373924_0074172 3300035410 Bacteria 1439
774 Ga0373931_0076358 3300035691 Bacteria 1840
775 Ga0373931_0245680 3300035691 Bacteria 1086
776 Ga0373935_0007970 3300035692 Bacteria 6351
777 Ga0373927_0005280 3300035695 Bacteria 8936
778 Ga0373933_0027979 3300035724 Bacteria 3250
779 Ga0373933_0071033 3300035724 Bacteria 2118
780 Ga0373933_0173295 3300035724 Bacteria 1374
781 Ga0373947_0066748 3300035725 Bacteria 2196
782 Ga0373947_0308310 3300035725 Bacteria 1057
783 Ga0373937_0009165 3300036401 Bacteria 8589
784 Ga0373937_0012705 3300036401 Bacteria 7411
785 Ga0373937_0063112 3300036401 Bacteria 3407
786 Ga0373937_0077803 3300036401 Bacteria 3065
787 Ga0373937_0096296 3300036401 Bacteria 2745
788 Ga0373937_0166831 3300036401 Bacteria 2065
789 Ga0373937_0172235 3300036401 Bacteria 2031
790 Ga0373937_0245783 3300036401 Bacteria 1686
791 Ga0373937_0291104 3300036401 Bacteria 1543
792 Ga0316584_0267585 3300036712 Bacteria 1245
793 Ga0373925_0074345 3300037068 Bacteria 2574
794 Ga0373925_0077143 3300037068 Bacteria 2528
795 Ga0373925_0139972 3300037068 Bacteria 1893
796 Ga0373925_0261054 3300037068 Bacteria 1391
797 Ga0395900_0001170 3300037418 Bacteria 32733
798 Ga0395900_0027557 3300037418 Bacteria 5821
799 Ga0395900_0295414 3300037418 Bacteria 1608
800 Ga0395905_0122619 3300037471 Bacteria 2444
801 Ga0395905_0166676 3300037471 Bacteria 2070
802 Ga0395905_0180443 3300037471 Bacteria 1982
803 Ga0395905_0201940 3300037471 Bacteria 1864
804 Ga0395905_0248344 3300037471 Bacteria 1662
805 Ga0395901_0025312 3300038443 Bacteria 6092
806 Ga0395901_0046407 3300038443 Bacteria 4513
807 Ga0242422_00187 3300038699 Bacteria 3442
808 Ga0242420_018863 3300038996 Bacteria 1218
809 Ga0436365_0668515 3300039437 Bacteria 3141
810 Ga0436365_1018976 3300039437 Bacteria 1782
811 Ga0436365_1444529 3300039437 Bacteria 6797
812 Ga0436360_0129730 3300039438 Bacteria 2486
813 Ga0436361_0010635 3300039447 Bacteria 60260
814 Ga0436361_0830524 3300039447 Bacteria 1233
815 Ga0439447_024633 3300041407 Bacteria 1557
816 Ga0439466_0037507 3300041411 Bacteria 1631
817 Ga0439433_0002025 3300041999 Bacteria 4256
818 Ga0439432_010096 3300042006 Bacteria 3282
819 Ga0439452_001783 3300042010 Bacteria 8388
820 Ga0439462_0001865 3300042015 Bacteria 4786
821 Ga0450907_006360 3300042146 Bacteria 1972
822 Ga0439458_0002185 3300042157 Bacteria 4836
823 Ga0450909_011881 3300042185 Bacteria 1275
824 Ga0439434_0016973 3300042435 Bacteria 2176
825 Ga0451577_0000167 3300042876 Bacteria 144675
826 Ga0451577_0000454 3300042876 Bacteria 71195
827 Ga0451577_0004538 3300042876 Bacteria 14614
828 Ga0451577_0005264 3300042876 Bacteria 13298
829 Ga0451577_0006551 3300042876 Bacteria 11585
830 Ga0451577_0014214 3300042876 Bacteria 7420
831 Ga0451577_0044677 3300042876 Bacteria 3966
832 Ga0451577_0351602 3300042876 Bacteria 1337
833 Ga0453683_0000124 3300044673 Bacteria 114941
834 Ga0453683_0000469 3300044673 Bacteria 46342
835 Ga0453683_0002089 3300044673 Bacteria 15953
836 Ga0453683_0016263 3300044673 Bacteria 4803
837 Ga0453683_0062097 3300044673 Bacteria 2336
838 Ga0453683_0103472 3300044673 Bacteria 1788
839 Ga0453683_0142632 3300044673 Bacteria 1512
840 Ga0466966_0149652 3300044684 Bacteria 1424
841 Ga0466961_0107870 3300044693 Bacteria 1753
842 Ga0466961_0221722 3300044693 Bacteria 1165
843 Ga0453684_0000422 3300044712 Bacteria 172695
844 Ga0453684_0000446 3300044712 Bacteria 166828
845 Ga0453684_0003944 3300044712 Bacteria 32474
846 Ga0453684_0004475 3300044712 Bacteria 29423
847 Ga0453684_0012103 3300044712 Bacteria 14321
848 Ga0453684_0014205 3300044712 Bacteria 12783
849 Ga0453684_0115326 3300044712 Bacteria 3255
850 Ga0453684_0153468 3300044712 Bacteria 2733
851 Ga0453684_0305648 3300044712 Bacteria 1806
852 Ga0453684_0307194 3300044712 Bacteria 1801
853 Ga0453684_0351808 3300044712 Bacteria 1661
854 Ga0466957_0169195 3300044842 Bacteria 1423
855 Ga0466960_0000063 3300044901 Bacteria 35457
856 Ga0451576_0000797 3300045051 Bacteria 61704
857 Ga0451576_0001109 3300045051 Bacteria 49112
858 Ga0451576_0032792 3300045051 Bacteria 5524
859 Ga0451576_0219815 3300045051 Bacteria 1984
860 Ga0451576_0252861 3300045051 Bacteria 1842
861 Ga0451576_0296546 3300045051 Bacteria 1690
862 Ga0451576_0325591 3300045051 Bacteria 1608
863 Ga0451576_0471373 3300045051 Bacteria 1318
864 Ga0466967_0007112 3300045976 Bacteria 8031
865 Ga0466967_0007615 3300045976 Bacteria 7833
866 Ga0495627_031181 3300046453 Bacteria 1685
867 Ga0495592_0019990 3300046454 Bacteria 5091
868 Ga0495592_0129088 3300046454 Bacteria 1770
869 Ga0495629_0029824 3300046459 Bacteria 3866
870 Ga0495629_0041944 3300046459 Bacteria 3217
871 Ga0495629_0047201 3300046459 Bacteria 3021
872 Ga0495651_0198073 3300046462 Bacteria 1408
873 Ga0495653_0006291 3300046463 Bacteria 9741
874 Ga0495653_0214736 3300046463 Bacteria 1297
875 Ga0495650_0000063 3300046471 Bacteria 277841
876 Ga0495580_0001579 3300046472 Bacteria 20013
877 Ga0495580_0022435 3300046472 Bacteria 4646
878 Ga0495580_0023443 3300046472 Bacteria 4532
879 Ga0495580_0025082 3300046472 Bacteria 4358
880 Ga0495580_0160284 3300046472 Bacteria 1557
881 Ga0495580_0306088 3300046472 Bacteria 1082
882 Ga0495582_0059366 3300046473 Bacteria 2110
883 Ga0495639_0084715 3300046475 Bacteria 1481
884 Ga0495639_0163838 3300046475 Bacteria 1077
885 Ga0495594_0005796 3300046499 Bacteria 6340
886 Ga0495594_0036758 3300046499 Bacteria 2671
887 Ga0495606_0001183 3300046507 Bacteria 36792
888 Ga0495608_0001348 3300046511 Bacteria 17514
889 Ga0495608_0025061 3300046511 Bacteria 4073
890 Ga0495616_0000122 3300046513 Bacteria 67299
891 Ga0495616_0000187 3300046513 Bacteria 51726
892 Ga0495616_0000276 3300046513 Bacteria 41682
893 Ga0495618_0005223 3300046514 Bacteria 7935
894 Ga0495628_0001615 3300046516 Bacteria 20645
895 Ga0495628_0273272 3300046516 Bacteria 1257
896 Ga0495630_0023311 3300046517 Bacteria 4576
897 Ga0495630_0160597 3300046517 Bacteria 1711
898 Ga0495630_0211324 3300046517 Bacteria 1481
899 Ga0495643_0000580 3300046522 Bacteria 44701
900 Ga0495663_0057726 3300046525 Bacteria 1215
901 Ga0495652_0000812 3300046529 Bacteria 36015
902 Ga0495654_0002529 3300046530 Bacteria 11757
903 Ga0495654_0011725 3300046530 Bacteria 4735
904 Ga0495640_0047091 3300046533 Bacteria 2985
905 Ga0495640_0140340 3300046533 Bacteria 1558
906 Ga0495586_0105991 3300046535 Bacteria 1563
907 Ga0495587_0012571 3300046536 Bacteria 5323
908 Ga0495633_0018036 3300046558 Bacteria 3590
909 Ga0495667_0000215 3300046559 Bacteria 38593
910 Ga0495667_0019050 3300046559 Bacteria 4631
911 Ga0495668_0003199 3300046616 Bacteria 12531
912 Ga0495668_0006493 3300046616 Bacteria 7651
913 Ga0495668_0009039 3300046616 Bacteria 6151
914 Ga0495668_0049342 3300046616 Bacteria 2334
915 Ga0495661_0031172 3300046665 Bacteria 3387
916 Ga0495657_0002973 3300046675 Bacteria 14032
917 Ga0495669_0057829 3300046684 Bacteria 1750
918 Ga0495613_0010066 3300046689 Bacteria 7024
919 Ga0495613_0088784 3300046689 Bacteria 2240
920 Ga0495613_0246447 3300046689 Bacteria 1248
921 Ga0495671_0121334 3300046692 Bacteria 1275
922 Ga0495589_0014533 3300046794 Bacteria 4052
923 Ga0495600_0154817 3300046809 Bacteria 1483
924 Ga0495581_0038863 3300047315 Bacteria 2755
925 Ga0495581_0041258 3300047315 Bacteria 2671
926 Ga0495604_0047480 3300047317 Bacteria 3343
927 Ga0495674_0000271 3300047319 Bacteria 44227
928 Ga0495674_0009483 3300047319 Bacteria 9248
929 Ga0495674_0204759 3300047319 Bacteria 1636
930 Ga0495680_0002950 3300047322 Bacteria 17024
931 Ga0495687_015990 3300047443 Bacteria 3788
932 Ga0495675_0000354 3300047444 Bacteria 32123
933 Ga0495684_0020764 3300047471 Bacteria 5060
934 Ga0495684_0066876 3300047471 Bacteria 2733
935 Ga0495684_0138283 3300047471 Bacteria 1827
936 Ga0495686_0007438 3300047472 Bacteria 8216
937 Ga0495686_0114900 3300047472 Bacteria 1610
938 Ga0495602_0073722 3300048088 Bacteria 2904
939 Ga0495602_0078102 3300048088 Bacteria 2797
940 Ga0496101_0131704 3300048904 Bacteria 1899
941 Ga0496102_0161837 3300048905 Bacteria 2105
942 Ga0496102_0223448 3300048905 Bacteria 1775
943 Ga0496103_0350144 3300048906 Bacteria 950
944 Ga0496104_0042519 3300048907 Bacteria 4265
945 Ga0496104_0138453 3300048907 Bacteria 2339
946 Ga0496104_0199700 3300048907 Bacteria 1912
947 Ga0496104_0244288 3300048907 Bacteria 1708
948 Ga0496104_0400636 3300048907 Bacteria 1284
949 Ga0496105_0046426 3300048908 Bacteria 3585
950 Ga0496105_0051326 3300048908 Bacteria 3407
951 Ga0496105_0470871 3300048908 Bacteria 990
952 Ga0496106_0018866 3300048909 Bacteria 5111
953 Ga0496106_0086588 3300048909 Bacteria 2413
954 Ga0496107_0022249 3300048910 Bacteria 4480
955 Ga0496108_0012657 3300048911 Bacteria 6873
956 Ga0496108_0027061 3300048911 Bacteria 4732
957 Ga0496108_0033172 3300048911 Bacteria 4289
958 Ga0496109_0025140 3300048912 Bacteria 5304
959 Ga0496109_0098718 3300048912 Bacteria 2707
960 Ga0496109_0111063 3300048912 Bacteria 2549
961 Ga0496109_0145251 3300048912 Bacteria 2219
962 Ga0496109_0221632 3300048912 Bacteria 1779
963 Ga0496110_0028922 3300048913 Bacteria 4764
964 Ga0496110_0149699 3300048913 Bacteria 2113
965 Ga0496110_0314615 3300048913 Bacteria 1426
966 Ga0496111_0020070 3300048914 Bacteria 4648
967 Ga0496112_0024604 3300048915 Bacteria 5770
968 Ga0496112_0156984 3300048915 Bacteria 2242
969 Ga0496112_0171241 3300048915 Bacteria 2136
970 Ga0496113_0204001 3300048916 Bacteria 1572
971 Ga0496114_0004338 3300048917 Bacteria 10980
972 Ga0496114_0033149 3300048917 Bacteria 4254
973 Ga0496114_0168010 3300048917 Bacteria 1911
974 Ga0496114_0413390 3300048917 Bacteria 1195
975 Ga0496115_0009048 3300048918 Bacteria 7388
976 Ga0496115_0013321 3300048918 Bacteria 6220
977 Ga0496115_0111770 3300048918 Bacteria 2245
978 Ga0496121_0005276 3300048924 Bacteria 16661
979 Ga0496121_0219989 3300048924 Bacteria 1338
980 Ga0496126_0003087 3300048929 Bacteria 21537
981 Ga0496126_0008507 3300048929 Bacteria 11058
982 Ga0501298_004427 3300049521 Bacteria 2214
983 Ga0501302_001857 3300049525 Bacteria 1172
984 Ga0501031_0046440 3300049568 Archaea 2831
985 Ga0501031_0059850 3300049568 Archaea 2482
986 Ga0501032_0023547 3300049569 Unclassified 4251
987 Ga0501032_0089706 3300049569 Bacteria 2041
988 Ga0501033_0000337 3300049570 Bacteria 44892
989 Ga0501033_0021848 3300049570 Bacteria 4829
990 Ga0501033_0122724 3300049570 Bacteria 1884
991 Ga0501034_0000461 3300049571 Bacteria 67308
992 Ga0501034_0002385 3300049571 Bacteria 22806
993 Ga0501034_0003139 3300049571 Bacteria 19020
994 Ga0501034_0033843 3300049571 Bacteria 5180
995 Ga0501034_0052307 3300049571 Bacteria 4115
996 Ga0501034_0068458 3300049571 Bacteria 3560
997 Ga0501034_0081922 3300049571 Bacteria 3229
998 Ga0501034_0127755 3300049571 Bacteria 2527
999 Ga0501034_0190370 3300049571 Bacteria 2014
1000 Ga0501036_0004555 3300049572 Bacteria 11194
1001 Ga0501036_0016233 3300049572 Archaea 6219
1002 Ga0501036_0105217 3300049572 Bacteria 2387
1003 Ga0501037_0004663 3300049573 Bacteria 9957
1004 Ga0501037_0114904 3300049573 Archaea 1937
1005 Ga0501038_0001263 3300049574 Bacteria 22989
1006 Ga0501038_0011870 3300049574 Bacteria 7951
1007 Ga0501038_0045157 3300049574 Bacteria 3825
1008 Ga0501038_0113357 3300049574 Bacteria 2244
1009 Ga0501039_0019759 3300049575 Bacteria 5164
1010 Ga0501039_0040703 3300049575 Bacteria 3587
1011 Ga0501039_0047509 3300049575 Archaea 3318
1012 Ga0501039_0080632 3300049575 Archaea 2532
1013 Ga0501040_0013105 3300049576 Archaea 5452
1014 Ga0501040_0181950 3300049576 Bacteria 1490
1015 Ga0501042_0030276 3300049578 Archaea 3821
1016 Ga0501042_0078975 3300049578 Archaea 2357
1017 Ga0501043_0002565 3300049579 Bacteria 15358
1018 Ga0501043_0060761 3300049579 Bacteria 2967
1019 Ga0501043_0164315 3300049579 Archaea 1733
1020 Ga0501046_0000025 3300049580 Bacteria 197542
1021 Ga0501046_0023621 3300049580 Bacteria 5053
1022 Ga0501046_0066279 3300049580 Archaea 2814
1023 Ga0501046_0267621 3300049580 Archaea 1254
1024 Ga0501047_0003053 3300049581 Bacteria 15886
1025 Ga0501047_0033929 3300049581 Bacteria 4926
1026 Ga0501047_0218951 3300049581 Bacteria 1760
1027 Ga0501048_0009926 3300049582 Bacteria 7131
1028 Ga0501048_0017442 3300049582 Archaea 5287
1029 Ga0501048_0050764 3300049582 Bacteria 2953
1030 Ga0501048_0129289 3300049582 Bacteria 1786
1031 Ga0501048_0139564 3300049582 Bacteria 1714
1032 Ga0501067_0146380 3300049583 Bacteria 1316
1033 Ga0501068_0030423 3300049584 Archaea 3203
1034 Ga0501071_0019378 3300049587 Archaea 4720
1035 Ga0501072_0014538 3300049588 Bacteria 6031
1036 Ga0501072_0275405 3300049588 Bacteria 1339
1037 Ga0501074_0030377 3300049590 Bacteria 3915
1038 Ga0501074_0112712 3300049590 Bacteria 1946
1039 Ga0501076_0005919 3300049592 Archaea 8827
1040 Ga0501076_0106010 3300049592 Bacteria 2268
1041 Ga0501077_0012622 3300049593 Bacteria 5289
1042 Ga0501077_0014673 3300049593 Plasmid 4924
1043 Ga0501077_0039740 3300049593 Bacteria 2997
1044 Ga0501216_013491 3300049660 Bacteria 1355
1045 Ga0501223_000438 3300049663 Bacteria 10055
1046 Ga0501235_000818 3300049669 Bacteria 6367
1047 Ga0501243_006117 3300049675 Bacteria 1822
1048 Ga0501234_001339 3300049707 Bacteria 3858
1049 Ga0501079_0005151 3300049741 Bacteria 9717
1050 Ga0501079_0094908 3300049741 Archaea 2311
1051 Ga0501079_0181110 3300049741 Bacteria 1644
1052 Ga0501080_0065836 3300049742 Archaea 3370
1053 Ga0501080_0067070 3300049742 Bacteria 3337
1054 Ga0501080_0286382 3300049742 Bacteria 1497
1055 Ga0501081_0072109 3300049743 Bacteria 2408
1056 Ga0501081_0261646 3300049743 Bacteria 1264
1057 Ga0501083_0001588 3300049744 Bacteria 15521
1058 Ga0501268_009087 3300049765 Bacteria 1521
1059 Ga0501270_002867 3300049767 Bacteria 1808
1060 Ga0501283_000160 3300049779 Bacteria 8610
1061 Ga0501035_0023351 3300049822 Bacteria 5672
1062 Ga0501035_0075534 3300049822 Bacteria 2980
1063 Ga0501035_0107548 3300049822 Bacteria 2445
1064 Ga0501035_0148234 3300049822 Bacteria 2037
1065 Ga0501035_0178965 3300049822 Bacteria 1828
1066 Ga0501044_0014492 3300049823 Bacteria 8507
1067 Ga0501044_0022075 3300049823 Bacteria 6787
1068 Ga0501044_0029323 3300049823 Archaea 5802
1069 Ga0501044_0092341 3300049823 Bacteria 3053
1070 Ga0501044_0104996 3300049823 Bacteria 2838
1071 Ga0501044_0118090 3300049823 Bacteria 2656
1072 Ga0501045_0008713 3300049824 Bacteria 7074
1073 Ga0501045_0021923 3300049824 Plasmid 4571
1074 Ga0501045_0101826 3300049824 Bacteria 2127
1075 nmdc:mga07m45_156482_c1 3300050496 Bacteria 1322
1076 nmdc:mga05p37_227256_c1 3300050507 Bacteria 2250
1077 nmdc:mga05p37_390218_c1 3300050507 Bacteria 1628
1078 nmdc:mga05p37_41169_c1 3300050507 Archaea 5674
1079 nmdc:mga09592_17734_c1 3300050508 Archaea 5835
1080 nmdc:mga09592_94627_c1 3300050508 Bacteria 2555
1081 nmdc:mga0qj67_29345_c1 3300050509 Bacteria 4273
1082 nmdc:mga0qj67_587_c1 3300050509 Archaea 24795
1083 nmdc:mga06r32_172951_c1 3300050510 Bacteria 2144
1084 nmdc:mga06r32_184181_c1 3300050510 Bacteria 2074
1085 nmdc:mga06r32_352112_c1 3300050510 Bacteria 1457
1086 nmdc:mga08y16_15671_c1 3300050511 Bacteria 7971
1087 nmdc:mga08y16_173702_c1 3300050511 Bacteria 2238
1088 nmdc:mga08y16_22520_c1 3300050511 Bacteria 6651
1089 nmdc:mga0n895_174777_c1 3300050512 Bacteria 2179
1090 nmdc:mga0n895_201428_c1 3300050512 Bacteria 2021
1091 nmdc:mga0n895_3811_c1 3300050512 Bacteria 12219
1092 nmdc:mga08x19_117339_c1 3300050514 Bacteria 1780
1093 Ga0495601_0016863 3300053077 Bacteria 4430
1094 Ga0495601_0058748 3300053077 Bacteria 2438
1095 Ga0495619_0077357 3300053085 Bacteria 2235
1096 Ga0495619_0215219 3300053085 Bacteria 1331
1097 Ga0495619_0254586 3300053085 Bacteria 1217
1098 Ga0500592_000310 3300053116 Bacteria 8376
1099 Ga0500592_000519 3300053116 Bacteria 6325
1100 Ga0500592_001386 3300053116 Bacteria 3922
1101 Ga0500595_019267 3300053119 Bacteria 2479
1102 Ga0500607_013278 3300053121 Bacteria 4814
1103 Ga0500568_0018534 3300053139 Bacteria 3043
1104 Ga0500577_0061201 3300053142 Bacteria 1448
1105 Ga0500604_0003278 3300053151 Bacteria 4358
1106 Ga0500604_0012031 3300053151 Bacteria 2332
1107 Ga0500604_0018702 3300053151 Bacteria 1933
1108 Ga0500616_0002767 3300053153 Bacteria 14162
1109 Ga0500616_0007137 3300053153 Bacteria 7150
1110 Ga0500627_0000218 3300053158 Bacteria 16566
1111 Ga0500627_0002835 3300053158 Bacteria 5233
1112 Ga0500627_0021298 3300053158 Bacteria 2614
1113 Ga0500634_0005118 3300053161 Bacteria 6180
1114 Ga0500636_0006862 3300053177 Bacteria 6560
1115 Ga0500637_0002948 3300053178 Bacteria 7705
1116 Ga0500645_013160 3300053730 Bacteria 2661
1117 Ga0501084_0010348 3300054114 Bacteria 7719
1118 Ga0501084_0024645 3300054114 Archaea 5020
1119 Ga0590075_003486 3300059424 Bacteria 3737
1120 Ga0590075_010969 3300059424 Bacteria 2186
1121 Ga0590075_021996 3300059424 Bacteria 1594
1122 Ga0590077_005594 3300059426 Bacteria 2570
1123 Ga0587084_008686 3300059477 Archaea 1293
1124 Ga0587070_010926 3300059491 Archaea 1347
1125 Ga0587073_0018703 3300059492 Unclassified 1298
1126 Ga0587073_0030133 3300059492 Archaea 1114
1127 Ga0587082_012301 3300059504 Unclassified 1269
1128 Ga0587092_010396 3300059512 Archaea 1272
1129 Ga0587072_015782 3300059643 Archaea 1287
1130 Ga0587076_013696 3300059645 Archaea 1235
1131 Ga0587110_003725 3300059654 Archaea 1290
1132 Ga0501082_0006861 3300060353 Bacteria 9847
1133 Ga0501082_0066443 3300060353 Archaea 3106
1134 Ga0530510_0009751 3300061734 Bacteria 6738
1135 Ga0530510_0015195 3300061734 Archaea 5437
1136 Ga0530510_0023280 3300061734 Bacteria 4412
1137 2748019729 2747842501 Bacteria 5293829
1138 2919522732 2919517244 Bacteria 5858162
1139 2945944968 2945941187 Bacteria 4682474
1140 8022951137 8022948649 Bacteria 5366783
1141 Ga0207652_10003270
1142 ARcpr5yngRDRAFT_c001556
1143 ARSoilOldRDRAFT_c000399
1144 LJNas_1001054
1145 JGI24034J26672_10000002
1146 JGI24751J29686_10000233
1147 JGI24751J29686_10008629
1148 JGI25156J39149_1006441
1149 JGI25157J39369_1003469
1150 JGI25406J46586_10000065
1151 JGI25406J46586_10002954
1152 rootH2_10060039
1153 JGI26144J50225_100489
1154 JGI25404J52841_10002499
1155 Ga0055529_1004004
1156 Ga0058863_11511870
1157 Ga0058862_12777708
1158 Ga0065716_1000318
1159 Ga0065714_10064426
1160 Ga0065704_10007764
1161 Ga0065712_10067732
1162 Ga0065712_10075433
1163 Ga0065712_10094064
1164 Ga0065712_10116389
1165 Ga0065712_10200756
1166 Ga0065715_10089198
1167 Ga0065715_10142034
1168 Ga0065707_10022085
1169 Ga0065707_10140090
1170 Ga0065707_10187479
1171 Ga0070658_10004860
1172 Ga0070658_10126546
1173 Ga0070676_10068868
1174 Ga0070676_10089491
1175 Ga0070683_100000031
1176 Ga0070683_100008679
1177 Ga0070683_100022911
1178 Ga0070683_100234141
1179 Ga0070683_100253829
1180 Ga0070690_100026972
1181 Ga0070690_100073932
1182 Ga0070690_100088229
1183 Ga0070690_100170826
1184 Ga0070670_100000688
1185 Ga0070670_100038640
1186 Ga0070670_100092794
1187 Ga0070670_100180189
1188 Ga0070666_10001918
1189 Ga0070666_10010934
1190 Ga0070666_10020033
1191 Ga0070666_10066056
1192 Ga0070682_100000347
1193 Ga0070682_100030096
1194 Ga0070682_100177012
1195 Ga0068868_100159430
1196 Ga0068868_100236221
1197 Ga0070660_100059320
1198 Ga0070660_100153588
1199 Ga0070660_100207527
1200 Ga0070689_100088810
1201 Ga0070689_100125832
1202 Ga0070687_100124091
1203 Ga0070661_100000055
1204 Ga0070661_100006128
1205 Ga0070661_100018950
1206 Ga0070692_10038710
1207 Ga0070668_100190282
1208 Ga0070668_100360656
1209 Ga0070669_100000023
1210 Ga0070669_100025331
1211 Ga0070669_100187896
1212 Ga0070669_100207706
1213 Ga0070675_100011925
1214 Ga0070675_100122582
1215 Ga0070675_100133244
1216 Ga0070671_100009139
1217 Ga0070671_100021272
1218 Ga0070671_100049868
1219 Ga0070671_100127440
1220 Ga0070671_100287862
1221 Ga0070674_100008654
1222 Ga0070673_100000385
1223 Ga0070659_100023815
1224 Ga0070659_100328874
1225 Ga0070667_100100475
1226 Ga0070667_100100873
1227 Ga0070667_100191618
1228 Ga0070667_100206793
1229 Ga0070667_100242939
1230 Ga0070667_100258595
1231 Ga0070703_10000798
1232 Ga0070709_10000039
1233 Ga0070709_10011466
1234 Ga0070709_10029380
1235 Ga0070709_10112178
1236 Ga0070714_100007032
1237 Ga0070714_100013704
1238 Ga0070714_100054675
1239 Ga0070713_100001464
1240 Ga0070713_100002736
1241 Ga0070713_100075736
1242 Ga0070713_100114361
1243 Ga0070713_100172970
1244 Ga0070713_100204404
1245 Ga0070713_100254169
1246 Ga0070713_100374186
1247 Ga0070713_100430557
1248 Ga0070710_10022157
1249 Ga0070710_10024129
1250 Ga0070710_10099253
1251 Ga0070711_100000225
1252 Ga0070711_100080116
1253 Ga0070711_100115172
1254 Ga0070711_100124959
1255 Ga0070711_100128224
1256 Ga0070705_100036058
1257 Ga0070705_100066479
1258 Ga0070705_100115458
1259 Ga0070700_100059212
1260 Ga0070694_100072569
1261 Ga0070708_100009638
1262 Ga0070708_100038650
1263 Ga0070708_100407723
1264 Ga0070663_100006248
1265 Ga0070663_100069213
1266 Ga0070678_100002567
1267 Ga0070678_100081635
1268 Ga0070678_100085922
1269 Ga0070678_100157094
1270 Ga0070678_100233803
1271 Ga0070662_100313278
1272 Ga0070681_10074222
1273 Ga0070681_10261553
1274 Ga0070685_10010854
1275 Ga0070685_10051395
1276 Ga0070706_100000131
1277 Ga0070706_100018749
1278 Ga0070706_100028059
1279 Ga0070706_100053627
1280 Ga0070706_100289634
1281 Ga0070698_100007615
1282 Ga0070698_100010085
1283 Ga0070698_100016313
1284 Ga0070699_100000009
1285 Ga0070699_100033175
1286 Ga0070699_100047435
1287 Ga0070679_100004900
1288 Ga0070679_100325805
1289 Ga0070679_100371267
1290 Ga0070684_100000030
1291 Ga0070684_100010128
1292 Ga0070684_100019042
1293 Ga0070684_100259344
1294 Ga0070697_100010791
1295 Ga0070697_100076502
1296 Ga0070697_100143626
1297 Ga0070697_100342648
1298 Ga0068853_100000108
1299 Ga0068853_100000635
1300 Ga0070672_100001906
1301 Ga0070672_100018779
1302 Ga0070672_100025876
1303 Ga0070672_100113429
1304 Ga0070672_100351734
1305 Ga0070695_100014494
1306 Ga0070696_100000136
1307 Ga0070696_100024739
1308 Ga0070696_100181736
1309 Ga0070693_100010008
1310 Ga0070693_100287697
1311 Ga0070665_100027074
1312 Ga0070665_100147492
1313 Ga0070665_100193326
1314 Ga0070665_100531735
1315 Ga0068855_100003669
1316 Ga0068855_100004022
1317 Ga0068855_100012713
1318 Ga0068855_100018921
1319 Ga0068855_100028545
1320 Ga0068855_100043088
1321 Ga0068855_100089705
1322 Ga0068855_100106728
1323 Ga0068857_100016940
1324 Ga0068857_100017552
1325 Ga0068857_100035636
1326 Ga0068854_100099374
1327 Ga0068856_100000408
1328 Ga0068856_100003746
1329 Ga0068856_100012673
1330 Ga0068856_100013228
1331 Ga0068856_100111800
1332 Ga0070702_100052249
1333 Ga0068852_100000234
1334 Ga0068852_100000599
1335 Ga0068852_100084244
1336 Ga0068852_100094164
1337 Ga0068859_100000016
1338 Ga0068859_100024921
1339 Ga0068859_100025105
1340 Ga0068859_100121876
1341 Ga0068859_100153608
1342 Ga0068859_100215522
1343 Ga0068859_100281856
1344 Ga0068864_100006197
1345 Ga0068864_100009787
1346 Ga0068864_100078445
1347 Ga0068864_100105441
1348 Ga0068864_100123187
1349 Ga0068864_100140689
1350 Ga0068864_100245975
1351 Ga0068866_10073156
1352 Ga0068861_100062317
1353 Ga0068851_10003565
1354 Ga0068851_10008995
1355 Ga0068851_10048224
1356 Ga0068863_100031542
1357 Ga0068863_100046447
1358 Ga0068863_100141855
1359 Ga0068863_100160866
1360 Ga0068863_100162014
1361 Ga0068863_100195773
1362 Ga0068863_100244694
1363 Ga0068863_100262960
1364 Ga0068863_100280606
1365 Ga0068863_100386836
1366 Ga0068858_100000008
1367 Ga0068858_100050397
1368 Ga0068858_100078741
1369 Ga0068858_100085695
1370 Ga0068858_100100162
1371 Ga0068858_100151613
1372 Ga0068858_100215275
1373 Ga0068858_100247213
1374 Ga0068858_100253899
1375 Ga0068860_100017093
1376 Ga0068860_100122386
1377 Ga0068860_100401371
1378 Ga0068862_100000425
1379 Ga0068862_100036013
1380 Ga0068862_100095758
1381 Ga0068862_100371831
1382 Ga0081455_10009500
1383 Ga0081455_10050949
1384 Ga0081455_10149124
1385 Ga0081540_1000560
1386 Ga0081540_1050005
1387 Ga0081539_10000647
1388 Ga0081539_10001121
1389 Ga0070717_10001781
1390 Ga0070717_10019574
1391 Ga0070717_10020888
1392 Ga0070717_10046477
1393 Ga0070717_10098598
1394 Ga0070717_10157615
1395 Ga0070715_10010166
1396 Ga0070715_10045941
1397 Ga0070716_100018244
1398 Ga0070716_100041273
1399 Ga0070716_100075652
1400 Ga0070712_100001263
1401 Ga0070712_100006323
1402 Ga0070712_100107766
1403 Ga0097621_100016407
1404 Ga0097621_100022381
1405 Ga0097621_100343149
1406 Ga0068871_100030665
1407 Ga0068871_100048940
1408 Ga0068871_100135326
1409 Ga0075428_100071511
1410 Ga0075428_100193412
1411 Ga0075430_100002212
1412 Ga0075430_100031247
1413 Ga0075430_100129829
1414 Ga0075430_100167609
1415 Ga0075431_100035241
1416 Ga0075431_100127325
1417 Ga0075431_100190758
1418 Ga0075433_10024007
1419 Ga0075434_100177251
1420 Ga0075434_100296961
1421 Ga0075429_100009967
1422 Ga0075429_100071950
1423 Ga0075436_100021577
1424 Ga0097620_100000016
1425 Ga0097620_100024921
1426 Ga0097620_100025106
1427 Ga0097620_100121876
1428 Ga0097620_100153613
1429 Ga0097620_100215524
1430 Ga0097620_100281875
1431 Ga0099794_10053035
1432 Ga0105240_10000060
1433 Ga0105240_10000166
1434 Ga0105240_10004201
1435 Ga0105240_10013037
1436 Ga0105240_10045314
1437 Ga0105240_10098903
1438 Ga0105240_10204825
1439 Ga0105240_10243846
1440 Ga0111539_10008568
1441 Ga0111539_10091985
1442 Ga0111539_10105841
1443 Ga0111539_10120853
1444 Ga0111539_10248974
1445 Ga0105245_10007338
1446 Ga0105245_10026955
1447 Ga0105245_10079682
1448 Ga0105245_10216712
1449 Ga0105247_10000001
1450 Ga0105247_10031476
1451 Ga0105247_10298087
1452 Ga0114129_10017754
1453 Ga0114129_10025752
1454 Ga0114129_10042110
1455 Ga0114129_10164202
1456 Ga0114129_10509965
1457 Ga0105243_10000344
1458 Ga0105243_10136167
1459 Ga0105241_10000383
1460 Ga0105241_10012596
1461 Ga0105241_10019513
1462 Ga0105241_10027715
1463 Ga0105242_10001266
1464 Ga0105242_10007464
1465 Ga0105242_10403251
1466 Ga0105248_10000003
1467 Ga0105248_10005255
1468 Ga0105248_10028964
1469 Ga0105248_10034308
1470 Ga0105248_10036829
1471 Ga0105248_10042745
1472 Ga0105248_10064342
1473 Ga0105237_10000163
1474 Ga0105237_10139725
1475 Ga0105237_10196891
1476 Ga0105238_10000710
1477 Ga0105238_10001915
1478 Ga0105238_10004919
1479 Ga0105238_10015258
1480 Ga0105238_10042251
1481 Ga0105238_10142273
1482 Ga0105238_10166809
1483 Ga0105238_10325243
1484 Ga0105249_10010647
1485 Ga0105249_10011728
1486 Ga0105249_10106798
1487 Ga0105249_10125511
1488 Ga0105249_10152117
1489 Ga0105239_10007680
1490 Ga0105239_10014324
1491 Ga0105239_10017583
1492 Ga0105239_10022558
1493 Ga0105239_10028637
1494 Ga0105246_10006614
1495 Ga0105246_10218498
1496 Ga0105246_10266065
1497 Ga0105246_10346656
1498 Ga0157373_10017490
1499 Ga0157371_10199480
1500 Ga0157371_10254448
1501 Ga0157370_10000139
1502 Ga0157370_10027580
1503 Ga0157370_10131507
1504 Ga0157369_10000079
1505 Ga0157369_10002833
1506 Ga0157369_10005321
1507 Ga0157369_10005381
1508 Ga0157369_10014871
1509 Ga0157369_10016614
1510 Ga0157369_10021389
1511 Ga0157369_10024091
1512 Ga0157369_10060830
1513 Ga0157369_10102224
1514 Ga0157369_10519835
1515 Ga0157374_10002079
1516 Ga0157374_10002768
1517 Ga0157374_10010430
1518 Ga0157374_10011582
1519 Ga0157374_10015604
1520 Ga0157374_10059851
1521 Ga0157374_10076509
1522 Ga0157374_10127327
1523 Ga0157374_10433572
1524 Ga0157378_10000019
1525 Ga0157378_10003965
1526 Ga0157378_10015715
1527 Ga0157378_10027554
1528 Ga0157378_10042866
1529 Ga0157378_10078813
1530 Ga0157378_10200127
1531 Ga0157378_10224682
1532 Ga0157378_10381486
1533 Ga0163162_10010125
1534 Ga0163162_10013020
1535 Ga0163162_10075653
1536 Ga0163162_10218628
1537 Ga0163162_10407171
1538 Ga0163162_10535788
1539 Ga0157372_10000101
1540 Ga0157372_10013100
1541 Ga0157372_10015595
1542 Ga0157372_10016255
1543 Ga0157372_10017037
1544 Ga0157372_10022915
1545 Ga0157372_10036318
1546 Ga0157372_10041549
1547 Ga0157372_10051907
1548 Ga0157372_10144086
1549 Ga0157375_10000560
1550 Ga0157375_10005673
1551 Ga0157375_10011769
1552 Ga0157375_10038820
1553 Ga0157375_10043115
1554 Ga0157375_10057446
1555 Ga0157375_10079346
1556 Ga0157375_10086066
1557 Ga0157375_10092613
1558 Ga0157375_10172709
1559 Ga0157375_10224438
1560 Ga0157375_10464062
1561 Ga0157375_10565792
1562 Ga0163163_10010210
1563 Ga0163163_10053291
1564 Ga0163163_10072035
1565 Ga0163163_10081964
1566 Ga0163163_10084728
1567 Ga0163163_10104549
1568 Ga0163163_10139706
1569 Ga0163163_10314985
1570 Ga0157380_10035473
1571 Ga0157380_10116764
1572 Ga0157377_10063295
1573 Ga0157379_10006136
1574 Ga0157379_10079767
1575 Ga0157379_10115265
1576 Ga0157376_10017159
1577 Ga0157376_10036766
1578 Ga0157376_10051476
1579 Ga0157376_10149393
1580 Ga0182006_1020509
1581 Ga0182005_1046605
1582 Ga0163161_10018993
1583 Ga0163161_10024906
1584 Ga0197907_10810373
1585 Ga0206356_11558599
1586 Ga0206355_1032423
1587 Ga0206354_10360414
1588 Ga0213872_10008858
1589 Ga0213876_10010940
1590 Ga0213871_10004892
1591 Ga0228598_1005083
1592 Ga0207672_1001192
1593 Ga0209026_1000158
1594 Ga0209026_1002284
1595 Ga0209759_1011628
1596 Ga0209455_1000218
1597 Ga0207697_10001233
1598 Ga0207697_10004903
1599 Ga0207697_10005583
1600 Ga0207697_10010998
1601 Ga0207656_10014248
1602 Ga0207656_10036147
1603 Ga0207653_10000070
1604 Ga0207692_10017016
1605 Ga0207710_10000003
1606 Ga0207710_10003349
1607 Ga0207710_10089493
1608 Ga0207680_10000062
1609 Ga0207680_10001509
1610 Ga0207647_10006978
1611 Ga0207647_10039344
1612 Ga0207647_10040783
1613 Ga0207685_10008205
1614 Ga0207685_10021792
1615 Ga0207685_10031441
1616 Ga0207699_10000023
1617 Ga0207699_10023506
1618 Ga0207699_10052630
1619 Ga0207699_10086410
1620 Ga0207699_10186581
1621 Ga0207699_10257162
1622 Ga0207645_10001695
1623 Ga0207645_10078565
1624 Ga0207643_10019602
1625 Ga0207705_10006079
1626 Ga0207705_10018618
1627 Ga0207705_10043759
1628 Ga0207705_10096983
1629 Ga0207705_10102189
1630 Ga0207684_10000102
1631 Ga0207684_10000186
1632 Ga0207684_10001595
1633 Ga0207684_10199384
1634 Ga0207684_10332854
1635 Ga0207654_10000731
1636 Ga0207654_10031820
1637 Ga0207654_10097857
1638 Ga0207707_10037611
1639 Ga0207695_10000025
1640 Ga0207695_10000028
1641 Ga0207695_10000637
1642 Ga0207695_10002224
1643 Ga0207695_10004845
1644 Ga0207695_10017985
1645 Ga0207695_10045150
1646 Ga0207695_10061340
1647 Ga0207695_10072590
1648 Ga0207695_10183972
1649 Ga0207671_10000582
1650 Ga0207671_10000935
1651 Ga0207671_10006120
1652 Ga0207693_10000262
1653 Ga0207693_10000734
1654 Ga0207693_10003119
1655 Ga0207693_10027230
1656 Ga0207693_10054645
1657 Ga0207693_10073547
1658 Ga0207663_10000553
1659 Ga0207663_10043276
1660 Ga0207663_10087055
1661 Ga0207657_10023837
1662 Ga0207649_10031041
1663 Ga0207649_10188954
1664 Ga0207649_10344200
1665 Ga0207652_10237450
1666 Ga0207652_10309757
1667 Ga0207646_10187635
1668 Ga0207681_10000004
1669 Ga0207681_10020058
1670 Ga0207694_10000249
1671 Ga0207694_10001221
1672 Ga0207694_10003221
1673 Ga0207694_10022238
1674 Ga0207694_10029722
1675 Ga0207694_10329467
1676 Ga0207650_10000570
1677 Ga0207650_10026870
1678 Ga0207650_10145993
1679 Ga0207650_10191481
1680 Ga0207650_10263471
1681 Ga0207650_10269628
1682 Ga0207659_10140489
1683 Ga0207687_10006671
1684 Ga0207687_10013607
1685 Ga0207687_10063563
1686 Ga0207700_10003181
1687 Ga0207700_10005575
1688 Ga0207700_10010940
1689 Ga0207700_10071596
1690 Ga0207700_10105364
1691 Ga0207700_10161288
1692 Ga0207664_10091429
1693 Ga0207664_10136065
1694 Ga0207664_10194032
1695 Ga0207644_10000031
1696 Ga0207644_10122052
1697 Ga0207644_10199048
1698 Ga0207706_10021238
1699 Ga0207706_10022300
1700 Ga0207706_10243359
1701 Ga0207686_10000777
1702 Ga0207686_10174065
1703 Ga0207670_10077436
1704 Ga0207669_10001072
1705 Ga0207704_10307034
1706 Ga0207665_10006615
1707 Ga0207665_10053885
1708 Ga0207665_10066925
1709 Ga0207691_10004834
1710 Ga0207691_10011167
1711 Ga0207691_10014258
1712 Ga0207691_10019641
1713 Ga0207691_10071999
1714 Ga0207691_10091098
1715 Ga0207711_10000012
1716 Ga0207711_10001298
1717 Ga0207711_10014531
1718 Ga0207711_10019311
1719 Ga0207711_10032837
1720 Ga0207711_10308784
1721 Ga0207689_10027664
1722 Ga0207661_10000012
1723 Ga0207661_10011022
1724 Ga0207661_10015140
1725 Ga0207661_10030159
1726 Ga0207661_10237215
1727 Ga0207667_10001916
1728 Ga0207667_10002211
1729 Ga0207667_10004385
1730 Ga0207667_10032351
1731 Ga0207667_10300354
1732 Ga0207667_10530194
1733 Ga0207651_10000243
1734 Ga0207712_10000665
1735 Ga0207712_10008830
1736 Ga0207712_10116035
1737 Ga0207668_10113241
1738 Ga0207658_10021940
1739 Ga0207658_10273239
1740 Ga0207677_10131626
1741 Ga0207677_10199277
1742 Ga0207703_10000109
1743 Ga0207703_10001882
1744 Ga0207703_10015204
1745 Ga0207703_10189299
1746 Ga0207639_10000127
1747 Ga0207639_10001341
1748 Ga0207678_10007664
1749 Ga0207678_10093204
1750 Ga0207702_10000809
1751 Ga0207702_10001049
1752 Ga0207702_10008988
1753 Ga0207702_10056864
1754 Ga0207702_10076091
1755 Ga0207702_10296989
1756 Ga0207641_10015238
1757 Ga0207641_10115442
1758 Ga0207641_10148957
1759 Ga0207641_10192700
1760 Ga0207676_10001214
1761 Ga0207676_10065857
1762 Ga0207676_10163011
1763 Ga0207676_10351490
1764 Ga0207676_10372142
1765 Ga0207674_10000675
1766 Ga0207674_10001753
1767 Ga0207674_10232453
1768 Ga0207675_100002039
1769 Ga0207675_100133918
1770 Ga0207683_10008786
1771 Ga0207683_10009704
1772 Ga0207683_10020934
1773 Ga0207683_10155051
1774 Ga0207683_10183725
1775 Ga0207683_10334699
1776 Ga0207698_10000623
1777 Ga0207698_10000895
1778 Ga0207698_10014938
1779 Ga0207698_10118541
1780 Ga0209967_1001744
1781 Ga0210000_1000015
1782 Ga0209968_1002263
1783 Ga0209999_1000452
1784 Ga0209970_1006825
1785 Ga0209966_1002410
1786 Ga0209966_1018816
1787 Ga0207428_10012376
1788 Ga0265354_1000204
1789 Ga0265354_1004108
1790 Ga0268266_10034222
1791 Ga0268266_10059930
1792 Ga0268266_10062500
1793 Ga0268266_10304023
1794 Ga0268266_10340734
1795 Ga0268265_10000046
1796 Ga0268264_10000879
1797 Ga0268264_10004546
1798 Ga0268264_10015871
1799 Ga0268264_10044443
1800 Ga0268264_10052522
1801 Ga0268264_10318016
1802 Ga0268264_10400795
1803 Ga0265326_10000443
1804 Ga0265334_10046880
1805 Ga0265318_10014358
1806 Ga0265323_10002666
1807 Ga0265323_10026857
1808 Ga0265336_10002094
1809 Ga0265338_10002061
1810 Ga0265338_10018503
1811 Ga0265338_10022912
1812 Ga0265338_10024815
1813 Ga0265338_10037490
1814 Ga0265338_10052369
1815 Ga0265338_10156561
1816 Ga0265338_10235210
1817 Ga0265770_1001690
1818 Ga0265760_10002054
1819 Ga0265760_10002624
1820 Ga0265760_10012599
1821 Ga0265330_10000183
1822 Ga0265320_10002070
1823 Ga0265320_10005985
1824 Ga0265325_10001847
1825 Ga0265325_10007361
1826 Ga0265325_10079272
1827 Ga0265329_10010196
1828 Ga0265340_10008168
1829 Ga0265339_10000017
1830 Ga0265339_10000196
1831 Ga0265331_10000851
1832 Ga0265331_10004840
1833 Ga0265331_10013839
1834 Ga0265327_10000307
1835 Ga0265327_10012262
1836 Ga0265327_10024684
1837 Ga0265316_10000604
1838 Ga0265316_10005921
1839 Ga0265316_10010560
1840 Ga0265316_10010808
1841 Ga0265316_10025120
1842 Ga0265316_10031939
1843 Ga0265316_10032762
1844 Ga0265316_10039642
1845 Ga0265316_10051179
1846 Ga0265316_10110789
1847 Ga0307408_100000053
1848 Ga0307408_100009298
1849 Ga0307408_100016884
1850 Ga0307408_100048127
1851 Ga0307408_100174886
1852 Ga0307408_100399411
1853 Ga0265313_10000823
1854 Ga0307508_10003602
1855 Ga0265314_10000764
1856 Ga0265314_10001769
1857 Ga0265314_10002441
1858 Ga0265314_10007673
1859 Ga0265314_10012428
1860 Ga0265314_10037430
1861 Ga0265314_10120439
1862 Ga0265314_10143389
1863 Ga0265314_10164819
1864 Ga0265342_10002491
1865 Ga0265342_10004192
1866 Ga0316578_10198269
1867 Ga0307516_10001545
1868 Ga0307516_10003925
1869 Ga0307516_10172953
1870 Ga0307405_10053208
1871 Ga0307405_10216007
1872 Ga0307413_10030509
1873 Ga0307413_10095086
1874 Ga0307410_10000005
1875 Ga0307410_10007730
1876 Ga0307410_10156523
1877 Ga0307410_10242807
1878 Ga0307406_10007849
1879 Ga0307406_10036789
1880 Ga0307407_10051016
1881 Ga0307412_10002920
1882 Ga0307412_10012973
1883 Ga0307412_10128596
1884 Ga0307412_10351826
1885 Ga0307409_100000679
1886 Ga0307409_100231683
1887 Ga0307416_100000056
1888 Ga0307416_100020411
1889 Ga0307416_100082732
1890 Ga0307416_100429524
1891 Ga0307414_10043448
1892 Ga0307414_10082959
1893 Ga0307411_10003475
1894 Ga0307411_10008180
1895 Ga0307411_10038223
1896 Ga0307411_10056154
1897 Ga0307411_10233625
1898 Ga0307415_100052612
1899 Ga0307415_100076281
1900 Ga0307415_100330169
1901 Ga0307415_100370387
1902 Ga0373928_0031329
1903 Ga0373923_0015310
1904 Ga0373932_0012612
1905 Ga0373945_0075272
1906 Ga0373957_0082634
1907 Ga0373943_0017367
1908 Ga0373955_0133206
1909 Ga0373962_0042950
1910 Ga0316574_0138456
1911 Ga0373924_0008676
1912 Ga0373924_0026442
1913 Ga0373924_0074172
1914 Ga0373931_0076358
1915 Ga0373931_0245680
1916 Ga0373935_0007970
1917 Ga0373927_0005280
1918 Ga0373933_0027979
1919 Ga0373933_0071033
1920 Ga0373933_0173295
1921 Ga0373947_0066748
1922 Ga0373947_0308310
1923 Ga0373937_0009165
1924 Ga0373937_0012705
1925 Ga0373937_0063112
1926 Ga0373937_0077803
1927 Ga0373937_0096296
1928 Ga0373937_0166831
1929 Ga0373937_0172235
1930 Ga0373937_0245783
1931 Ga0373937_0291104
1932 Ga0316584_0267585
1933 Ga0373925_0074345
1934 Ga0373925_0077143
1935 Ga0373925_0139972
1936 Ga0373925_0261054
1937 Ga0395900_0001170
1938 Ga0395900_0027557
1939 Ga0395900_0295414
1940 Ga0395905_0122619
1941 Ga0395905_0166676
1942 Ga0395905_0180443
1943 Ga0395905_0201940
1944 Ga0395905_0248344
1945 Ga0395901_0025312
1946 Ga0395901_0046407
1947 Ga0242422_00187
1948 Ga0242420_018863
1949 Ga0436365_0668515
1950 Ga0436365_1018976
1951 Ga0436365_1444529
1952 Ga0436360_0129730
1953 Ga0436361_0010635
1954 Ga0436361_0830524
1955 Ga0439447_024633
1956 Ga0439466_0037507
1957 Ga0439433_0002025
1958 Ga0439432_010096
1959 Ga0439452_001783
1960 Ga0439462_0001865
1961 Ga0450907_006360
1962 Ga0439458_0002185
1963 Ga0450909_011881
1964 Ga0439434_0016973
1965 Ga0451577_0000167
1966 Ga0451577_0000454
1967 Ga0451577_0004538
1968 Ga0451577_0005264
1969 Ga0451577_0006551
1970 Ga0451577_0014214
1971 Ga0451577_0044677
1972 Ga0451577_0351602
1973 Ga0453683_0000124
1974 Ga0453683_0000469
1975 Ga0453683_0002089
1976 Ga0453683_0016263
1977 Ga0453683_0062097
1978 Ga0453683_0103472
1979 Ga0453683_0142632
1980 Ga0466966_0149652
1981 Ga0466961_0107870
1982 Ga0466961_0221722
1983 Ga0453684_0000422
1984 Ga0453684_0000446
1985 Ga0453684_0003944
1986 Ga0453684_0004475
1987 Ga0453684_0012103
1988 Ga0453684_0014205
1989 Ga0453684_0115326
1990 Ga0453684_0153468
1991 Ga0453684_0305648
1992 Ga0453684_0307194
1993 Ga0453684_0351808
1994 Ga0466957_0169195
1995 Ga0466960_0000063
1996 Ga0451576_0000797
1997 Ga0451576_0001109
1998 Ga0451576_0032792
1999 Ga0451576_0219815
2000 Ga0451576_0252861
2001 Ga0451576_0296546
2002 Ga0451576_0325591
2003 Ga0451576_0471373
2004 Ga0466967_0007112
2005 Ga0466967_0007615
2006 Ga0495627_031181
2007 Ga0495592_0019990
2008 Ga0495592_0129088
2009 Ga0495629_0029824
2010 Ga0495629_0041944
2011 Ga0495629_0047201
2012 Ga0495651_0198073
2013 Ga0495653_0006291
2014 Ga0495653_0214736
2015 Ga0495650_0000063
2016 Ga0495580_0001579
2017 Ga0495580_0022435
2018 Ga0495580_0023443
2019 Ga0495580_0025082
2020 Ga0495580_0160284
2021 Ga0495580_0306088
2022 Ga0495582_0059366
2023 Ga0495639_0084715
2024 Ga0495639_0163838
2025 Ga0495594_0005796
2026 Ga0495594_0036758
2027 Ga0495606_0001183
2028 Ga0495608_0001348
2029 Ga0495608_0025061
2030 Ga0495616_0000122
2031 Ga0495616_0000187
2032 Ga0495616_0000276
2033 Ga0495618_0005223
2034 Ga0495628_0001615
2035 Ga0495628_0273272
2036 Ga0495630_0023311
2037 Ga0495630_0160597
2038 Ga0495630_0211324
2039 Ga0495643_0000580
2040 Ga0495663_0057726
2041 Ga0495652_0000812
2042 Ga0495654_0002529
2043 Ga0495654_0011725
2044 Ga0495640_0047091
2045 Ga0495640_0140340
2046 Ga0495586_0105991
2047 Ga0495587_0012571
2048 Ga0495633_0018036
2049 Ga0495667_0000215
2050 Ga0495667_0019050
2051 Ga0495668_0003199
2052 Ga0495668_0006493
2053 Ga0495668_0009039
2054 Ga0495668_0049342
2055 Ga0495661_0031172
2056 Ga0495657_0002973
2057 Ga0495669_0057829
2058 Ga0495613_0010066
2059 Ga0495613_0088784
2060 Ga0495613_0246447
2061 Ga0495671_0121334
2062 Ga0495589_0014533
2063 Ga0495600_0154817
2064 Ga0495581_0038863
2065 Ga0495581_0041258
2066 Ga0495604_0047480
2067 Ga0495674_0000271
2068 Ga0495674_0009483
2069 Ga0495674_0204759
2070 Ga0495680_0002950
2071 Ga0495687_015990
2072 Ga0495675_0000354
2073 Ga0495684_0020764
2074 Ga0495684_0066876
2075 Ga0495684_0138283
2076 Ga0495686_0007438
2077 Ga0495686_0114900
2078 Ga0495602_0073722
2079 Ga0495602_0078102
2080 Ga0496101_0131704
2081 Ga0496102_0161837
2082 Ga0496102_0223448
2083 Ga0496103_0350144
2084 Ga0496104_0042519
2085 Ga0496104_0138453
2086 Ga0496104_0199700
2087 Ga0496104_0244288
2088 Ga0496104_0400636
2089 Ga0496105_0046426
2090 Ga0496105_0051326
2091 Ga0496105_0470871
2092 Ga0496106_0018866
2093 Ga0496106_0086588
2094 Ga0496107_0022249
2095 Ga0496108_0012657
2096 Ga0496108_0027061
2097 Ga0496108_0033172
2098 Ga0496109_0025140
2099 Ga0496109_0098718
2100 Ga0496109_0111063
2101 Ga0496109_0145251
2102 Ga0496109_0221632
2103 Ga0496110_0028922
2104 Ga0496110_0149699
2105 Ga0496110_0314615
2106 Ga0496111_0020070
2107 Ga0496112_0024604
2108 Ga0496112_0156984
2109 Ga0496112_0171241
2110 Ga0496113_0204001
2111 Ga0496114_0004338
2112 Ga0496114_0033149
2113 Ga0496114_0168010
2114 Ga0496114_0413390
2115 Ga0496115_0009048
2116 Ga0496115_0013321
2117 Ga0496115_0111770
2118 Ga0496121_0005276
2119 Ga0496121_0219989
2120 Ga0496126_0003087
2121 Ga0496126_0008507
2122 Ga0501298_004427
2123 Ga0501302_001857
2124 Ga0501031_0046440
2125 Ga0501031_0059850
2126 Ga0501032_0023547
2127 Ga0501032_0089706
2128 Ga0501033_0000337
2129 Ga0501033_0021848
2130 Ga0501033_0122724
2131 Ga0501034_0000461
2132 Ga0501034_0002385
2133 Ga0501034_0003139
2134 Ga0501034_0033843
2135 Ga0501034_0052307
2136 Ga0501034_0068458
2137 Ga0501034_0081922
2138 Ga0501034_0127755
2139 Ga0501034_0190370
2140 Ga0501036_0004555
2141 Ga0501036_0016233
2142 Ga0501036_0105217
2143 Ga0501037_0004663
2144 Ga0501037_0114904
2145 Ga0501038_0001263
2146 Ga0501038_0011870
2147 Ga0501038_0045157
2148 Ga0501038_0113357
2149 Ga0501039_0019759
2150 Ga0501039_0040703
2151 Ga0501039_0047509
2152 Ga0501039_0080632
2153 Ga0501040_0013105
2154 Ga0501040_0181950
2155 Ga0501042_0030276
2156 Ga0501042_0078975
2157 Ga0501043_0002565
2158 Ga0501043_0060761
2159 Ga0501043_0164315
2160 Ga0501046_0000025
2161 Ga0501046_0023621
2162 Ga0501046_0066279
2163 Ga0501046_0267621
2164 Ga0501047_0003053
2165 Ga0501047_0033929
2166 Ga0501047_0218951
2167 Ga0501048_0009926
2168 Ga0501048_0017442
2169 Ga0501048_0050764
2170 Ga0501048_0129289
2171 Ga0501048_0139564
2172 Ga0501067_0146380
2173 Ga0501068_0030423
2174 Ga0501071_0019378
2175 Ga0501072_0014538
2176 Ga0501072_0275405
2177 Ga0501074_0030377
2178 Ga0501074_0112712
2179 Ga0501076_0005919
2180 Ga0501076_0106010
2181 Ga0501077_0012622
2182 Ga0501077_0014673
2183 Ga0501077_0039740
2184 Ga0501216_013491
2185 Ga0501223_000438
2186 Ga0501235_000818
2187 Ga0501243_006117
2188 Ga0501234_001339
2189 Ga0501079_0005151
2190 Ga0501079_0094908
2191 Ga0501079_0181110
2192 Ga0501080_0065836
2193 Ga0501080_0067070
2194 Ga0501080_0286382
2195 Ga0501081_0072109
2196 Ga0501081_0261646
2197 Ga0501083_0001588
2198 Ga0501268_009087
2199 Ga0501270_002867
2200 Ga0501283_000160
2201 Ga0501035_0023351
2202 Ga0501035_0075534
2203 Ga0501035_0107548
2204 Ga0501035_0148234
2205 Ga0501035_0178965
2206 Ga0501044_0014492
2207 Ga0501044_0022075
2208 Ga0501044_0029323
2209 Ga0501044_0092341
2210 Ga0501044_0104996
2211 Ga0501044_0118090
2212 Ga0501045_0008713
2213 Ga0501045_0021923
2214 Ga0501045_0101826
2215 nmdc:mga07m45_156482_c1
2216 nmdc:mga05p37_227256_c1
2217 nmdc:mga05p37_390218_c1
2218 nmdc:mga05p37_41169_c1
2219 nmdc:mga09592_17734_c1
2220 nmdc:mga09592_94627_c1
2221 nmdc:mga0qj67_29345_c1
2222 nmdc:mga0qj67_587_c1
2223 nmdc:mga06r32_172951_c1
2224 nmdc:mga06r32_184181_c1
2225 nmdc:mga06r32_352112_c1
2226 nmdc:mga08y16_15671_c1
2227 nmdc:mga08y16_173702_c1
2228 nmdc:mga08y16_22520_c1
2229 nmdc:mga0n895_174777_c1
2230 nmdc:mga0n895_201428_c1
2231 nmdc:mga0n895_3811_c1
2232 nmdc:mga08x19_117339_c1
2233 Ga0495601_0016863
2234 Ga0495601_0058748
2235 Ga0495619_0077357
2236 Ga0495619_0215219
2237 Ga0495619_0254586
2238 Ga0500592_000310
2239 Ga0500592_000519
2240 Ga0500592_001386
2241 Ga0500595_019267
2242 Ga0500607_013278
2243 Ga0500568_0018534
2244 Ga0500577_0061201
2245 Ga0500604_0003278
2246 Ga0500604_0012031
2247 Ga0500604_0018702
2248 Ga0500616_0002767
2249 Ga0500616_0007137
2250 Ga0500627_0000218
2251 Ga0500627_0002835
2252 Ga0500627_0021298
2253 Ga0500634_0005118
2254 Ga0500636_0006862
2255 Ga0500637_0002948
2256 Ga0500645_013160
2257 Ga0501084_0010348
2258 Ga0501084_0024645
2259 Ga0590075_003486
2260 Ga0590075_010969
2261 Ga0590075_021996
2262 Ga0590077_005594
2263 Ga0587084_008686
2264 Ga0587070_010926
2265 Ga0587073_0018703
2266 Ga0587073_0030133
2267 Ga0587082_012301
2268 Ga0587092_010396
2269 Ga0587072_015782
2270 Ga0587076_013696
2271 Ga0587110_003725
2272 Ga0501082_0006861
2273 Ga0501082_0066443
2274 Ga0530510_0009751
2275 Ga0530510_0015195
2276 Ga0530510_0023280
2277 2748019729
2278 2919522732
2279 2945944968
2280 8022951137

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

246

366

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

92

214

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

275

394

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z0c-assembly1.cif.gz_A-2 nerol dehydrogenase from persicaria minor 0.9765 11 357
1uuf-assembly1.cif.gz_A-2 crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk 0.972 17 360
1yqx-assembly1.cif.gz_B sinapyl alcohol dehydrogenase at 2.5 angstrom resolution 0.9717 15 357
5fi5-assembly1.cif.gz_B heteroyohimbine synthase thas1 from catharanthus roseus - apo form 0.9675 15 358
7cgu-assembly1.cif.gz_A crystal structure of abhar 0.9652 11 358
ID Description Score Start End Superfamily
af_P9WQC5_159_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9892 174 325 3.40.50.720
af_P9WQC5_8_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.982 21 264 3.40.50.720
af_C6TB56_4_167_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9805 15 176 3.90.180.10
af_A0A0R0FW40_1_100_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9777 77 176 3.90.180.10
af_A0A0R0ITF2_16_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9777 20 129 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A835E2P8-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9963 252 356 GO:0016616
AF-A0A068TXD9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9945 246 358 GO:0016616
AF-A0A0Y0IGH8-F1-model_v4 deleted 0.9939 184 333
AF-A0A3A8H498-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9935 199 360 GO:0016616
AF-A0A7S0L745-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9924 247 344 GO:0016616

Map