F490700
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1140 | 428 | 2280 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10003270|Ga0207652_1000327012 |
| Length | 407 |
| Sequence | MSVFPHKNGTASLLPIHSNRRFALNVCEQSCARSRRDLWEQDGVIGIKNGVFCILACSQRSYSEAMYNAKAFSAASATSPLASTTIARRDPTETDVQIEILFCGICHSDLHQVRNEWSGVMPTVYPCIPGHEIVGRVTSVGSAVTKFKAGDLAAVGCMVDSDGTCPECKAGFEQFCPNMTLTYNFPDKHTGGVTYGGYSDSVVVDERFVLKVPSNLDLAGAAPLLCAGITTYSPMHHWGVTKGNKVGIVKFAHALGAHTVLFTTSPNKVEDALRLGADEVVLSRDANQMAKHAGSFDFILDAVSADHDINALLGLLRRDGNLCLVGAPEKPLAVSAFNLLFGRRSLSGSPIGGIAETQEMLDFCGQHNLTADVEVIAIQQVNEAYERLLKADVKYRFSIDMASLKSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003380 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM | Metagenome | Rhizosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 141 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 142 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 270 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 275 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 276 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 277 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 278 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 279 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 280 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 281 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 282 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 283 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 353 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 376 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 378 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 379 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 385 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 386 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 403 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 404 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 414 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 415 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 425 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 426 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 427 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 428 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 1.67 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.93 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 92.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207652_10003270 | 3300025921 | Bacteria | 13425 |
| 2 | ARcpr5yngRDRAFT_c001556 | 3300000043 | Archaea | 2514 |
| 3 | ARSoilOldRDRAFT_c000399 | 3300000044 | Archaea | 5337 |
| 4 | LJNas_1001054 | 3300000546 | Bacteria | 4318 |
| 5 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 6 | JGI24751J29686_10000233 | 3300002459 | Bacteria | 22750 |
| 7 | JGI24751J29686_10008629 | 3300002459 | Bacteria | 2087 |
| 8 | JGI25156J39149_1006441 | 3300002705 | Bacteria | 3207 |
| 9 | JGI25157J39369_1003469 | 3300002741 | Bacteria | 3207 |
| 10 | JGI25406J46586_10000065 | 3300003203 | Bacteria | 48566 |
| 11 | JGI25406J46586_10002954 | 3300003203 | Bacteria | 8019 |
| 12 | rootH2_10060039 | 3300003320 | Bacteria | 4067 |
| 13 | JGI26144J50225_100489 | 3300003380 | Bacteria | 1484 |
| 14 | JGI25404J52841_10002499 | 3300003659 | Bacteria | 3488 |
| 15 | Ga0055529_1004004 | 3300003763 | Bacteria | 2311 |
| 16 | Ga0058863_11511870 | 3300004799 | Bacteria | 1596 |
| 17 | Ga0058862_12777708 | 3300004803 | Bacteria | 1814 |
| 18 | Ga0065716_1000318 | 3300005277 | Bacteria | 3780 |
| 19 | Ga0065714_10064426 | 3300005288 | Bacteria | 186606 |
| 20 | Ga0065704_10007764 | 3300005289 | Bacteria | 2527 |
| 21 | Ga0065712_10067732 | 3300005290 | Bacteria | 130748 |
| 22 | Ga0065712_10075433 | 3300005290 | Bacteria | 3864 |
| 23 | Ga0065712_10094064 | 3300005290 | Bacteria | 2269 |
| 24 | Ga0065712_10116389 | 3300005290 | Bacteria | 1736 |
| 25 | Ga0065712_10200756 | 3300005290 | Bacteria | 1109 |
| 26 | Ga0065715_10089198 | 3300005293 | Bacteria | 12701 |
| 27 | Ga0065715_10142034 | 3300005293 | Bacteria | 1839 |
| 28 | Ga0065707_10022085 | 3300005295 | Bacteria | 3331 |
| 29 | Ga0065707_10140090 | 3300005295 | Bacteria | 1785 |
| 30 | Ga0065707_10187479 | 3300005295 | Bacteria | 1370 |
| 31 | Ga0070658_10004860 | 3300005327 | Bacteria | 10942 |
| 32 | Ga0070658_10126546 | 3300005327 | Bacteria | 2127 |
| 33 | Ga0070676_10068868 | 3300005328 | Bacteria | 2119 |
| 34 | Ga0070676_10089491 | 3300005328 | Bacteria | 1883 |
| 35 | Ga0070683_100000031 | 3300005329 | Bacteria | 150779 |
| 36 | Ga0070683_100008679 | 3300005329 | Bacteria | 8640 |
| 37 | Ga0070683_100022911 | 3300005329 | Bacteria | 5583 |
| 38 | Ga0070683_100234141 | 3300005329 | Bacteria | 1746 |
| 39 | Ga0070683_100253829 | 3300005329 | Bacteria | 1672 |
| 40 | Ga0070690_100026972 | 3300005330 | Bacteria | 3548 |
| 41 | Ga0070690_100073932 | 3300005330 | Bacteria | 2218 |
| 42 | Ga0070690_100088229 | 3300005330 | Bacteria | 2038 |
| 43 | Ga0070690_100170826 | 3300005330 | Bacteria | 1496 |
| 44 | Ga0070670_100000688 | 3300005331 | Bacteria | 26251 |
| 45 | Ga0070670_100038640 | 3300005331 | Bacteria | 4104 |
| 46 | Ga0070670_100092794 | 3300005331 | Bacteria | 2596 |
| 47 | Ga0070670_100180189 | 3300005331 | Bacteria | 1834 |
| 48 | Ga0070666_10001918 | 3300005335 | Bacteria | 12652 |
| 49 | Ga0070666_10010934 | 3300005335 | Bacteria | 5687 |
| 50 | Ga0070666_10020033 | 3300005335 | Bacteria | 4322 |
| 51 | Ga0070666_10066056 | 3300005335 | Bacteria | 2454 |
| 52 | Ga0070682_100000347 | 3300005337 | Bacteria | 31681 |
| 53 | Ga0070682_100030096 | 3300005337 | Bacteria | 3274 |
| 54 | Ga0070682_100177012 | 3300005337 | Bacteria | 1487 |
| 55 | Ga0068868_100159430 | 3300005338 | Bacteria | 1862 |
| 56 | Ga0068868_100236221 | 3300005338 | Bacteria | 1535 |
| 57 | Ga0070660_100059320 | 3300005339 | Bacteria | 2967 |
| 58 | Ga0070660_100153588 | 3300005339 | Bacteria | 1852 |
| 59 | Ga0070660_100207527 | 3300005339 | Bacteria | 1590 |
| 60 | Ga0070689_100088810 | 3300005340 | Bacteria | 2434 |
| 61 | Ga0070689_100125832 | 3300005340 | Bacteria | 2051 |
| 62 | Ga0070687_100124091 | 3300005343 | Bacteria | 1481 |
| 63 | Ga0070661_100000055 | 3300005344 | Bacteria | 88266 |
| 64 | Ga0070661_100006128 | 3300005344 | Bacteria | 8278 |
| 65 | Ga0070661_100018950 | 3300005344 | Bacteria | 4901 |
| 66 | Ga0070692_10038710 | 3300005345 | Bacteria | 2432 |
| 67 | Ga0070668_100190282 | 3300005347 | Bacteria | 1680 |
| 68 | Ga0070668_100360656 | 3300005347 | Bacteria | 1232 |
| 69 | Ga0070669_100000023 | 3300005353 | Bacteria | 174496 |
| 70 | Ga0070669_100025331 | 3300005353 | Bacteria | 4260 |
| 71 | Ga0070669_100187896 | 3300005353 | Bacteria | 1619 |
| 72 | Ga0070669_100207706 | 3300005353 | Bacteria | 1543 |
| 73 | Ga0070675_100011925 | 3300005354 | Bacteria | 6810 |
| 74 | Ga0070675_100122582 | 3300005354 | Bacteria | 2209 |
| 75 | Ga0070675_100133244 | 3300005354 | Bacteria | 2119 |
| 76 | Ga0070671_100009139 | 3300005355 | Bacteria | 7958 |
| 77 | Ga0070671_100021272 | 3300005355 | Bacteria | 5299 |
| 78 | Ga0070671_100049868 | 3300005355 | Bacteria | 3482 |
| 79 | Ga0070671_100127440 | 3300005355 | Bacteria | 2143 |
| 80 | Ga0070671_100287862 | 3300005355 | Bacteria | 1398 |
| 81 | Ga0070674_100008654 | 3300005356 | Bacteria | 6067 |
| 82 | Ga0070673_100000385 | 3300005364 | Bacteria | 23206 |
| 83 | Ga0070659_100023815 | 3300005366 | Bacteria | 4688 |
| 84 | Ga0070659_100328874 | 3300005366 | Bacteria | 1279 |
| 85 | Ga0070667_100100475 | 3300005367 | Bacteria | 2498 |
| 86 | Ga0070667_100100873 | 3300005367 | Bacteria | 2493 |
| 87 | Ga0070667_100191618 | 3300005367 | Bacteria | 1811 |
| 88 | Ga0070667_100206793 | 3300005367 | Bacteria | 1743 |
| 89 | Ga0070667_100242939 | 3300005367 | Bacteria | 1608 |
| 90 | Ga0070667_100258595 | 3300005367 | Bacteria | 1558 |
| 91 | Ga0070703_10000798 | 3300005406 | Bacteria | 10311 |
| 92 | Ga0070709_10000039 | 3300005434 | Bacteria | 108771 |
| 93 | Ga0070709_10011466 | 3300005434 | Archaea | 4941 |
| 94 | Ga0070709_10029380 | 3300005434 | Bacteria | 3288 |
| 95 | Ga0070709_10112178 | 3300005434 | Bacteria | 1834 |
| 96 | Ga0070714_100007032 | 3300005435 | Bacteria | 8721 |
| 97 | Ga0070714_100013704 | 3300005435 | Bacteria | 6502 |
| 98 | Ga0070714_100054675 | 3300005435 | Bacteria | 3411 |
| 99 | Ga0070713_100001464 | 3300005436 | Bacteria | 15081 |
| 100 | Ga0070713_100002736 | 3300005436 | Bacteria | 11521 |
| 101 | Ga0070713_100075736 | 3300005436 | Bacteria | 2855 |
| 102 | Ga0070713_100114361 | 3300005436 | Bacteria | 2358 |
| 103 | Ga0070713_100172970 | 3300005436 | Bacteria | 1936 |
| 104 | Ga0070713_100204404 | 3300005436 | Bacteria | 1785 |
| 105 | Ga0070713_100254169 | 3300005436 | Bacteria | 1604 |
| 106 | Ga0070713_100374186 | 3300005436 | Bacteria | 1326 |
| 107 | Ga0070713_100430557 | 3300005436 | Bacteria | 1236 |
| 108 | Ga0070710_10022157 | 3300005437 | Archaea | 3320 |
| 109 | Ga0070710_10024129 | 3300005437 | Bacteria | 3205 |
| 110 | Ga0070710_10099253 | 3300005437 | Bacteria | 1731 |
| 111 | Ga0070711_100000225 | 3300005439 | Bacteria | 29822 |
| 112 | Ga0070711_100080116 | 3300005439 | Bacteria | 2324 |
| 113 | Ga0070711_100115172 | 3300005439 | Archaea | 1979 |
| 114 | Ga0070711_100124959 | 3300005439 | Bacteria | 1908 |
| 115 | Ga0070711_100128224 | 3300005439 | Bacteria | 1886 |
| 116 | Ga0070705_100036058 | 3300005440 | Bacteria | 2777 |
| 117 | Ga0070705_100066479 | 3300005440 | Bacteria | 2162 |
| 118 | Ga0070705_100115458 | 3300005440 | Bacteria | 1724 |
| 119 | Ga0070700_100059212 | 3300005441 | Bacteria | 2410 |
| 120 | Ga0070694_100072569 | 3300005444 | Bacteria | 2375 |
| 121 | Ga0070708_100009638 | 3300005445 | Bacteria | 7789 |
| 122 | Ga0070708_100038650 | 3300005445 | Bacteria | 4170 |
| 123 | Ga0070708_100407723 | 3300005445 | Bacteria | 1282 |
| 124 | Ga0070663_100006248 | 3300005455 | Bacteria | 7142 |
| 125 | Ga0070663_100069213 | 3300005455 | Bacteria | 2563 |
| 126 | Ga0070678_100002567 | 3300005456 | Bacteria | 9973 |
| 127 | Ga0070678_100081635 | 3300005456 | Bacteria | 2452 |
| 128 | Ga0070678_100085922 | 3300005456 | Bacteria | 2398 |
| 129 | Ga0070678_100157094 | 3300005456 | Bacteria | 1838 |
| 130 | Ga0070678_100233803 | 3300005456 | Bacteria | 1534 |
| 131 | Ga0070662_100313278 | 3300005457 | Bacteria | 1278 |
| 132 | Ga0070681_10074222 | 3300005458 | Bacteria | 3362 |
| 133 | Ga0070681_10261553 | 3300005458 | Bacteria | 1642 |
| 134 | Ga0070685_10010854 | 3300005466 | Bacteria | 4747 |
| 135 | Ga0070685_10051395 | 3300005466 | Archaea | 2383 |
| 136 | Ga0070706_100000131 | 3300005467 | Bacteria | 92723 |
| 137 | Ga0070706_100018749 | 3300005467 | Bacteria | 6380 |
| 138 | Ga0070706_100028059 | 3300005467 | Bacteria | 5180 |
| 139 | Ga0070706_100053627 | 3300005467 | Bacteria | 3721 |
| 140 | Ga0070706_100289634 | 3300005467 | Bacteria | 1528 |
| 141 | Ga0070698_100007615 | 3300005471 | Bacteria | 11719 |
| 142 | Ga0070698_100010085 | 3300005471 | Bacteria | 10090 |
| 143 | Ga0070698_100016313 | 3300005471 | Bacteria | 7842 |
| 144 | Ga0070699_100000009 | 3300005518 | Bacteria | 272902 |
| 145 | Ga0070699_100033175 | 3300005518 | Bacteria | 4460 |
| 146 | Ga0070699_100047435 | 3300005518 | Bacteria | 3717 |
| 147 | Ga0070679_100004900 | 3300005530 | Bacteria | 12345 |
| 148 | Ga0070679_100325805 | 3300005530 | Bacteria | 1485 |
| 149 | Ga0070679_100371267 | 3300005530 | Bacteria | 1378 |
| 150 | Ga0070684_100000030 | 3300005535 | Bacteria | 107248 |
| 151 | Ga0070684_100010128 | 3300005535 | Bacteria | 7454 |
| 152 | Ga0070684_100019042 | 3300005535 | Archaea | 5672 |
| 153 | Ga0070684_100259344 | 3300005535 | Bacteria | 1590 |
| 154 | Ga0070697_100010791 | 3300005536 | Bacteria | 7134 |
| 155 | Ga0070697_100076502 | 3300005536 | Bacteria | 2753 |
| 156 | Ga0070697_100143626 | 3300005536 | Bacteria | 2008 |
| 157 | Ga0070697_100342648 | 3300005536 | Bacteria | 1290 |
| 158 | Ga0068853_100000108 | 3300005539 | Bacteria | 55985 |
| 159 | Ga0068853_100000635 | 3300005539 | Bacteria | 24029 |
| 160 | Ga0070672_100001906 | 3300005543 | Bacteria | 13072 |
| 161 | Ga0070672_100018779 | 3300005543 | Bacteria | 5007 |
| 162 | Ga0070672_100025876 | 3300005543 | Bacteria | 4359 |
| 163 | Ga0070672_100113429 | 3300005543 | Bacteria | 2212 |
| 164 | Ga0070672_100351734 | 3300005543 | Bacteria | 1256 |
| 165 | Ga0070695_100014494 | 3300005545 | Bacteria | 4752 |
| 166 | Ga0070696_100000136 | 3300005546 | Bacteria | 39907 |
| 167 | Ga0070696_100024739 | 3300005546 | Bacteria | 4081 |
| 168 | Ga0070696_100181736 | 3300005546 | Bacteria | 1561 |
| 169 | Ga0070693_100010008 | 3300005547 | Bacteria | 4732 |
| 170 | Ga0070693_100287697 | 3300005547 | Bacteria | 1103 |
| 171 | Ga0070665_100027074 | 3300005548 | Bacteria | 5774 |
| 172 | Ga0070665_100147492 | 3300005548 | Bacteria | 2355 |
| 173 | Ga0070665_100193326 | 3300005548 | Bacteria | 2035 |
| 174 | Ga0070665_100531735 | 3300005548 | Bacteria | 1187 |
| 175 | Ga0068855_100003669 | 3300005563 | Bacteria | 18779 |
| 176 | Ga0068855_100004022 | 3300005563 | Bacteria | 17947 |
| 177 | Ga0068855_100012713 | 3300005563 | Bacteria | 10153 |
| 178 | Ga0068855_100018921 | 3300005563 | Bacteria | 8278 |
| 179 | Ga0068855_100028545 | 3300005563 | Bacteria | 6675 |
| 180 | Ga0068855_100043088 | 3300005563 | Bacteria | 5347 |
| 181 | Ga0068855_100089705 | 3300005563 | Bacteria | 3549 |
| 182 | Ga0068855_100106728 | 3300005563 | Bacteria | 3218 |
| 183 | Ga0068857_100016940 | 3300005577 | Bacteria | 6385 |
| 184 | Ga0068857_100017552 | 3300005577 | Bacteria | 6274 |
| 185 | Ga0068857_100035636 | 3300005577 | Bacteria | 4407 |
| 186 | Ga0068854_100099374 | 3300005578 | Bacteria | 2179 |
| 187 | Ga0068856_100000408 | 3300005614 | Bacteria | 47282 |
| 188 | Ga0068856_100003746 | 3300005614 | Bacteria | 15243 |
| 189 | Ga0068856_100012673 | 3300005614 | Bacteria | 8163 |
| 190 | Ga0068856_100013228 | 3300005614 | Bacteria | 7992 |
| 191 | Ga0068856_100111800 | 3300005614 | Bacteria | 2729 |
| 192 | Ga0070702_100052249 | 3300005615 | Bacteria | 2343 |
| 193 | Ga0068852_100000234 | 3300005616 | Bacteria | 37575 |
| 194 | Ga0068852_100000599 | 3300005616 | Bacteria | 23630 |
| 195 | Ga0068852_100084244 | 3300005616 | Bacteria | 2829 |
| 196 | Ga0068852_100094164 | 3300005616 | Bacteria | 2686 |
| 197 | Ga0068859_100000016 | 3300005617 | Bacteria | 261719 |
| 198 | Ga0068859_100024921 | 3300005617 | Bacteria | 6004 |
| 199 | Ga0068859_100025105 | 3300005617 | Bacteria | 5981 |
| 200 | Ga0068859_100121876 | 3300005617 | Bacteria | 2674 |
| 201 | Ga0068859_100153608 | 3300005617 | Bacteria | 2378 |
| 202 | Ga0068859_100215522 | 3300005617 | Bacteria | 2007 |
| 203 | Ga0068859_100281856 | 3300005617 | Bacteria | 1755 |
| 204 | Ga0068864_100006197 | 3300005618 | Bacteria | 9805 |
| 205 | Ga0068864_100009787 | 3300005618 | Bacteria | 7904 |
| 206 | Ga0068864_100078445 | 3300005618 | Bacteria | 2890 |
| 207 | Ga0068864_100105441 | 3300005618 | Bacteria | 2505 |
| 208 | Ga0068864_100123187 | 3300005618 | Bacteria | 2321 |
| 209 | Ga0068864_100140689 | 3300005618 | Bacteria | 2176 |
| 210 | Ga0068864_100245975 | 3300005618 | Bacteria | 1659 |
| 211 | Ga0068866_10073156 | 3300005718 | Bacteria | 1818 |
| 212 | Ga0068861_100062317 | 3300005719 | Bacteria | 2864 |
| 213 | Ga0068851_10003565 | 3300005834 | Bacteria | 6933 |
| 214 | Ga0068851_10008995 | 3300005834 | Bacteria | 4634 |
| 215 | Ga0068851_10048224 | 3300005834 | Bacteria | 2159 |
| 216 | Ga0068863_100031542 | 3300005841 | Bacteria | 5056 |
| 217 | Ga0068863_100046447 | 3300005841 | Bacteria | 4121 |
| 218 | Ga0068863_100141855 | 3300005841 | Bacteria | 2297 |
| 219 | Ga0068863_100160866 | 3300005841 | Bacteria | 2151 |
| 220 | Ga0068863_100162014 | 3300005841 | Bacteria | 2143 |
| 221 | Ga0068863_100195773 | 3300005841 | Bacteria | 1943 |
| 222 | Ga0068863_100244694 | 3300005841 | Bacteria | 1732 |
| 223 | Ga0068863_100262960 | 3300005841 | Bacteria | 1668 |
| 224 | Ga0068863_100280606 | 3300005841 | Bacteria | 1614 |
| 225 | Ga0068863_100386836 | 3300005841 | Bacteria | 1366 |
| 226 | Ga0068858_100000008 | 3300005842 | Bacteria | 238361 |
| 227 | Ga0068858_100050397 | 3300005842 | Bacteria | 3854 |
| 228 | Ga0068858_100078741 | 3300005842 | Bacteria | 3062 |
| 229 | Ga0068858_100085695 | 3300005842 | Bacteria | 2931 |
| 230 | Ga0068858_100100162 | 3300005842 | Bacteria | 2702 |
| 231 | Ga0068858_100151613 | 3300005842 | Bacteria | 2180 |
| 232 | Ga0068858_100215275 | 3300005842 | Bacteria | 1819 |
| 233 | Ga0068858_100247213 | 3300005842 | Bacteria | 1694 |
| 234 | Ga0068858_100253899 | 3300005842 | Bacteria | 1670 |
| 235 | Ga0068860_100017093 | 3300005843 | Bacteria | 7071 |
| 236 | Ga0068860_100122386 | 3300005843 | Bacteria | 2492 |
| 237 | Ga0068860_100401371 | 3300005843 | Bacteria | 1356 |
| 238 | Ga0068862_100000425 | 3300005844 | Bacteria | 45885 |
| 239 | Ga0068862_100036013 | 3300005844 | Bacteria | 4192 |
| 240 | Ga0068862_100095758 | 3300005844 | Bacteria | 2590 |
| 241 | Ga0068862_100371831 | 3300005844 | Bacteria | 1331 |
| 242 | Ga0081455_10009500 | 3300005937 | Bacteria | 9994 |
| 243 | Ga0081455_10050949 | 3300005937 | Bacteria | 3555 |
| 244 | Ga0081455_10149124 | 3300005937 | Bacteria | 1805 |
| 245 | Ga0081540_1000560 | 3300005983 | Bacteria | 36099 |
| 246 | Ga0081540_1050005 | 3300005983 | Bacteria | 2080 |
| 247 | Ga0081539_10000647 | 3300005985 | Bacteria | 70112 |
| 248 | Ga0081539_10001121 | 3300005985 | Bacteria | 48615 |
| 249 | Ga0070717_10001781 | 3300006028 | Bacteria | 15018 |
| 250 | Ga0070717_10019574 | 3300006028 | Bacteria | 5311 |
| 251 | Ga0070717_10020888 | 3300006028 | Bacteria | 5155 |
| 252 | Ga0070717_10046477 | 3300006028 | Bacteria | 3552 |
| 253 | Ga0070717_10098598 | 3300006028 | Bacteria | 2477 |
| 254 | Ga0070717_10157615 | 3300006028 | Bacteria | 1968 |
| 255 | Ga0070715_10010166 | 3300006163 | Bacteria | 3345 |
| 256 | Ga0070715_10045941 | 3300006163 | Bacteria | 1854 |
| 257 | Ga0070716_100018244 | 3300006173 | Bacteria | 3652 |
| 258 | Ga0070716_100041273 | 3300006173 | Archaea | 2570 |
| 259 | Ga0070716_100075652 | 3300006173 | Bacteria | 1993 |
| 260 | Ga0070712_100001263 | 3300006175 | Bacteria | 15280 |
| 261 | Ga0070712_100006323 | 3300006175 | Bacteria | 7344 |
| 262 | Ga0070712_100107766 | 3300006175 | Bacteria | 2073 |
| 263 | Ga0097621_100016407 | 3300006237 | Bacteria | 5600 |
| 264 | Ga0097621_100022381 | 3300006237 | Bacteria | 4906 |
| 265 | Ga0097621_100343149 | 3300006237 | Bacteria | 1326 |
| 266 | Ga0068871_100030665 | 3300006358 | Bacteria | 4237 |
| 267 | Ga0068871_100048940 | 3300006358 | Bacteria | 3414 |
| 268 | Ga0068871_100135326 | 3300006358 | Bacteria | 2092 |
| 269 | Ga0075428_100071511 | 3300006844 | Archaea | 3791 |
| 270 | Ga0075428_100193412 | 3300006844 | Bacteria | 2200 |
| 271 | Ga0075430_100002212 | 3300006846 | Bacteria | 16123 |
| 272 | Ga0075430_100031247 | 3300006846 | Bacteria | 4519 |
| 273 | Ga0075430_100129829 | 3300006846 | Bacteria | 2100 |
| 274 | Ga0075430_100167609 | 3300006846 | Archaea | 1827 |
| 275 | Ga0075431_100035241 | 3300006847 | Archaea | 5152 |
| 276 | Ga0075431_100127325 | 3300006847 | Bacteria | 2628 |
| 277 | Ga0075431_100190758 | 3300006847 | Bacteria | 2100 |
| 278 | Ga0075433_10024007 | 3300006852 | Bacteria | 5140 |
| 279 | Ga0075434_100177251 | 3300006871 | Bacteria | 2151 |
| 280 | Ga0075434_100296961 | 3300006871 | Bacteria | 1636 |
| 281 | Ga0075429_100009967 | 3300006880 | Bacteria | 8235 |
| 282 | Ga0075429_100071950 | 3300006880 | Archaea | 3011 |
| 283 | Ga0075436_100021577 | 3300006914 | Bacteria | 4421 |
| 284 | Ga0097620_100000016 | 3300006931 | Bacteria | 261719 |
| 285 | Ga0097620_100024921 | 3300006931 | Bacteria | 6004 |
| 286 | Ga0097620_100025106 | 3300006931 | Bacteria | 5981 |
| 287 | Ga0097620_100121876 | 3300006931 | Bacteria | 2674 |
| 288 | Ga0097620_100153613 | 3300006931 | Bacteria | 2378 |
| 289 | Ga0097620_100215524 | 3300006931 | Bacteria | 2007 |
| 290 | Ga0097620_100281875 | 3300006931 | Bacteria | 1755 |
| 291 | Ga0099794_10053035 | 3300007265 | Bacteria | 1955 |
| 292 | Ga0105240_10000060 | 3300009093 | Bacteria | 219839 |
| 293 | Ga0105240_10000166 | 3300009093 | Bacteria | 134735 |
| 294 | Ga0105240_10004201 | 3300009093 | Bacteria | 22030 |
| 295 | Ga0105240_10013037 | 3300009093 | Bacteria | 11442 |
| 296 | Ga0105240_10045314 | 3300009093 | Bacteria | 5580 |
| 297 | Ga0105240_10098903 | 3300009093 | Bacteria | 3552 |
| 298 | Ga0105240_10204825 | 3300009093 | Bacteria | 2310 |
| 299 | Ga0105240_10243846 | 3300009093 | Bacteria | 2082 |
| 300 | Ga0111539_10008568 | 3300009094 | Bacteria | 12983 |
| 301 | Ga0111539_10091985 | 3300009094 | Bacteria | 3564 |
| 302 | Ga0111539_10105841 | 3300009094 | Bacteria | 3300 |
| 303 | Ga0111539_10120853 | 3300009094 | Plasmid | 3069 |
| 304 | Ga0111539_10248974 | 3300009094 | Bacteria | 2069 |
| 305 | Ga0105245_10007338 | 3300009098 | Bacteria | 9654 |
| 306 | Ga0105245_10026955 | 3300009098 | Bacteria | 5060 |
| 307 | Ga0105245_10079682 | 3300009098 | Bacteria | 2991 |
| 308 | Ga0105245_10216712 | 3300009098 | Bacteria | 1845 |
| 309 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 310 | Ga0105247_10031476 | 3300009101 | Bacteria | 3219 |
| 311 | Ga0105247_10298087 | 3300009101 | Bacteria | 1117 |
| 312 | Ga0114129_10017754 | 3300009147 | Bacteria | 10131 |
| 313 | Ga0114129_10025752 | 3300009147 | Bacteria | 8333 |
| 314 | Ga0114129_10042110 | 3300009147 | Bacteria | 6431 |
| 315 | Ga0114129_10164202 | 3300009147 | Archaea | 3032 |
| 316 | Ga0114129_10509965 | 3300009147 | Bacteria | 1569 |
| 317 | Ga0105243_10000344 | 3300009148 | Bacteria | 50059 |
| 318 | Ga0105243_10136167 | 3300009148 | Bacteria | 2090 |
| 319 | Ga0105241_10000383 | 3300009174 | Bacteria | 33616 |
| 320 | Ga0105241_10012596 | 3300009174 | Bacteria | 6204 |
| 321 | Ga0105241_10019513 | 3300009174 | Bacteria | 4999 |
| 322 | Ga0105241_10027715 | 3300009174 | Bacteria | 4218 |
| 323 | Ga0105242_10001266 | 3300009176 | Bacteria | 19956 |
| 324 | Ga0105242_10007464 | 3300009176 | Bacteria | 8416 |
| 325 | Ga0105242_10403251 | 3300009176 | Bacteria | 1277 |
| 326 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 327 | Ga0105248_10005255 | 3300009177 | Bacteria | 14254 |
| 328 | Ga0105248_10028964 | 3300009177 | Bacteria | 6173 |
| 329 | Ga0105248_10034308 | 3300009177 | Bacteria | 5672 |
| 330 | Ga0105248_10036829 | 3300009177 | Bacteria | 5472 |
| 331 | Ga0105248_10042745 | 3300009177 | Bacteria | 5082 |
| 332 | Ga0105248_10064342 | 3300009177 | Bacteria | 4118 |
| 333 | Ga0105237_10000163 | 3300009545 | Bacteria | 94679 |
| 334 | Ga0105237_10139725 | 3300009545 | Bacteria | 2416 |
| 335 | Ga0105237_10196891 | 3300009545 | Bacteria | 2015 |
| 336 | Ga0105238_10000710 | 3300009551 | Bacteria | 34798 |
| 337 | Ga0105238_10001915 | 3300009551 | Bacteria | 20880 |
| 338 | Ga0105238_10004919 | 3300009551 | Bacteria | 13224 |
| 339 | Ga0105238_10015258 | 3300009551 | Bacteria | 7778 |
| 340 | Ga0105238_10042251 | 3300009551 | Bacteria | 4617 |
| 341 | Ga0105238_10142273 | 3300009551 | Bacteria | 2375 |
| 342 | Ga0105238_10166809 | 3300009551 | Bacteria | 2178 |
| 343 | Ga0105238_10325243 | 3300009551 | Bacteria | 1524 |
| 344 | Ga0105249_10010647 | 3300009553 | Bacteria | 8078 |
| 345 | Ga0105249_10011728 | 3300009553 | Bacteria | 7707 |
| 346 | Ga0105249_10106798 | 3300009553 | Bacteria | 2642 |
| 347 | Ga0105249_10125511 | 3300009553 | Bacteria | 2443 |
| 348 | Ga0105249_10152117 | 3300009553 | Bacteria | 2229 |
| 349 | Ga0105239_10007680 | 3300010375 | Bacteria | 12350 |
| 350 | Ga0105239_10014324 | 3300010375 | Bacteria | 8798 |
| 351 | Ga0105239_10017583 | 3300010375 | Bacteria | 7908 |
| 352 | Ga0105239_10022558 | 3300010375 | Bacteria | 6941 |
| 353 | Ga0105239_10028637 | 3300010375 | Bacteria | 6124 |
| 354 | Ga0105246_10006614 | 3300011119 | Bacteria | 7083 |
| 355 | Ga0105246_10218498 | 3300011119 | Bacteria | 1492 |
| 356 | Ga0105246_10266065 | 3300011119 | Bacteria | 1368 |
| 357 | Ga0105246_10346656 | 3300011119 | Bacteria | 1216 |
| 358 | Ga0157373_10017490 | 3300013100 | Bacteria | 5221 |
| 359 | Ga0157371_10199480 | 3300013102 | Bacteria | 1434 |
| 360 | Ga0157371_10254448 | 3300013102 | Bacteria | 1265 |
| 361 | Ga0157370_10000139 | 3300013104 | Bacteria | 87840 |
| 362 | Ga0157370_10027580 | 3300013104 | Bacteria | 5599 |
| 363 | Ga0157370_10131507 | 3300013104 | Bacteria | 2334 |
| 364 | Ga0157369_10000079 | 3300013105 | Bacteria | 134893 |
| 365 | Ga0157369_10002833 | 3300013105 | Bacteria | 20696 |
| 366 | Ga0157369_10005321 | 3300013105 | Bacteria | 14997 |
| 367 | Ga0157369_10005381 | 3300013105 | Bacteria | 14906 |
| 368 | Ga0157369_10014871 | 3300013105 | Bacteria | 8784 |
| 369 | Ga0157369_10016614 | 3300013105 | Bacteria | 8274 |
| 370 | Ga0157369_10021389 | 3300013105 | Bacteria | 7236 |
| 371 | Ga0157369_10024091 | 3300013105 | Bacteria | 6774 |
| 372 | Ga0157369_10060830 | 3300013105 | Bacteria | 4072 |
| 373 | Ga0157369_10102224 | 3300013105 | Bacteria | 3054 |
| 374 | Ga0157369_10519835 | 3300013105 | Bacteria | 1231 |
| 375 | Ga0157374_10002079 | 3300013296 | Bacteria | 16850 |
| 376 | Ga0157374_10002768 | 3300013296 | Bacteria | 14718 |
| 377 | Ga0157374_10010430 | 3300013296 | Bacteria | 7988 |
| 378 | Ga0157374_10011582 | 3300013296 | Bacteria | 7644 |
| 379 | Ga0157374_10015604 | 3300013296 | Bacteria | 6667 |
| 380 | Ga0157374_10059851 | 3300013296 | Bacteria | 3563 |
| 381 | Ga0157374_10076509 | 3300013296 | Bacteria | 3165 |
| 382 | Ga0157374_10127327 | 3300013296 | Bacteria | 2462 |
| 383 | Ga0157374_10433572 | 3300013296 | Bacteria | 1314 |
| 384 | Ga0157378_10000019 | 3300013297 | Bacteria | 132704 |
| 385 | Ga0157378_10003965 | 3300013297 | Bacteria | 13078 |
| 386 | Ga0157378_10015715 | 3300013297 | Bacteria | 6629 |
| 387 | Ga0157378_10027554 | 3300013297 | Bacteria | 5012 |
| 388 | Ga0157378_10042866 | 3300013297 | Bacteria | 4017 |
| 389 | Ga0157378_10078813 | 3300013297 | Bacteria | 2973 |
| 390 | Ga0157378_10200127 | 3300013297 | Bacteria | 1889 |
| 391 | Ga0157378_10224682 | 3300013297 | Bacteria | 1786 |
| 392 | Ga0157378_10381486 | 3300013297 | Bacteria | 1384 |
| 393 | Ga0163162_10010125 | 3300013306 | Bacteria | 9163 |
| 394 | Ga0163162_10013020 | 3300013306 | Bacteria | 8118 |
| 395 | Ga0163162_10075653 | 3300013306 | Bacteria | 3427 |
| 396 | Ga0163162_10218628 | 3300013306 | Bacteria | 2035 |
| 397 | Ga0163162_10407171 | 3300013306 | Bacteria | 1493 |
| 398 | Ga0163162_10535788 | 3300013306 | Bacteria | 1300 |
| 399 | Ga0157372_10000101 | 3300013307 | Bacteria | 89344 |
| 400 | Ga0157372_10013100 | 3300013307 | Bacteria | 8847 |
| 401 | Ga0157372_10015595 | 3300013307 | Bacteria | 8147 |
| 402 | Ga0157372_10016255 | 3300013307 | Bacteria | 7986 |
| 403 | Ga0157372_10017037 | 3300013307 | Bacteria | 7800 |
| 404 | Ga0157372_10022915 | 3300013307 | Bacteria | 6763 |
| 405 | Ga0157372_10036318 | 3300013307 | Bacteria | 5430 |
| 406 | Ga0157372_10041549 | 3300013307 | Bacteria | 5085 |
| 407 | Ga0157372_10051907 | 3300013307 | Bacteria | 4564 |
| 408 | Ga0157372_10144086 | 3300013307 | Bacteria | 2747 |
| 409 | Ga0157375_10000560 | 3300013308 | Bacteria | 33418 |
| 410 | Ga0157375_10005673 | 3300013308 | Bacteria | 10862 |
| 411 | Ga0157375_10011769 | 3300013308 | Bacteria | 7736 |
| 412 | Ga0157375_10038820 | 3300013308 | Bacteria | 4576 |
| 413 | Ga0157375_10043115 | 3300013308 | Bacteria | 4373 |
| 414 | Ga0157375_10057446 | 3300013308 | Bacteria | 3847 |
| 415 | Ga0157375_10079346 | 3300013308 | Bacteria | 3318 |
| 416 | Ga0157375_10086066 | 3300013308 | Bacteria | 3193 |
| 417 | Ga0157375_10092613 | 3300013308 | Bacteria | 3086 |
| 418 | Ga0157375_10172709 | 3300013308 | Bacteria | 2310 |
| 419 | Ga0157375_10224438 | 3300013308 | Bacteria | 2038 |
| 420 | Ga0157375_10464062 | 3300013308 | Bacteria | 1432 |
| 421 | Ga0157375_10565792 | 3300013308 | Bacteria | 1297 |
| 422 | Ga0163163_10010210 | 3300014325 | Bacteria | 8431 |
| 423 | Ga0163163_10053291 | 3300014325 | Bacteria | 3993 |
| 424 | Ga0163163_10072035 | 3300014325 | Bacteria | 3444 |
| 425 | Ga0163163_10081964 | 3300014325 | Bacteria | 3229 |
| 426 | Ga0163163_10084728 | 3300014325 | Bacteria | 3176 |
| 427 | Ga0163163_10104549 | 3300014325 | Bacteria | 2857 |
| 428 | Ga0163163_10139706 | 3300014325 | Bacteria | 2464 |
| 429 | Ga0163163_10314985 | 3300014325 | Bacteria | 1618 |
| 430 | Ga0157380_10035473 | 3300014326 | Bacteria | 3853 |
| 431 | Ga0157380_10116764 | 3300014326 | Bacteria | 2253 |
| 432 | Ga0157377_10063295 | 3300014745 | Archaea | 2119 |
| 433 | Ga0157379_10006136 | 3300014968 | Bacteria | 10347 |
| 434 | Ga0157379_10079767 | 3300014968 | Bacteria | 2932 |
| 435 | Ga0157379_10115265 | 3300014968 | Bacteria | 2416 |
| 436 | Ga0157376_10017159 | 3300014969 | Bacteria | 5514 |
| 437 | Ga0157376_10036766 | 3300014969 | Bacteria | 3969 |
| 438 | Ga0157376_10051476 | 3300014969 | Bacteria | 3421 |
| 439 | Ga0157376_10149393 | 3300014969 | Bacteria | 2105 |
| 440 | Ga0182006_1020509 | 3300015261 | Bacteria | 2769 |
| 441 | Ga0182005_1046605 | 3300015265 | Bacteria | 1178 |
| 442 | Ga0163161_10018993 | 3300017792 | Bacteria | 4818 |
| 443 | Ga0163161_10024906 | 3300017792 | Bacteria | 4230 |
| 444 | Ga0197907_10810373 | 3300020069 | Bacteria | 1232 |
| 445 | Ga0206356_11558599 | 3300020070 | Bacteria | 1599 |
| 446 | Ga0206355_1032423 | 3300020076 | Bacteria | 1220 |
| 447 | Ga0206354_10360414 | 3300020081 | Bacteria | 1156 |
| 448 | Ga0213872_10008858 | 3300021361 | Bacteria | 4846 |
| 449 | Ga0213876_10010940 | 3300021384 | Bacteria | 4860 |
| 450 | Ga0213871_10004892 | 3300021441 | Bacteria | 2720 |
| 451 | Ga0228598_1005083 | 3300024227 | Bacteria | 2763 |
| 452 | Ga0207672_1001192 | 3300025223 | Bacteria | 2255 |
| 453 | Ga0209026_1000158 | 3300025250 | Bacteria | 106333 |
| 454 | Ga0209026_1002284 | 3300025250 | Bacteria | 7326 |
| 455 | Ga0209759_1011628 | 3300025256 | Bacteria | 2489 |
| 456 | Ga0209455_1000218 | 3300025272 | Bacteria | 79966 |
| 457 | Ga0207697_10001233 | 3300025315 | Bacteria | 14016 |
| 458 | Ga0207697_10004903 | 3300025315 | Bacteria | 6309 |
| 459 | Ga0207697_10005583 | 3300025315 | Bacteria | 5826 |
| 460 | Ga0207697_10010998 | 3300025315 | Bacteria | 3842 |
| 461 | Ga0207656_10014248 | 3300025321 | Bacteria | 3058 |
| 462 | Ga0207656_10036147 | 3300025321 | Bacteria | 2072 |
| 463 | Ga0207653_10000070 | 3300025885 | Bacteria | 76652 |
| 464 | Ga0207692_10017016 | 3300025898 | Bacteria | 3234 |
| 465 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 466 | Ga0207710_10003349 | 3300025900 | Bacteria | 7163 |
| 467 | Ga0207710_10089493 | 3300025900 | Bacteria | 1439 |
| 468 | Ga0207680_10000062 | 3300025903 | Bacteria | 48850 |
| 469 | Ga0207680_10001509 | 3300025903 | Bacteria | 10961 |
| 470 | Ga0207647_10006978 | 3300025904 | Bacteria | 8186 |
| 471 | Ga0207647_10039344 | 3300025904 | Bacteria | 2984 |
| 472 | Ga0207647_10040783 | 3300025904 | Bacteria | 2922 |
| 473 | Ga0207685_10008205 | 3300025905 | Bacteria | 2959 |
| 474 | Ga0207685_10021792 | 3300025905 | Archaea | 2154 |
| 475 | Ga0207685_10031441 | 3300025905 | Bacteria | 1901 |
| 476 | Ga0207699_10000023 | 3300025906 | Bacteria | 172262 |
| 477 | Ga0207699_10023506 | 3300025906 | Bacteria | 3355 |
| 478 | Ga0207699_10052630 | 3300025906 | Bacteria | 2411 |
| 479 | Ga0207699_10086410 | 3300025906 | Bacteria | 1959 |
| 480 | Ga0207699_10186581 | 3300025906 | Bacteria | 1397 |
| 481 | Ga0207699_10257162 | 3300025906 | Bacteria | 1206 |
| 482 | Ga0207645_10001695 | 3300025907 | Bacteria | 17900 |
| 483 | Ga0207645_10078565 | 3300025907 | Bacteria | 2114 |
| 484 | Ga0207643_10019602 | 3300025908 | Bacteria | 3708 |
| 485 | Ga0207705_10006079 | 3300025909 | Bacteria | 8985 |
| 486 | Ga0207705_10018618 | 3300025909 | Bacteria | 4965 |
| 487 | Ga0207705_10043759 | 3300025909 | Bacteria | 3217 |
| 488 | Ga0207705_10096983 | 3300025909 | Bacteria | 2165 |
| 489 | Ga0207705_10102189 | 3300025909 | Bacteria | 2110 |
| 490 | Ga0207684_10000102 | 3300025910 | Bacteria | 162120 |
| 491 | Ga0207684_10000186 | 3300025910 | Bacteria | 98342 |
| 492 | Ga0207684_10001595 | 3300025910 | Bacteria | 24099 |
| 493 | Ga0207684_10199384 | 3300025910 | Bacteria | 1727 |
| 494 | Ga0207684_10332854 | 3300025910 | Bacteria | 1308 |
| 495 | Ga0207654_10000731 | 3300025911 | Bacteria | 18271 |
| 496 | Ga0207654_10031820 | 3300025911 | Bacteria | 2909 |
| 497 | Ga0207654_10097857 | 3300025911 | Bacteria | 1802 |
| 498 | Ga0207707_10037611 | 3300025912 | Bacteria | 4230 |
| 499 | Ga0207695_10000025 | 3300025913 | Bacteria | 627211 |
| 500 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 501 | Ga0207695_10000637 | 3300025913 | Bacteria | 70175 |
| 502 | Ga0207695_10002224 | 3300025913 | Bacteria | 29144 |
| 503 | Ga0207695_10004845 | 3300025913 | Bacteria | 18166 |
| 504 | Ga0207695_10017985 | 3300025913 | Bacteria | 8185 |
| 505 | Ga0207695_10045150 | 3300025913 | Bacteria | 4680 |
| 506 | Ga0207695_10061340 | 3300025913 | Bacteria | 3886 |
| 507 | Ga0207695_10072590 | 3300025913 | Bacteria | 3510 |
| 508 | Ga0207695_10183972 | 3300025913 | Bacteria | 2009 |
| 509 | Ga0207671_10000582 | 3300025914 | Bacteria | 48826 |
| 510 | Ga0207671_10000935 | 3300025914 | Bacteria | 36496 |
| 511 | Ga0207671_10006120 | 3300025914 | Bacteria | 10822 |
| 512 | Ga0207693_10000262 | 3300025915 | Bacteria | 48422 |
| 513 | Ga0207693_10000734 | 3300025915 | Bacteria | 29569 |
| 514 | Ga0207693_10003119 | 3300025915 | Bacteria | 14270 |
| 515 | Ga0207693_10027230 | 3300025915 | Bacteria | 4520 |
| 516 | Ga0207693_10054645 | 3300025915 | Bacteria | 3132 |
| 517 | Ga0207693_10073547 | 3300025915 | Unclassified | 2676 |
| 518 | Ga0207663_10000553 | 3300025916 | Bacteria | 16492 |
| 519 | Ga0207663_10043276 | 3300025916 | Bacteria | 2756 |
| 520 | Ga0207663_10087055 | 3300025916 | Bacteria | 2062 |
| 521 | Ga0207657_10023837 | 3300025919 | Bacteria | 5687 |
| 522 | Ga0207649_10031041 | 3300025920 | Bacteria | 3171 |
| 523 | Ga0207649_10188954 | 3300025920 | Bacteria | 1447 |
| 524 | Ga0207649_10344200 | 3300025920 | Bacteria | 1102 |
| 525 | Ga0207652_10237450 | 3300025921 | Bacteria | 1643 |
| 526 | Ga0207652_10309757 | 3300025921 | Bacteria | 1425 |
| 527 | Ga0207646_10187635 | 3300025922 | Bacteria | 1867 |
| 528 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 529 | Ga0207681_10020058 | 3300025923 | Bacteria | 4232 |
| 530 | Ga0207694_10000249 | 3300025924 | Bacteria | 51431 |
| 531 | Ga0207694_10001221 | 3300025924 | Bacteria | 22261 |
| 532 | Ga0207694_10003221 | 3300025924 | Bacteria | 13003 |
| 533 | Ga0207694_10022238 | 3300025924 | Bacteria | 4809 |
| 534 | Ga0207694_10029722 | 3300025924 | Bacteria | 4171 |
| 535 | Ga0207694_10329467 | 3300025924 | Bacteria | 1261 |
| 536 | Ga0207650_10000570 | 3300025925 | Bacteria | 29776 |
| 537 | Ga0207650_10026870 | 3300025925 | Bacteria | 4112 |
| 538 | Ga0207650_10145993 | 3300025925 | Bacteria | 1863 |
| 539 | Ga0207650_10191481 | 3300025925 | Bacteria | 1634 |
| 540 | Ga0207650_10263471 | 3300025925 | Bacteria | 1399 |
| 541 | Ga0207650_10269628 | 3300025925 | Bacteria | 1383 |
| 542 | Ga0207659_10140489 | 3300025926 | Bacteria | 1874 |
| 543 | Ga0207687_10006671 | 3300025927 | Bacteria | 7612 |
| 544 | Ga0207687_10013607 | 3300025927 | Bacteria | 5311 |
| 545 | Ga0207687_10063563 | 3300025927 | Bacteria | 2614 |
| 546 | Ga0207700_10003181 | 3300025928 | Bacteria | 9483 |
| 547 | Ga0207700_10005575 | 3300025928 | Bacteria | 7553 |
| 548 | Ga0207700_10010940 | 3300025928 | Bacteria | 5759 |
| 549 | Ga0207700_10071596 | 3300025928 | Bacteria | 2670 |
| 550 | Ga0207700_10105364 | 3300025928 | Bacteria | 2258 |
| 551 | Ga0207700_10161288 | 3300025928 | Bacteria | 1862 |
| 552 | Ga0207664_10091429 | 3300025929 | Bacteria | 2496 |
| 553 | Ga0207664_10136065 | 3300025929 | Bacteria | 2073 |
| 554 | Ga0207664_10194032 | 3300025929 | Bacteria | 1750 |
| 555 | Ga0207644_10000031 | 3300025931 | Bacteria | 134402 |
| 556 | Ga0207644_10122052 | 3300025931 | Bacteria | 1984 |
| 557 | Ga0207644_10199048 | 3300025931 | Bacteria | 1579 |
| 558 | Ga0207706_10021238 | 3300025933 | Bacteria | 5832 |
| 559 | Ga0207706_10022300 | 3300025933 | Bacteria | 5681 |
| 560 | Ga0207706_10243359 | 3300025933 | Bacteria | 1572 |
| 561 | Ga0207686_10000777 | 3300025934 | Bacteria | 19590 |
| 562 | Ga0207686_10174065 | 3300025934 | Bacteria | 1520 |
| 563 | Ga0207670_10077436 | 3300025936 | Bacteria | 2317 |
| 564 | Ga0207669_10001072 | 3300025937 | Bacteria | 11671 |
| 565 | Ga0207704_10307034 | 3300025938 | Archaea | 1218 |
| 566 | Ga0207665_10006615 | 3300025939 | Bacteria | 7689 |
| 567 | Ga0207665_10053885 | 3300025939 | Bacteria | 2711 |
| 568 | Ga0207665_10066925 | 3300025939 | Bacteria | 2446 |
| 569 | Ga0207691_10004834 | 3300025940 | Bacteria | 13030 |
| 570 | Ga0207691_10011167 | 3300025940 | Archaea | 8620 |
| 571 | Ga0207691_10014258 | 3300025940 | Bacteria | 7582 |
| 572 | Ga0207691_10019641 | 3300025940 | Bacteria | 6392 |
| 573 | Ga0207691_10071999 | 3300025940 | Bacteria | 3118 |
| 574 | Ga0207691_10091098 | 3300025940 | Bacteria | 2732 |
| 575 | Ga0207711_10000012 | 3300025941 | Bacteria | 515147 |
| 576 | Ga0207711_10001298 | 3300025941 | Bacteria | 23674 |
| 577 | Ga0207711_10014531 | 3300025941 | Bacteria | 6544 |
| 578 | Ga0207711_10019311 | 3300025941 | Bacteria | 5676 |
| 579 | Ga0207711_10032837 | 3300025941 | Bacteria | 4390 |
| 580 | Ga0207711_10308784 | 3300025941 | Bacteria | 1460 |
| 581 | Ga0207689_10027664 | 3300025942 | Bacteria | 4746 |
| 582 | Ga0207661_10000012 | 3300025944 | Bacteria | 354345 |
| 583 | Ga0207661_10011022 | 3300025944 | Bacteria | 6533 |
| 584 | Ga0207661_10015140 | 3300025944 | Bacteria | 5669 |
| 585 | Ga0207661_10030159 | 3300025944 | Bacteria | 4174 |
| 586 | Ga0207661_10237215 | 3300025944 | Bacteria | 1617 |
| 587 | Ga0207667_10001916 | 3300025949 | Bacteria | 26137 |
| 588 | Ga0207667_10002211 | 3300025949 | Bacteria | 24417 |
| 589 | Ga0207667_10004385 | 3300025949 | Bacteria | 17283 |
| 590 | Ga0207667_10032351 | 3300025949 | Bacteria | 5638 |
| 591 | Ga0207667_10300354 | 3300025949 | Bacteria | 1640 |
| 592 | Ga0207667_10530194 | 3300025949 | Bacteria | 1192 |
| 593 | Ga0207651_10000243 | 3300025960 | Bacteria | 23595 |
| 594 | Ga0207712_10000665 | 3300025961 | Bacteria | 26689 |
| 595 | Ga0207712_10008830 | 3300025961 | Bacteria | 6373 |
| 596 | Ga0207712_10116035 | 3300025961 | Bacteria | 2017 |
| 597 | Ga0207668_10113241 | 3300025972 | Bacteria | 2039 |
| 598 | Ga0207658_10021940 | 3300025986 | Bacteria | 4439 |
| 599 | Ga0207658_10273239 | 3300025986 | Bacteria | 1445 |
| 600 | Ga0207677_10131626 | 3300026023 | Bacteria | 1900 |
| 601 | Ga0207677_10199277 | 3300026023 | Bacteria | 1590 |
| 602 | Ga0207703_10000109 | 3300026035 | Bacteria | 97743 |
| 603 | Ga0207703_10001882 | 3300026035 | Bacteria | 18650 |
| 604 | Ga0207703_10015204 | 3300026035 | Bacteria | 6005 |
| 605 | Ga0207703_10189299 | 3300026035 | Bacteria | 1821 |
| 606 | Ga0207639_10000127 | 3300026041 | Bacteria | 56027 |
| 607 | Ga0207639_10001341 | 3300026041 | Bacteria | 16626 |
| 608 | Ga0207678_10007664 | 3300026067 | Bacteria | 9535 |
| 609 | Ga0207678_10093204 | 3300026067 | Bacteria | 2574 |
| 610 | Ga0207702_10000809 | 3300026078 | Bacteria | 33188 |
| 611 | Ga0207702_10001049 | 3300026078 | Bacteria | 28307 |
| 612 | Ga0207702_10008988 | 3300026078 | Bacteria | 8415 |
| 613 | Ga0207702_10056864 | 3300026078 | Bacteria | 3322 |
| 614 | Ga0207702_10076091 | 3300026078 | Bacteria | 2901 |
| 615 | Ga0207702_10296989 | 3300026078 | Bacteria | 1532 |
| 616 | Ga0207641_10015238 | 3300026088 | Bacteria | 6299 |
| 617 | Ga0207641_10115442 | 3300026088 | Bacteria | 2387 |
| 618 | Ga0207641_10148957 | 3300026088 | Bacteria | 2118 |
| 619 | Ga0207641_10192700 | 3300026088 | Bacteria | 1874 |
| 620 | Ga0207676_10001214 | 3300026095 | Bacteria | 19239 |
| 621 | Ga0207676_10065857 | 3300026095 | Bacteria | 2886 |
| 622 | Ga0207676_10163011 | 3300026095 | Bacteria | 1934 |
| 623 | Ga0207676_10351490 | 3300026095 | Bacteria | 1363 |
| 624 | Ga0207676_10372142 | 3300026095 | Bacteria | 1327 |
| 625 | Ga0207674_10000675 | 3300026116 | Bacteria | 44298 |
| 626 | Ga0207674_10001753 | 3300026116 | Bacteria | 27749 |
| 627 | Ga0207674_10232453 | 3300026116 | Bacteria | 1791 |
| 628 | Ga0207675_100002039 | 3300026118 | Bacteria | 20154 |
| 629 | Ga0207675_100133918 | 3300026118 | Bacteria | 2350 |
| 630 | Ga0207683_10008786 | 3300026121 | Bacteria | 8625 |
| 631 | Ga0207683_10009704 | 3300026121 | Bacteria | 8208 |
| 632 | Ga0207683_10020934 | 3300026121 | Bacteria | 5598 |
| 633 | Ga0207683_10155051 | 3300026121 | Bacteria | 2068 |
| 634 | Ga0207683_10183725 | 3300026121 | Bacteria | 1897 |
| 635 | Ga0207683_10334699 | 3300026121 | Bacteria | 1388 |
| 636 | Ga0207698_10000623 | 3300026142 | Bacteria | 20591 |
| 637 | Ga0207698_10000895 | 3300026142 | Bacteria | 17319 |
| 638 | Ga0207698_10014938 | 3300026142 | Bacteria | 5183 |
| 639 | Ga0207698_10118541 | 3300026142 | Bacteria | 2235 |
| 640 | Ga0209967_1001744 | 3300027364 | Bacteria | 2800 |
| 641 | Ga0210000_1000015 | 3300027462 | Bacteria | 30974 |
| 642 | Ga0209968_1002263 | 3300027526 | Bacteria | 2909 |
| 643 | Ga0209999_1000452 | 3300027543 | Bacteria | 6333 |
| 644 | Ga0209970_1006825 | 3300027614 | Bacteria | 1875 |
| 645 | Ga0209966_1002410 | 3300027695 | Bacteria | 3119 |
| 646 | Ga0209966_1018816 | 3300027695 | Bacteria | 1326 |
| 647 | Ga0207428_10012376 | 3300027907 | Archaea | 7497 |
| 648 | Ga0265354_1000204 | 3300028016 | Bacteria | 10905 |
| 649 | Ga0265354_1004108 | 3300028016 | Bacteria | 1555 |
| 650 | Ga0268266_10034222 | 3300028379 | Bacteria | 4321 |
| 651 | Ga0268266_10059930 | 3300028379 | Bacteria | 3279 |
| 652 | Ga0268266_10062500 | 3300028379 | Bacteria | 3214 |
| 653 | Ga0268266_10304023 | 3300028379 | Bacteria | 1489 |
| 654 | Ga0268266_10340734 | 3300028379 | Bacteria | 1407 |
| 655 | Ga0268265_10000046 | 3300028380 | Bacteria | 179361 |
| 656 | Ga0268264_10000879 | 3300028381 | Bacteria | 31672 |
| 657 | Ga0268264_10004546 | 3300028381 | Bacteria | 11817 |
| 658 | Ga0268264_10015871 | 3300028381 | Bacteria | 6168 |
| 659 | Ga0268264_10044443 | 3300028381 | Bacteria | 3685 |
| 660 | Ga0268264_10052522 | 3300028381 | Bacteria | 3398 |
| 661 | Ga0268264_10318016 | 3300028381 | Bacteria | 1471 |
| 662 | Ga0268264_10400795 | 3300028381 | Bacteria | 1318 |
| 663 | Ga0265326_10000443 | 3300028558 | Bacteria | 16256 |
| 664 | Ga0265334_10046880 | 3300028573 | Bacteria | 1669 |
| 665 | Ga0265318_10014358 | 3300028577 | Bacteria | 3327 |
| 666 | Ga0265323_10002666 | 3300028653 | Bacteria | 8060 |
| 667 | Ga0265323_10026857 | 3300028653 | Bacteria | 2168 |
| 668 | Ga0265336_10002094 | 3300028666 | Bacteria | 8476 |
| 669 | Ga0265338_10002061 | 3300028800 | Bacteria | 31057 |
| 670 | Ga0265338_10018503 | 3300028800 | Bacteria | 7456 |
| 671 | Ga0265338_10022912 | 3300028800 | Bacteria | 6443 |
| 672 | Ga0265338_10024815 | 3300028800 | Bacteria | 6109 |
| 673 | Ga0265338_10037490 | 3300028800 | Bacteria | 4613 |
| 674 | Ga0265338_10052369 | 3300028800 | Bacteria | 3662 |
| 675 | Ga0265338_10156561 | 3300028800 | Bacteria | 1764 |
| 676 | Ga0265338_10235210 | 3300028800 | Bacteria | 1360 |
| 677 | Ga0265770_1001690 | 3300030878 | Bacteria | 3022 |
| 678 | Ga0265760_10002054 | 3300031090 | Bacteria | 5928 |
| 679 | Ga0265760_10002624 | 3300031090 | Bacteria | 5257 |
| 680 | Ga0265760_10012599 | 3300031090 | Bacteria | 2419 |
| 681 | Ga0265330_10000183 | 3300031235 | Bacteria | 48463 |
| 682 | Ga0265320_10002070 | 3300031240 | Bacteria | 14123 |
| 683 | Ga0265320_10005985 | 3300031240 | Bacteria | 7728 |
| 684 | Ga0265325_10001847 | 3300031241 | Bacteria | 14626 |
| 685 | Ga0265325_10007361 | 3300031241 | Bacteria | 6594 |
| 686 | Ga0265325_10079272 | 3300031241 | Bacteria | 1634 |
| 687 | Ga0265329_10010196 | 3300031242 | Bacteria | 3463 |
| 688 | Ga0265340_10008168 | 3300031247 | Bacteria | 5659 |
| 689 | Ga0265339_10000017 | 3300031249 | Bacteria | 185084 |
| 690 | Ga0265339_10000196 | 3300031249 | Bacteria | 49860 |
| 691 | Ga0265331_10000851 | 3300031250 | Bacteria | 24815 |
| 692 | Ga0265331_10004840 | 3300031250 | Bacteria | 8293 |
| 693 | Ga0265331_10013839 | 3300031250 | Bacteria | 4322 |
| 694 | Ga0265327_10000307 | 3300031251 | Bacteria | 95145 |
| 695 | Ga0265327_10012262 | 3300031251 | Bacteria | 5806 |
| 696 | Ga0265327_10024684 | 3300031251 | Bacteria | 3523 |
| 697 | Ga0265316_10000604 | 3300031344 | Bacteria | 40036 |
| 698 | Ga0265316_10005921 | 3300031344 | Bacteria | 11774 |
| 699 | Ga0265316_10010560 | 3300031344 | Bacteria | 8408 |
| 700 | Ga0265316_10010808 | 3300031344 | Bacteria | 8292 |
| 701 | Ga0265316_10025120 | 3300031344 | Bacteria | 4976 |
| 702 | Ga0265316_10031939 | 3300031344 | Bacteria | 4302 |
| 703 | Ga0265316_10032762 | 3300031344 | Bacteria | 4239 |
| 704 | Ga0265316_10039642 | 3300031344 | Bacteria | 3782 |
| 705 | Ga0265316_10051179 | 3300031344 | Bacteria | 3245 |
| 706 | Ga0265316_10110789 | 3300031344 | Bacteria | 2079 |
| 707 | Ga0307408_100000053 | 3300031548 | Bacteria | 147370 |
| 708 | Ga0307408_100009298 | 3300031548 | Bacteria | 6479 |
| 709 | Ga0307408_100016884 | 3300031548 | Bacteria | 4880 |
| 710 | Ga0307408_100048127 | 3300031548 | Bacteria | 3057 |
| 711 | Ga0307408_100174886 | 3300031548 | Bacteria | 1717 |
| 712 | Ga0307408_100399411 | 3300031548 | Bacteria | 1180 |
| 713 | Ga0265313_10000823 | 3300031595 | Bacteria | 31314 |
| 714 | Ga0307508_10003602 | 3300031616 | Bacteria | 15569 |
| 715 | Ga0265314_10000764 | 3300031711 | Bacteria | 38414 |
| 716 | Ga0265314_10001769 | 3300031711 | Bacteria | 23305 |
| 717 | Ga0265314_10002441 | 3300031711 | Bacteria | 19044 |
| 718 | Ga0265314_10007673 | 3300031711 | Bacteria | 9328 |
| 719 | Ga0265314_10012428 | 3300031711 | Bacteria | 6946 |
| 720 | Ga0265314_10037430 | 3300031711 | Bacteria | 3516 |
| 721 | Ga0265314_10120439 | 3300031711 | Bacteria | 1653 |
| 722 | Ga0265314_10143389 | 3300031711 | Bacteria | 1474 |
| 723 | Ga0265314_10164819 | 3300031711 | Bacteria | 1344 |
| 724 | Ga0265342_10002491 | 3300031712 | Bacteria | 15853 |
| 725 | Ga0265342_10004192 | 3300031712 | Bacteria | 11471 |
| 726 | Ga0316578_10198269 | 3300031728 | Bacteria | 1209 |
| 727 | Ga0307516_10001545 | 3300031730 | Bacteria | 31640 |
| 728 | Ga0307516_10003925 | 3300031730 | Bacteria | 18740 |
| 729 | Ga0307516_10172953 | 3300031730 | Bacteria | 1899 |
| 730 | Ga0307405_10053208 | 3300031731 | Bacteria | 2521 |
| 731 | Ga0307405_10216007 | 3300031731 | Bacteria | 1404 |
| 732 | Ga0307413_10030509 | 3300031824 | Bacteria | 3030 |
| 733 | Ga0307413_10095086 | 3300031824 | Bacteria | 1952 |
| 734 | Ga0307410_10000005 | 3300031852 | Bacteria | 100475 |
| 735 | Ga0307410_10007730 | 3300031852 | Bacteria | 5903 |
| 736 | Ga0307410_10156523 | 3300031852 | Bacteria | 1702 |
| 737 | Ga0307410_10242807 | 3300031852 | Bacteria | 1396 |
| 738 | Ga0307406_10007849 | 3300031901 | Bacteria | 5938 |
| 739 | Ga0307406_10036789 | 3300031901 | Bacteria | 3018 |
| 740 | Ga0307407_10051016 | 3300031903 | Bacteria | 2370 |
| 741 | Ga0307412_10002920 | 3300031911 | Bacteria | 9483 |
| 742 | Ga0307412_10012973 | 3300031911 | Bacteria | 4871 |
| 743 | Ga0307412_10128596 | 3300031911 | Bacteria | 1836 |
| 744 | Ga0307412_10351826 | 3300031911 | Bacteria | 1183 |
| 745 | Ga0307409_100000679 | 3300031995 | Bacteria | 15090 |
| 746 | Ga0307409_100231683 | 3300031995 | Bacteria | 1675 |
| 747 | Ga0307416_100000056 | 3300032002 | Bacteria | 107434 |
| 748 | Ga0307416_100020411 | 3300032002 | Bacteria | 4727 |
| 749 | Ga0307416_100082732 | 3300032002 | Bacteria | 2720 |
| 750 | Ga0307416_100429524 | 3300032002 | Bacteria | 1368 |
| 751 | Ga0307414_10043448 | 3300032004 | Bacteria | 3061 |
| 752 | Ga0307414_10082959 | 3300032004 | Bacteria | 2352 |
| 753 | Ga0307411_10003475 | 3300032005 | Bacteria | 7318 |
| 754 | Ga0307411_10008180 | 3300032005 | Bacteria | 5397 |
| 755 | Ga0307411_10038223 | 3300032005 | Bacteria | 3025 |
| 756 | Ga0307411_10056154 | 3300032005 | Bacteria | 2594 |
| 757 | Ga0307411_10233625 | 3300032005 | Bacteria | 1435 |
| 758 | Ga0307415_100052612 | 3300032126 | Bacteria | 2770 |
| 759 | Ga0307415_100076281 | 3300032126 | Bacteria | 2376 |
| 760 | Ga0307415_100330169 | 3300032126 | Bacteria | 1276 |
| 761 | Ga0307415_100370387 | 3300032126 | Bacteria | 1213 |
| 762 | Ga0373928_0031329 | 3300035084 | Bacteria | 1180 |
| 763 | Ga0373923_0015310 | 3300035111 | Bacteria | 2894 |
| 764 | Ga0373932_0012612 | 3300035112 | Bacteria | 2084 |
| 765 | Ga0373945_0075272 | 3300035116 | Bacteria | 1285 |
| 766 | Ga0373957_0082634 | 3300035120 | Bacteria | 1270 |
| 767 | Ga0373943_0017367 | 3300035170 | Bacteria | 3292 |
| 768 | Ga0373955_0133206 | 3300035172 | Bacteria | 1452 |
| 769 | Ga0373962_0042950 | 3300035242 | Bacteria | 1280 |
| 770 | Ga0316574_0138456 | 3300035398 | Bacteria | 1568 |
| 771 | Ga0373924_0008676 | 3300035410 | Bacteria | 3704 |
| 772 | Ga0373924_0026442 | 3300035410 | Bacteria | 2302 |
| 773 | Ga0373924_0074172 | 3300035410 | Bacteria | 1439 |
| 774 | Ga0373931_0076358 | 3300035691 | Bacteria | 1840 |
| 775 | Ga0373931_0245680 | 3300035691 | Bacteria | 1086 |
| 776 | Ga0373935_0007970 | 3300035692 | Bacteria | 6351 |
| 777 | Ga0373927_0005280 | 3300035695 | Bacteria | 8936 |
| 778 | Ga0373933_0027979 | 3300035724 | Bacteria | 3250 |
| 779 | Ga0373933_0071033 | 3300035724 | Bacteria | 2118 |
| 780 | Ga0373933_0173295 | 3300035724 | Bacteria | 1374 |
| 781 | Ga0373947_0066748 | 3300035725 | Bacteria | 2196 |
| 782 | Ga0373947_0308310 | 3300035725 | Bacteria | 1057 |
| 783 | Ga0373937_0009165 | 3300036401 | Bacteria | 8589 |
| 784 | Ga0373937_0012705 | 3300036401 | Bacteria | 7411 |
| 785 | Ga0373937_0063112 | 3300036401 | Bacteria | 3407 |
| 786 | Ga0373937_0077803 | 3300036401 | Bacteria | 3065 |
| 787 | Ga0373937_0096296 | 3300036401 | Bacteria | 2745 |
| 788 | Ga0373937_0166831 | 3300036401 | Bacteria | 2065 |
| 789 | Ga0373937_0172235 | 3300036401 | Bacteria | 2031 |
| 790 | Ga0373937_0245783 | 3300036401 | Bacteria | 1686 |
| 791 | Ga0373937_0291104 | 3300036401 | Bacteria | 1543 |
| 792 | Ga0316584_0267585 | 3300036712 | Bacteria | 1245 |
| 793 | Ga0373925_0074345 | 3300037068 | Bacteria | 2574 |
| 794 | Ga0373925_0077143 | 3300037068 | Bacteria | 2528 |
| 795 | Ga0373925_0139972 | 3300037068 | Bacteria | 1893 |
| 796 | Ga0373925_0261054 | 3300037068 | Bacteria | 1391 |
| 797 | Ga0395900_0001170 | 3300037418 | Bacteria | 32733 |
| 798 | Ga0395900_0027557 | 3300037418 | Bacteria | 5821 |
| 799 | Ga0395900_0295414 | 3300037418 | Bacteria | 1608 |
| 800 | Ga0395905_0122619 | 3300037471 | Bacteria | 2444 |
| 801 | Ga0395905_0166676 | 3300037471 | Bacteria | 2070 |
| 802 | Ga0395905_0180443 | 3300037471 | Bacteria | 1982 |
| 803 | Ga0395905_0201940 | 3300037471 | Bacteria | 1864 |
| 804 | Ga0395905_0248344 | 3300037471 | Bacteria | 1662 |
| 805 | Ga0395901_0025312 | 3300038443 | Bacteria | 6092 |
| 806 | Ga0395901_0046407 | 3300038443 | Bacteria | 4513 |
| 807 | Ga0242422_00187 | 3300038699 | Bacteria | 3442 |
| 808 | Ga0242420_018863 | 3300038996 | Bacteria | 1218 |
| 809 | Ga0436365_0668515 | 3300039437 | Bacteria | 3141 |
| 810 | Ga0436365_1018976 | 3300039437 | Bacteria | 1782 |
| 811 | Ga0436365_1444529 | 3300039437 | Bacteria | 6797 |
| 812 | Ga0436360_0129730 | 3300039438 | Bacteria | 2486 |
| 813 | Ga0436361_0010635 | 3300039447 | Bacteria | 60260 |
| 814 | Ga0436361_0830524 | 3300039447 | Bacteria | 1233 |
| 815 | Ga0439447_024633 | 3300041407 | Bacteria | 1557 |
| 816 | Ga0439466_0037507 | 3300041411 | Bacteria | 1631 |
| 817 | Ga0439433_0002025 | 3300041999 | Bacteria | 4256 |
| 818 | Ga0439432_010096 | 3300042006 | Bacteria | 3282 |
| 819 | Ga0439452_001783 | 3300042010 | Bacteria | 8388 |
| 820 | Ga0439462_0001865 | 3300042015 | Bacteria | 4786 |
| 821 | Ga0450907_006360 | 3300042146 | Bacteria | 1972 |
| 822 | Ga0439458_0002185 | 3300042157 | Bacteria | 4836 |
| 823 | Ga0450909_011881 | 3300042185 | Bacteria | 1275 |
| 824 | Ga0439434_0016973 | 3300042435 | Bacteria | 2176 |
| 825 | Ga0451577_0000167 | 3300042876 | Bacteria | 144675 |
| 826 | Ga0451577_0000454 | 3300042876 | Bacteria | 71195 |
| 827 | Ga0451577_0004538 | 3300042876 | Bacteria | 14614 |
| 828 | Ga0451577_0005264 | 3300042876 | Bacteria | 13298 |
| 829 | Ga0451577_0006551 | 3300042876 | Bacteria | 11585 |
| 830 | Ga0451577_0014214 | 3300042876 | Bacteria | 7420 |
| 831 | Ga0451577_0044677 | 3300042876 | Bacteria | 3966 |
| 832 | Ga0451577_0351602 | 3300042876 | Bacteria | 1337 |
| 833 | Ga0453683_0000124 | 3300044673 | Bacteria | 114941 |
| 834 | Ga0453683_0000469 | 3300044673 | Bacteria | 46342 |
| 835 | Ga0453683_0002089 | 3300044673 | Bacteria | 15953 |
| 836 | Ga0453683_0016263 | 3300044673 | Bacteria | 4803 |
| 837 | Ga0453683_0062097 | 3300044673 | Bacteria | 2336 |
| 838 | Ga0453683_0103472 | 3300044673 | Bacteria | 1788 |
| 839 | Ga0453683_0142632 | 3300044673 | Bacteria | 1512 |
| 840 | Ga0466966_0149652 | 3300044684 | Bacteria | 1424 |
| 841 | Ga0466961_0107870 | 3300044693 | Bacteria | 1753 |
| 842 | Ga0466961_0221722 | 3300044693 | Bacteria | 1165 |
| 843 | Ga0453684_0000422 | 3300044712 | Bacteria | 172695 |
| 844 | Ga0453684_0000446 | 3300044712 | Bacteria | 166828 |
| 845 | Ga0453684_0003944 | 3300044712 | Bacteria | 32474 |
| 846 | Ga0453684_0004475 | 3300044712 | Bacteria | 29423 |
| 847 | Ga0453684_0012103 | 3300044712 | Bacteria | 14321 |
| 848 | Ga0453684_0014205 | 3300044712 | Bacteria | 12783 |
| 849 | Ga0453684_0115326 | 3300044712 | Bacteria | 3255 |
| 850 | Ga0453684_0153468 | 3300044712 | Bacteria | 2733 |
| 851 | Ga0453684_0305648 | 3300044712 | Bacteria | 1806 |
| 852 | Ga0453684_0307194 | 3300044712 | Bacteria | 1801 |
| 853 | Ga0453684_0351808 | 3300044712 | Bacteria | 1661 |
| 854 | Ga0466957_0169195 | 3300044842 | Bacteria | 1423 |
| 855 | Ga0466960_0000063 | 3300044901 | Bacteria | 35457 |
| 856 | Ga0451576_0000797 | 3300045051 | Bacteria | 61704 |
| 857 | Ga0451576_0001109 | 3300045051 | Bacteria | 49112 |
| 858 | Ga0451576_0032792 | 3300045051 | Bacteria | 5524 |
| 859 | Ga0451576_0219815 | 3300045051 | Bacteria | 1984 |
| 860 | Ga0451576_0252861 | 3300045051 | Bacteria | 1842 |
| 861 | Ga0451576_0296546 | 3300045051 | Bacteria | 1690 |
| 862 | Ga0451576_0325591 | 3300045051 | Bacteria | 1608 |
| 863 | Ga0451576_0471373 | 3300045051 | Bacteria | 1318 |
| 864 | Ga0466967_0007112 | 3300045976 | Bacteria | 8031 |
| 865 | Ga0466967_0007615 | 3300045976 | Bacteria | 7833 |
| 866 | Ga0495627_031181 | 3300046453 | Bacteria | 1685 |
| 867 | Ga0495592_0019990 | 3300046454 | Bacteria | 5091 |
| 868 | Ga0495592_0129088 | 3300046454 | Bacteria | 1770 |
| 869 | Ga0495629_0029824 | 3300046459 | Bacteria | 3866 |
| 870 | Ga0495629_0041944 | 3300046459 | Bacteria | 3217 |
| 871 | Ga0495629_0047201 | 3300046459 | Bacteria | 3021 |
| 872 | Ga0495651_0198073 | 3300046462 | Bacteria | 1408 |
| 873 | Ga0495653_0006291 | 3300046463 | Bacteria | 9741 |
| 874 | Ga0495653_0214736 | 3300046463 | Bacteria | 1297 |
| 875 | Ga0495650_0000063 | 3300046471 | Bacteria | 277841 |
| 876 | Ga0495580_0001579 | 3300046472 | Bacteria | 20013 |
| 877 | Ga0495580_0022435 | 3300046472 | Bacteria | 4646 |
| 878 | Ga0495580_0023443 | 3300046472 | Bacteria | 4532 |
| 879 | Ga0495580_0025082 | 3300046472 | Bacteria | 4358 |
| 880 | Ga0495580_0160284 | 3300046472 | Bacteria | 1557 |
| 881 | Ga0495580_0306088 | 3300046472 | Bacteria | 1082 |
| 882 | Ga0495582_0059366 | 3300046473 | Bacteria | 2110 |
| 883 | Ga0495639_0084715 | 3300046475 | Bacteria | 1481 |
| 884 | Ga0495639_0163838 | 3300046475 | Bacteria | 1077 |
| 885 | Ga0495594_0005796 | 3300046499 | Bacteria | 6340 |
| 886 | Ga0495594_0036758 | 3300046499 | Bacteria | 2671 |
| 887 | Ga0495606_0001183 | 3300046507 | Bacteria | 36792 |
| 888 | Ga0495608_0001348 | 3300046511 | Bacteria | 17514 |
| 889 | Ga0495608_0025061 | 3300046511 | Bacteria | 4073 |
| 890 | Ga0495616_0000122 | 3300046513 | Bacteria | 67299 |
| 891 | Ga0495616_0000187 | 3300046513 | Bacteria | 51726 |
| 892 | Ga0495616_0000276 | 3300046513 | Bacteria | 41682 |
| 893 | Ga0495618_0005223 | 3300046514 | Bacteria | 7935 |
| 894 | Ga0495628_0001615 | 3300046516 | Bacteria | 20645 |
| 895 | Ga0495628_0273272 | 3300046516 | Bacteria | 1257 |
| 896 | Ga0495630_0023311 | 3300046517 | Bacteria | 4576 |
| 897 | Ga0495630_0160597 | 3300046517 | Bacteria | 1711 |
| 898 | Ga0495630_0211324 | 3300046517 | Bacteria | 1481 |
| 899 | Ga0495643_0000580 | 3300046522 | Bacteria | 44701 |
| 900 | Ga0495663_0057726 | 3300046525 | Bacteria | 1215 |
| 901 | Ga0495652_0000812 | 3300046529 | Bacteria | 36015 |
| 902 | Ga0495654_0002529 | 3300046530 | Bacteria | 11757 |
| 903 | Ga0495654_0011725 | 3300046530 | Bacteria | 4735 |
| 904 | Ga0495640_0047091 | 3300046533 | Bacteria | 2985 |
| 905 | Ga0495640_0140340 | 3300046533 | Bacteria | 1558 |
| 906 | Ga0495586_0105991 | 3300046535 | Bacteria | 1563 |
| 907 | Ga0495587_0012571 | 3300046536 | Bacteria | 5323 |
| 908 | Ga0495633_0018036 | 3300046558 | Bacteria | 3590 |
| 909 | Ga0495667_0000215 | 3300046559 | Bacteria | 38593 |
| 910 | Ga0495667_0019050 | 3300046559 | Bacteria | 4631 |
| 911 | Ga0495668_0003199 | 3300046616 | Bacteria | 12531 |
| 912 | Ga0495668_0006493 | 3300046616 | Bacteria | 7651 |
| 913 | Ga0495668_0009039 | 3300046616 | Bacteria | 6151 |
| 914 | Ga0495668_0049342 | 3300046616 | Bacteria | 2334 |
| 915 | Ga0495661_0031172 | 3300046665 | Bacteria | 3387 |
| 916 | Ga0495657_0002973 | 3300046675 | Bacteria | 14032 |
| 917 | Ga0495669_0057829 | 3300046684 | Bacteria | 1750 |
| 918 | Ga0495613_0010066 | 3300046689 | Bacteria | 7024 |
| 919 | Ga0495613_0088784 | 3300046689 | Bacteria | 2240 |
| 920 | Ga0495613_0246447 | 3300046689 | Bacteria | 1248 |
| 921 | Ga0495671_0121334 | 3300046692 | Bacteria | 1275 |
| 922 | Ga0495589_0014533 | 3300046794 | Bacteria | 4052 |
| 923 | Ga0495600_0154817 | 3300046809 | Bacteria | 1483 |
| 924 | Ga0495581_0038863 | 3300047315 | Bacteria | 2755 |
| 925 | Ga0495581_0041258 | 3300047315 | Bacteria | 2671 |
| 926 | Ga0495604_0047480 | 3300047317 | Bacteria | 3343 |
| 927 | Ga0495674_0000271 | 3300047319 | Bacteria | 44227 |
| 928 | Ga0495674_0009483 | 3300047319 | Bacteria | 9248 |
| 929 | Ga0495674_0204759 | 3300047319 | Bacteria | 1636 |
| 930 | Ga0495680_0002950 | 3300047322 | Bacteria | 17024 |
| 931 | Ga0495687_015990 | 3300047443 | Bacteria | 3788 |
| 932 | Ga0495675_0000354 | 3300047444 | Bacteria | 32123 |
| 933 | Ga0495684_0020764 | 3300047471 | Bacteria | 5060 |
| 934 | Ga0495684_0066876 | 3300047471 | Bacteria | 2733 |
| 935 | Ga0495684_0138283 | 3300047471 | Bacteria | 1827 |
| 936 | Ga0495686_0007438 | 3300047472 | Bacteria | 8216 |
| 937 | Ga0495686_0114900 | 3300047472 | Bacteria | 1610 |
| 938 | Ga0495602_0073722 | 3300048088 | Bacteria | 2904 |
| 939 | Ga0495602_0078102 | 3300048088 | Bacteria | 2797 |
| 940 | Ga0496101_0131704 | 3300048904 | Bacteria | 1899 |
| 941 | Ga0496102_0161837 | 3300048905 | Bacteria | 2105 |
| 942 | Ga0496102_0223448 | 3300048905 | Bacteria | 1775 |
| 943 | Ga0496103_0350144 | 3300048906 | Bacteria | 950 |
| 944 | Ga0496104_0042519 | 3300048907 | Bacteria | 4265 |
| 945 | Ga0496104_0138453 | 3300048907 | Bacteria | 2339 |
| 946 | Ga0496104_0199700 | 3300048907 | Bacteria | 1912 |
| 947 | Ga0496104_0244288 | 3300048907 | Bacteria | 1708 |
| 948 | Ga0496104_0400636 | 3300048907 | Bacteria | 1284 |
| 949 | Ga0496105_0046426 | 3300048908 | Bacteria | 3585 |
| 950 | Ga0496105_0051326 | 3300048908 | Bacteria | 3407 |
| 951 | Ga0496105_0470871 | 3300048908 | Bacteria | 990 |
| 952 | Ga0496106_0018866 | 3300048909 | Bacteria | 5111 |
| 953 | Ga0496106_0086588 | 3300048909 | Bacteria | 2413 |
| 954 | Ga0496107_0022249 | 3300048910 | Bacteria | 4480 |
| 955 | Ga0496108_0012657 | 3300048911 | Bacteria | 6873 |
| 956 | Ga0496108_0027061 | 3300048911 | Bacteria | 4732 |
| 957 | Ga0496108_0033172 | 3300048911 | Bacteria | 4289 |
| 958 | Ga0496109_0025140 | 3300048912 | Bacteria | 5304 |
| 959 | Ga0496109_0098718 | 3300048912 | Bacteria | 2707 |
| 960 | Ga0496109_0111063 | 3300048912 | Bacteria | 2549 |
| 961 | Ga0496109_0145251 | 3300048912 | Bacteria | 2219 |
| 962 | Ga0496109_0221632 | 3300048912 | Bacteria | 1779 |
| 963 | Ga0496110_0028922 | 3300048913 | Bacteria | 4764 |
| 964 | Ga0496110_0149699 | 3300048913 | Bacteria | 2113 |
| 965 | Ga0496110_0314615 | 3300048913 | Bacteria | 1426 |
| 966 | Ga0496111_0020070 | 3300048914 | Bacteria | 4648 |
| 967 | Ga0496112_0024604 | 3300048915 | Bacteria | 5770 |
| 968 | Ga0496112_0156984 | 3300048915 | Bacteria | 2242 |
| 969 | Ga0496112_0171241 | 3300048915 | Bacteria | 2136 |
| 970 | Ga0496113_0204001 | 3300048916 | Bacteria | 1572 |
| 971 | Ga0496114_0004338 | 3300048917 | Bacteria | 10980 |
| 972 | Ga0496114_0033149 | 3300048917 | Bacteria | 4254 |
| 973 | Ga0496114_0168010 | 3300048917 | Bacteria | 1911 |
| 974 | Ga0496114_0413390 | 3300048917 | Bacteria | 1195 |
| 975 | Ga0496115_0009048 | 3300048918 | Bacteria | 7388 |
| 976 | Ga0496115_0013321 | 3300048918 | Bacteria | 6220 |
| 977 | Ga0496115_0111770 | 3300048918 | Bacteria | 2245 |
| 978 | Ga0496121_0005276 | 3300048924 | Bacteria | 16661 |
| 979 | Ga0496121_0219989 | 3300048924 | Bacteria | 1338 |
| 980 | Ga0496126_0003087 | 3300048929 | Bacteria | 21537 |
| 981 | Ga0496126_0008507 | 3300048929 | Bacteria | 11058 |
| 982 | Ga0501298_004427 | 3300049521 | Bacteria | 2214 |
| 983 | Ga0501302_001857 | 3300049525 | Bacteria | 1172 |
| 984 | Ga0501031_0046440 | 3300049568 | Archaea | 2831 |
| 985 | Ga0501031_0059850 | 3300049568 | Archaea | 2482 |
| 986 | Ga0501032_0023547 | 3300049569 | Unclassified | 4251 |
| 987 | Ga0501032_0089706 | 3300049569 | Bacteria | 2041 |
| 988 | Ga0501033_0000337 | 3300049570 | Bacteria | 44892 |
| 989 | Ga0501033_0021848 | 3300049570 | Bacteria | 4829 |
| 990 | Ga0501033_0122724 | 3300049570 | Bacteria | 1884 |
| 991 | Ga0501034_0000461 | 3300049571 | Bacteria | 67308 |
| 992 | Ga0501034_0002385 | 3300049571 | Bacteria | 22806 |
| 993 | Ga0501034_0003139 | 3300049571 | Bacteria | 19020 |
| 994 | Ga0501034_0033843 | 3300049571 | Bacteria | 5180 |
| 995 | Ga0501034_0052307 | 3300049571 | Bacteria | 4115 |
| 996 | Ga0501034_0068458 | 3300049571 | Bacteria | 3560 |
| 997 | Ga0501034_0081922 | 3300049571 | Bacteria | 3229 |
| 998 | Ga0501034_0127755 | 3300049571 | Bacteria | 2527 |
| 999 | Ga0501034_0190370 | 3300049571 | Bacteria | 2014 |
| 1000 | Ga0501036_0004555 | 3300049572 | Bacteria | 11194 |
| 1001 | Ga0501036_0016233 | 3300049572 | Archaea | 6219 |
| 1002 | Ga0501036_0105217 | 3300049572 | Bacteria | 2387 |
| 1003 | Ga0501037_0004663 | 3300049573 | Bacteria | 9957 |
| 1004 | Ga0501037_0114904 | 3300049573 | Archaea | 1937 |
| 1005 | Ga0501038_0001263 | 3300049574 | Bacteria | 22989 |
| 1006 | Ga0501038_0011870 | 3300049574 | Bacteria | 7951 |
| 1007 | Ga0501038_0045157 | 3300049574 | Bacteria | 3825 |
| 1008 | Ga0501038_0113357 | 3300049574 | Bacteria | 2244 |
| 1009 | Ga0501039_0019759 | 3300049575 | Bacteria | 5164 |
| 1010 | Ga0501039_0040703 | 3300049575 | Bacteria | 3587 |
| 1011 | Ga0501039_0047509 | 3300049575 | Archaea | 3318 |
| 1012 | Ga0501039_0080632 | 3300049575 | Archaea | 2532 |
| 1013 | Ga0501040_0013105 | 3300049576 | Archaea | 5452 |
| 1014 | Ga0501040_0181950 | 3300049576 | Bacteria | 1490 |
| 1015 | Ga0501042_0030276 | 3300049578 | Archaea | 3821 |
| 1016 | Ga0501042_0078975 | 3300049578 | Archaea | 2357 |
| 1017 | Ga0501043_0002565 | 3300049579 | Bacteria | 15358 |
| 1018 | Ga0501043_0060761 | 3300049579 | Bacteria | 2967 |
| 1019 | Ga0501043_0164315 | 3300049579 | Archaea | 1733 |
| 1020 | Ga0501046_0000025 | 3300049580 | Bacteria | 197542 |
| 1021 | Ga0501046_0023621 | 3300049580 | Bacteria | 5053 |
| 1022 | Ga0501046_0066279 | 3300049580 | Archaea | 2814 |
| 1023 | Ga0501046_0267621 | 3300049580 | Archaea | 1254 |
| 1024 | Ga0501047_0003053 | 3300049581 | Bacteria | 15886 |
| 1025 | Ga0501047_0033929 | 3300049581 | Bacteria | 4926 |
| 1026 | Ga0501047_0218951 | 3300049581 | Bacteria | 1760 |
| 1027 | Ga0501048_0009926 | 3300049582 | Bacteria | 7131 |
| 1028 | Ga0501048_0017442 | 3300049582 | Archaea | 5287 |
| 1029 | Ga0501048_0050764 | 3300049582 | Bacteria | 2953 |
| 1030 | Ga0501048_0129289 | 3300049582 | Bacteria | 1786 |
| 1031 | Ga0501048_0139564 | 3300049582 | Bacteria | 1714 |
| 1032 | Ga0501067_0146380 | 3300049583 | Bacteria | 1316 |
| 1033 | Ga0501068_0030423 | 3300049584 | Archaea | 3203 |
| 1034 | Ga0501071_0019378 | 3300049587 | Archaea | 4720 |
| 1035 | Ga0501072_0014538 | 3300049588 | Bacteria | 6031 |
| 1036 | Ga0501072_0275405 | 3300049588 | Bacteria | 1339 |
| 1037 | Ga0501074_0030377 | 3300049590 | Bacteria | 3915 |
| 1038 | Ga0501074_0112712 | 3300049590 | Bacteria | 1946 |
| 1039 | Ga0501076_0005919 | 3300049592 | Archaea | 8827 |
| 1040 | Ga0501076_0106010 | 3300049592 | Bacteria | 2268 |
| 1041 | Ga0501077_0012622 | 3300049593 | Bacteria | 5289 |
| 1042 | Ga0501077_0014673 | 3300049593 | Plasmid | 4924 |
| 1043 | Ga0501077_0039740 | 3300049593 | Bacteria | 2997 |
| 1044 | Ga0501216_013491 | 3300049660 | Bacteria | 1355 |
| 1045 | Ga0501223_000438 | 3300049663 | Bacteria | 10055 |
| 1046 | Ga0501235_000818 | 3300049669 | Bacteria | 6367 |
| 1047 | Ga0501243_006117 | 3300049675 | Bacteria | 1822 |
| 1048 | Ga0501234_001339 | 3300049707 | Bacteria | 3858 |
| 1049 | Ga0501079_0005151 | 3300049741 | Bacteria | 9717 |
| 1050 | Ga0501079_0094908 | 3300049741 | Archaea | 2311 |
| 1051 | Ga0501079_0181110 | 3300049741 | Bacteria | 1644 |
| 1052 | Ga0501080_0065836 | 3300049742 | Archaea | 3370 |
| 1053 | Ga0501080_0067070 | 3300049742 | Bacteria | 3337 |
| 1054 | Ga0501080_0286382 | 3300049742 | Bacteria | 1497 |
| 1055 | Ga0501081_0072109 | 3300049743 | Bacteria | 2408 |
| 1056 | Ga0501081_0261646 | 3300049743 | Bacteria | 1264 |
| 1057 | Ga0501083_0001588 | 3300049744 | Bacteria | 15521 |
| 1058 | Ga0501268_009087 | 3300049765 | Bacteria | 1521 |
| 1059 | Ga0501270_002867 | 3300049767 | Bacteria | 1808 |
| 1060 | Ga0501283_000160 | 3300049779 | Bacteria | 8610 |
| 1061 | Ga0501035_0023351 | 3300049822 | Bacteria | 5672 |
| 1062 | Ga0501035_0075534 | 3300049822 | Bacteria | 2980 |
| 1063 | Ga0501035_0107548 | 3300049822 | Bacteria | 2445 |
| 1064 | Ga0501035_0148234 | 3300049822 | Bacteria | 2037 |
| 1065 | Ga0501035_0178965 | 3300049822 | Bacteria | 1828 |
| 1066 | Ga0501044_0014492 | 3300049823 | Bacteria | 8507 |
| 1067 | Ga0501044_0022075 | 3300049823 | Bacteria | 6787 |
| 1068 | Ga0501044_0029323 | 3300049823 | Archaea | 5802 |
| 1069 | Ga0501044_0092341 | 3300049823 | Bacteria | 3053 |
| 1070 | Ga0501044_0104996 | 3300049823 | Bacteria | 2838 |
| 1071 | Ga0501044_0118090 | 3300049823 | Bacteria | 2656 |
| 1072 | Ga0501045_0008713 | 3300049824 | Bacteria | 7074 |
| 1073 | Ga0501045_0021923 | 3300049824 | Plasmid | 4571 |
| 1074 | Ga0501045_0101826 | 3300049824 | Bacteria | 2127 |
| 1075 | nmdc:mga07m45_156482_c1 | 3300050496 | Bacteria | 1322 |
| 1076 | nmdc:mga05p37_227256_c1 | 3300050507 | Bacteria | 2250 |
| 1077 | nmdc:mga05p37_390218_c1 | 3300050507 | Bacteria | 1628 |
| 1078 | nmdc:mga05p37_41169_c1 | 3300050507 | Archaea | 5674 |
| 1079 | nmdc:mga09592_17734_c1 | 3300050508 | Archaea | 5835 |
| 1080 | nmdc:mga09592_94627_c1 | 3300050508 | Bacteria | 2555 |
| 1081 | nmdc:mga0qj67_29345_c1 | 3300050509 | Bacteria | 4273 |
| 1082 | nmdc:mga0qj67_587_c1 | 3300050509 | Archaea | 24795 |
| 1083 | nmdc:mga06r32_172951_c1 | 3300050510 | Bacteria | 2144 |
| 1084 | nmdc:mga06r32_184181_c1 | 3300050510 | Bacteria | 2074 |
| 1085 | nmdc:mga06r32_352112_c1 | 3300050510 | Bacteria | 1457 |
| 1086 | nmdc:mga08y16_15671_c1 | 3300050511 | Bacteria | 7971 |
| 1087 | nmdc:mga08y16_173702_c1 | 3300050511 | Bacteria | 2238 |
| 1088 | nmdc:mga08y16_22520_c1 | 3300050511 | Bacteria | 6651 |
| 1089 | nmdc:mga0n895_174777_c1 | 3300050512 | Bacteria | 2179 |
| 1090 | nmdc:mga0n895_201428_c1 | 3300050512 | Bacteria | 2021 |
| 1091 | nmdc:mga0n895_3811_c1 | 3300050512 | Bacteria | 12219 |
| 1092 | nmdc:mga08x19_117339_c1 | 3300050514 | Bacteria | 1780 |
| 1093 | Ga0495601_0016863 | 3300053077 | Bacteria | 4430 |
| 1094 | Ga0495601_0058748 | 3300053077 | Bacteria | 2438 |
| 1095 | Ga0495619_0077357 | 3300053085 | Bacteria | 2235 |
| 1096 | Ga0495619_0215219 | 3300053085 | Bacteria | 1331 |
| 1097 | Ga0495619_0254586 | 3300053085 | Bacteria | 1217 |
| 1098 | Ga0500592_000310 | 3300053116 | Bacteria | 8376 |
| 1099 | Ga0500592_000519 | 3300053116 | Bacteria | 6325 |
| 1100 | Ga0500592_001386 | 3300053116 | Bacteria | 3922 |
| 1101 | Ga0500595_019267 | 3300053119 | Bacteria | 2479 |
| 1102 | Ga0500607_013278 | 3300053121 | Bacteria | 4814 |
| 1103 | Ga0500568_0018534 | 3300053139 | Bacteria | 3043 |
| 1104 | Ga0500577_0061201 | 3300053142 | Bacteria | 1448 |
| 1105 | Ga0500604_0003278 | 3300053151 | Bacteria | 4358 |
| 1106 | Ga0500604_0012031 | 3300053151 | Bacteria | 2332 |
| 1107 | Ga0500604_0018702 | 3300053151 | Bacteria | 1933 |
| 1108 | Ga0500616_0002767 | 3300053153 | Bacteria | 14162 |
| 1109 | Ga0500616_0007137 | 3300053153 | Bacteria | 7150 |
| 1110 | Ga0500627_0000218 | 3300053158 | Bacteria | 16566 |
| 1111 | Ga0500627_0002835 | 3300053158 | Bacteria | 5233 |
| 1112 | Ga0500627_0021298 | 3300053158 | Bacteria | 2614 |
| 1113 | Ga0500634_0005118 | 3300053161 | Bacteria | 6180 |
| 1114 | Ga0500636_0006862 | 3300053177 | Bacteria | 6560 |
| 1115 | Ga0500637_0002948 | 3300053178 | Bacteria | 7705 |
| 1116 | Ga0500645_013160 | 3300053730 | Bacteria | 2661 |
| 1117 | Ga0501084_0010348 | 3300054114 | Bacteria | 7719 |
| 1118 | Ga0501084_0024645 | 3300054114 | Archaea | 5020 |
| 1119 | Ga0590075_003486 | 3300059424 | Bacteria | 3737 |
| 1120 | Ga0590075_010969 | 3300059424 | Bacteria | 2186 |
| 1121 | Ga0590075_021996 | 3300059424 | Bacteria | 1594 |
| 1122 | Ga0590077_005594 | 3300059426 | Bacteria | 2570 |
| 1123 | Ga0587084_008686 | 3300059477 | Archaea | 1293 |
| 1124 | Ga0587070_010926 | 3300059491 | Archaea | 1347 |
| 1125 | Ga0587073_0018703 | 3300059492 | Unclassified | 1298 |
| 1126 | Ga0587073_0030133 | 3300059492 | Archaea | 1114 |
| 1127 | Ga0587082_012301 | 3300059504 | Unclassified | 1269 |
| 1128 | Ga0587092_010396 | 3300059512 | Archaea | 1272 |
| 1129 | Ga0587072_015782 | 3300059643 | Archaea | 1287 |
| 1130 | Ga0587076_013696 | 3300059645 | Archaea | 1235 |
| 1131 | Ga0587110_003725 | 3300059654 | Archaea | 1290 |
| 1132 | Ga0501082_0006861 | 3300060353 | Bacteria | 9847 |
| 1133 | Ga0501082_0066443 | 3300060353 | Archaea | 3106 |
| 1134 | Ga0530510_0009751 | 3300061734 | Bacteria | 6738 |
| 1135 | Ga0530510_0015195 | 3300061734 | Archaea | 5437 |
| 1136 | Ga0530510_0023280 | 3300061734 | Bacteria | 4412 |
| 1137 | 2748019729 | 2747842501 | Bacteria | 5293829 |
| 1138 | 2919522732 | 2919517244 | Bacteria | 5858162 |
| 1139 | 2945944968 | 2945941187 | Bacteria | 4682474 |
| 1140 | 8022951137 | 8022948649 | Bacteria | 5366783 |
| 1141 | Ga0207652_10003270 | |||
| 1142 | ARcpr5yngRDRAFT_c001556 | |||
| 1143 | ARSoilOldRDRAFT_c000399 | |||
| 1144 | LJNas_1001054 | |||
| 1145 | JGI24034J26672_10000002 | |||
| 1146 | JGI24751J29686_10000233 | |||
| 1147 | JGI24751J29686_10008629 | |||
| 1148 | JGI25156J39149_1006441 | |||
| 1149 | JGI25157J39369_1003469 | |||
| 1150 | JGI25406J46586_10000065 | |||
| 1151 | JGI25406J46586_10002954 | |||
| 1152 | rootH2_10060039 | |||
| 1153 | JGI26144J50225_100489 | |||
| 1154 | JGI25404J52841_10002499 | |||
| 1155 | Ga0055529_1004004 | |||
| 1156 | Ga0058863_11511870 | |||
| 1157 | Ga0058862_12777708 | |||
| 1158 | Ga0065716_1000318 | |||
| 1159 | Ga0065714_10064426 | |||
| 1160 | Ga0065704_10007764 | |||
| 1161 | Ga0065712_10067732 | |||
| 1162 | Ga0065712_10075433 | |||
| 1163 | Ga0065712_10094064 | |||
| 1164 | Ga0065712_10116389 | |||
| 1165 | Ga0065712_10200756 | |||
| 1166 | Ga0065715_10089198 | |||
| 1167 | Ga0065715_10142034 | |||
| 1168 | Ga0065707_10022085 | |||
| 1169 | Ga0065707_10140090 | |||
| 1170 | Ga0065707_10187479 | |||
| 1171 | Ga0070658_10004860 | |||
| 1172 | Ga0070658_10126546 | |||
| 1173 | Ga0070676_10068868 | |||
| 1174 | Ga0070676_10089491 | |||
| 1175 | Ga0070683_100000031 | |||
| 1176 | Ga0070683_100008679 | |||
| 1177 | Ga0070683_100022911 | |||
| 1178 | Ga0070683_100234141 | |||
| 1179 | Ga0070683_100253829 | |||
| 1180 | Ga0070690_100026972 | |||
| 1181 | Ga0070690_100073932 | |||
| 1182 | Ga0070690_100088229 | |||
| 1183 | Ga0070690_100170826 | |||
| 1184 | Ga0070670_100000688 | |||
| 1185 | Ga0070670_100038640 | |||
| 1186 | Ga0070670_100092794 | |||
| 1187 | Ga0070670_100180189 | |||
| 1188 | Ga0070666_10001918 | |||
| 1189 | Ga0070666_10010934 | |||
| 1190 | Ga0070666_10020033 | |||
| 1191 | Ga0070666_10066056 | |||
| 1192 | Ga0070682_100000347 | |||
| 1193 | Ga0070682_100030096 | |||
| 1194 | Ga0070682_100177012 | |||
| 1195 | Ga0068868_100159430 | |||
| 1196 | Ga0068868_100236221 | |||
| 1197 | Ga0070660_100059320 | |||
| 1198 | Ga0070660_100153588 | |||
| 1199 | Ga0070660_100207527 | |||
| 1200 | Ga0070689_100088810 | |||
| 1201 | Ga0070689_100125832 | |||
| 1202 | Ga0070687_100124091 | |||
| 1203 | Ga0070661_100000055 | |||
| 1204 | Ga0070661_100006128 | |||
| 1205 | Ga0070661_100018950 | |||
| 1206 | Ga0070692_10038710 | |||
| 1207 | Ga0070668_100190282 | |||
| 1208 | Ga0070668_100360656 | |||
| 1209 | Ga0070669_100000023 | |||
| 1210 | Ga0070669_100025331 | |||
| 1211 | Ga0070669_100187896 | |||
| 1212 | Ga0070669_100207706 | |||
| 1213 | Ga0070675_100011925 | |||
| 1214 | Ga0070675_100122582 | |||
| 1215 | Ga0070675_100133244 | |||
| 1216 | Ga0070671_100009139 | |||
| 1217 | Ga0070671_100021272 | |||
| 1218 | Ga0070671_100049868 | |||
| 1219 | Ga0070671_100127440 | |||
| 1220 | Ga0070671_100287862 | |||
| 1221 | Ga0070674_100008654 | |||
| 1222 | Ga0070673_100000385 | |||
| 1223 | Ga0070659_100023815 | |||
| 1224 | Ga0070659_100328874 | |||
| 1225 | Ga0070667_100100475 | |||
| 1226 | Ga0070667_100100873 | |||
| 1227 | Ga0070667_100191618 | |||
| 1228 | Ga0070667_100206793 | |||
| 1229 | Ga0070667_100242939 | |||
| 1230 | Ga0070667_100258595 | |||
| 1231 | Ga0070703_10000798 | |||
| 1232 | Ga0070709_10000039 | |||
| 1233 | Ga0070709_10011466 | |||
| 1234 | Ga0070709_10029380 | |||
| 1235 | Ga0070709_10112178 | |||
| 1236 | Ga0070714_100007032 | |||
| 1237 | Ga0070714_100013704 | |||
| 1238 | Ga0070714_100054675 | |||
| 1239 | Ga0070713_100001464 | |||
| 1240 | Ga0070713_100002736 | |||
| 1241 | Ga0070713_100075736 | |||
| 1242 | Ga0070713_100114361 | |||
| 1243 | Ga0070713_100172970 | |||
| 1244 | Ga0070713_100204404 | |||
| 1245 | Ga0070713_100254169 | |||
| 1246 | Ga0070713_100374186 | |||
| 1247 | Ga0070713_100430557 | |||
| 1248 | Ga0070710_10022157 | |||
| 1249 | Ga0070710_10024129 | |||
| 1250 | Ga0070710_10099253 | |||
| 1251 | Ga0070711_100000225 | |||
| 1252 | Ga0070711_100080116 | |||
| 1253 | Ga0070711_100115172 | |||
| 1254 | Ga0070711_100124959 | |||
| 1255 | Ga0070711_100128224 | |||
| 1256 | Ga0070705_100036058 | |||
| 1257 | Ga0070705_100066479 | |||
| 1258 | Ga0070705_100115458 | |||
| 1259 | Ga0070700_100059212 | |||
| 1260 | Ga0070694_100072569 | |||
| 1261 | Ga0070708_100009638 | |||
| 1262 | Ga0070708_100038650 | |||
| 1263 | Ga0070708_100407723 | |||
| 1264 | Ga0070663_100006248 | |||
| 1265 | Ga0070663_100069213 | |||
| 1266 | Ga0070678_100002567 | |||
| 1267 | Ga0070678_100081635 | |||
| 1268 | Ga0070678_100085922 | |||
| 1269 | Ga0070678_100157094 | |||
| 1270 | Ga0070678_100233803 | |||
| 1271 | Ga0070662_100313278 | |||
| 1272 | Ga0070681_10074222 | |||
| 1273 | Ga0070681_10261553 | |||
| 1274 | Ga0070685_10010854 | |||
| 1275 | Ga0070685_10051395 | |||
| 1276 | Ga0070706_100000131 | |||
| 1277 | Ga0070706_100018749 | |||
| 1278 | Ga0070706_100028059 | |||
| 1279 | Ga0070706_100053627 | |||
| 1280 | Ga0070706_100289634 | |||
| 1281 | Ga0070698_100007615 | |||
| 1282 | Ga0070698_100010085 | |||
| 1283 | Ga0070698_100016313 | |||
| 1284 | Ga0070699_100000009 | |||
| 1285 | Ga0070699_100033175 | |||
| 1286 | Ga0070699_100047435 | |||
| 1287 | Ga0070679_100004900 | |||
| 1288 | Ga0070679_100325805 | |||
| 1289 | Ga0070679_100371267 | |||
| 1290 | Ga0070684_100000030 | |||
| 1291 | Ga0070684_100010128 | |||
| 1292 | Ga0070684_100019042 | |||
| 1293 | Ga0070684_100259344 | |||
| 1294 | Ga0070697_100010791 | |||
| 1295 | Ga0070697_100076502 | |||
| 1296 | Ga0070697_100143626 | |||
| 1297 | Ga0070697_100342648 | |||
| 1298 | Ga0068853_100000108 | |||
| 1299 | Ga0068853_100000635 | |||
| 1300 | Ga0070672_100001906 | |||
| 1301 | Ga0070672_100018779 | |||
| 1302 | Ga0070672_100025876 | |||
| 1303 | Ga0070672_100113429 | |||
| 1304 | Ga0070672_100351734 | |||
| 1305 | Ga0070695_100014494 | |||
| 1306 | Ga0070696_100000136 | |||
| 1307 | Ga0070696_100024739 | |||
| 1308 | Ga0070696_100181736 | |||
| 1309 | Ga0070693_100010008 | |||
| 1310 | Ga0070693_100287697 | |||
| 1311 | Ga0070665_100027074 | |||
| 1312 | Ga0070665_100147492 | |||
| 1313 | Ga0070665_100193326 | |||
| 1314 | Ga0070665_100531735 | |||
| 1315 | Ga0068855_100003669 | |||
| 1316 | Ga0068855_100004022 | |||
| 1317 | Ga0068855_100012713 | |||
| 1318 | Ga0068855_100018921 | |||
| 1319 | Ga0068855_100028545 | |||
| 1320 | Ga0068855_100043088 | |||
| 1321 | Ga0068855_100089705 | |||
| 1322 | Ga0068855_100106728 | |||
| 1323 | Ga0068857_100016940 | |||
| 1324 | Ga0068857_100017552 | |||
| 1325 | Ga0068857_100035636 | |||
| 1326 | Ga0068854_100099374 | |||
| 1327 | Ga0068856_100000408 | |||
| 1328 | Ga0068856_100003746 | |||
| 1329 | Ga0068856_100012673 | |||
| 1330 | Ga0068856_100013228 | |||
| 1331 | Ga0068856_100111800 | |||
| 1332 | Ga0070702_100052249 | |||
| 1333 | Ga0068852_100000234 | |||
| 1334 | Ga0068852_100000599 | |||
| 1335 | Ga0068852_100084244 | |||
| 1336 | Ga0068852_100094164 | |||
| 1337 | Ga0068859_100000016 | |||
| 1338 | Ga0068859_100024921 | |||
| 1339 | Ga0068859_100025105 | |||
| 1340 | Ga0068859_100121876 | |||
| 1341 | Ga0068859_100153608 | |||
| 1342 | Ga0068859_100215522 | |||
| 1343 | Ga0068859_100281856 | |||
| 1344 | Ga0068864_100006197 | |||
| 1345 | Ga0068864_100009787 | |||
| 1346 | Ga0068864_100078445 | |||
| 1347 | Ga0068864_100105441 | |||
| 1348 | Ga0068864_100123187 | |||
| 1349 | Ga0068864_100140689 | |||
| 1350 | Ga0068864_100245975 | |||
| 1351 | Ga0068866_10073156 | |||
| 1352 | Ga0068861_100062317 | |||
| 1353 | Ga0068851_10003565 | |||
| 1354 | Ga0068851_10008995 | |||
| 1355 | Ga0068851_10048224 | |||
| 1356 | Ga0068863_100031542 | |||
| 1357 | Ga0068863_100046447 | |||
| 1358 | Ga0068863_100141855 | |||
| 1359 | Ga0068863_100160866 | |||
| 1360 | Ga0068863_100162014 | |||
| 1361 | Ga0068863_100195773 | |||
| 1362 | Ga0068863_100244694 | |||
| 1363 | Ga0068863_100262960 | |||
| 1364 | Ga0068863_100280606 | |||
| 1365 | Ga0068863_100386836 | |||
| 1366 | Ga0068858_100000008 | |||
| 1367 | Ga0068858_100050397 | |||
| 1368 | Ga0068858_100078741 | |||
| 1369 | Ga0068858_100085695 | |||
| 1370 | Ga0068858_100100162 | |||
| 1371 | Ga0068858_100151613 | |||
| 1372 | Ga0068858_100215275 | |||
| 1373 | Ga0068858_100247213 | |||
| 1374 | Ga0068858_100253899 | |||
| 1375 | Ga0068860_100017093 | |||
| 1376 | Ga0068860_100122386 | |||
| 1377 | Ga0068860_100401371 | |||
| 1378 | Ga0068862_100000425 | |||
| 1379 | Ga0068862_100036013 | |||
| 1380 | Ga0068862_100095758 | |||
| 1381 | Ga0068862_100371831 | |||
| 1382 | Ga0081455_10009500 | |||
| 1383 | Ga0081455_10050949 | |||
| 1384 | Ga0081455_10149124 | |||
| 1385 | Ga0081540_1000560 | |||
| 1386 | Ga0081540_1050005 | |||
| 1387 | Ga0081539_10000647 | |||
| 1388 | Ga0081539_10001121 | |||
| 1389 | Ga0070717_10001781 | |||
| 1390 | Ga0070717_10019574 | |||
| 1391 | Ga0070717_10020888 | |||
| 1392 | Ga0070717_10046477 | |||
| 1393 | Ga0070717_10098598 | |||
| 1394 | Ga0070717_10157615 | |||
| 1395 | Ga0070715_10010166 | |||
| 1396 | Ga0070715_10045941 | |||
| 1397 | Ga0070716_100018244 | |||
| 1398 | Ga0070716_100041273 | |||
| 1399 | Ga0070716_100075652 | |||
| 1400 | Ga0070712_100001263 | |||
| 1401 | Ga0070712_100006323 | |||
| 1402 | Ga0070712_100107766 | |||
| 1403 | Ga0097621_100016407 | |||
| 1404 | Ga0097621_100022381 | |||
| 1405 | Ga0097621_100343149 | |||
| 1406 | Ga0068871_100030665 | |||
| 1407 | Ga0068871_100048940 | |||
| 1408 | Ga0068871_100135326 | |||
| 1409 | Ga0075428_100071511 | |||
| 1410 | Ga0075428_100193412 | |||
| 1411 | Ga0075430_100002212 | |||
| 1412 | Ga0075430_100031247 | |||
| 1413 | Ga0075430_100129829 | |||
| 1414 | Ga0075430_100167609 | |||
| 1415 | Ga0075431_100035241 | |||
| 1416 | Ga0075431_100127325 | |||
| 1417 | Ga0075431_100190758 | |||
| 1418 | Ga0075433_10024007 | |||
| 1419 | Ga0075434_100177251 | |||
| 1420 | Ga0075434_100296961 | |||
| 1421 | Ga0075429_100009967 | |||
| 1422 | Ga0075429_100071950 | |||
| 1423 | Ga0075436_100021577 | |||
| 1424 | Ga0097620_100000016 | |||
| 1425 | Ga0097620_100024921 | |||
| 1426 | Ga0097620_100025106 | |||
| 1427 | Ga0097620_100121876 | |||
| 1428 | Ga0097620_100153613 | |||
| 1429 | Ga0097620_100215524 | |||
| 1430 | Ga0097620_100281875 | |||
| 1431 | Ga0099794_10053035 | |||
| 1432 | Ga0105240_10000060 | |||
| 1433 | Ga0105240_10000166 | |||
| 1434 | Ga0105240_10004201 | |||
| 1435 | Ga0105240_10013037 | |||
| 1436 | Ga0105240_10045314 | |||
| 1437 | Ga0105240_10098903 | |||
| 1438 | Ga0105240_10204825 | |||
| 1439 | Ga0105240_10243846 | |||
| 1440 | Ga0111539_10008568 | |||
| 1441 | Ga0111539_10091985 | |||
| 1442 | Ga0111539_10105841 | |||
| 1443 | Ga0111539_10120853 | |||
| 1444 | Ga0111539_10248974 | |||
| 1445 | Ga0105245_10007338 | |||
| 1446 | Ga0105245_10026955 | |||
| 1447 | Ga0105245_10079682 | |||
| 1448 | Ga0105245_10216712 | |||
| 1449 | Ga0105247_10000001 | |||
| 1450 | Ga0105247_10031476 | |||
| 1451 | Ga0105247_10298087 | |||
| 1452 | Ga0114129_10017754 | |||
| 1453 | Ga0114129_10025752 | |||
| 1454 | Ga0114129_10042110 | |||
| 1455 | Ga0114129_10164202 | |||
| 1456 | Ga0114129_10509965 | |||
| 1457 | Ga0105243_10000344 | |||
| 1458 | Ga0105243_10136167 | |||
| 1459 | Ga0105241_10000383 | |||
| 1460 | Ga0105241_10012596 | |||
| 1461 | Ga0105241_10019513 | |||
| 1462 | Ga0105241_10027715 | |||
| 1463 | Ga0105242_10001266 | |||
| 1464 | Ga0105242_10007464 | |||
| 1465 | Ga0105242_10403251 | |||
| 1466 | Ga0105248_10000003 | |||
| 1467 | Ga0105248_10005255 | |||
| 1468 | Ga0105248_10028964 | |||
| 1469 | Ga0105248_10034308 | |||
| 1470 | Ga0105248_10036829 | |||
| 1471 | Ga0105248_10042745 | |||
| 1472 | Ga0105248_10064342 | |||
| 1473 | Ga0105237_10000163 | |||
| 1474 | Ga0105237_10139725 | |||
| 1475 | Ga0105237_10196891 | |||
| 1476 | Ga0105238_10000710 | |||
| 1477 | Ga0105238_10001915 | |||
| 1478 | Ga0105238_10004919 | |||
| 1479 | Ga0105238_10015258 | |||
| 1480 | Ga0105238_10042251 | |||
| 1481 | Ga0105238_10142273 | |||
| 1482 | Ga0105238_10166809 | |||
| 1483 | Ga0105238_10325243 | |||
| 1484 | Ga0105249_10010647 | |||
| 1485 | Ga0105249_10011728 | |||
| 1486 | Ga0105249_10106798 | |||
| 1487 | Ga0105249_10125511 | |||
| 1488 | Ga0105249_10152117 | |||
| 1489 | Ga0105239_10007680 | |||
| 1490 | Ga0105239_10014324 | |||
| 1491 | Ga0105239_10017583 | |||
| 1492 | Ga0105239_10022558 | |||
| 1493 | Ga0105239_10028637 | |||
| 1494 | Ga0105246_10006614 | |||
| 1495 | Ga0105246_10218498 | |||
| 1496 | Ga0105246_10266065 | |||
| 1497 | Ga0105246_10346656 | |||
| 1498 | Ga0157373_10017490 | |||
| 1499 | Ga0157371_10199480 | |||
| 1500 | Ga0157371_10254448 | |||
| 1501 | Ga0157370_10000139 | |||
| 1502 | Ga0157370_10027580 | |||
| 1503 | Ga0157370_10131507 | |||
| 1504 | Ga0157369_10000079 | |||
| 1505 | Ga0157369_10002833 | |||
| 1506 | Ga0157369_10005321 | |||
| 1507 | Ga0157369_10005381 | |||
| 1508 | Ga0157369_10014871 | |||
| 1509 | Ga0157369_10016614 | |||
| 1510 | Ga0157369_10021389 | |||
| 1511 | Ga0157369_10024091 | |||
| 1512 | Ga0157369_10060830 | |||
| 1513 | Ga0157369_10102224 | |||
| 1514 | Ga0157369_10519835 | |||
| 1515 | Ga0157374_10002079 | |||
| 1516 | Ga0157374_10002768 | |||
| 1517 | Ga0157374_10010430 | |||
| 1518 | Ga0157374_10011582 | |||
| 1519 | Ga0157374_10015604 | |||
| 1520 | Ga0157374_10059851 | |||
| 1521 | Ga0157374_10076509 | |||
| 1522 | Ga0157374_10127327 | |||
| 1523 | Ga0157374_10433572 | |||
| 1524 | Ga0157378_10000019 | |||
| 1525 | Ga0157378_10003965 | |||
| 1526 | Ga0157378_10015715 | |||
| 1527 | Ga0157378_10027554 | |||
| 1528 | Ga0157378_10042866 | |||
| 1529 | Ga0157378_10078813 | |||
| 1530 | Ga0157378_10200127 | |||
| 1531 | Ga0157378_10224682 | |||
| 1532 | Ga0157378_10381486 | |||
| 1533 | Ga0163162_10010125 | |||
| 1534 | Ga0163162_10013020 | |||
| 1535 | Ga0163162_10075653 | |||
| 1536 | Ga0163162_10218628 | |||
| 1537 | Ga0163162_10407171 | |||
| 1538 | Ga0163162_10535788 | |||
| 1539 | Ga0157372_10000101 | |||
| 1540 | Ga0157372_10013100 | |||
| 1541 | Ga0157372_10015595 | |||
| 1542 | Ga0157372_10016255 | |||
| 1543 | Ga0157372_10017037 | |||
| 1544 | Ga0157372_10022915 | |||
| 1545 | Ga0157372_10036318 | |||
| 1546 | Ga0157372_10041549 | |||
| 1547 | Ga0157372_10051907 | |||
| 1548 | Ga0157372_10144086 | |||
| 1549 | Ga0157375_10000560 | |||
| 1550 | Ga0157375_10005673 | |||
| 1551 | Ga0157375_10011769 | |||
| 1552 | Ga0157375_10038820 | |||
| 1553 | Ga0157375_10043115 | |||
| 1554 | Ga0157375_10057446 | |||
| 1555 | Ga0157375_10079346 | |||
| 1556 | Ga0157375_10086066 | |||
| 1557 | Ga0157375_10092613 | |||
| 1558 | Ga0157375_10172709 | |||
| 1559 | Ga0157375_10224438 | |||
| 1560 | Ga0157375_10464062 | |||
| 1561 | Ga0157375_10565792 | |||
| 1562 | Ga0163163_10010210 | |||
| 1563 | Ga0163163_10053291 | |||
| 1564 | Ga0163163_10072035 | |||
| 1565 | Ga0163163_10081964 | |||
| 1566 | Ga0163163_10084728 | |||
| 1567 | Ga0163163_10104549 | |||
| 1568 | Ga0163163_10139706 | |||
| 1569 | Ga0163163_10314985 | |||
| 1570 | Ga0157380_10035473 | |||
| 1571 | Ga0157380_10116764 | |||
| 1572 | Ga0157377_10063295 | |||
| 1573 | Ga0157379_10006136 | |||
| 1574 | Ga0157379_10079767 | |||
| 1575 | Ga0157379_10115265 | |||
| 1576 | Ga0157376_10017159 | |||
| 1577 | Ga0157376_10036766 | |||
| 1578 | Ga0157376_10051476 | |||
| 1579 | Ga0157376_10149393 | |||
| 1580 | Ga0182006_1020509 | |||
| 1581 | Ga0182005_1046605 | |||
| 1582 | Ga0163161_10018993 | |||
| 1583 | Ga0163161_10024906 | |||
| 1584 | Ga0197907_10810373 | |||
| 1585 | Ga0206356_11558599 | |||
| 1586 | Ga0206355_1032423 | |||
| 1587 | Ga0206354_10360414 | |||
| 1588 | Ga0213872_10008858 | |||
| 1589 | Ga0213876_10010940 | |||
| 1590 | Ga0213871_10004892 | |||
| 1591 | Ga0228598_1005083 | |||
| 1592 | Ga0207672_1001192 | |||
| 1593 | Ga0209026_1000158 | |||
| 1594 | Ga0209026_1002284 | |||
| 1595 | Ga0209759_1011628 | |||
| 1596 | Ga0209455_1000218 | |||
| 1597 | Ga0207697_10001233 | |||
| 1598 | Ga0207697_10004903 | |||
| 1599 | Ga0207697_10005583 | |||
| 1600 | Ga0207697_10010998 | |||
| 1601 | Ga0207656_10014248 | |||
| 1602 | Ga0207656_10036147 | |||
| 1603 | Ga0207653_10000070 | |||
| 1604 | Ga0207692_10017016 | |||
| 1605 | Ga0207710_10000003 | |||
| 1606 | Ga0207710_10003349 | |||
| 1607 | Ga0207710_10089493 | |||
| 1608 | Ga0207680_10000062 | |||
| 1609 | Ga0207680_10001509 | |||
| 1610 | Ga0207647_10006978 | |||
| 1611 | Ga0207647_10039344 | |||
| 1612 | Ga0207647_10040783 | |||
| 1613 | Ga0207685_10008205 | |||
| 1614 | Ga0207685_10021792 | |||
| 1615 | Ga0207685_10031441 | |||
| 1616 | Ga0207699_10000023 | |||
| 1617 | Ga0207699_10023506 | |||
| 1618 | Ga0207699_10052630 | |||
| 1619 | Ga0207699_10086410 | |||
| 1620 | Ga0207699_10186581 | |||
| 1621 | Ga0207699_10257162 | |||
| 1622 | Ga0207645_10001695 | |||
| 1623 | Ga0207645_10078565 | |||
| 1624 | Ga0207643_10019602 | |||
| 1625 | Ga0207705_10006079 | |||
| 1626 | Ga0207705_10018618 | |||
| 1627 | Ga0207705_10043759 | |||
| 1628 | Ga0207705_10096983 | |||
| 1629 | Ga0207705_10102189 | |||
| 1630 | Ga0207684_10000102 | |||
| 1631 | Ga0207684_10000186 | |||
| 1632 | Ga0207684_10001595 | |||
| 1633 | Ga0207684_10199384 | |||
| 1634 | Ga0207684_10332854 | |||
| 1635 | Ga0207654_10000731 | |||
| 1636 | Ga0207654_10031820 | |||
| 1637 | Ga0207654_10097857 | |||
| 1638 | Ga0207707_10037611 | |||
| 1639 | Ga0207695_10000025 | |||
| 1640 | Ga0207695_10000028 | |||
| 1641 | Ga0207695_10000637 | |||
| 1642 | Ga0207695_10002224 | |||
| 1643 | Ga0207695_10004845 | |||
| 1644 | Ga0207695_10017985 | |||
| 1645 | Ga0207695_10045150 | |||
| 1646 | Ga0207695_10061340 | |||
| 1647 | Ga0207695_10072590 | |||
| 1648 | Ga0207695_10183972 | |||
| 1649 | Ga0207671_10000582 | |||
| 1650 | Ga0207671_10000935 | |||
| 1651 | Ga0207671_10006120 | |||
| 1652 | Ga0207693_10000262 | |||
| 1653 | Ga0207693_10000734 | |||
| 1654 | Ga0207693_10003119 | |||
| 1655 | Ga0207693_10027230 | |||
| 1656 | Ga0207693_10054645 | |||
| 1657 | Ga0207693_10073547 | |||
| 1658 | Ga0207663_10000553 | |||
| 1659 | Ga0207663_10043276 | |||
| 1660 | Ga0207663_10087055 | |||
| 1661 | Ga0207657_10023837 | |||
| 1662 | Ga0207649_10031041 | |||
| 1663 | Ga0207649_10188954 | |||
| 1664 | Ga0207649_10344200 | |||
| 1665 | Ga0207652_10237450 | |||
| 1666 | Ga0207652_10309757 | |||
| 1667 | Ga0207646_10187635 | |||
| 1668 | Ga0207681_10000004 | |||
| 1669 | Ga0207681_10020058 | |||
| 1670 | Ga0207694_10000249 | |||
| 1671 | Ga0207694_10001221 | |||
| 1672 | Ga0207694_10003221 | |||
| 1673 | Ga0207694_10022238 | |||
| 1674 | Ga0207694_10029722 | |||
| 1675 | Ga0207694_10329467 | |||
| 1676 | Ga0207650_10000570 | |||
| 1677 | Ga0207650_10026870 | |||
| 1678 | Ga0207650_10145993 | |||
| 1679 | Ga0207650_10191481 | |||
| 1680 | Ga0207650_10263471 | |||
| 1681 | Ga0207650_10269628 | |||
| 1682 | Ga0207659_10140489 | |||
| 1683 | Ga0207687_10006671 | |||
| 1684 | Ga0207687_10013607 | |||
| 1685 | Ga0207687_10063563 | |||
| 1686 | Ga0207700_10003181 | |||
| 1687 | Ga0207700_10005575 | |||
| 1688 | Ga0207700_10010940 | |||
| 1689 | Ga0207700_10071596 | |||
| 1690 | Ga0207700_10105364 | |||
| 1691 | Ga0207700_10161288 | |||
| 1692 | Ga0207664_10091429 | |||
| 1693 | Ga0207664_10136065 | |||
| 1694 | Ga0207664_10194032 | |||
| 1695 | Ga0207644_10000031 | |||
| 1696 | Ga0207644_10122052 | |||
| 1697 | Ga0207644_10199048 | |||
| 1698 | Ga0207706_10021238 | |||
| 1699 | Ga0207706_10022300 | |||
| 1700 | Ga0207706_10243359 | |||
| 1701 | Ga0207686_10000777 | |||
| 1702 | Ga0207686_10174065 | |||
| 1703 | Ga0207670_10077436 | |||
| 1704 | Ga0207669_10001072 | |||
| 1705 | Ga0207704_10307034 | |||
| 1706 | Ga0207665_10006615 | |||
| 1707 | Ga0207665_10053885 | |||
| 1708 | Ga0207665_10066925 | |||
| 1709 | Ga0207691_10004834 | |||
| 1710 | Ga0207691_10011167 | |||
| 1711 | Ga0207691_10014258 | |||
| 1712 | Ga0207691_10019641 | |||
| 1713 | Ga0207691_10071999 | |||
| 1714 | Ga0207691_10091098 | |||
| 1715 | Ga0207711_10000012 | |||
| 1716 | Ga0207711_10001298 | |||
| 1717 | Ga0207711_10014531 | |||
| 1718 | Ga0207711_10019311 | |||
| 1719 | Ga0207711_10032837 | |||
| 1720 | Ga0207711_10308784 | |||
| 1721 | Ga0207689_10027664 | |||
| 1722 | Ga0207661_10000012 | |||
| 1723 | Ga0207661_10011022 | |||
| 1724 | Ga0207661_10015140 | |||
| 1725 | Ga0207661_10030159 | |||
| 1726 | Ga0207661_10237215 | |||
| 1727 | Ga0207667_10001916 | |||
| 1728 | Ga0207667_10002211 | |||
| 1729 | Ga0207667_10004385 | |||
| 1730 | Ga0207667_10032351 | |||
| 1731 | Ga0207667_10300354 | |||
| 1732 | Ga0207667_10530194 | |||
| 1733 | Ga0207651_10000243 | |||
| 1734 | Ga0207712_10000665 | |||
| 1735 | Ga0207712_10008830 | |||
| 1736 | Ga0207712_10116035 | |||
| 1737 | Ga0207668_10113241 | |||
| 1738 | Ga0207658_10021940 | |||
| 1739 | Ga0207658_10273239 | |||
| 1740 | Ga0207677_10131626 | |||
| 1741 | Ga0207677_10199277 | |||
| 1742 | Ga0207703_10000109 | |||
| 1743 | Ga0207703_10001882 | |||
| 1744 | Ga0207703_10015204 | |||
| 1745 | Ga0207703_10189299 | |||
| 1746 | Ga0207639_10000127 | |||
| 1747 | Ga0207639_10001341 | |||
| 1748 | Ga0207678_10007664 | |||
| 1749 | Ga0207678_10093204 | |||
| 1750 | Ga0207702_10000809 | |||
| 1751 | Ga0207702_10001049 | |||
| 1752 | Ga0207702_10008988 | |||
| 1753 | Ga0207702_10056864 | |||
| 1754 | Ga0207702_10076091 | |||
| 1755 | Ga0207702_10296989 | |||
| 1756 | Ga0207641_10015238 | |||
| 1757 | Ga0207641_10115442 | |||
| 1758 | Ga0207641_10148957 | |||
| 1759 | Ga0207641_10192700 | |||
| 1760 | Ga0207676_10001214 | |||
| 1761 | Ga0207676_10065857 | |||
| 1762 | Ga0207676_10163011 | |||
| 1763 | Ga0207676_10351490 | |||
| 1764 | Ga0207676_10372142 | |||
| 1765 | Ga0207674_10000675 | |||
| 1766 | Ga0207674_10001753 | |||
| 1767 | Ga0207674_10232453 | |||
| 1768 | Ga0207675_100002039 | |||
| 1769 | Ga0207675_100133918 | |||
| 1770 | Ga0207683_10008786 | |||
| 1771 | Ga0207683_10009704 | |||
| 1772 | Ga0207683_10020934 | |||
| 1773 | Ga0207683_10155051 | |||
| 1774 | Ga0207683_10183725 | |||
| 1775 | Ga0207683_10334699 | |||
| 1776 | Ga0207698_10000623 | |||
| 1777 | Ga0207698_10000895 | |||
| 1778 | Ga0207698_10014938 | |||
| 1779 | Ga0207698_10118541 | |||
| 1780 | Ga0209967_1001744 | |||
| 1781 | Ga0210000_1000015 | |||
| 1782 | Ga0209968_1002263 | |||
| 1783 | Ga0209999_1000452 | |||
| 1784 | Ga0209970_1006825 | |||
| 1785 | Ga0209966_1002410 | |||
| 1786 | Ga0209966_1018816 | |||
| 1787 | Ga0207428_10012376 | |||
| 1788 | Ga0265354_1000204 | |||
| 1789 | Ga0265354_1004108 | |||
| 1790 | Ga0268266_10034222 | |||
| 1791 | Ga0268266_10059930 | |||
| 1792 | Ga0268266_10062500 | |||
| 1793 | Ga0268266_10304023 | |||
| 1794 | Ga0268266_10340734 | |||
| 1795 | Ga0268265_10000046 | |||
| 1796 | Ga0268264_10000879 | |||
| 1797 | Ga0268264_10004546 | |||
| 1798 | Ga0268264_10015871 | |||
| 1799 | Ga0268264_10044443 | |||
| 1800 | Ga0268264_10052522 | |||
| 1801 | Ga0268264_10318016 | |||
| 1802 | Ga0268264_10400795 | |||
| 1803 | Ga0265326_10000443 | |||
| 1804 | Ga0265334_10046880 | |||
| 1805 | Ga0265318_10014358 | |||
| 1806 | Ga0265323_10002666 | |||
| 1807 | Ga0265323_10026857 | |||
| 1808 | Ga0265336_10002094 | |||
| 1809 | Ga0265338_10002061 | |||
| 1810 | Ga0265338_10018503 | |||
| 1811 | Ga0265338_10022912 | |||
| 1812 | Ga0265338_10024815 | |||
| 1813 | Ga0265338_10037490 | |||
| 1814 | Ga0265338_10052369 | |||
| 1815 | Ga0265338_10156561 | |||
| 1816 | Ga0265338_10235210 | |||
| 1817 | Ga0265770_1001690 | |||
| 1818 | Ga0265760_10002054 | |||
| 1819 | Ga0265760_10002624 | |||
| 1820 | Ga0265760_10012599 | |||
| 1821 | Ga0265330_10000183 | |||
| 1822 | Ga0265320_10002070 | |||
| 1823 | Ga0265320_10005985 | |||
| 1824 | Ga0265325_10001847 | |||
| 1825 | Ga0265325_10007361 | |||
| 1826 | Ga0265325_10079272 | |||
| 1827 | Ga0265329_10010196 | |||
| 1828 | Ga0265340_10008168 | |||
| 1829 | Ga0265339_10000017 | |||
| 1830 | Ga0265339_10000196 | |||
| 1831 | Ga0265331_10000851 | |||
| 1832 | Ga0265331_10004840 | |||
| 1833 | Ga0265331_10013839 | |||
| 1834 | Ga0265327_10000307 | |||
| 1835 | Ga0265327_10012262 | |||
| 1836 | Ga0265327_10024684 | |||
| 1837 | Ga0265316_10000604 | |||
| 1838 | Ga0265316_10005921 | |||
| 1839 | Ga0265316_10010560 | |||
| 1840 | Ga0265316_10010808 | |||
| 1841 | Ga0265316_10025120 | |||
| 1842 | Ga0265316_10031939 | |||
| 1843 | Ga0265316_10032762 | |||
| 1844 | Ga0265316_10039642 | |||
| 1845 | Ga0265316_10051179 | |||
| 1846 | Ga0265316_10110789 | |||
| 1847 | Ga0307408_100000053 | |||
| 1848 | Ga0307408_100009298 | |||
| 1849 | Ga0307408_100016884 | |||
| 1850 | Ga0307408_100048127 | |||
| 1851 | Ga0307408_100174886 | |||
| 1852 | Ga0307408_100399411 | |||
| 1853 | Ga0265313_10000823 | |||
| 1854 | Ga0307508_10003602 | |||
| 1855 | Ga0265314_10000764 | |||
| 1856 | Ga0265314_10001769 | |||
| 1857 | Ga0265314_10002441 | |||
| 1858 | Ga0265314_10007673 | |||
| 1859 | Ga0265314_10012428 | |||
| 1860 | Ga0265314_10037430 | |||
| 1861 | Ga0265314_10120439 | |||
| 1862 | Ga0265314_10143389 | |||
| 1863 | Ga0265314_10164819 | |||
| 1864 | Ga0265342_10002491 | |||
| 1865 | Ga0265342_10004192 | |||
| 1866 | Ga0316578_10198269 | |||
| 1867 | Ga0307516_10001545 | |||
| 1868 | Ga0307516_10003925 | |||
| 1869 | Ga0307516_10172953 | |||
| 1870 | Ga0307405_10053208 | |||
| 1871 | Ga0307405_10216007 | |||
| 1872 | Ga0307413_10030509 | |||
| 1873 | Ga0307413_10095086 | |||
| 1874 | Ga0307410_10000005 | |||
| 1875 | Ga0307410_10007730 | |||
| 1876 | Ga0307410_10156523 | |||
| 1877 | Ga0307410_10242807 | |||
| 1878 | Ga0307406_10007849 | |||
| 1879 | Ga0307406_10036789 | |||
| 1880 | Ga0307407_10051016 | |||
| 1881 | Ga0307412_10002920 | |||
| 1882 | Ga0307412_10012973 | |||
| 1883 | Ga0307412_10128596 | |||
| 1884 | Ga0307412_10351826 | |||
| 1885 | Ga0307409_100000679 | |||
| 1886 | Ga0307409_100231683 | |||
| 1887 | Ga0307416_100000056 | |||
| 1888 | Ga0307416_100020411 | |||
| 1889 | Ga0307416_100082732 | |||
| 1890 | Ga0307416_100429524 | |||
| 1891 | Ga0307414_10043448 | |||
| 1892 | Ga0307414_10082959 | |||
| 1893 | Ga0307411_10003475 | |||
| 1894 | Ga0307411_10008180 | |||
| 1895 | Ga0307411_10038223 | |||
| 1896 | Ga0307411_10056154 | |||
| 1897 | Ga0307411_10233625 | |||
| 1898 | Ga0307415_100052612 | |||
| 1899 | Ga0307415_100076281 | |||
| 1900 | Ga0307415_100330169 | |||
| 1901 | Ga0307415_100370387 | |||
| 1902 | Ga0373928_0031329 | |||
| 1903 | Ga0373923_0015310 | |||
| 1904 | Ga0373932_0012612 | |||
| 1905 | Ga0373945_0075272 | |||
| 1906 | Ga0373957_0082634 | |||
| 1907 | Ga0373943_0017367 | |||
| 1908 | Ga0373955_0133206 | |||
| 1909 | Ga0373962_0042950 | |||
| 1910 | Ga0316574_0138456 | |||
| 1911 | Ga0373924_0008676 | |||
| 1912 | Ga0373924_0026442 | |||
| 1913 | Ga0373924_0074172 | |||
| 1914 | Ga0373931_0076358 | |||
| 1915 | Ga0373931_0245680 | |||
| 1916 | Ga0373935_0007970 | |||
| 1917 | Ga0373927_0005280 | |||
| 1918 | Ga0373933_0027979 | |||
| 1919 | Ga0373933_0071033 | |||
| 1920 | Ga0373933_0173295 | |||
| 1921 | Ga0373947_0066748 | |||
| 1922 | Ga0373947_0308310 | |||
| 1923 | Ga0373937_0009165 | |||
| 1924 | Ga0373937_0012705 | |||
| 1925 | Ga0373937_0063112 | |||
| 1926 | Ga0373937_0077803 | |||
| 1927 | Ga0373937_0096296 | |||
| 1928 | Ga0373937_0166831 | |||
| 1929 | Ga0373937_0172235 | |||
| 1930 | Ga0373937_0245783 | |||
| 1931 | Ga0373937_0291104 | |||
| 1932 | Ga0316584_0267585 | |||
| 1933 | Ga0373925_0074345 | |||
| 1934 | Ga0373925_0077143 | |||
| 1935 | Ga0373925_0139972 | |||
| 1936 | Ga0373925_0261054 | |||
| 1937 | Ga0395900_0001170 | |||
| 1938 | Ga0395900_0027557 | |||
| 1939 | Ga0395900_0295414 | |||
| 1940 | Ga0395905_0122619 | |||
| 1941 | Ga0395905_0166676 | |||
| 1942 | Ga0395905_0180443 | |||
| 1943 | Ga0395905_0201940 | |||
| 1944 | Ga0395905_0248344 | |||
| 1945 | Ga0395901_0025312 | |||
| 1946 | Ga0395901_0046407 | |||
| 1947 | Ga0242422_00187 | |||
| 1948 | Ga0242420_018863 | |||
| 1949 | Ga0436365_0668515 | |||
| 1950 | Ga0436365_1018976 | |||
| 1951 | Ga0436365_1444529 | |||
| 1952 | Ga0436360_0129730 | |||
| 1953 | Ga0436361_0010635 | |||
| 1954 | Ga0436361_0830524 | |||
| 1955 | Ga0439447_024633 | |||
| 1956 | Ga0439466_0037507 | |||
| 1957 | Ga0439433_0002025 | |||
| 1958 | Ga0439432_010096 | |||
| 1959 | Ga0439452_001783 | |||
| 1960 | Ga0439462_0001865 | |||
| 1961 | Ga0450907_006360 | |||
| 1962 | Ga0439458_0002185 | |||
| 1963 | Ga0450909_011881 | |||
| 1964 | Ga0439434_0016973 | |||
| 1965 | Ga0451577_0000167 | |||
| 1966 | Ga0451577_0000454 | |||
| 1967 | Ga0451577_0004538 | |||
| 1968 | Ga0451577_0005264 | |||
| 1969 | Ga0451577_0006551 | |||
| 1970 | Ga0451577_0014214 | |||
| 1971 | Ga0451577_0044677 | |||
| 1972 | Ga0451577_0351602 | |||
| 1973 | Ga0453683_0000124 | |||
| 1974 | Ga0453683_0000469 | |||
| 1975 | Ga0453683_0002089 | |||
| 1976 | Ga0453683_0016263 | |||
| 1977 | Ga0453683_0062097 | |||
| 1978 | Ga0453683_0103472 | |||
| 1979 | Ga0453683_0142632 | |||
| 1980 | Ga0466966_0149652 | |||
| 1981 | Ga0466961_0107870 | |||
| 1982 | Ga0466961_0221722 | |||
| 1983 | Ga0453684_0000422 | |||
| 1984 | Ga0453684_0000446 | |||
| 1985 | Ga0453684_0003944 | |||
| 1986 | Ga0453684_0004475 | |||
| 1987 | Ga0453684_0012103 | |||
| 1988 | Ga0453684_0014205 | |||
| 1989 | Ga0453684_0115326 | |||
| 1990 | Ga0453684_0153468 | |||
| 1991 | Ga0453684_0305648 | |||
| 1992 | Ga0453684_0307194 | |||
| 1993 | Ga0453684_0351808 | |||
| 1994 | Ga0466957_0169195 | |||
| 1995 | Ga0466960_0000063 | |||
| 1996 | Ga0451576_0000797 | |||
| 1997 | Ga0451576_0001109 | |||
| 1998 | Ga0451576_0032792 | |||
| 1999 | Ga0451576_0219815 | |||
| 2000 | Ga0451576_0252861 | |||
| 2001 | Ga0451576_0296546 | |||
| 2002 | Ga0451576_0325591 | |||
| 2003 | Ga0451576_0471373 | |||
| 2004 | Ga0466967_0007112 | |||
| 2005 | Ga0466967_0007615 | |||
| 2006 | Ga0495627_031181 | |||
| 2007 | Ga0495592_0019990 | |||
| 2008 | Ga0495592_0129088 | |||
| 2009 | Ga0495629_0029824 | |||
| 2010 | Ga0495629_0041944 | |||
| 2011 | Ga0495629_0047201 | |||
| 2012 | Ga0495651_0198073 | |||
| 2013 | Ga0495653_0006291 | |||
| 2014 | Ga0495653_0214736 | |||
| 2015 | Ga0495650_0000063 | |||
| 2016 | Ga0495580_0001579 | |||
| 2017 | Ga0495580_0022435 | |||
| 2018 | Ga0495580_0023443 | |||
| 2019 | Ga0495580_0025082 | |||
| 2020 | Ga0495580_0160284 | |||
| 2021 | Ga0495580_0306088 | |||
| 2022 | Ga0495582_0059366 | |||
| 2023 | Ga0495639_0084715 | |||
| 2024 | Ga0495639_0163838 | |||
| 2025 | Ga0495594_0005796 | |||
| 2026 | Ga0495594_0036758 | |||
| 2027 | Ga0495606_0001183 | |||
| 2028 | Ga0495608_0001348 | |||
| 2029 | Ga0495608_0025061 | |||
| 2030 | Ga0495616_0000122 | |||
| 2031 | Ga0495616_0000187 | |||
| 2032 | Ga0495616_0000276 | |||
| 2033 | Ga0495618_0005223 | |||
| 2034 | Ga0495628_0001615 | |||
| 2035 | Ga0495628_0273272 | |||
| 2036 | Ga0495630_0023311 | |||
| 2037 | Ga0495630_0160597 | |||
| 2038 | Ga0495630_0211324 | |||
| 2039 | Ga0495643_0000580 | |||
| 2040 | Ga0495663_0057726 | |||
| 2041 | Ga0495652_0000812 | |||
| 2042 | Ga0495654_0002529 | |||
| 2043 | Ga0495654_0011725 | |||
| 2044 | Ga0495640_0047091 | |||
| 2045 | Ga0495640_0140340 | |||
| 2046 | Ga0495586_0105991 | |||
| 2047 | Ga0495587_0012571 | |||
| 2048 | Ga0495633_0018036 | |||
| 2049 | Ga0495667_0000215 | |||
| 2050 | Ga0495667_0019050 | |||
| 2051 | Ga0495668_0003199 | |||
| 2052 | Ga0495668_0006493 | |||
| 2053 | Ga0495668_0009039 | |||
| 2054 | Ga0495668_0049342 | |||
| 2055 | Ga0495661_0031172 | |||
| 2056 | Ga0495657_0002973 | |||
| 2057 | Ga0495669_0057829 | |||
| 2058 | Ga0495613_0010066 | |||
| 2059 | Ga0495613_0088784 | |||
| 2060 | Ga0495613_0246447 | |||
| 2061 | Ga0495671_0121334 | |||
| 2062 | Ga0495589_0014533 | |||
| 2063 | Ga0495600_0154817 | |||
| 2064 | Ga0495581_0038863 | |||
| 2065 | Ga0495581_0041258 | |||
| 2066 | Ga0495604_0047480 | |||
| 2067 | Ga0495674_0000271 | |||
| 2068 | Ga0495674_0009483 | |||
| 2069 | Ga0495674_0204759 | |||
| 2070 | Ga0495680_0002950 | |||
| 2071 | Ga0495687_015990 | |||
| 2072 | Ga0495675_0000354 | |||
| 2073 | Ga0495684_0020764 | |||
| 2074 | Ga0495684_0066876 | |||
| 2075 | Ga0495684_0138283 | |||
| 2076 | Ga0495686_0007438 | |||
| 2077 | Ga0495686_0114900 | |||
| 2078 | Ga0495602_0073722 | |||
| 2079 | Ga0495602_0078102 | |||
| 2080 | Ga0496101_0131704 | |||
| 2081 | Ga0496102_0161837 | |||
| 2082 | Ga0496102_0223448 | |||
| 2083 | Ga0496103_0350144 | |||
| 2084 | Ga0496104_0042519 | |||
| 2085 | Ga0496104_0138453 | |||
| 2086 | Ga0496104_0199700 | |||
| 2087 | Ga0496104_0244288 | |||
| 2088 | Ga0496104_0400636 | |||
| 2089 | Ga0496105_0046426 | |||
| 2090 | Ga0496105_0051326 | |||
| 2091 | Ga0496105_0470871 | |||
| 2092 | Ga0496106_0018866 | |||
| 2093 | Ga0496106_0086588 | |||
| 2094 | Ga0496107_0022249 | |||
| 2095 | Ga0496108_0012657 | |||
| 2096 | Ga0496108_0027061 | |||
| 2097 | Ga0496108_0033172 | |||
| 2098 | Ga0496109_0025140 | |||
| 2099 | Ga0496109_0098718 | |||
| 2100 | Ga0496109_0111063 | |||
| 2101 | Ga0496109_0145251 | |||
| 2102 | Ga0496109_0221632 | |||
| 2103 | Ga0496110_0028922 | |||
| 2104 | Ga0496110_0149699 | |||
| 2105 | Ga0496110_0314615 | |||
| 2106 | Ga0496111_0020070 | |||
| 2107 | Ga0496112_0024604 | |||
| 2108 | Ga0496112_0156984 | |||
| 2109 | Ga0496112_0171241 | |||
| 2110 | Ga0496113_0204001 | |||
| 2111 | Ga0496114_0004338 | |||
| 2112 | Ga0496114_0033149 | |||
| 2113 | Ga0496114_0168010 | |||
| 2114 | Ga0496114_0413390 | |||
| 2115 | Ga0496115_0009048 | |||
| 2116 | Ga0496115_0013321 | |||
| 2117 | Ga0496115_0111770 | |||
| 2118 | Ga0496121_0005276 | |||
| 2119 | Ga0496121_0219989 | |||
| 2120 | Ga0496126_0003087 | |||
| 2121 | Ga0496126_0008507 | |||
| 2122 | Ga0501298_004427 | |||
| 2123 | Ga0501302_001857 | |||
| 2124 | Ga0501031_0046440 | |||
| 2125 | Ga0501031_0059850 | |||
| 2126 | Ga0501032_0023547 | |||
| 2127 | Ga0501032_0089706 | |||
| 2128 | Ga0501033_0000337 | |||
| 2129 | Ga0501033_0021848 | |||
| 2130 | Ga0501033_0122724 | |||
| 2131 | Ga0501034_0000461 | |||
| 2132 | Ga0501034_0002385 | |||
| 2133 | Ga0501034_0003139 | |||
| 2134 | Ga0501034_0033843 | |||
| 2135 | Ga0501034_0052307 | |||
| 2136 | Ga0501034_0068458 | |||
| 2137 | Ga0501034_0081922 | |||
| 2138 | Ga0501034_0127755 | |||
| 2139 | Ga0501034_0190370 | |||
| 2140 | Ga0501036_0004555 | |||
| 2141 | Ga0501036_0016233 | |||
| 2142 | Ga0501036_0105217 | |||
| 2143 | Ga0501037_0004663 | |||
| 2144 | Ga0501037_0114904 | |||
| 2145 | Ga0501038_0001263 | |||
| 2146 | Ga0501038_0011870 | |||
| 2147 | Ga0501038_0045157 | |||
| 2148 | Ga0501038_0113357 | |||
| 2149 | Ga0501039_0019759 | |||
| 2150 | Ga0501039_0040703 | |||
| 2151 | Ga0501039_0047509 | |||
| 2152 | Ga0501039_0080632 | |||
| 2153 | Ga0501040_0013105 | |||
| 2154 | Ga0501040_0181950 | |||
| 2155 | Ga0501042_0030276 | |||
| 2156 | Ga0501042_0078975 | |||
| 2157 | Ga0501043_0002565 | |||
| 2158 | Ga0501043_0060761 | |||
| 2159 | Ga0501043_0164315 | |||
| 2160 | Ga0501046_0000025 | |||
| 2161 | Ga0501046_0023621 | |||
| 2162 | Ga0501046_0066279 | |||
| 2163 | Ga0501046_0267621 | |||
| 2164 | Ga0501047_0003053 | |||
| 2165 | Ga0501047_0033929 | |||
| 2166 | Ga0501047_0218951 | |||
| 2167 | Ga0501048_0009926 | |||
| 2168 | Ga0501048_0017442 | |||
| 2169 | Ga0501048_0050764 | |||
| 2170 | Ga0501048_0129289 | |||
| 2171 | Ga0501048_0139564 | |||
| 2172 | Ga0501067_0146380 | |||
| 2173 | Ga0501068_0030423 | |||
| 2174 | Ga0501071_0019378 | |||
| 2175 | Ga0501072_0014538 | |||
| 2176 | Ga0501072_0275405 | |||
| 2177 | Ga0501074_0030377 | |||
| 2178 | Ga0501074_0112712 | |||
| 2179 | Ga0501076_0005919 | |||
| 2180 | Ga0501076_0106010 | |||
| 2181 | Ga0501077_0012622 | |||
| 2182 | Ga0501077_0014673 | |||
| 2183 | Ga0501077_0039740 | |||
| 2184 | Ga0501216_013491 | |||
| 2185 | Ga0501223_000438 | |||
| 2186 | Ga0501235_000818 | |||
| 2187 | Ga0501243_006117 | |||
| 2188 | Ga0501234_001339 | |||
| 2189 | Ga0501079_0005151 | |||
| 2190 | Ga0501079_0094908 | |||
| 2191 | Ga0501079_0181110 | |||
| 2192 | Ga0501080_0065836 | |||
| 2193 | Ga0501080_0067070 | |||
| 2194 | Ga0501080_0286382 | |||
| 2195 | Ga0501081_0072109 | |||
| 2196 | Ga0501081_0261646 | |||
| 2197 | Ga0501083_0001588 | |||
| 2198 | Ga0501268_009087 | |||
| 2199 | Ga0501270_002867 | |||
| 2200 | Ga0501283_000160 | |||
| 2201 | Ga0501035_0023351 | |||
| 2202 | Ga0501035_0075534 | |||
| 2203 | Ga0501035_0107548 | |||
| 2204 | Ga0501035_0148234 | |||
| 2205 | Ga0501035_0178965 | |||
| 2206 | Ga0501044_0014492 | |||
| 2207 | Ga0501044_0022075 | |||
| 2208 | Ga0501044_0029323 | |||
| 2209 | Ga0501044_0092341 | |||
| 2210 | Ga0501044_0104996 | |||
| 2211 | Ga0501044_0118090 | |||
| 2212 | Ga0501045_0008713 | |||
| 2213 | Ga0501045_0021923 | |||
| 2214 | Ga0501045_0101826 | |||
| 2215 | nmdc:mga07m45_156482_c1 | |||
| 2216 | nmdc:mga05p37_227256_c1 | |||
| 2217 | nmdc:mga05p37_390218_c1 | |||
| 2218 | nmdc:mga05p37_41169_c1 | |||
| 2219 | nmdc:mga09592_17734_c1 | |||
| 2220 | nmdc:mga09592_94627_c1 | |||
| 2221 | nmdc:mga0qj67_29345_c1 | |||
| 2222 | nmdc:mga0qj67_587_c1 | |||
| 2223 | nmdc:mga06r32_172951_c1 | |||
| 2224 | nmdc:mga06r32_184181_c1 | |||
| 2225 | nmdc:mga06r32_352112_c1 | |||
| 2226 | nmdc:mga08y16_15671_c1 | |||
| 2227 | nmdc:mga08y16_173702_c1 | |||
| 2228 | nmdc:mga08y16_22520_c1 | |||
| 2229 | nmdc:mga0n895_174777_c1 | |||
| 2230 | nmdc:mga0n895_201428_c1 | |||
| 2231 | nmdc:mga0n895_3811_c1 | |||
| 2232 | nmdc:mga08x19_117339_c1 | |||
| 2233 | Ga0495601_0016863 | |||
| 2234 | Ga0495601_0058748 | |||
| 2235 | Ga0495619_0077357 | |||
| 2236 | Ga0495619_0215219 | |||
| 2237 | Ga0495619_0254586 | |||
| 2238 | Ga0500592_000310 | |||
| 2239 | Ga0500592_000519 | |||
| 2240 | Ga0500592_001386 | |||
| 2241 | Ga0500595_019267 | |||
| 2242 | Ga0500607_013278 | |||
| 2243 | Ga0500568_0018534 | |||
| 2244 | Ga0500577_0061201 | |||
| 2245 | Ga0500604_0003278 | |||
| 2246 | Ga0500604_0012031 | |||
| 2247 | Ga0500604_0018702 | |||
| 2248 | Ga0500616_0002767 | |||
| 2249 | Ga0500616_0007137 | |||
| 2250 | Ga0500627_0000218 | |||
| 2251 | Ga0500627_0002835 | |||
| 2252 | Ga0500627_0021298 | |||
| 2253 | Ga0500634_0005118 | |||
| 2254 | Ga0500636_0006862 | |||
| 2255 | Ga0500637_0002948 | |||
| 2256 | Ga0500645_013160 | |||
| 2257 | Ga0501084_0010348 | |||
| 2258 | Ga0501084_0024645 | |||
| 2259 | Ga0590075_003486 | |||
| 2260 | Ga0590075_010969 | |||
| 2261 | Ga0590075_021996 | |||
| 2262 | Ga0590077_005594 | |||
| 2263 | Ga0587084_008686 | |||
| 2264 | Ga0587070_010926 | |||
| 2265 | Ga0587073_0018703 | |||
| 2266 | Ga0587073_0030133 | |||
| 2267 | Ga0587082_012301 | |||
| 2268 | Ga0587092_010396 | |||
| 2269 | Ga0587072_015782 | |||
| 2270 | Ga0587076_013696 | |||
| 2271 | Ga0587110_003725 | |||
| 2272 | Ga0501082_0006861 | |||
| 2273 | Ga0501082_0066443 | |||
| 2274 | Ga0530510_0009751 | |||
| 2275 | Ga0530510_0015195 | |||
| 2276 | Ga0530510_0023280 | |||
| 2277 | 2748019729 | |||
| 2278 | 2919522732 | |||
| 2279 | 2945944968 | |||
| 2280 | 8022951137 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z0c-assembly1.cif.gz_A-2 | nerol dehydrogenase from persicaria minor | 0.9765 | 11 | 357 |
| 1uuf-assembly1.cif.gz_A-2 | crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk | 0.972 | 17 | 360 |
| 1yqx-assembly1.cif.gz_B | sinapyl alcohol dehydrogenase at 2.5 angstrom resolution | 0.9717 | 15 | 357 |
| 5fi5-assembly1.cif.gz_B | heteroyohimbine synthase thas1 from catharanthus roseus - apo form | 0.9675 | 15 | 358 |
| 7cgu-assembly1.cif.gz_A | crystal structure of abhar | 0.9652 | 11 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQC5_159_311_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9892 | 174 | 325 | 3.40.50.720 |
| af_P9WQC5_8_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.982 | 21 | 264 | 3.40.50.720 |
| af_C6TB56_4_167_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9805 | 15 | 176 | 3.90.180.10 |
| af_A0A0R0FW40_1_100_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9777 | 77 | 176 | 3.90.180.10 |
| af_A0A0R0ITF2_16_127_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9777 | 20 | 129 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A835E2P8-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9963 | 252 | 356 |
GO:0016616
|
| AF-A0A068TXD9-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9945 | 246 | 358 |
GO:0016616
|
| AF-A0A0Y0IGH8-F1-model_v4 | deleted | 0.9939 | 184 | 333 |
|
| AF-A0A3A8H498-F1-model_v4 | NAD(P)-dependent alcohol dehydrogenase | 0.9935 | 199 | 360 |
GO:0016616
|
| AF-A0A7S0L745-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9924 | 247 | 344 |
GO:0016616
|