F490702

General Info

Members Datasets Scaffolds Average Seq Length
1140 380 2280 227

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10473503|Ga0268266_104735031
Length 231
Sequence MAQQLLMPKATAIWLVDNTALSFDQIAQFCKLHPLEVKAIADGEAAQGIKGLDPIATGQLSRDEIARAEGNPNYKLKLSEPKVRVPESKRRGPRYTPVSKRQDKPDGIAWIIRNHPEVSDGQISKLIGTTRTTIAAIRDRTHWNIANIVPKDPVTLGLCSQRELDAVVAKAAKAAGIEAQTDTRLEGDREALIEQLRAERDAAARGADATLADEEAALFGNSSGFQDPFKR

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
225 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
233 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
234 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
235 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
236 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
270 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
316 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
320 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
321 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
322 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
323 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
324 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
325 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
326 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
327 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
328 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
329 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
330 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
333 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
334 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
335 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
336 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
341 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
342 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
346 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
347 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
350 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
356 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
357 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
363 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
367 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
368 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
369 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
370 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
371 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
372 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
373 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
374 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
375 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
376 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
377 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
378 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
379 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
380 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.35
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 4.74
Rhizosphere 82.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10473503 3300028379 Bacteria 1193
2 JGI24736J21556_1000030 3300001904 Bacteria 24315
3 JGI24741J21665_1001317 3300001915 Bacteria 7262
4 JGI24741J21665_1004089 3300001915 Bacteria 3310
5 JGI24752J21851_1004310 3300001976 Bacteria 1866
6 JGI24740J21852_10003058 3300001979 Bacteria 7400
7 JGI24740J21852_10030569 3300001979 Bacteria 1750
8 JGI24739J22299_10001692 3300001989 Bacteria 8378
9 JGI24739J22299_10006535 3300001989 Bacteria 4392
10 JGI24739J22299_10047732 3300001989 Bacteria 1395
11 JGI24737J22298_10002390 3300001990 Bacteria 6695
12 JGI24737J22298_10005137 3300001990 Bacteria 4532
13 JGI24737J22298_10039840 3300001990 Bacteria 1443
14 JGI24735J21928_10000944 3300002067 Bacteria 10388
15 JGI24735J21928_10014907 3300002067 Bacteria 2431
16 JGI24735J21928_10021243 3300002067 Bacteria 1982
17 JGI24735J21928_10023346 3300002067 Bacteria 1876
18 JGI24735J21928_10051268 3300002067 Bacteria 1191
19 JGI24750J21931_1000713 3300002070 Bacteria 4792
20 JGI24748J21848_1000015 3300002074 Bacteria 143883
21 JGI24738J21930_10000900 3300002075 Bacteria 8536
22 JGI24738J21930_10034667 3300002075 Bacteria 1028
23 JGI24034J26672_10000006 3300002239 Bacteria 294495
24 JGI24034J26672_10011930 3300002239 Bacteria 1306
25 JGI24742J22300_10002123 3300002244 Bacteria 3152
26 JGI24751J29686_10000093 3300002459 Bacteria 50074
27 JGI24751J29686_10004337 3300002459 Bacteria 2879
28 JGI25150J39212_1000855 3300002774 Bacteria 10133
29 JGI25165J46597_1000024 3300003214 Bacteria 335150
30 JGI25153J46596_10000008 3300003215 Bacteria 376808
31 JGI25153J46596_10000091 3300003215 Bacteria 105614
32 JGI25153J46596_10000186 3300003215 Bacteria 60427
33 JGI25153J46596_10004838 3300003215 Bacteria 7177
34 Ga0055542_1004222 3300003762 Bacteria 3565
35 Ga0055537_1001760 3300003773 Bacteria 7934
36 Ga0055537_1002910 3300003773 Bacteria 5462
37 Ga0055524_1000118 3300003775 Bacteria 93202
38 Ga0055530_10000072 3300003791 Bacteria 85675
39 Ga0055530_10019126 3300003791 Bacteria 2083
40 Ga0055540_1001847 3300003792 Bacteria 11935
41 Ga0055531_10000114 3300003794 Bacteria 88453
42 Ga0055531_10001624 3300003794 Bacteria 16296
43 Ga0065165_1002052 3300005262 Bacteria 18661
44 Ga0065165_1012710 3300005262 Bacteria 3406
45 Ga0065704_10097475 3300005289 Bacteria 2393
46 Ga0065712_10079995 3300005290 Bacteria 3157
47 Ga0065707_10082467 3300005295 Bacteria 14795
48 Ga0065707_10082564 3300005295 Bacteria 13708
49 Ga0070658_10000181 3300005327 Bacteria 55191
50 Ga0070658_10001561 3300005327 Bacteria 19422
51 Ga0070658_10007616 3300005327 Bacteria 8731
52 Ga0070658_10028040 3300005327 Bacteria 4520
53 Ga0070658_10079969 3300005327 Bacteria 2684
54 Ga0070658_10192660 3300005327 Bacteria 1718
55 Ga0070676_10005147 3300005328 Bacteria 6940
56 Ga0070676_10091881 3300005328 Bacteria 1861
57 Ga0070676_10217451 3300005328 Bacteria 1260
58 Ga0070683_100006563 3300005329 Bacteria 9770
59 Ga0070683_100122456 3300005329 Bacteria 2457
60 Ga0070683_100195833 3300005329 Bacteria 1919
61 Ga0070690_100000012 3300005330 Bacteria 91852
62 Ga0070670_100000005 3300005331 Bacteria 351569
63 Ga0070670_100000169 3300005331 Bacteria 59093
64 Ga0070670_100000528 3300005331 Bacteria 30641
65 Ga0070670_100002960 3300005331 Bacteria 14072
66 Ga0070670_100036176 3300005331 Bacteria 4250
67 Ga0070670_100049951 3300005331 Bacteria 3595
68 Ga0070677_10061237 3300005333 Bacteria 1553
69 Ga0068869_100000635 3300005334 Bacteria 19852
70 Ga0070666_10000014 3300005335 Bacteria 224479
71 Ga0070666_10004574 3300005335 Bacteria 8436
72 Ga0070666_10012077 3300005335 Bacteria 5438
73 Ga0070680_100414715 3300005336 Bacteria 1149
74 Ga0068868_100000049 3300005338 Bacteria 67274
75 Ga0068868_100119637 3300005338 Bacteria 2147
76 Ga0070660_100003617 3300005339 Bacteria 10682
77 Ga0070660_100024707 3300005339 Bacteria 4459
78 Ga0070660_100031552 3300005339 Bacteria 3980
79 Ga0070660_100045703 3300005339 Bacteria 3353
80 Ga0070660_100193300 3300005339 Bacteria 1649
81 Ga0070660_100550573 3300005339 Bacteria 962
82 Ga0070689_100029687 3300005340 Bacteria 4142
83 Ga0070691_10000763 3300005341 Bacteria 12747
84 Ga0070661_100005116 3300005344 Bacteria 9042
85 Ga0070661_100015407 3300005344 Bacteria 5396
86 Ga0070661_100022812 3300005344 Bacteria 4482
87 Ga0070661_100029811 3300005344 Bacteria 3940
88 Ga0070661_100036547 3300005344 Bacteria 3570
89 Ga0070661_100138860 3300005344 Bacteria 1830
90 Ga0070692_10060955 3300005345 Bacteria 1987
91 Ga0070692_10125102 3300005345 Bacteria 1439
92 Ga0070668_100000007 3300005347 Bacteria 150621
93 Ga0070668_100002131 3300005347 Bacteria 14472
94 Ga0070668_100011256 3300005347 Bacteria 6662
95 Ga0070668_100021509 3300005347 Bacteria 4873
96 Ga0070668_100124704 3300005347 Bacteria 2062
97 Ga0070668_100399676 3300005347 Bacteria 1173
98 Ga0070669_100000195 3300005353 Bacteria 53791
99 Ga0070669_100000351 3300005353 Bacteria 35974
100 Ga0070669_100034494 3300005353 Bacteria 3663
101 Ga0070669_100291587 3300005353 Bacteria 1310
102 Ga0070675_100002343 3300005354 Bacteria 14076
103 Ga0070675_100013583 3300005354 Bacteria 6403
104 Ga0070671_100000388 3300005355 Bacteria 30256
105 Ga0070671_100000461 3300005355 Bacteria 28331
106 Ga0070671_100014361 3300005355 Bacteria 6397
107 Ga0070671_100020224 3300005355 Bacteria 5426
108 Ga0070671_100078984 3300005355 Bacteria 2750
109 Ga0070671_100121302 3300005355 Bacteria 2200
110 Ga0070671_100239139 3300005355 Bacteria 1541
111 Ga0070674_100032561 3300005356 Bacteria 3462
112 Ga0070674_100215623 3300005356 Bacteria 1490
113 Ga0070674_100218977 3300005356 Bacteria 1480
114 Ga0070673_100000006 3300005364 Bacteria 184299
115 Ga0070673_100020191 3300005364 Bacteria 4801
116 Ga0070673_100024623 3300005364 Bacteria 4417
117 Ga0070673_100045414 3300005364 Bacteria 3406
118 Ga0070673_100065042 3300005364 Bacteria 2907
119 Ga0070688_100010920 3300005365 Bacteria 5029
120 Ga0070659_100005974 3300005366 Bacteria 8778
121 Ga0070659_100007753 3300005366 Bacteria 7808
122 Ga0070659_100031286 3300005366 Bacteria 4121
123 Ga0070659_100059821 3300005366 Bacteria 3008
124 Ga0070659_100151979 3300005366 Bacteria 1889
125 Ga0070659_100235550 3300005366 Bacteria 1513
126 Ga0070667_100000003 3300005367 Bacteria 447715
127 Ga0070667_100000327 3300005367 Bacteria 52972
128 Ga0070667_100000873 3300005367 Bacteria 27955
129 Ga0070667_100001850 3300005367 Bacteria 18783
130 Ga0070667_100022481 3300005367 Bacteria 5230
131 Ga0070667_100033868 3300005367 Bacteria 4273
132 Ga0070667_100113824 3300005367 Bacteria 2348
133 Ga0070667_100674259 3300005367 Bacteria 955
134 Ga0070714_100188223 3300005435 Bacteria 1882
135 Ga0070713_100502716 3300005436 Bacteria 1144
136 Ga0070705_100710137 3300005440 Bacteria 791
137 Ga0070663_100016888 3300005455 Bacteria 4750
138 Ga0070663_100028223 3300005455 Bacteria 3819
139 Ga0070663_100051649 3300005455 Bacteria 2930
140 Ga0070663_100113967 3300005455 Bacteria 2035
141 Ga0070663_100671073 3300005455 Bacteria 878
142 Ga0070663_100695733 3300005455 Bacteria 864
143 Ga0070678_100000505 3300005456 Bacteria 18820
144 Ga0070678_100008600 3300005456 Bacteria 6119
145 Ga0070678_100166600 3300005456 Bacteria 1791
146 Ga0070662_100005871 3300005457 Bacteria 7879
147 Ga0070662_100006250 3300005457 Bacteria 7670
148 Ga0070662_100021277 3300005457 Bacteria 4427
149 Ga0070662_100131956 3300005457 Bacteria 1927
150 Ga0070662_100228129 3300005457 Bacteria 1489
151 Ga0070681_10029966 3300005458 Bacteria 5461
152 Ga0070681_10069647 3300005458 Bacteria 3484
153 Ga0068867_100000001 3300005459 Bacteria 427563
154 Ga0068867_100029493 3300005459 Bacteria 3953
155 Ga0068867_100524361 3300005459 Bacteria 1022
156 Ga0070685_10002655 3300005466 Bacteria 9156
157 Ga0070679_100033561 3300005530 Bacteria 5082
158 Ga0070679_100153616 3300005530 Bacteria 2278
159 Ga0070684_100004255 3300005535 Bacteria 10845
160 Ga0070684_100125792 3300005535 Bacteria 2309
161 Ga0070684_100143776 3300005535 Bacteria 2158
162 Ga0068853_100016963 3300005539 Bacteria 6003
163 Ga0068853_100035156 3300005539 Bacteria 4255
164 Ga0068853_100064038 3300005539 Bacteria 3186
165 Ga0068853_100066503 3300005539 Bacteria 3130
166 Ga0068853_100106522 3300005539 Bacteria 2485
167 Ga0068853_100191840 3300005539 Bacteria 1857
168 Ga0068853_100261358 3300005539 Bacteria 1591
169 Ga0068853_100289580 3300005539 Bacteria 1512
170 Ga0070672_100006310 3300005543 Bacteria 7951
171 Ga0070672_100014230 3300005543 Bacteria 5633
172 Ga0070672_100064036 3300005543 Bacteria 2904
173 Ga0070672_100185299 3300005543 Bacteria 1736
174 Ga0070686_100000002 3300005544 Bacteria 336303
175 Ga0070686_100046913 3300005544 Bacteria 2729
176 Ga0070695_100011571 3300005545 Bacteria 5279
177 Ga0070696_100003877 3300005546 Bacteria 9991
178 Ga0070696_100006531 3300005546 Bacteria 7787
179 Ga0070665_100000025 3300005548 Bacteria 367488
180 Ga0070665_100000471 3300005548 Bacteria 58097
181 Ga0070665_100009495 3300005548 Bacteria 9838
182 Ga0070665_100050070 3300005548 Bacteria 4192
183 Ga0070665_100069910 3300005548 Bacteria 3518
184 Ga0070665_100597007 3300005548 Bacteria 1117
185 Ga0068855_100000023 3300005563 Bacteria 190440
186 Ga0068855_100003431 3300005563 Bacteria 19388
187 Ga0068855_100058591 3300005563 Bacteria 4509
188 Ga0068855_100256310 3300005563 Bacteria 1950
189 Ga0068855_100259344 3300005563 Bacteria 1937
190 Ga0070664_100000093 3300005564 Bacteria 57415
191 Ga0070664_100003267 3300005564 Bacteria 13100
192 Ga0070664_100006241 3300005564 Bacteria 9626
193 Ga0070664_100062965 3300005564 Bacteria 3162
194 Ga0070664_100073476 3300005564 Bacteria 2934
195 Ga0070664_100081692 3300005564 Bacteria 2786
196 Ga0070664_100168737 3300005564 Bacteria 1940
197 Ga0068857_100015202 3300005577 Bacteria 6716
198 Ga0068857_100015964 3300005577 Bacteria 6577
199 Ga0068857_100288529 3300005577 Bacteria 1510
200 Ga0068854_100000722 3300005578 Bacteria 19534
201 Ga0068854_100005206 3300005578 Bacteria 8205
202 Ga0068854_100027141 3300005578 Bacteria 3944
203 Ga0068854_100029193 3300005578 Bacteria 3817
204 Ga0068854_100095691 3300005578 Bacteria 2217
205 Ga0068854_100100723 3300005578 Bacteria 2166
206 Ga0068854_100121256 3300005578 Bacteria 1985
207 Ga0068854_100164056 3300005578 Bacteria 1723
208 Ga0068854_100247681 3300005578 Bacteria 1421
209 Ga0068856_100033806 3300005614 Bacteria 5007
210 Ga0068856_100042299 3300005614 Bacteria 4481
211 Ga0068856_100063293 3300005614 Bacteria 3655
212 Ga0068856_100275276 3300005614 Bacteria 1700
213 Ga0068856_100290640 3300005614 Bacteria 1651
214 Ga0068852_100001538 3300005616 Bacteria 15655
215 Ga0068852_100021306 3300005616 Bacteria 5172
216 Ga0068852_100043422 3300005616 Bacteria 3813
217 Ga0068852_100049064 3300005616 Bacteria 3610
218 Ga0068859_100007110 3300005617 Bacteria 11360
219 Ga0068859_100008939 3300005617 Bacteria 10118
220 Ga0068859_100014394 3300005617 Bacteria 7938
221 Ga0068859_100021440 3300005617 Bacteria 6485
222 Ga0068859_100029142 3300005617 Bacteria 5540
223 Ga0068859_100065318 3300005617 Bacteria 3673
224 Ga0068859_100127874 3300005617 Bacteria 2611
225 Ga0068859_100256410 3300005617 Bacteria 1840
226 Ga0068859_100358221 3300005617 Bacteria 1554
227 Ga0068864_100000004 3300005618 Bacteria 489341
228 Ga0068864_100000011 3300005618 Bacteria 350056
229 Ga0068864_100000078 3300005618 Bacteria 103622
230 Ga0068864_100003288 3300005618 Bacteria 13355
231 Ga0068864_100012174 3300005618 Bacteria 7111
232 Ga0068864_100017806 3300005618 Bacteria 5927
233 Ga0068864_100070649 3300005618 Bacteria 3038
234 Ga0068866_10001322 3300005718 Bacteria 10746
235 Ga0068861_100000132 3300005719 Bacteria 38465
236 Ga0068861_100000629 3300005719 Bacteria 20887
237 Ga0068861_100017934 3300005719 Bacteria 5033
238 Ga0068861_100233353 3300005719 Bacteria 1561
239 Ga0068851_10005578 3300005834 Bacteria 5708
240 Ga0068851_10025486 3300005834 Bacteria 2901
241 Ga0068851_10027636 3300005834 Bacteria 2797
242 Ga0068851_10078004 3300005834 Bacteria 1725
243 Ga0068851_10090935 3300005834 Bacteria 1606
244 Ga0068863_100000002 3300005841 Bacteria 489510
245 Ga0068863_100000270 3300005841 Bacteria 54081
246 Ga0068863_100001062 3300005841 Bacteria 27480
247 Ga0068863_100001939 3300005841 Bacteria 20551
248 Ga0068863_100002169 3300005841 Bacteria 19450
249 Ga0068863_100003398 3300005841 Bacteria 15704
250 Ga0068863_100004607 3300005841 Bacteria 13580
251 Ga0068863_100017965 3300005841 Bacteria 6769
252 Ga0068863_100053028 3300005841 Bacteria 3843
253 Ga0068863_100076334 3300005841 Bacteria 3170
254 Ga0068863_100370262 3300005841 Bacteria 1398
255 Ga0068858_100000181 3300005842 Bacteria 66254
256 Ga0068858_100000832 3300005842 Bacteria 32118
257 Ga0068858_100006226 3300005842 Bacteria 11628
258 Ga0068858_100006347 3300005842 Bacteria 11512
259 Ga0068858_100007133 3300005842 Bacteria 10854
260 Ga0068858_100180276 3300005842 Bacteria 1994
261 Ga0068860_100000001 3300005843 Bacteria 703043
262 Ga0068860_100000045 3300005843 Bacteria 223252
263 Ga0068860_100000834 3300005843 Bacteria 34494
264 Ga0068860_100004334 3300005843 Bacteria 14504
265 Ga0068860_100016501 3300005843 Bacteria 7203
266 Ga0068860_100060507 3300005843 Bacteria 3599
267 Ga0068860_100076230 3300005843 Bacteria 3189
268 Ga0068860_100080027 3300005843 Bacteria 3107
269 Ga0068860_100347777 3300005843 Bacteria 1458
270 Ga0068860_100423460 3300005843 Bacteria 1320
271 Ga0068860_100693098 3300005843 Bacteria 1028
272 Ga0068862_100000002 3300005844 Bacteria 489341
273 Ga0068862_100000011 3300005844 Bacteria 270105
274 Ga0068862_100000032 3300005844 Bacteria 179887
275 Ga0068862_100000048 3300005844 Bacteria 150043
276 Ga0068862_100000989 3300005844 Bacteria 27179
277 Ga0068862_100007656 3300005844 Bacteria 8943
278 Ga0068862_100009813 3300005844 Bacteria 7911
279 Ga0068862_100199992 3300005844 Bacteria 1801
280 Ga0070712_100210454 3300006175 Bacteria 1533
281 Ga0097621_100002557 3300006237 Bacteria 12458
282 Ga0068871_100031090 3300006358 Bacteria 4207
283 Ga0075430_100038654 3300006846 Bacteria 4042
284 Ga0068865_100000003 3300006881 Bacteria 231761
285 Ga0097620_100007111 3300006931 Bacteria 11360
286 Ga0097620_100008939 3300006931 Bacteria 10118
287 Ga0097620_100014392 3300006931 Bacteria 7938
288 Ga0097620_100021440 3300006931 Bacteria 6485
289 Ga0097620_100029143 3300006931 Bacteria 5540
290 Ga0097620_100065319 3300006931 Bacteria 3673
291 Ga0097620_100127861 3300006931 Bacteria 2611
292 Ga0097620_100256395 3300006931 Bacteria 1840
293 Ga0097620_100358208 3300006931 Bacteria 1554
294 Ga0105251_10000342 3300009011 Bacteria 46221
295 Ga0105250_10005428 3300009092 Bacteria 5719
296 Ga0105240_10009282 3300009093 Bacteria 13947
297 Ga0105240_10011291 3300009093 Bacteria 12447
298 Ga0105240_10040268 3300009093 Bacteria 5978
299 Ga0105240_10075745 3300009093 Bacteria 4150
300 Ga0105240_10079587 3300009093 Bacteria 4032
301 Ga0111539_10073522 3300009094 Bacteria 4030
302 Ga0105245_10001536 3300009098 Bacteria 20925
303 Ga0105245_10006243 3300009098 Bacteria 10483
304 Ga0105245_10031992 3300009098 Bacteria 4657
305 Ga0105247_10012347 3300009101 Bacteria 5130
306 Ga0105247_10155492 3300009101 Bacteria 1510
307 Ga0105243_10000611 3300009148 Bacteria 35583
308 Ga0105243_10001363 3300009148 Bacteria 21679
309 Ga0105243_10412562 3300009148 Bacteria 1257
310 Ga0105241_10011404 3300009174 Bacteria 6515
311 Ga0105242_10000818 3300009176 Bacteria 24172
312 Ga0105242_10003633 3300009176 Bacteria 12007
313 Ga0105242_10258590 3300009176 Bacteria 1572
314 Ga0105242_10719686 3300009176 Bacteria 979
315 Ga0105248_10000016 3300009177 Bacteria 308151
316 Ga0105248_10000069 3300009177 Bacteria 120989
317 Ga0105248_10002223 3300009177 Bacteria 21450
318 Ga0105248_10002773 3300009177 Bacteria 19480
319 Ga0105248_10014376 3300009177 Bacteria 8711
320 Ga0105248_10026331 3300009177 Bacteria 6470
321 Ga0105248_10033496 3300009177 Bacteria 5739
322 Ga0105248_10046730 3300009177 Bacteria 4853
323 Ga0105248_10065059 3300009177 Bacteria 4093
324 Ga0105248_10069459 3300009177 Bacteria 3955
325 Ga0105248_10155231 3300009177 Bacteria 2583
326 Ga0105248_10374757 3300009177 Bacteria 1602
327 Ga0105248_10426907 3300009177 Bacteria 1493
328 Ga0105248_10471263 3300009177 Bacteria 1415
329 Ga0105237_10030869 3300009545 Bacteria 5438
330 Ga0105237_10032851 3300009545 Bacteria 5253
331 Ga0105237_10054983 3300009545 Bacteria 3987
332 Ga0105237_10155275 3300009545 Bacteria 2285
333 Ga0105237_10570343 3300009545 Bacteria 1138
334 Ga0105238_10003703 3300009551 Bacteria 15217
335 Ga0105238_10016971 3300009551 Bacteria 7389
336 Ga0105238_10020220 3300009551 Bacteria 6776
337 Ga0105238_10025509 3300009551 Bacteria 6026
338 Ga0105238_10056843 3300009551 Bacteria 3924
339 Ga0105238_10067233 3300009551 Bacteria 3585
340 Ga0105238_10154632 3300009551 Bacteria 2269
341 Ga0105238_10367966 3300009551 Bacteria 1428
342 Ga0105238_10633714 3300009551 Bacteria 1078
343 Ga0105238_10969517 3300009551 Bacteria 870
344 Ga0105249_10000005 3300009553 Bacteria 362467
345 Ga0105249_10000017 3300009553 Bacteria 277115
346 Ga0105249_10000106 3300009553 Bacteria 115526
347 Ga0105249_10005694 3300009553 Bacteria 10774
348 Ga0105249_10166446 3300009553 Bacteria 2134
349 Ga0105249_10266691 3300009553 Bacteria 1704
350 Ga0105239_10070023 3300010375 Bacteria 3853
351 Ga0105239_10098131 3300010375 Bacteria 3238
352 Ga0105246_10000620 3300011119 Bacteria 19799
353 Ga0157373_10028624 3300013100 Bacteria 4019
354 Ga0157373_10085988 3300013100 Bacteria 2216
355 Ga0157373_10102585 3300013100 Bacteria 2013
356 Ga0157373_10136279 3300013100 Bacteria 1726
357 Ga0157373_10272680 3300013100 Bacteria 1198
358 Ga0157373_10429189 3300013100 Bacteria 949
359 Ga0157373_10537277 3300013100 Bacteria 847
360 Ga0157371_10000110 3300013102 Bacteria 124933
361 Ga0157371_10037024 3300013102 Bacteria 3494
362 Ga0157371_10040991 3300013102 Bacteria 3306
363 Ga0157371_10128541 3300013102 Bacteria 1802
364 Ga0157371_10152424 3300013102 Bacteria 1649
365 Ga0157370_10012605 3300013104 Bacteria 8761
366 Ga0157370_10041223 3300013104 Bacteria 4456
367 Ga0157370_10112118 3300013104 Bacteria 2549
368 Ga0157369_10002495 3300013105 Bacteria 22057
369 Ga0157369_10003524 3300013105 Bacteria 18600
370 Ga0157369_10008669 3300013105 Bacteria 11658
371 Ga0157369_10008947 3300013105 Bacteria 11468
372 Ga0157369_10009057 3300013105 Bacteria 11398
373 Ga0157369_10068610 3300013105 Bacteria 3810
374 Ga0157369_10094805 3300013105 Bacteria 3186
375 Ga0157374_10006203 3300013296 Bacteria 10133
376 Ga0157374_10046810 3300013296 Bacteria 4007
377 Ga0157374_10070052 3300013296 Bacteria 3303
378 Ga0157374_10080623 3300013296 Bacteria 3087
379 Ga0157374_10090575 3300013296 Bacteria 2916
380 Ga0157374_11346219 3300013296 Bacteria 736
381 Ga0157378_10008062 3300013297 Bacteria 9195
382 Ga0157378_10033143 3300013297 Bacteria 4566
383 Ga0157378_10042832 3300013297 Bacteria 4019
384 Ga0157378_10217265 3300013297 Bacteria 1816
385 Ga0163162_10005086 3300013306 Bacteria 12670
386 Ga0163162_10048885 3300013306 Bacteria 4238
387 Ga0163162_10050115 3300013306 Bacteria 4187
388 Ga0163162_10081335 3300013306 Bacteria 3310
389 Ga0163162_10091245 3300013306 Bacteria 3129
390 Ga0163162_10250436 3300013306 Bacteria 1903
391 Ga0157372_10064804 3300013307 Bacteria 4100
392 Ga0157372_10085245 3300013307 Bacteria 3583
393 Ga0157372_10107945 3300013307 Bacteria 3185
394 Ga0157372_10116707 3300013307 Bacteria 3061
395 Ga0157372_10305248 3300013307 Bacteria 1852
396 Ga0157372_10494116 3300013307 Bacteria 1427
397 Ga0157372_10510680 3300013307 Bacteria 1401
398 Ga0157372_10512443 3300013307 Bacteria 1399
399 Ga0157372_10605423 3300013307 Bacteria 1277
400 Ga0157375_10004152 3300013308 Bacteria 12569
401 Ga0157375_10035911 3300013308 Bacteria 4735
402 Ga0157375_10037485 3300013308 Bacteria 4646
403 Ga0157375_10435869 3300013308 Bacteria 1476
404 Ga0163163_10000588 3300014325 Bacteria 32034
405 Ga0163163_10039738 3300014325 Bacteria 4593
406 Ga0163163_10095415 3300014325 Bacteria 2994
407 Ga0163163_10346614 3300014325 Bacteria 1541
408 Ga0163163_11008936 3300014325 Bacteria 896
409 Ga0157380_10000363 3300014326 Bacteria 27231
410 Ga0157380_10001569 3300014326 Bacteria 15028
411 Ga0157380_10024926 3300014326 Bacteria 4532
412 Ga0157379_10031170 3300014968 Bacteria 4749
413 Ga0157379_10034380 3300014968 Bacteria 4520
414 Ga0157379_10154402 3300014968 Bacteria 2070
415 Ga0157379_10181989 3300014968 Bacteria 1899
416 Ga0157376_10000955 3300014969 Bacteria 18842
417 Ga0157376_10001235 3300014969 Bacteria 16843
418 Ga0163161_10000509 3300017792 Bacteria 31722
419 Ga0163161_10007048 3300017792 Bacteria 7777
420 Ga0163161_10294282 3300017792 Bacteria 1277
421 Ga0206356_10636768 3300020070 Bacteria 2955
422 Ga0206356_10794718 3300020070 Bacteria 2159
423 Ga0206354_10580221 3300020081 Bacteria 4717
424 Ga0206353_11160495 3300020082 Bacteria 3360
425 Ga0213876_10000714 3300021384 Bacteria 23269
426 Ga0213875_10001461 3300021388 Bacteria 15300
427 Ga0213875_10002933 3300021388 Bacteria 9939
428 Ga0207672_1001571 3300025223 Bacteria 1656
429 Ga0209563_100130 3300025230 Bacteria 98627
430 Ga0209677_107479 3300025253 Bacteria 2314
431 Ga0209148_1000171 3300025254 Bacteria 131700
432 Ga0209129_1003658 3300025258 Bacteria 6544
433 Ga0209233_1000084 3300025261 Bacteria 335222
434 Ga0209233_1018102 3300025261 Bacteria 1905
435 Ga0209565_1000011 3300025263 Bacteria 637062
436 Ga0209565_1000170 3300025263 Bacteria 84580
437 Ga0209455_1001814 3300025272 Bacteria 8967
438 Ga0209455_1009677 3300025272 Bacteria 2511
439 Ga0209673_1000827 3300025273 Bacteria 40748
440 Ga0209673_1008761 3300025273 Bacteria 4463
441 Ga0209676_1006991 3300025292 Bacteria 5422
442 Ga0209025_1000068 3300025294 Bacteria 294129
443 Ga0209564_1000335 3300025295 Bacteria 91079
444 Ga0209564_1016363 3300025295 Bacteria 2957
445 Ga0209758_1000017 3300025297 Bacteria 754393
446 Ga0209758_1000019 3300025297 Bacteria 743682
447 Ga0209050_1000001 3300025298 Bacteria 3563507
448 Ga0209050_1000108 3300025298 Bacteria 222534
449 Ga0209050_1000209 3300025298 Bacteria 130884
450 Ga0209050_1009517 3300025298 Bacteria 4957
451 Ga0209050_1009555 3300025298 Bacteria 4945
452 Ga0209050_1019060 3300025298 Bacteria 2629
453 Ga0209256_1000016 3300025299 Bacteria 599092
454 Ga0209051_1000239 3300025303 Bacteria 92575
455 Ga0209257_1000027 3300025304 Bacteria 703541
456 Ga0209257_1001066 3300025304 Bacteria 36225
457 Ga0209257_1001071 3300025304 Bacteria 36088
458 Ga0209257_1001515 3300025304 Bacteria 27237
459 Ga0209257_1013597 3300025304 Bacteria 3597
460 Ga0207697_10045640 3300025315 Bacteria 1804
461 Ga0207656_10001422 3300025321 Bacteria 7919
462 Ga0207656_10005083 3300025321 Bacteria 4626
463 Ga0207656_10028661 3300025321 Bacteria 2287
464 Ga0207656_10029028 3300025321 Bacteria 2275
465 Ga0207656_10039998 3300025321 Bacteria 1986
466 Ga0207656_10112987 3300025321 Bacteria 1257
467 Ga0207713_1003473 3300025735 Bacteria 10729
468 Ga0207642_10007833 3300025899 Bacteria 3628
469 Ga0207710_10068749 3300025900 Bacteria 1620
470 Ga0207710_10075666 3300025900 Bacteria 1552
471 Ga0207688_10015331 3300025901 Bacteria 4158
472 Ga0207680_10000004 3300025903 Bacteria 827324
473 Ga0207680_10002571 3300025903 Bacteria 8464
474 Ga0207680_10009078 3300025903 Bacteria 4915
475 Ga0207680_10175237 3300025903 Bacteria 1447
476 Ga0207647_10000805 3300025904 Bacteria 24314
477 Ga0207647_10005630 3300025904 Bacteria 9147
478 Ga0207647_10078400 3300025904 Bacteria 1984
479 Ga0207647_10084282 3300025904 Bacteria 1902
480 Ga0207647_10088179 3300025904 Bacteria 1853
481 Ga0207647_10117171 3300025904 Bacteria 1572
482 Ga0207647_10251248 3300025904 Bacteria 1014
483 Ga0207645_10015238 3300025907 Bacteria 5117
484 Ga0207645_10026774 3300025907 Bacteria 3725
485 Ga0207645_10080062 3300025907 Bacteria 2094
486 Ga0207645_10086739 3300025907 Bacteria 2011
487 Ga0207645_10110473 3300025907 Bacteria 1779
488 Ga0207705_10000121 3300025909 Bacteria 86649
489 Ga0207705_10000592 3300025909 Bacteria 30427
490 Ga0207705_10017650 3300025909 Bacteria 5106
491 Ga0207705_10024003 3300025909 Bacteria 4351
492 Ga0207705_10031278 3300025909 Bacteria 3797
493 Ga0207705_10042845 3300025909 Bacteria 3250
494 Ga0207705_10043256 3300025909 Bacteria 3235
495 Ga0207705_10079630 3300025909 Bacteria 2386
496 Ga0207654_10003722 3300025911 Bacteria 7699
497 Ga0207654_10011547 3300025911 Bacteria 4507
498 Ga0207707_10008275 3300025912 Bacteria 9025
499 Ga0207707_10096899 3300025912 Bacteria 2577
500 Ga0207707_10344103 3300025912 Bacteria 1285
501 Ga0207695_10002715 3300025913 Bacteria 25830
502 Ga0207695_10007597 3300025913 Bacteria 13744
503 Ga0207695_10016512 3300025913 Bacteria 8631
504 Ga0207695_10038816 3300025913 Bacteria 5122
505 Ga0207671_10001479 3300025914 Bacteria 27142
506 Ga0207671_10011623 3300025914 Bacteria 7144
507 Ga0207671_10013100 3300025914 Bacteria 6625
508 Ga0207671_10175338 3300025914 Bacteria 1666
509 Ga0207671_10254387 3300025914 Bacteria 1381
510 Ga0207671_10694554 3300025914 Bacteria 809
511 Ga0207693_10210615 3300025915 Bacteria 1528
512 Ga0207660_10038492 3300025917 Bacteria 3339
513 Ga0207660_10161905 3300025917 Bacteria 1727
514 Ga0207660_10181164 3300025917 Bacteria 1636
515 Ga0207657_10002178 3300025919 Bacteria 21220
516 Ga0207657_10003582 3300025919 Bacteria 16572
517 Ga0207657_10008376 3300025919 Bacteria 10500
518 Ga0207657_10012964 3300025919 Bacteria 8196
519 Ga0207657_10014496 3300025919 Bacteria 7691
520 Ga0207657_10016571 3300025919 Bacteria 7100
521 Ga0207657_10023959 3300025919 Bacteria 5667
522 Ga0207657_10035869 3300025919 Bacteria 4442
523 Ga0207657_10167232 3300025919 Bacteria 1783
524 Ga0207657_10247796 3300025919 Bacteria 1421
525 Ga0207657_10382327 3300025919 Bacteria 1108
526 Ga0207649_10000475 3300025920 Bacteria 28671
527 Ga0207649_10006830 3300025920 Bacteria 6201
528 Ga0207649_10015845 3300025920 Bacteria 4238
529 Ga0207649_10153329 3300025920 Bacteria 1589
530 Ga0207652_10037349 3300025921 Bacteria 4111
531 Ga0207681_10000001 3300025923 Bacteria 1105841
532 Ga0207681_10000038 3300025923 Bacteria 153694
533 Ga0207681_10049750 3300025923 Bacteria 2834
534 Ga0207681_10054598 3300025923 Bacteria 2717
535 Ga0207681_10059426 3300025923 Bacteria 2621
536 Ga0207681_10229385 3300025923 Bacteria 1440
537 Ga0207681_10250157 3300025923 Bacteria 1383
538 Ga0207681_10293046 3300025923 Bacteria 1285
539 Ga0207694_10001050 3300025924 Bacteria 24056
540 Ga0207694_10004743 3300025924 Bacteria 10571
541 Ga0207694_10009796 3300025924 Bacteria 7232
542 Ga0207694_10014424 3300025924 Bacteria 5957
543 Ga0207694_10021743 3300025924 Bacteria 4861
544 Ga0207694_10026198 3300025924 Bacteria 4433
545 Ga0207694_10053932 3300025924 Bacteria 3118
546 Ga0207694_10183155 3300025924 Bacteria 1699
547 Ga0207694_10512327 3300025924 Bacteria 1005
548 Ga0207650_10000018 3300025925 Bacteria 352120
549 Ga0207650_10000294 3300025925 Bacteria 50141
550 Ga0207650_10004568 3300025925 Bacteria 9467
551 Ga0207650_10024760 3300025925 Bacteria 4271
552 Ga0207650_10080057 3300025925 Bacteria 2476
553 Ga0207650_10121113 3300025925 Bacteria 2037
554 Ga0207650_10200919 3300025925 Bacteria 1597
555 Ga0207650_10287302 3300025925 Bacteria 1340
556 Ga0207659_10000922 3300025926 Bacteria 17511
557 Ga0207659_10271913 3300025926 Bacteria 1382
558 Ga0207687_10004504 3300025927 Bacteria 9272
559 Ga0207644_10000039 3300025931 Bacteria 121348
560 Ga0207644_10000197 3300025931 Bacteria 42679
561 Ga0207644_10000214 3300025931 Bacteria 39975
562 Ga0207644_10000863 3300025931 Bacteria 19167
563 Ga0207644_10002893 3300025931 Bacteria 11065
564 Ga0207644_10010201 3300025931 Bacteria 6189
565 Ga0207644_10020550 3300025931 Bacteria 4490
566 Ga0207644_10022249 3300025931 Bacteria 4330
567 Ga0207644_10031319 3300025931 Bacteria 3705
568 Ga0207644_10036676 3300025931 Bacteria 3444
569 Ga0207644_10537220 3300025931 Bacteria 967
570 Ga0207690_10002990 3300025932 Bacteria 10182
571 Ga0207690_10007682 3300025932 Bacteria 6398
572 Ga0207690_10008018 3300025932 Bacteria 6270
573 Ga0207690_10012702 3300025932 Bacteria 5047
574 Ga0207690_10056672 3300025932 Bacteria 2644
575 Ga0207690_10107312 3300025932 Bacteria 2005
576 Ga0207690_10363951 3300025932 Bacteria 1146
577 Ga0207706_10004569 3300025933 Bacteria 12991
578 Ga0207706_10005341 3300025933 Bacteria 11974
579 Ga0207706_10009419 3300025933 Bacteria 8966
580 Ga0207706_10011916 3300025933 Bacteria 7916
581 Ga0207706_10022091 3300025933 Bacteria 5710
582 Ga0207706_10028785 3300025933 Bacteria 4960
583 Ga0207706_10047492 3300025933 Bacteria 3798
584 Ga0207706_10051583 3300025933 Bacteria 3632
585 Ga0207706_10062580 3300025933 Bacteria 3277
586 Ga0207706_10373486 3300025933 Bacteria 1238
587 Ga0207686_10002145 3300025934 Bacteria 10850
588 Ga0207686_10013436 3300025934 Bacteria 4532
589 Ga0207709_10000629 3300025935 Bacteria 28906
590 Ga0207709_10000951 3300025935 Bacteria 21659
591 Ga0207709_10058533 3300025935 Bacteria 2395
592 Ga0207709_10614511 3300025935 Bacteria 862
593 Ga0207670_10106249 3300025936 Bacteria 2014
594 Ga0207669_10000755 3300025937 Bacteria 13988
595 Ga0207669_10005841 3300025937 Bacteria 5566
596 Ga0207669_10069602 3300025937 Bacteria 2202
597 Ga0207669_10209644 3300025937 Bacteria 1421
598 Ga0207704_10000001 3300025938 Bacteria 716296
599 Ga0207704_10061836 3300025938 Bacteria 2325
600 Ga0207704_10665084 3300025938 Bacteria 859
601 Ga0207691_10003283 3300025940 Bacteria 15755
602 Ga0207691_10056417 3300025940 Bacteria 3578
603 Ga0207691_10099573 3300025940 Bacteria 2595
604 Ga0207691_10704127 3300025940 Bacteria 852
605 Ga0207711_10000022 3300025941 Bacteria 340441
606 Ga0207711_10000042 3300025941 Bacteria 158782
607 Ga0207711_10001064 3300025941 Bacteria 26287
608 Ga0207711_10002492 3300025941 Bacteria 16434
609 Ga0207711_10012589 3300025941 Bacteria 7025
610 Ga0207711_10047359 3300025941 Bacteria 3675
611 Ga0207711_10063922 3300025941 Bacteria 3178
612 Ga0207711_10088519 3300025941 Bacteria 2719
613 Ga0207711_10209286 3300025941 Bacteria 1781
614 Ga0207711_10256413 3300025941 Bacteria 1607
615 Ga0207711_10371094 3300025941 Bacteria 1327
616 Ga0207689_10001710 3300025942 Bacteria 20764
617 Ga0207689_10069129 3300025942 Bacteria 2902
618 Ga0207689_10117639 3300025942 Bacteria 2185
619 Ga0207661_10228734 3300025944 Bacteria 1646
620 Ga0207661_10481259 3300025944 Bacteria 1133
621 Ga0207679_10002349 3300025945 Bacteria 11640
622 Ga0207679_10014116 3300025945 Bacteria 5244
623 Ga0207679_10014928 3300025945 Bacteria 5118
624 Ga0207679_10041360 3300025945 Bacteria 3305
625 Ga0207679_10058126 3300025945 Bacteria 2864
626 Ga0207679_10074849 3300025945 Bacteria 2567
627 Ga0207679_10222304 3300025945 Bacteria 1589
628 Ga0207679_10303461 3300025945 Bacteria 1377
629 Ga0207667_10000001 3300025949 Bacteria 1178522
630 Ga0207667_10000016 3300025949 Bacteria 391466
631 Ga0207667_10000651 3300025949 Bacteria 45008
632 Ga0207667_10000692 3300025949 Bacteria 43754
633 Ga0207667_10010455 3300025949 Bacteria 10845
634 Ga0207667_10021125 3300025949 Bacteria 7220
635 Ga0207667_10172630 3300025949 Bacteria 2222
636 Ga0207667_10367666 3300025949 Bacteria 1466
637 Ga0207651_10000002 3300025960 Bacteria 427663
638 Ga0207651_10003812 3300025960 Bacteria 7472
639 Ga0207651_10003837 3300025960 Bacteria 7452
640 Ga0207651_10011490 3300025960 Bacteria 4960
641 Ga0207651_10411755 3300025960 Bacteria 1152
642 Ga0207712_10000001 3300025961 Bacteria 750309
643 Ga0207712_10000012 3300025961 Bacteria 392363
644 Ga0207712_10000224 3300025961 Bacteria 55674
645 Ga0207712_10030985 3300025961 Bacteria 3599
646 Ga0207712_10101759 3300025961 Bacteria 2137
647 Ga0207712_10433445 3300025961 Bacteria 1111
648 Ga0207712_10733493 3300025961 Bacteria 864
649 Ga0207668_10000026 3300025972 Bacteria 128309
650 Ga0207668_10000228 3300025972 Bacteria 37684
651 Ga0207668_10000490 3300025972 Bacteria 24826
652 Ga0207668_10013664 3300025972 Bacteria 5008
653 Ga0207668_10014529 3300025972 Bacteria 4875
654 Ga0207668_10203323 3300025972 Bacteria 1579
655 Ga0207668_10548058 3300025972 Bacteria 1001
656 Ga0207640_10000891 3300025981 Bacteria 16939
657 Ga0207640_10004646 3300025981 Bacteria 7453
658 Ga0207640_10005537 3300025981 Bacteria 6881
659 Ga0207640_10037340 3300025981 Bacteria 3055
660 Ga0207640_10046863 3300025981 Bacteria 2785
661 Ga0207640_10047485 3300025981 Bacteria 2769
662 Ga0207640_10086439 3300025981 Bacteria 2159
663 Ga0207640_10095691 3300025981 Bacteria 2068
664 Ga0207640_10208530 3300025981 Bacteria 1487
665 Ga0207640_10281484 3300025981 Bacteria 1306
666 Ga0207640_10500198 3300025981 Bacteria 1012
667 Ga0207658_10000002 3300025986 Bacteria 1364188
668 Ga0207658_10000364 3300025986 Bacteria 44527
669 Ga0207658_10000545 3300025986 Bacteria 34100
670 Ga0207658_10000902 3300025986 Bacteria 24720
671 Ga0207658_10009480 3300025986 Bacteria 6606
672 Ga0207658_10009613 3300025986 Bacteria 6562
673 Ga0207658_10009967 3300025986 Bacteria 6457
674 Ga0207658_10049116 3300025986 Bacteria 3098
675 Ga0207658_10225527 3300025986 Bacteria 1579
676 Ga0207677_10000030 3300026023 Bacteria 120692
677 Ga0207677_10009857 3300026023 Bacteria 5385
678 Ga0207703_10000135 3300026035 Bacteria 89779
679 Ga0207703_10000404 3300026035 Bacteria 46297
680 Ga0207703_10001087 3300026035 Bacteria 25874
681 Ga0207703_10015254 3300026035 Bacteria 5995
682 Ga0207703_10054327 3300026035 Bacteria 3257
683 Ga0207639_10002074 3300026041 Bacteria 13509
684 Ga0207639_10007490 3300026041 Bacteria 7447
685 Ga0207639_10008847 3300026041 Bacteria 6924
686 Ga0207639_10044857 3300026041 Bacteria 3327
687 Ga0207639_10051972 3300026041 Bacteria 3120
688 Ga0207639_10095900 3300026041 Bacteria 2385
689 Ga0207639_10187075 3300026041 Bacteria 1766
690 Ga0207639_10254497 3300026041 Bacteria 1533
691 Ga0207678_10006676 3300026067 Bacteria 10229
692 Ga0207678_10008727 3300026067 Bacteria 8925
693 Ga0207678_10036870 3300026067 Bacteria 4256
694 Ga0207678_10048089 3300026067 Bacteria 3688
695 Ga0207678_10067448 3300026067 Bacteria 3071
696 Ga0207678_10076194 3300026067 Bacteria 2873
697 Ga0207678_10257733 3300026067 Bacteria 1494
698 Ga0207702_10000462 3300026078 Bacteria 45995
699 Ga0207702_10016406 3300026078 Bacteria 6131
700 Ga0207702_10052596 3300026078 Bacteria 3447
701 Ga0207702_10185626 3300026078 Bacteria 1918
702 Ga0207702_10198470 3300026078 Bacteria 1858
703 Ga0207702_10201102 3300026078 Bacteria 1847
704 Ga0207702_10414569 3300026078 Bacteria 1301
705 Ga0207702_10449235 3300026078 Bacteria 1250
706 Ga0207641_10000002 3300026088 Bacteria 981004
707 Ga0207641_10000024 3300026088 Bacteria 250751
708 Ga0207641_10000033 3300026088 Bacteria 219261
709 Ga0207641_10000277 3300026088 Bacteria 64441
710 Ga0207641_10000626 3300026088 Bacteria 38602
711 Ga0207641_10001261 3300026088 Bacteria 25224
712 Ga0207641_10002117 3300026088 Bacteria 18786
713 Ga0207641_10004973 3300026088 Bacteria 11403
714 Ga0207641_10005398 3300026088 Bacteria 10920
715 Ga0207641_10006503 3300026088 Bacteria 9839
716 Ga0207641_10017421 3300026088 Bacteria 5880
717 Ga0207641_10173019 3300026088 Bacteria 1972
718 Ga0207648_10000001 3300026089 Bacteria 427499
719 Ga0207648_10003494 3300026089 Bacteria 16462
720 Ga0207676_10000004 3300026095 Bacteria 725417
721 Ga0207676_10000040 3300026095 Bacteria 167947
722 Ga0207676_10000340 3300026095 Bacteria 40187
723 Ga0207676_10000600 3300026095 Bacteria 29522
724 Ga0207676_10002850 3300026095 Bacteria 12309
725 Ga0207676_10006287 3300026095 Bacteria 8388
726 Ga0207676_10042482 3300026095 Bacteria 3497
727 Ga0207676_10080658 3300026095 Bacteria 2641
728 Ga0207676_10107993 3300026095 Bacteria 2322
729 Ga0207674_10003716 3300026116 Bacteria 18636
730 Ga0207674_10010165 3300026116 Bacteria 10693
731 Ga0207674_10012150 3300026116 Bacteria 9640
732 Ga0207674_10014103 3300026116 Bacteria 8829
733 Ga0207674_10058492 3300026116 Bacteria 3904
734 Ga0207675_100000071 3300026118 Bacteria 77575
735 Ga0207675_100000171 3300026118 Bacteria 58198
736 Ga0207675_100004115 3300026118 Bacteria 14077
737 Ga0207675_100074164 3300026118 Bacteria 3184
738 Ga0207675_100275287 3300026118 Bacteria 1634
739 Ga0207675_100690505 3300026118 Bacteria 1029
740 Ga0207683_10030752 3300026121 Bacteria 4654
741 Ga0207683_10038419 3300026121 Bacteria 4172
742 Ga0207683_10059873 3300026121 Bacteria 3346
743 Ga0207683_10204941 3300026121 Bacteria 1794
744 Ga0207698_10008400 3300026142 Bacteria 6529
745 Ga0207698_10009783 3300026142 Bacteria 6125
746 Ga0207698_10013046 3300026142 Bacteria 5467
747 Ga0207698_10035886 3300026142 Bacteria 3632
748 Ga0207698_10064919 3300026142 Bacteria 2864
749 Ga0207698_10089859 3300026142 Bacteria 2510
750 Ga0207698_10158574 3300026142 Bacteria 1975
751 Ga0207698_10172860 3300026142 Bacteria 1904
752 Ga0207698_10207361 3300026142 Bacteria 1760
753 Ga0268266_10000028 3300028379 Bacteria 425294
754 Ga0268266_10398752 3300028379 Bacteria 1300
755 Ga0268266_10664587 3300028379 Bacteria 1003
756 Ga0268265_10000002 3300028380 Bacteria 1035381
757 Ga0268265_10000003 3300028380 Bacteria 949201
758 Ga0268265_10000071 3300028380 Bacteria 132890
759 Ga0268265_10000081 3300028380 Bacteria 120869
760 Ga0268265_10001985 3300028380 Bacteria 16188
761 Ga0268265_10070456 3300028380 Bacteria 2719
762 Ga0268265_10155686 3300028380 Bacteria 1933
763 Ga0268264_10000006 3300028381 Bacteria 827324
764 Ga0268264_10000101 3300028381 Bacteria 225109
765 Ga0268264_10000277 3300028381 Bacteria 86740
766 Ga0268264_10002895 3300028381 Bacteria 14925
767 Ga0268264_10007584 3300028381 Bacteria 9048
768 Ga0268264_10017268 3300028381 Bacteria 5912
769 Ga0268264_10046924 3300028381 Bacteria 3590
770 Ga0268264_10046935 3300028381 Bacteria 3590
771 Ga0268264_10513770 3300028381 Bacteria 1170
772 Ga0268264_10648904 3300028381 Bacteria 1044
773 Ga0307517_10017543 3300028786 Bacteria 9325
774 Ga0314311_1253059 3300030733 Bacteria 1106
775 Ga0307513_10038050 3300031456 Bacteria 5347
776 Ga0307513_10062253 3300031456 Bacteria 3945
777 Ga0307408_100159239 3300031548 Bacteria 1791
778 Ga0307408_100375434 3300031548 Bacteria 1214
779 Ga0307405_10010820 3300031731 Bacteria 4749
780 Ga0307405_10019377 3300031731 Bacteria 3777
781 Ga0307413_10011043 3300031824 Bacteria 4417
782 Ga0307413_10177020 3300031824 Bacteria 1516
783 Ga0307413_10326141 3300031824 Bacteria 1175
784 Ga0307410_10051488 3300031852 Bacteria 2775
785 Ga0307410_10060530 3300031852 Bacteria 2588
786 Ga0307410_10101091 3300031852 Bacteria 2066
787 Ga0307410_10301796 3300031852 Bacteria 1264
788 Ga0307406_10107594 3300031901 Bacteria 1912
789 Ga0307406_10220312 3300031901 Bacteria 1410
790 Ga0307406_10833827 3300031901 Bacteria 780
791 Ga0307407_10014810 3300031903 Bacteria 3830
792 Ga0307412_10014384 3300031911 Bacteria 4665
793 Ga0307412_10119740 3300031911 Bacteria 1893
794 Ga0307412_10530911 3300031911 Bacteria 985
795 Ga0307409_100048881 3300031995 Bacteria 3222
796 Ga0307409_100309460 3300031995 Bacteria 1473
797 Ga0307409_100484735 3300031995 Bacteria 1201
798 Ga0307409_100510853 3300031995 Bacteria 1172
799 Ga0307416_100009723 3300032002 Bacteria 6315
800 Ga0307416_101033116 3300032002 Bacteria 925
801 Ga0307414_10001499 3300032004 Bacteria 12124
802 Ga0307414_10025253 3300032004 Bacteria 3802
803 Ga0307414_10070847 3300032004 Bacteria 2512
804 Ga0307414_10081762 3300032004 Bacteria 2366
805 Ga0307414_10159855 3300032004 Bacteria 1788
806 Ga0307411_10012651 3300032005 Bacteria 4617
807 Ga0307411_10040331 3300032005 Bacteria 2961
808 Ga0307411_10060206 3300032005 Bacteria 2520
809 Ga0307411_10070385 3300032005 Bacteria 2367
810 Ga0307411_10101841 3300032005 Bacteria 2033
811 Ga0307411_10207482 3300032005 Bacteria 1510
812 Ga0307411_10252169 3300032005 Bacteria 1388
813 Ga0307411_10347093 3300032005 Bacteria 1208
814 Ga0307411_10572468 3300032005 Bacteria 967
815 Ga0307415_100020974 3300032126 Bacteria 4003
816 Ga0307415_100100012 3300032126 Bacteria 2124
817 Ga0307510_10219879 3300033180 Bacteria 1412
818 Ga0307510_10238088 3300033180 Bacteria 1317
819 Ga0373941_0085440 3300035115 Bacteria 1073
820 Ga0373931_0246318 3300035691 Bacteria 1085
821 Ga0395899_0018782 3300037312 Bacteria 5252
822 Ga0395899_0037136 3300037312 Bacteria 3652
823 Ga0395900_0000764 3300037418 Bacteria 42836
824 Ga0395900_0081537 3300037418 Bacteria 3323
825 Ga0395900_0094288 3300037418 Bacteria 3074
826 Ga0395900_0178364 3300037418 Bacteria 2160
827 Ga0395900_0359544 3300037418 Bacteria 1427
828 Ga0395900_0579831 3300037418 Bacteria 1064
829 Ga0395900_0630950 3300037418 Bacteria 1010
830 Ga0395898_0021463 3300037466 Bacteria 6548
831 Ga0395898_0028931 3300037466 Bacteria 5553
832 Ga0395898_0058445 3300037466 Bacteria 3753
833 Ga0395898_0117307 3300037466 Bacteria 2550
834 Ga0395905_0003045 3300037471 Bacteria 18153
835 Ga0395905_0004674 3300037471 Bacteria 14154
836 Ga0395905_0013463 3300037471 Bacteria 7838
837 Ga0395905_0017316 3300037471 Bacteria 6842
838 Ga0395905_0033153 3300037471 Bacteria 4853
839 Ga0395905_0043534 3300037471 Bacteria 4211
840 Ga0395905_0044710 3300037471 Bacteria 4155
841 Ga0395905_0117126 3300037471 Bacteria 2503
842 Ga0395905_0158282 3300037471 Bacteria 2130
843 Ga0395905_0328782 3300037471 Bacteria 1419
844 Ga0395905_0742484 3300037471 Bacteria 884
845 Ga0395905_0755988 3300037471 Bacteria 874
846 Ga0395905_0794686 3300037471 Bacteria 849
847 Ga0436364_0612163 3300037853 Bacteria 25384
848 Ga0436364_0852694 3300037853 Bacteria 36694
849 Ga0395901_0005146 3300038443 Bacteria 13202
850 Ga0395901_0009829 3300038443 Bacteria 9698
851 Ga0395901_0118405 3300038443 Bacteria 2782
852 Ga0395901_0343089 3300038443 Bacteria 1543
853 Ga0395901_0438477 3300038443 Bacteria 1337
854 Ga0436365_0866041 3300039437 Bacteria 911
855 Ga0436363_1386082 3300039450 Bacteria 1243
856 Ga0439436_0044005 3300041404 Bacteria 1272
857 Ga0439439_0003354 3300041406 Bacteria 3524
858 Ga0439461_0000202 3300041410 Bacteria 8326
859 Ga0439461_0016751 3300041410 Bacteria 1418
860 Ga0439465_0000274 3300041413 Bacteria 14388
861 Ga0451807_0150684 3300041486 Bacteria 1517
862 Ga0439431_0000103 3300041997 Bacteria 14374
863 Ga0439445_0025915 3300042004 Bacteria 1498
864 Ga0439448_0013838 3300042005 Bacteria 2429
865 Ga0439432_012147 3300042006 Bacteria 2954
866 Ga0439432_030753 3300042006 Bacteria 1740
867 Ga0439432_032372 3300042006 Bacteria 1686
868 Ga0450919_005818 3300042121 Bacteria 1473
869 Ga0450905_001171 3300042142 Bacteria 3319
870 Ga0450889_002955 3300042144 Bacteria 1679
871 Ga0439458_0000559 3300042157 Bacteria 9582
872 Ga0439434_0021611 3300042435 Bacteria 1933
873 Ga0466972_0027337 3300044658 Bacteria 2823
874 Ga0466961_0011363 3300044693 Bacteria 5693
875 Ga0466961_0028348 3300044693 Bacteria 3600
876 Ga0466963_0015006 3300044694 Bacteria 4788
877 Ga0466963_0024760 3300044694 Bacteria 3822
878 Ga0466963_0034218 3300044694 Bacteria 3305
879 Ga0466963_0459130 3300044694 Bacteria 899
880 Ga0466968_0010515 3300044735 Bacteria 3590
881 Ga0466968_0253574 3300044735 Bacteria 836
882 Ga0466970_0177239 3300044765 Bacteria 1182
883 Ga0466957_0002027 3300044842 Bacteria 10800
884 Ga0466960_0025899 3300044901 Bacteria 2659
885 Ga0466959_0013667 3300045049 Bacteria 5890
886 Ga0466959_0033855 3300045049 Bacteria 3779
887 Ga0466959_0068216 3300045049 Bacteria 2577
888 Ga0451576_0064272 3300045051 Bacteria 3823
889 Ga0466958_0025243 3300045836 Bacteria 3502
890 Ga0466958_0246927 3300045836 Bacteria 1141
891 Ga0466967_0015627 3300045976 Bacteria 5956
892 Ga0466967_0037136 3300045976 Bacteria 4165
893 Ga0466967_0086428 3300045976 Bacteria 2841
894 Ga0466967_0146406 3300045976 Bacteria 2203
895 Ga0466967_0313871 3300045976 Bacteria 1511
896 Ga0466967_0402204 3300045976 Bacteria 1332
897 Ga0466967_0558545 3300045976 Bacteria 1127
898 Ga0495627_003594 3300046453 Bacteria 6757
899 Ga0495629_0237250 3300046459 Bacteria 1256
900 Ga0495638_0032605 3300046460 Bacteria 3338
901 Ga0495638_0325835 3300046460 Bacteria 819
902 Ga0495650_0000428 3300046471 Bacteria 68082
903 Ga0495582_0443271 3300046473 Bacteria 750
904 Ga0495662_0063501 3300046476 Bacteria 1784
905 Ga0495584_0162164 3300046491 Bacteria 1136
906 Ga0495585_0039184 3300046492 Bacteria 2664
907 Ga0495585_0041703 3300046492 Bacteria 2573
908 Ga0495583_0000023 3300046506 Bacteria 280019
909 Ga0495583_0001895 3300046506 Bacteria 19369
910 Ga0495583_0003188 3300046506 Bacteria 12867
911 Ga0495583_0069191 3300046506 Bacteria 1555
912 Ga0495606_0000383 3300046507 Bacteria 75070
913 Ga0495606_0007942 3300046507 Bacteria 9347
914 Ga0495606_0031914 3300046507 Bacteria 3656
915 Ga0495610_0000146 3300046512 Bacteria 77326
916 Ga0495610_0132277 3300046512 Bacteria 1082
917 Ga0495616_0189655 3300046513 Bacteria 909
918 Ga0495631_0001928 3300046518 Bacteria 12186
919 Ga0495637_0001942 3300046520 Bacteria 11707
920 Ga0495637_0011424 3300046520 Bacteria 4267
921 Ga0495643_0004145 3300046522 Bacteria 10301
922 Ga0495643_0006878 3300046522 Bacteria 7409
923 Ga0495643_0084923 3300046522 Bacteria 1642
924 Ga0495643_0236448 3300046522 Bacteria 859
925 Ga0495648_0001391 3300046524 Bacteria 23802
926 Ga0495663_0002898 3300046525 Bacteria 5065
927 Ga0495654_0066436 3300046530 Bacteria 1719
928 Ga0495654_0080270 3300046530 Bacteria 1531
929 Ga0495587_0153556 3300046536 Bacteria 1312
930 Ga0495609_0113675 3300046538 Bacteria 1167
931 Ga0495621_0002284 3300046539 Bacteria 5135
932 Ga0495621_0030722 3300046539 Bacteria 1839
933 Ga0495597_0012717 3300046542 Bacteria 4054
934 Ga0495633_0002596 3300046558 Bacteria 12647
935 Ga0495633_0003946 3300046558 Bacteria 9655
936 Ga0495633_0013402 3300046558 Bacteria 4322
937 Ga0495633_0029090 3300046558 Bacteria 2688
938 Ga0495668_0000218 3300046616 Bacteria 83540
939 Ga0495668_0023087 3300046616 Bacteria 3551
940 Ga0495668_0169808 3300046616 Bacteria 1195
941 Ga0495668_0246353 3300046616 Bacteria 978
942 Ga0495611_0007098 3300046648 Bacteria 4758
943 Ga0495625_0000496 3300046660 Bacteria 58853
944 Ga0495625_0001071 3300046660 Bacteria 35534
945 Ga0495625_0011582 3300046660 Bacteria 7178
946 Ga0495625_0044610 3300046660 Bacteria 3209
947 Ga0495625_0154925 3300046660 Bacteria 1538
948 Ga0495661_0012693 3300046665 Bacteria 5687
949 Ga0495661_0029644 3300046665 Bacteria 3491
950 Ga0495588_0318398 3300046674 Bacteria 818
951 Ga0495669_0000241 3300046684 Bacteria 32038
952 Ga0495669_0008608 3300046684 Bacteria 4294
953 Ga0495669_0017147 3300046684 Bacteria 3105
954 Ga0495669_0098652 3300046684 Bacteria 1355
955 Ga0495670_0000028 3300046691 Bacteria 90085
956 Ga0495670_0024419 3300046691 Bacteria 2987
957 Ga0495649_0237533 3300046694 Bacteria 939
958 Ga0495600_0049411 3300046809 Bacteria 2744
959 Ga0495660_0118787 3300046810 Bacteria 1340
960 Ga0495660_0142058 3300046810 Bacteria 1193
961 Ga0495683_0010498 3300047323 Bacteria 4890
962 Ga0495687_001043 3300047443 Bacteria 27520
963 Ga0495687_001672 3300047443 Bacteria 19833
964 Ga0495677_0005009 3300047445 Bacteria 5054
965 Ga0495677_0151658 3300047445 Bacteria 892
966 Ga0495681_0000214 3300047470 Bacteria 48192
967 Ga0495681_0025540 3300047470 Bacteria 3088
968 Ga0495686_0001053 3300047472 Bacteria 32974
969 Ga0495686_0002522 3300047472 Bacteria 17141
970 Ga0495686_0004950 3300047472 Bacteria 10718
971 Ga0495686_0083568 3300047472 Bacteria 1947
972 Ga0495686_0099470 3300047472 Bacteria 1756
973 Ga0496100_0005362 3300048903 Bacteria 6896
974 Ga0496100_0132399 3300048903 Bacteria 1758
975 Ga0496101_0001845 3300048904 Bacteria 12772
976 Ga0496101_0020761 3300048904 Bacteria 4505
977 Ga0496101_0141793 3300048904 Bacteria 1832
978 Ga0496101_0265316 3300048904 Bacteria 1340
979 Ga0496102_0000719 3300048905 Bacteria 32658
980 Ga0496102_0000756 3300048905 Bacteria 31601
981 Ga0496102_0004530 3300048905 Bacteria 11741
982 Ga0496102_0357322 3300048905 Bacteria 1375
983 Ga0496102_0583481 3300048905 Bacteria 1041
984 Ga0496103_0000562 3300048906 Bacteria 29450
985 Ga0496103_0002302 3300048906 Bacteria 12068
986 Ga0496103_0007333 3300048906 Bacteria 6572
987 Ga0496103_0014624 3300048906 Bacteria 4663
988 Ga0496103_0070972 3300048906 Bacteria 2179
989 Ga0496103_0423131 3300048906 Bacteria 855
990 Ga0496104_0017339 3300048907 Bacteria 6555
991 Ga0496104_0063254 3300048907 Bacteria 3509
992 Ga0496105_0009443 3300048908 Bacteria 7630
993 Ga0496105_0035375 3300048908 Bacteria 4111
994 Ga0496105_0086958 3300048908 Bacteria 2583
995 Ga0496105_0156845 3300048908 Bacteria 1869
996 Ga0496106_0024920 3300048909 Bacteria 4448
997 Ga0496106_0397289 3300048909 Bacteria 1108
998 Ga0496107_0002051 3300048910 Bacteria 12880
999 Ga0496107_0047010 3300048910 Bacteria 3107
1000 Ga0496107_0165819 3300048910 Bacteria 1638
1001 Ga0496108_0014779 3300048911 Bacteria 6372
1002 Ga0496108_0051888 3300048911 Bacteria 3435
1003 Ga0496109_0030292 3300048912 Bacteria 4850
1004 Ga0496109_0038420 3300048912 Bacteria 4327
1005 Ga0496109_0064818 3300048912 Bacteria 3344
1006 Ga0496109_0071775 3300048912 Bacteria 3180
1007 Ga0496110_0000948 3300048913 Bacteria 20317
1008 Ga0496110_0009431 3300048913 Bacteria 7906
1009 Ga0496110_0029480 3300048913 Bacteria 4724
1010 Ga0496110_0083631 3300048913 Bacteria 2848
1011 Ga0496110_0275824 3300048913 Bacteria 1531
1012 Ga0496110_0471574 3300048913 Bacteria 1144
1013 Ga0496111_0001035 3300048914 Bacteria 15288
1014 Ga0496111_0004529 3300048914 Bacteria 8794
1015 Ga0496111_0022502 3300048914 Bacteria 4414
1016 Ga0496111_0074293 3300048914 Bacteria 2476
1017 Ga0496112_0013316 3300048915 Bacteria 7592
1018 Ga0496112_0554255 3300048915 Bacteria 1083
1019 Ga0496113_0025057 3300048916 Bacteria 4248
1020 Ga0496113_0284930 3300048916 Bacteria 1321
1021 Ga0496114_0022765 3300048917 Bacteria 5107
1022 Ga0496115_0000464 3300048918 Bacteria 32447
1023 Ga0496115_0005489 3300048918 Bacteria 9229
1024 Ga0496116_0002037 3300048919 Bacteria 21676
1025 Ga0496116_0009864 3300048919 Bacteria 8081
1026 Ga0496116_0056694 3300048919 Bacteria 2566
1027 Ga0496117_0000519 3300048920 Bacteria 63633
1028 Ga0496117_0001114 3300048920 Bacteria 40518
1029 Ga0496117_0011627 3300048920 Bacteria 7867
1030 Ga0496117_0021825 3300048920 Bacteria 5163
1031 Ga0496117_0037145 3300048920 Bacteria 3633
1032 Ga0496117_0040426 3300048920 Bacteria 3429
1033 Ga0496118_0000127 3300048921 Bacteria 135377
1034 Ga0496118_0000193 3300048921 Bacteria 107307
1035 Ga0496118_0001703 3300048921 Bacteria 32166
1036 Ga0496118_0004860 3300048921 Bacteria 15648
1037 Ga0496118_0009117 3300048921 Bacteria 10095
1038 Ga0496118_0029470 3300048921 Bacteria 4601
1039 Ga0496119_0027214 3300048922 Bacteria 3937
1040 Ga0496119_0036669 3300048922 Bacteria 3197
1041 Ga0496119_0040560 3300048922 Bacteria 2975
1042 Ga0496120_0049671 3300048923 Bacteria 2406
1043 Ga0496121_0005712 3300048924 Bacteria 15799
1044 Ga0496121_0010096 3300048924 Bacteria 10710
1045 Ga0496121_0051385 3300048924 Bacteria 3472
1046 Ga0496122_0016138 3300048925 Bacteria 7094
1047 Ga0496123_0030686 3300048926 Bacteria 3930
1048 Ga0496124_0000011 3300048927 Bacteria 524145
1049 Ga0496124_0000237 3300048927 Bacteria 107270
1050 Ga0496124_0067342 3300048927 Bacteria 2980
1051 Ga0496125_0001918 3300048928 Bacteria 28461
1052 Ga0496125_0062178 3300048928 Bacteria 2988
1053 Ga0496126_0007282 3300048929 Bacteria 12162
1054 Ga0496126_0008126 3300048929 Bacteria 11358
1055 Ga0496126_0341185 3300048929 Bacteria 1227
1056 Ga0495682_0023253 3300049460 Bacteria 2314
1057 Ga0501290_002973 3300049513 Bacteria 2156
1058 Ga0501290_011399 3300049513 Bacteria 1145
1059 Ga0501292_000040 3300049515 Bacteria 31058
1060 Ga0501043_0099754 3300049579 Bacteria 2282
1061 Ga0501047_0000402 3300049581 Bacteria 48648
1062 Ga0501206_001042 3300049653 Bacteria 3455
1063 Ga0501208_006654 3300049655 Bacteria 1483
1064 Ga0501222_002113 3300049662 Bacteria 2752
1065 Ga0501223_001533 3300049663 Bacteria 5329
1066 Ga0501224_001796 3300049664 Bacteria 2885
1067 Ga0501235_003681 3300049669 Bacteria 3310
1068 Ga0501249_000545 3300049679 Bacteria 9066
1069 Ga0501257_000093 3300049686 Bacteria 21754
1070 Ga0501261_000110 3300049690 Bacteria 12389
1071 Ga0501221_001519 3300049704 Bacteria 3840
1072 Ga0501225_0027884 3300049705 Bacteria 1552
1073 Ga0501245_002143 3300049708 Bacteria 2622
1074 Ga0501080_0971614 3300049742 Bacteria 738
1075 Ga0501279_000008 3300049775 Bacteria 125267
1076 Ga0501280_000233 3300049776 Bacteria 13988
1077 Ga0501280_000772 3300049776 Bacteria 6988
1078 Ga0501281_00064 3300049777 Bacteria 12462
1079 Ga0501282_000614 3300049778 Bacteria 4119
1080 Ga0501204_005049 3300049850 Bacteria 1434
1081 nmdc:mga0qj67_621834_c1 3300050509 Bacteria 863
1082 nmdc:mga08y16_94019_c1 3300050511 Bacteria 3123
1083 nmdc:mga0sz30_41051_c1 3300050516 Bacteria 1945
1084 Ga0500610_0000668 3300053079 Bacteria 10580
1085 Ga0500643_000136 3300053087 Bacteria 74292
1086 Ga0500643_000338 3300053087 Bacteria 37288
1087 Ga0500643_001250 3300053087 Bacteria 15061
1088 Ga0500643_001549 3300053087 Bacteria 13025
1089 Ga0500643_002056 3300053087 Bacteria 10762
1090 Ga0500643_002934 3300053087 Bacteria 8461
1091 Ga0500643_007149 3300053087 Bacteria 4564
1092 Ga0500647_0092524 3300053091 Bacteria 1447
1093 Ga0500651_0042612 3300053093 Bacteria 2860
1094 Ga0500566_0000877 3300053094 Bacteria 17172
1095 Ga0500555_000164 3300053103 Bacteria 30996
1096 Ga0500592_000232 3300053116 Bacteria 10092
1097 Ga0500592_002720 3300053116 Bacteria 2846
1098 Ga0500592_022616 3300053116 Bacteria 1013
1099 Ga0500595_002635 3300053119 Bacteria 8733
1100 Ga0500608_076391 3300053122 Bacteria 1586
1101 Ga0500608_192747 3300053122 Bacteria 850
1102 Ga0500642_0000751 3300053130 Bacteria 9519
1103 Ga0500642_0018625 3300053130 Bacteria 2690
1104 Ga0500655_000159 3300053133 Bacteria 16704
1105 Ga0500658_0002920 3300053134 Bacteria 6563
1106 Ga0500658_0185545 3300053134 Bacteria 948
1107 Ga0500559_0031963 3300053136 Bacteria 2259
1108 Ga0500559_0110284 3300053136 Bacteria 1274
1109 Ga0500564_057764 3300053138 Bacteria 1764
1110 Ga0500568_0015114 3300053139 Bacteria 3462
1111 Ga0500573_0000019 3300053140 Bacteria 173601
1112 Ga0500573_0175726 3300053140 Bacteria 1155
1113 Ga0500577_0032742 3300053142 Bacteria 1831
1114 Ga0500590_005065 3300053148 Bacteria 6310
1115 Ga0500616_0002503 3300053153 Bacteria 15215
1116 Ga0500624_000009 3300053157 Bacteria 178763
1117 Ga0500627_0000091 3300053158 Bacteria 30128
1118 Ga0500636_0319596 3300053177 Bacteria 755
1119 Ga0500570_001921 3300053724 Bacteria 9977
1120 Ga0500625_000011 3300053729 Bacteria 133655
1121 Ga0500645_000237 3300053730 Bacteria 41544
1122 Ga0500645_001144 3300053730 Bacteria 14373
1123 Ga0500645_011613 3300053730 Bacteria 2870
1124 Ga0500645_020770 3300053730 Bacteria 2032
1125 Ga0466962_0036472 3300061719 Bacteria 2353
1126 2600202819 2599185354 Bacteria 4398675
1127 2600228189 2599185359 Bacteria 4772316
1128 2643730531 2643221541 Bacteria 5498788
1129 2644037506 2643221605 Bacteria 4772303
1130 2644043700 2643221606 Bacteria 5588032
1131 2644128132 2643221622 Bacteria 4212502
1132 2644393859 2643221671 Bacteria 5496681
1133 2819716234 2818991466 Bacteria 4748179
1134 2879163813 2879163058 Bacteria 4223965
1135 2885430514 2885429604 Bacteria 3642894
1136 2928528963 2928526807 Bacteria 4760224
1137 2928971198 2928968154 Bacteria 4633371
1138 2990265880 2990265787 Bacteria 3943888
1139 2993696329 2993693658 Bacteria 4040749
1140 8057101643 8057101203 Bacteria 5034064
1141 Ga0268266_10473503
1142 JGI24736J21556_1000030
1143 JGI24741J21665_1001317
1144 JGI24741J21665_1004089
1145 JGI24752J21851_1004310
1146 JGI24740J21852_10003058
1147 JGI24740J21852_10030569
1148 JGI24739J22299_10001692
1149 JGI24739J22299_10006535
1150 JGI24739J22299_10047732
1151 JGI24737J22298_10002390
1152 JGI24737J22298_10005137
1153 JGI24737J22298_10039840
1154 JGI24735J21928_10000944
1155 JGI24735J21928_10014907
1156 JGI24735J21928_10021243
1157 JGI24735J21928_10023346
1158 JGI24735J21928_10051268
1159 JGI24750J21931_1000713
1160 JGI24748J21848_1000015
1161 JGI24738J21930_10000900
1162 JGI24738J21930_10034667
1163 JGI24034J26672_10000006
1164 JGI24034J26672_10011930
1165 JGI24742J22300_10002123
1166 JGI24751J29686_10000093
1167 JGI24751J29686_10004337
1168 JGI25150J39212_1000855
1169 JGI25165J46597_1000024
1170 JGI25153J46596_10000008
1171 JGI25153J46596_10000091
1172 JGI25153J46596_10000186
1173 JGI25153J46596_10004838
1174 Ga0055542_1004222
1175 Ga0055537_1001760
1176 Ga0055537_1002910
1177 Ga0055524_1000118
1178 Ga0055530_10000072
1179 Ga0055530_10019126
1180 Ga0055540_1001847
1181 Ga0055531_10000114
1182 Ga0055531_10001624
1183 Ga0065165_1002052
1184 Ga0065165_1012710
1185 Ga0065704_10097475
1186 Ga0065712_10079995
1187 Ga0065707_10082467
1188 Ga0065707_10082564
1189 Ga0070658_10000181
1190 Ga0070658_10001561
1191 Ga0070658_10007616
1192 Ga0070658_10028040
1193 Ga0070658_10079969
1194 Ga0070658_10192660
1195 Ga0070676_10005147
1196 Ga0070676_10091881
1197 Ga0070676_10217451
1198 Ga0070683_100006563
1199 Ga0070683_100122456
1200 Ga0070683_100195833
1201 Ga0070690_100000012
1202 Ga0070670_100000005
1203 Ga0070670_100000169
1204 Ga0070670_100000528
1205 Ga0070670_100002960
1206 Ga0070670_100036176
1207 Ga0070670_100049951
1208 Ga0070677_10061237
1209 Ga0068869_100000635
1210 Ga0070666_10000014
1211 Ga0070666_10004574
1212 Ga0070666_10012077
1213 Ga0070680_100414715
1214 Ga0068868_100000049
1215 Ga0068868_100119637
1216 Ga0070660_100003617
1217 Ga0070660_100024707
1218 Ga0070660_100031552
1219 Ga0070660_100045703
1220 Ga0070660_100193300
1221 Ga0070660_100550573
1222 Ga0070689_100029687
1223 Ga0070691_10000763
1224 Ga0070661_100005116
1225 Ga0070661_100015407
1226 Ga0070661_100022812
1227 Ga0070661_100029811
1228 Ga0070661_100036547
1229 Ga0070661_100138860
1230 Ga0070692_10060955
1231 Ga0070692_10125102
1232 Ga0070668_100000007
1233 Ga0070668_100002131
1234 Ga0070668_100011256
1235 Ga0070668_100021509
1236 Ga0070668_100124704
1237 Ga0070668_100399676
1238 Ga0070669_100000195
1239 Ga0070669_100000351
1240 Ga0070669_100034494
1241 Ga0070669_100291587
1242 Ga0070675_100002343
1243 Ga0070675_100013583
1244 Ga0070671_100000388
1245 Ga0070671_100000461
1246 Ga0070671_100014361
1247 Ga0070671_100020224
1248 Ga0070671_100078984
1249 Ga0070671_100121302
1250 Ga0070671_100239139
1251 Ga0070674_100032561
1252 Ga0070674_100215623
1253 Ga0070674_100218977
1254 Ga0070673_100000006
1255 Ga0070673_100020191
1256 Ga0070673_100024623
1257 Ga0070673_100045414
1258 Ga0070673_100065042
1259 Ga0070688_100010920
1260 Ga0070659_100005974
1261 Ga0070659_100007753
1262 Ga0070659_100031286
1263 Ga0070659_100059821
1264 Ga0070659_100151979
1265 Ga0070659_100235550
1266 Ga0070667_100000003
1267 Ga0070667_100000327
1268 Ga0070667_100000873
1269 Ga0070667_100001850
1270 Ga0070667_100022481
1271 Ga0070667_100033868
1272 Ga0070667_100113824
1273 Ga0070667_100674259
1274 Ga0070714_100188223
1275 Ga0070713_100502716
1276 Ga0070705_100710137
1277 Ga0070663_100016888
1278 Ga0070663_100028223
1279 Ga0070663_100051649
1280 Ga0070663_100113967
1281 Ga0070663_100671073
1282 Ga0070663_100695733
1283 Ga0070678_100000505
1284 Ga0070678_100008600
1285 Ga0070678_100166600
1286 Ga0070662_100005871
1287 Ga0070662_100006250
1288 Ga0070662_100021277
1289 Ga0070662_100131956
1290 Ga0070662_100228129
1291 Ga0070681_10029966
1292 Ga0070681_10069647
1293 Ga0068867_100000001
1294 Ga0068867_100029493
1295 Ga0068867_100524361
1296 Ga0070685_10002655
1297 Ga0070679_100033561
1298 Ga0070679_100153616
1299 Ga0070684_100004255
1300 Ga0070684_100125792
1301 Ga0070684_100143776
1302 Ga0068853_100016963
1303 Ga0068853_100035156
1304 Ga0068853_100064038
1305 Ga0068853_100066503
1306 Ga0068853_100106522
1307 Ga0068853_100191840
1308 Ga0068853_100261358
1309 Ga0068853_100289580
1310 Ga0070672_100006310
1311 Ga0070672_100014230
1312 Ga0070672_100064036
1313 Ga0070672_100185299
1314 Ga0070686_100000002
1315 Ga0070686_100046913
1316 Ga0070695_100011571
1317 Ga0070696_100003877
1318 Ga0070696_100006531
1319 Ga0070665_100000025
1320 Ga0070665_100000471
1321 Ga0070665_100009495
1322 Ga0070665_100050070
1323 Ga0070665_100069910
1324 Ga0070665_100597007
1325 Ga0068855_100000023
1326 Ga0068855_100003431
1327 Ga0068855_100058591
1328 Ga0068855_100256310
1329 Ga0068855_100259344
1330 Ga0070664_100000093
1331 Ga0070664_100003267
1332 Ga0070664_100006241
1333 Ga0070664_100062965
1334 Ga0070664_100073476
1335 Ga0070664_100081692
1336 Ga0070664_100168737
1337 Ga0068857_100015202
1338 Ga0068857_100015964
1339 Ga0068857_100288529
1340 Ga0068854_100000722
1341 Ga0068854_100005206
1342 Ga0068854_100027141
1343 Ga0068854_100029193
1344 Ga0068854_100095691
1345 Ga0068854_100100723
1346 Ga0068854_100121256
1347 Ga0068854_100164056
1348 Ga0068854_100247681
1349 Ga0068856_100033806
1350 Ga0068856_100042299
1351 Ga0068856_100063293
1352 Ga0068856_100275276
1353 Ga0068856_100290640
1354 Ga0068852_100001538
1355 Ga0068852_100021306
1356 Ga0068852_100043422
1357 Ga0068852_100049064
1358 Ga0068859_100007110
1359 Ga0068859_100008939
1360 Ga0068859_100014394
1361 Ga0068859_100021440
1362 Ga0068859_100029142
1363 Ga0068859_100065318
1364 Ga0068859_100127874
1365 Ga0068859_100256410
1366 Ga0068859_100358221
1367 Ga0068864_100000004
1368 Ga0068864_100000011
1369 Ga0068864_100000078
1370 Ga0068864_100003288
1371 Ga0068864_100012174
1372 Ga0068864_100017806
1373 Ga0068864_100070649
1374 Ga0068866_10001322
1375 Ga0068861_100000132
1376 Ga0068861_100000629
1377 Ga0068861_100017934
1378 Ga0068861_100233353
1379 Ga0068851_10005578
1380 Ga0068851_10025486
1381 Ga0068851_10027636
1382 Ga0068851_10078004
1383 Ga0068851_10090935
1384 Ga0068863_100000002
1385 Ga0068863_100000270
1386 Ga0068863_100001062
1387 Ga0068863_100001939
1388 Ga0068863_100002169
1389 Ga0068863_100003398
1390 Ga0068863_100004607
1391 Ga0068863_100017965
1392 Ga0068863_100053028
1393 Ga0068863_100076334
1394 Ga0068863_100370262
1395 Ga0068858_100000181
1396 Ga0068858_100000832
1397 Ga0068858_100006226
1398 Ga0068858_100006347
1399 Ga0068858_100007133
1400 Ga0068858_100180276
1401 Ga0068860_100000001
1402 Ga0068860_100000045
1403 Ga0068860_100000834
1404 Ga0068860_100004334
1405 Ga0068860_100016501
1406 Ga0068860_100060507
1407 Ga0068860_100076230
1408 Ga0068860_100080027
1409 Ga0068860_100347777
1410 Ga0068860_100423460
1411 Ga0068860_100693098
1412 Ga0068862_100000002
1413 Ga0068862_100000011
1414 Ga0068862_100000032
1415 Ga0068862_100000048
1416 Ga0068862_100000989
1417 Ga0068862_100007656
1418 Ga0068862_100009813
1419 Ga0068862_100199992
1420 Ga0070712_100210454
1421 Ga0097621_100002557
1422 Ga0068871_100031090
1423 Ga0075430_100038654
1424 Ga0068865_100000003
1425 Ga0097620_100007111
1426 Ga0097620_100008939
1427 Ga0097620_100014392
1428 Ga0097620_100021440
1429 Ga0097620_100029143
1430 Ga0097620_100065319
1431 Ga0097620_100127861
1432 Ga0097620_100256395
1433 Ga0097620_100358208
1434 Ga0105251_10000342
1435 Ga0105250_10005428
1436 Ga0105240_10009282
1437 Ga0105240_10011291
1438 Ga0105240_10040268
1439 Ga0105240_10075745
1440 Ga0105240_10079587
1441 Ga0111539_10073522
1442 Ga0105245_10001536
1443 Ga0105245_10006243
1444 Ga0105245_10031992
1445 Ga0105247_10012347
1446 Ga0105247_10155492
1447 Ga0105243_10000611
1448 Ga0105243_10001363
1449 Ga0105243_10412562
1450 Ga0105241_10011404
1451 Ga0105242_10000818
1452 Ga0105242_10003633
1453 Ga0105242_10258590
1454 Ga0105242_10719686
1455 Ga0105248_10000016
1456 Ga0105248_10000069
1457 Ga0105248_10002223
1458 Ga0105248_10002773
1459 Ga0105248_10014376
1460 Ga0105248_10026331
1461 Ga0105248_10033496
1462 Ga0105248_10046730
1463 Ga0105248_10065059
1464 Ga0105248_10069459
1465 Ga0105248_10155231
1466 Ga0105248_10374757
1467 Ga0105248_10426907
1468 Ga0105248_10471263
1469 Ga0105237_10030869
1470 Ga0105237_10032851
1471 Ga0105237_10054983
1472 Ga0105237_10155275
1473 Ga0105237_10570343
1474 Ga0105238_10003703
1475 Ga0105238_10016971
1476 Ga0105238_10020220
1477 Ga0105238_10025509
1478 Ga0105238_10056843
1479 Ga0105238_10067233
1480 Ga0105238_10154632
1481 Ga0105238_10367966
1482 Ga0105238_10633714
1483 Ga0105238_10969517
1484 Ga0105249_10000005
1485 Ga0105249_10000017
1486 Ga0105249_10000106
1487 Ga0105249_10005694
1488 Ga0105249_10166446
1489 Ga0105249_10266691
1490 Ga0105239_10070023
1491 Ga0105239_10098131
1492 Ga0105246_10000620
1493 Ga0157373_10028624
1494 Ga0157373_10085988
1495 Ga0157373_10102585
1496 Ga0157373_10136279
1497 Ga0157373_10272680
1498 Ga0157373_10429189
1499 Ga0157373_10537277
1500 Ga0157371_10000110
1501 Ga0157371_10037024
1502 Ga0157371_10040991
1503 Ga0157371_10128541
1504 Ga0157371_10152424
1505 Ga0157370_10012605
1506 Ga0157370_10041223
1507 Ga0157370_10112118
1508 Ga0157369_10002495
1509 Ga0157369_10003524
1510 Ga0157369_10008669
1511 Ga0157369_10008947
1512 Ga0157369_10009057
1513 Ga0157369_10068610
1514 Ga0157369_10094805
1515 Ga0157374_10006203
1516 Ga0157374_10046810
1517 Ga0157374_10070052
1518 Ga0157374_10080623
1519 Ga0157374_10090575
1520 Ga0157374_11346219
1521 Ga0157378_10008062
1522 Ga0157378_10033143
1523 Ga0157378_10042832
1524 Ga0157378_10217265
1525 Ga0163162_10005086
1526 Ga0163162_10048885
1527 Ga0163162_10050115
1528 Ga0163162_10081335
1529 Ga0163162_10091245
1530 Ga0163162_10250436
1531 Ga0157372_10064804
1532 Ga0157372_10085245
1533 Ga0157372_10107945
1534 Ga0157372_10116707
1535 Ga0157372_10305248
1536 Ga0157372_10494116
1537 Ga0157372_10510680
1538 Ga0157372_10512443
1539 Ga0157372_10605423
1540 Ga0157375_10004152
1541 Ga0157375_10035911
1542 Ga0157375_10037485
1543 Ga0157375_10435869
1544 Ga0163163_10000588
1545 Ga0163163_10039738
1546 Ga0163163_10095415
1547 Ga0163163_10346614
1548 Ga0163163_11008936
1549 Ga0157380_10000363
1550 Ga0157380_10001569
1551 Ga0157380_10024926
1552 Ga0157379_10031170
1553 Ga0157379_10034380
1554 Ga0157379_10154402
1555 Ga0157379_10181989
1556 Ga0157376_10000955
1557 Ga0157376_10001235
1558 Ga0163161_10000509
1559 Ga0163161_10007048
1560 Ga0163161_10294282
1561 Ga0206356_10636768
1562 Ga0206356_10794718
1563 Ga0206354_10580221
1564 Ga0206353_11160495
1565 Ga0213876_10000714
1566 Ga0213875_10001461
1567 Ga0213875_10002933
1568 Ga0207672_1001571
1569 Ga0209563_100130
1570 Ga0209677_107479
1571 Ga0209148_1000171
1572 Ga0209129_1003658
1573 Ga0209233_1000084
1574 Ga0209233_1018102
1575 Ga0209565_1000011
1576 Ga0209565_1000170
1577 Ga0209455_1001814
1578 Ga0209455_1009677
1579 Ga0209673_1000827
1580 Ga0209673_1008761
1581 Ga0209676_1006991
1582 Ga0209025_1000068
1583 Ga0209564_1000335
1584 Ga0209564_1016363
1585 Ga0209758_1000017
1586 Ga0209758_1000019
1587 Ga0209050_1000001
1588 Ga0209050_1000108
1589 Ga0209050_1000209
1590 Ga0209050_1009517
1591 Ga0209050_1009555
1592 Ga0209050_1019060
1593 Ga0209256_1000016
1594 Ga0209051_1000239
1595 Ga0209257_1000027
1596 Ga0209257_1001066
1597 Ga0209257_1001071
1598 Ga0209257_1001515
1599 Ga0209257_1013597
1600 Ga0207697_10045640
1601 Ga0207656_10001422
1602 Ga0207656_10005083
1603 Ga0207656_10028661
1604 Ga0207656_10029028
1605 Ga0207656_10039998
1606 Ga0207656_10112987
1607 Ga0207713_1003473
1608 Ga0207642_10007833
1609 Ga0207710_10068749
1610 Ga0207710_10075666
1611 Ga0207688_10015331
1612 Ga0207680_10000004
1613 Ga0207680_10002571
1614 Ga0207680_10009078
1615 Ga0207680_10175237
1616 Ga0207647_10000805
1617 Ga0207647_10005630
1618 Ga0207647_10078400
1619 Ga0207647_10084282
1620 Ga0207647_10088179
1621 Ga0207647_10117171
1622 Ga0207647_10251248
1623 Ga0207645_10015238
1624 Ga0207645_10026774
1625 Ga0207645_10080062
1626 Ga0207645_10086739
1627 Ga0207645_10110473
1628 Ga0207705_10000121
1629 Ga0207705_10000592
1630 Ga0207705_10017650
1631 Ga0207705_10024003
1632 Ga0207705_10031278
1633 Ga0207705_10042845
1634 Ga0207705_10043256
1635 Ga0207705_10079630
1636 Ga0207654_10003722
1637 Ga0207654_10011547
1638 Ga0207707_10008275
1639 Ga0207707_10096899
1640 Ga0207707_10344103
1641 Ga0207695_10002715
1642 Ga0207695_10007597
1643 Ga0207695_10016512
1644 Ga0207695_10038816
1645 Ga0207671_10001479
1646 Ga0207671_10011623
1647 Ga0207671_10013100
1648 Ga0207671_10175338
1649 Ga0207671_10254387
1650 Ga0207671_10694554
1651 Ga0207693_10210615
1652 Ga0207660_10038492
1653 Ga0207660_10161905
1654 Ga0207660_10181164
1655 Ga0207657_10002178
1656 Ga0207657_10003582
1657 Ga0207657_10008376
1658 Ga0207657_10012964
1659 Ga0207657_10014496
1660 Ga0207657_10016571
1661 Ga0207657_10023959
1662 Ga0207657_10035869
1663 Ga0207657_10167232
1664 Ga0207657_10247796
1665 Ga0207657_10382327
1666 Ga0207649_10000475
1667 Ga0207649_10006830
1668 Ga0207649_10015845
1669 Ga0207649_10153329
1670 Ga0207652_10037349
1671 Ga0207681_10000001
1672 Ga0207681_10000038
1673 Ga0207681_10049750
1674 Ga0207681_10054598
1675 Ga0207681_10059426
1676 Ga0207681_10229385
1677 Ga0207681_10250157
1678 Ga0207681_10293046
1679 Ga0207694_10001050
1680 Ga0207694_10004743
1681 Ga0207694_10009796
1682 Ga0207694_10014424
1683 Ga0207694_10021743
1684 Ga0207694_10026198
1685 Ga0207694_10053932
1686 Ga0207694_10183155
1687 Ga0207694_10512327
1688 Ga0207650_10000018
1689 Ga0207650_10000294
1690 Ga0207650_10004568
1691 Ga0207650_10024760
1692 Ga0207650_10080057
1693 Ga0207650_10121113
1694 Ga0207650_10200919
1695 Ga0207650_10287302
1696 Ga0207659_10000922
1697 Ga0207659_10271913
1698 Ga0207687_10004504
1699 Ga0207644_10000039
1700 Ga0207644_10000197
1701 Ga0207644_10000214
1702 Ga0207644_10000863
1703 Ga0207644_10002893
1704 Ga0207644_10010201
1705 Ga0207644_10020550
1706 Ga0207644_10022249
1707 Ga0207644_10031319
1708 Ga0207644_10036676
1709 Ga0207644_10537220
1710 Ga0207690_10002990
1711 Ga0207690_10007682
1712 Ga0207690_10008018
1713 Ga0207690_10012702
1714 Ga0207690_10056672
1715 Ga0207690_10107312
1716 Ga0207690_10363951
1717 Ga0207706_10004569
1718 Ga0207706_10005341
1719 Ga0207706_10009419
1720 Ga0207706_10011916
1721 Ga0207706_10022091
1722 Ga0207706_10028785
1723 Ga0207706_10047492
1724 Ga0207706_10051583
1725 Ga0207706_10062580
1726 Ga0207706_10373486
1727 Ga0207686_10002145
1728 Ga0207686_10013436
1729 Ga0207709_10000629
1730 Ga0207709_10000951
1731 Ga0207709_10058533
1732 Ga0207709_10614511
1733 Ga0207670_10106249
1734 Ga0207669_10000755
1735 Ga0207669_10005841
1736 Ga0207669_10069602
1737 Ga0207669_10209644
1738 Ga0207704_10000001
1739 Ga0207704_10061836
1740 Ga0207704_10665084
1741 Ga0207691_10003283
1742 Ga0207691_10056417
1743 Ga0207691_10099573
1744 Ga0207691_10704127
1745 Ga0207711_10000022
1746 Ga0207711_10000042
1747 Ga0207711_10001064
1748 Ga0207711_10002492
1749 Ga0207711_10012589
1750 Ga0207711_10047359
1751 Ga0207711_10063922
1752 Ga0207711_10088519
1753 Ga0207711_10209286
1754 Ga0207711_10256413
1755 Ga0207711_10371094
1756 Ga0207689_10001710
1757 Ga0207689_10069129
1758 Ga0207689_10117639
1759 Ga0207661_10228734
1760 Ga0207661_10481259
1761 Ga0207679_10002349
1762 Ga0207679_10014116
1763 Ga0207679_10014928
1764 Ga0207679_10041360
1765 Ga0207679_10058126
1766 Ga0207679_10074849
1767 Ga0207679_10222304
1768 Ga0207679_10303461
1769 Ga0207667_10000001
1770 Ga0207667_10000016
1771 Ga0207667_10000651
1772 Ga0207667_10000692
1773 Ga0207667_10010455
1774 Ga0207667_10021125
1775 Ga0207667_10172630
1776 Ga0207667_10367666
1777 Ga0207651_10000002
1778 Ga0207651_10003812
1779 Ga0207651_10003837
1780 Ga0207651_10011490
1781 Ga0207651_10411755
1782 Ga0207712_10000001
1783 Ga0207712_10000012
1784 Ga0207712_10000224
1785 Ga0207712_10030985
1786 Ga0207712_10101759
1787 Ga0207712_10433445
1788 Ga0207712_10733493
1789 Ga0207668_10000026
1790 Ga0207668_10000228
1791 Ga0207668_10000490
1792 Ga0207668_10013664
1793 Ga0207668_10014529
1794 Ga0207668_10203323
1795 Ga0207668_10548058
1796 Ga0207640_10000891
1797 Ga0207640_10004646
1798 Ga0207640_10005537
1799 Ga0207640_10037340
1800 Ga0207640_10046863
1801 Ga0207640_10047485
1802 Ga0207640_10086439
1803 Ga0207640_10095691
1804 Ga0207640_10208530
1805 Ga0207640_10281484
1806 Ga0207640_10500198
1807 Ga0207658_10000002
1808 Ga0207658_10000364
1809 Ga0207658_10000545
1810 Ga0207658_10000902
1811 Ga0207658_10009480
1812 Ga0207658_10009613
1813 Ga0207658_10009967
1814 Ga0207658_10049116
1815 Ga0207658_10225527
1816 Ga0207677_10000030
1817 Ga0207677_10009857
1818 Ga0207703_10000135
1819 Ga0207703_10000404
1820 Ga0207703_10001087
1821 Ga0207703_10015254
1822 Ga0207703_10054327
1823 Ga0207639_10002074
1824 Ga0207639_10007490
1825 Ga0207639_10008847
1826 Ga0207639_10044857
1827 Ga0207639_10051972
1828 Ga0207639_10095900
1829 Ga0207639_10187075
1830 Ga0207639_10254497
1831 Ga0207678_10006676
1832 Ga0207678_10008727
1833 Ga0207678_10036870
1834 Ga0207678_10048089
1835 Ga0207678_10067448
1836 Ga0207678_10076194
1837 Ga0207678_10257733
1838 Ga0207702_10000462
1839 Ga0207702_10016406
1840 Ga0207702_10052596
1841 Ga0207702_10185626
1842 Ga0207702_10198470
1843 Ga0207702_10201102
1844 Ga0207702_10414569
1845 Ga0207702_10449235
1846 Ga0207641_10000002
1847 Ga0207641_10000024
1848 Ga0207641_10000033
1849 Ga0207641_10000277
1850 Ga0207641_10000626
1851 Ga0207641_10001261
1852 Ga0207641_10002117
1853 Ga0207641_10004973
1854 Ga0207641_10005398
1855 Ga0207641_10006503
1856 Ga0207641_10017421
1857 Ga0207641_10173019
1858 Ga0207648_10000001
1859 Ga0207648_10003494
1860 Ga0207676_10000004
1861 Ga0207676_10000040
1862 Ga0207676_10000340
1863 Ga0207676_10000600
1864 Ga0207676_10002850
1865 Ga0207676_10006287
1866 Ga0207676_10042482
1867 Ga0207676_10080658
1868 Ga0207676_10107993
1869 Ga0207674_10003716
1870 Ga0207674_10010165
1871 Ga0207674_10012150
1872 Ga0207674_10014103
1873 Ga0207674_10058492
1874 Ga0207675_100000071
1875 Ga0207675_100000171
1876 Ga0207675_100004115
1877 Ga0207675_100074164
1878 Ga0207675_100275287
1879 Ga0207675_100690505
1880 Ga0207683_10030752
1881 Ga0207683_10038419
1882 Ga0207683_10059873
1883 Ga0207683_10204941
1884 Ga0207698_10008400
1885 Ga0207698_10009783
1886 Ga0207698_10013046
1887 Ga0207698_10035886
1888 Ga0207698_10064919
1889 Ga0207698_10089859
1890 Ga0207698_10158574
1891 Ga0207698_10172860
1892 Ga0207698_10207361
1893 Ga0268266_10000028
1894 Ga0268266_10398752
1895 Ga0268266_10664587
1896 Ga0268265_10000002
1897 Ga0268265_10000003
1898 Ga0268265_10000071
1899 Ga0268265_10000081
1900 Ga0268265_10001985
1901 Ga0268265_10070456
1902 Ga0268265_10155686
1903 Ga0268264_10000006
1904 Ga0268264_10000101
1905 Ga0268264_10000277
1906 Ga0268264_10002895
1907 Ga0268264_10007584
1908 Ga0268264_10017268
1909 Ga0268264_10046924
1910 Ga0268264_10046935
1911 Ga0268264_10513770
1912 Ga0268264_10648904
1913 Ga0307517_10017543
1914 Ga0314311_1253059
1915 Ga0307513_10038050
1916 Ga0307513_10062253
1917 Ga0307408_100159239
1918 Ga0307408_100375434
1919 Ga0307405_10010820
1920 Ga0307405_10019377
1921 Ga0307413_10011043
1922 Ga0307413_10177020
1923 Ga0307413_10326141
1924 Ga0307410_10051488
1925 Ga0307410_10060530
1926 Ga0307410_10101091
1927 Ga0307410_10301796
1928 Ga0307406_10107594
1929 Ga0307406_10220312
1930 Ga0307406_10833827
1931 Ga0307407_10014810
1932 Ga0307412_10014384
1933 Ga0307412_10119740
1934 Ga0307412_10530911
1935 Ga0307409_100048881
1936 Ga0307409_100309460
1937 Ga0307409_100484735
1938 Ga0307409_100510853
1939 Ga0307416_100009723
1940 Ga0307416_101033116
1941 Ga0307414_10001499
1942 Ga0307414_10025253
1943 Ga0307414_10070847
1944 Ga0307414_10081762
1945 Ga0307414_10159855
1946 Ga0307411_10012651
1947 Ga0307411_10040331
1948 Ga0307411_10060206
1949 Ga0307411_10070385
1950 Ga0307411_10101841
1951 Ga0307411_10207482
1952 Ga0307411_10252169
1953 Ga0307411_10347093
1954 Ga0307411_10572468
1955 Ga0307415_100020974
1956 Ga0307415_100100012
1957 Ga0307510_10219879
1958 Ga0307510_10238088
1959 Ga0373941_0085440
1960 Ga0373931_0246318
1961 Ga0395899_0018782
1962 Ga0395899_0037136
1963 Ga0395900_0000764
1964 Ga0395900_0081537
1965 Ga0395900_0094288
1966 Ga0395900_0178364
1967 Ga0395900_0359544
1968 Ga0395900_0579831
1969 Ga0395900_0630950
1970 Ga0395898_0021463
1971 Ga0395898_0028931
1972 Ga0395898_0058445
1973 Ga0395898_0117307
1974 Ga0395905_0003045
1975 Ga0395905_0004674
1976 Ga0395905_0013463
1977 Ga0395905_0017316
1978 Ga0395905_0033153
1979 Ga0395905_0043534
1980 Ga0395905_0044710
1981 Ga0395905_0117126
1982 Ga0395905_0158282
1983 Ga0395905_0328782
1984 Ga0395905_0742484
1985 Ga0395905_0755988
1986 Ga0395905_0794686
1987 Ga0436364_0612163
1988 Ga0436364_0852694
1989 Ga0395901_0005146
1990 Ga0395901_0009829
1991 Ga0395901_0118405
1992 Ga0395901_0343089
1993 Ga0395901_0438477
1994 Ga0436365_0866041
1995 Ga0436363_1386082
1996 Ga0439436_0044005
1997 Ga0439439_0003354
1998 Ga0439461_0000202
1999 Ga0439461_0016751
2000 Ga0439465_0000274
2001 Ga0451807_0150684
2002 Ga0439431_0000103
2003 Ga0439445_0025915
2004 Ga0439448_0013838
2005 Ga0439432_012147
2006 Ga0439432_030753
2007 Ga0439432_032372
2008 Ga0450919_005818
2009 Ga0450905_001171
2010 Ga0450889_002955
2011 Ga0439458_0000559
2012 Ga0439434_0021611
2013 Ga0466972_0027337
2014 Ga0466961_0011363
2015 Ga0466961_0028348
2016 Ga0466963_0015006
2017 Ga0466963_0024760
2018 Ga0466963_0034218
2019 Ga0466963_0459130
2020 Ga0466968_0010515
2021 Ga0466968_0253574
2022 Ga0466970_0177239
2023 Ga0466957_0002027
2024 Ga0466960_0025899
2025 Ga0466959_0013667
2026 Ga0466959_0033855
2027 Ga0466959_0068216
2028 Ga0451576_0064272
2029 Ga0466958_0025243
2030 Ga0466958_0246927
2031 Ga0466967_0015627
2032 Ga0466967_0037136
2033 Ga0466967_0086428
2034 Ga0466967_0146406
2035 Ga0466967_0313871
2036 Ga0466967_0402204
2037 Ga0466967_0558545
2038 Ga0495627_003594
2039 Ga0495629_0237250
2040 Ga0495638_0032605
2041 Ga0495638_0325835
2042 Ga0495650_0000428
2043 Ga0495582_0443271
2044 Ga0495662_0063501
2045 Ga0495584_0162164
2046 Ga0495585_0039184
2047 Ga0495585_0041703
2048 Ga0495583_0000023
2049 Ga0495583_0001895
2050 Ga0495583_0003188
2051 Ga0495583_0069191
2052 Ga0495606_0000383
2053 Ga0495606_0007942
2054 Ga0495606_0031914
2055 Ga0495610_0000146
2056 Ga0495610_0132277
2057 Ga0495616_0189655
2058 Ga0495631_0001928
2059 Ga0495637_0001942
2060 Ga0495637_0011424
2061 Ga0495643_0004145
2062 Ga0495643_0006878
2063 Ga0495643_0084923
2064 Ga0495643_0236448
2065 Ga0495648_0001391
2066 Ga0495663_0002898
2067 Ga0495654_0066436
2068 Ga0495654_0080270
2069 Ga0495587_0153556
2070 Ga0495609_0113675
2071 Ga0495621_0002284
2072 Ga0495621_0030722
2073 Ga0495597_0012717
2074 Ga0495633_0002596
2075 Ga0495633_0003946
2076 Ga0495633_0013402
2077 Ga0495633_0029090
2078 Ga0495668_0000218
2079 Ga0495668_0023087
2080 Ga0495668_0169808
2081 Ga0495668_0246353
2082 Ga0495611_0007098
2083 Ga0495625_0000496
2084 Ga0495625_0001071
2085 Ga0495625_0011582
2086 Ga0495625_0044610
2087 Ga0495625_0154925
2088 Ga0495661_0012693
2089 Ga0495661_0029644
2090 Ga0495588_0318398
2091 Ga0495669_0000241
2092 Ga0495669_0008608
2093 Ga0495669_0017147
2094 Ga0495669_0098652
2095 Ga0495670_0000028
2096 Ga0495670_0024419
2097 Ga0495649_0237533
2098 Ga0495600_0049411
2099 Ga0495660_0118787
2100 Ga0495660_0142058
2101 Ga0495683_0010498
2102 Ga0495687_001043
2103 Ga0495687_001672
2104 Ga0495677_0005009
2105 Ga0495677_0151658
2106 Ga0495681_0000214
2107 Ga0495681_0025540
2108 Ga0495686_0001053
2109 Ga0495686_0002522
2110 Ga0495686_0004950
2111 Ga0495686_0083568
2112 Ga0495686_0099470
2113 Ga0496100_0005362
2114 Ga0496100_0132399
2115 Ga0496101_0001845
2116 Ga0496101_0020761
2117 Ga0496101_0141793
2118 Ga0496101_0265316
2119 Ga0496102_0000719
2120 Ga0496102_0000756
2121 Ga0496102_0004530
2122 Ga0496102_0357322
2123 Ga0496102_0583481
2124 Ga0496103_0000562
2125 Ga0496103_0002302
2126 Ga0496103_0007333
2127 Ga0496103_0014624
2128 Ga0496103_0070972
2129 Ga0496103_0423131
2130 Ga0496104_0017339
2131 Ga0496104_0063254
2132 Ga0496105_0009443
2133 Ga0496105_0035375
2134 Ga0496105_0086958
2135 Ga0496105_0156845
2136 Ga0496106_0024920
2137 Ga0496106_0397289
2138 Ga0496107_0002051
2139 Ga0496107_0047010
2140 Ga0496107_0165819
2141 Ga0496108_0014779
2142 Ga0496108_0051888
2143 Ga0496109_0030292
2144 Ga0496109_0038420
2145 Ga0496109_0064818
2146 Ga0496109_0071775
2147 Ga0496110_0000948
2148 Ga0496110_0009431
2149 Ga0496110_0029480
2150 Ga0496110_0083631
2151 Ga0496110_0275824
2152 Ga0496110_0471574
2153 Ga0496111_0001035
2154 Ga0496111_0004529
2155 Ga0496111_0022502
2156 Ga0496111_0074293
2157 Ga0496112_0013316
2158 Ga0496112_0554255
2159 Ga0496113_0025057
2160 Ga0496113_0284930
2161 Ga0496114_0022765
2162 Ga0496115_0000464
2163 Ga0496115_0005489
2164 Ga0496116_0002037
2165 Ga0496116_0009864
2166 Ga0496116_0056694
2167 Ga0496117_0000519
2168 Ga0496117_0001114
2169 Ga0496117_0011627
2170 Ga0496117_0021825
2171 Ga0496117_0037145
2172 Ga0496117_0040426
2173 Ga0496118_0000127
2174 Ga0496118_0000193
2175 Ga0496118_0001703
2176 Ga0496118_0004860
2177 Ga0496118_0009117
2178 Ga0496118_0029470
2179 Ga0496119_0027214
2180 Ga0496119_0036669
2181 Ga0496119_0040560
2182 Ga0496120_0049671
2183 Ga0496121_0005712
2184 Ga0496121_0010096
2185 Ga0496121_0051385
2186 Ga0496122_0016138
2187 Ga0496123_0030686
2188 Ga0496124_0000011
2189 Ga0496124_0000237
2190 Ga0496124_0067342
2191 Ga0496125_0001918
2192 Ga0496125_0062178
2193 Ga0496126_0007282
2194 Ga0496126_0008126
2195 Ga0496126_0341185
2196 Ga0495682_0023253
2197 Ga0501290_002973
2198 Ga0501290_011399
2199 Ga0501292_000040
2200 Ga0501043_0099754
2201 Ga0501047_0000402
2202 Ga0501206_001042
2203 Ga0501208_006654
2204 Ga0501222_002113
2205 Ga0501223_001533
2206 Ga0501224_001796
2207 Ga0501235_003681
2208 Ga0501249_000545
2209 Ga0501257_000093
2210 Ga0501261_000110
2211 Ga0501221_001519
2212 Ga0501225_0027884
2213 Ga0501245_002143
2214 Ga0501080_0971614
2215 Ga0501279_000008
2216 Ga0501280_000233
2217 Ga0501280_000772
2218 Ga0501281_00064
2219 Ga0501282_000614
2220 Ga0501204_005049
2221 nmdc:mga0qj67_621834_c1
2222 nmdc:mga08y16_94019_c1
2223 nmdc:mga0sz30_41051_c1
2224 Ga0500610_0000668
2225 Ga0500643_000136
2226 Ga0500643_000338
2227 Ga0500643_001250
2228 Ga0500643_001549
2229 Ga0500643_002056
2230 Ga0500643_002934
2231 Ga0500643_007149
2232 Ga0500647_0092524
2233 Ga0500651_0042612
2234 Ga0500566_0000877
2235 Ga0500555_000164
2236 Ga0500592_000232
2237 Ga0500592_002720
2238 Ga0500592_022616
2239 Ga0500595_002635
2240 Ga0500608_076391
2241 Ga0500608_192747
2242 Ga0500642_0000751
2243 Ga0500642_0018625
2244 Ga0500655_000159
2245 Ga0500658_0002920
2246 Ga0500658_0185545
2247 Ga0500559_0031963
2248 Ga0500559_0110284
2249 Ga0500564_057764
2250 Ga0500568_0015114
2251 Ga0500573_0000019
2252 Ga0500573_0175726
2253 Ga0500577_0032742
2254 Ga0500590_005065
2255 Ga0500616_0002503
2256 Ga0500624_000009
2257 Ga0500627_0000091
2258 Ga0500636_0319596
2259 Ga0500570_001921
2260 Ga0500625_000011
2261 Ga0500645_000237
2262 Ga0500645_001144
2263 Ga0500645_011613
2264 Ga0500645_020770
2265 Ga0466962_0036472
2266 2600202819
2267 2600228189
2268 2643730531
2269 2644037506
2270 2644043700
2271 2644128132
2272 2644393859
2273 2819716234
2274 2879163813
2275 2885430514
2276 2928528963
2277 2928971198
2278 2990265880
2279 2993696329
2280 8057101643

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06242

TrcR

Transcriptional cell cycle regulator TrcR

35

173

0.99

Map