F490702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1140 | 380 | 2280 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_10473503|Ga0268266_104735031 |
| Length | 231 |
| Sequence | MAQQLLMPKATAIWLVDNTALSFDQIAQFCKLHPLEVKAIADGEAAQGIKGLDPIATGQLSRDEIARAEGNPNYKLKLSEPKVRVPESKRRGPRYTPVSKRQDKPDGIAWIIRNHPEVSDGQISKLIGTTRTTIAAIRDRTHWNIANIVPKDPVTLGLCSQRELDAVVAKAAKAAGIEAQTDTRLEGDREALIEQLRAERDAAARGADATLADEEAALFGNSSGFQDPFKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 225 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 226 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 227 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 228 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 233 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 234 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 235 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 236 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 316 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 320 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 321 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 322 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 327 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 328 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 329 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 333 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 334 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 335 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 336 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 342 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 347 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 350 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 351 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 356 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 363 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 367 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 368 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 369 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 370 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 371 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 372 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 373 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 374 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 375 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 376 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 377 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 378 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 379 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 380 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 0.35 |
| Isolates | 1.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 7.89 |
| Nodule | 0 |
| Rhizoplane | 4.74 |
| Rhizosphere | 82.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0268266_10473503 | 3300028379 | Bacteria | 1193 |
| 2 | JGI24736J21556_1000030 | 3300001904 | Bacteria | 24315 |
| 3 | JGI24741J21665_1001317 | 3300001915 | Bacteria | 7262 |
| 4 | JGI24741J21665_1004089 | 3300001915 | Bacteria | 3310 |
| 5 | JGI24752J21851_1004310 | 3300001976 | Bacteria | 1866 |
| 6 | JGI24740J21852_10003058 | 3300001979 | Bacteria | 7400 |
| 7 | JGI24740J21852_10030569 | 3300001979 | Bacteria | 1750 |
| 8 | JGI24739J22299_10001692 | 3300001989 | Bacteria | 8378 |
| 9 | JGI24739J22299_10006535 | 3300001989 | Bacteria | 4392 |
| 10 | JGI24739J22299_10047732 | 3300001989 | Bacteria | 1395 |
| 11 | JGI24737J22298_10002390 | 3300001990 | Bacteria | 6695 |
| 12 | JGI24737J22298_10005137 | 3300001990 | Bacteria | 4532 |
| 13 | JGI24737J22298_10039840 | 3300001990 | Bacteria | 1443 |
| 14 | JGI24735J21928_10000944 | 3300002067 | Bacteria | 10388 |
| 15 | JGI24735J21928_10014907 | 3300002067 | Bacteria | 2431 |
| 16 | JGI24735J21928_10021243 | 3300002067 | Bacteria | 1982 |
| 17 | JGI24735J21928_10023346 | 3300002067 | Bacteria | 1876 |
| 18 | JGI24735J21928_10051268 | 3300002067 | Bacteria | 1191 |
| 19 | JGI24750J21931_1000713 | 3300002070 | Bacteria | 4792 |
| 20 | JGI24748J21848_1000015 | 3300002074 | Bacteria | 143883 |
| 21 | JGI24738J21930_10000900 | 3300002075 | Bacteria | 8536 |
| 22 | JGI24738J21930_10034667 | 3300002075 | Bacteria | 1028 |
| 23 | JGI24034J26672_10000006 | 3300002239 | Bacteria | 294495 |
| 24 | JGI24034J26672_10011930 | 3300002239 | Bacteria | 1306 |
| 25 | JGI24742J22300_10002123 | 3300002244 | Bacteria | 3152 |
| 26 | JGI24751J29686_10000093 | 3300002459 | Bacteria | 50074 |
| 27 | JGI24751J29686_10004337 | 3300002459 | Bacteria | 2879 |
| 28 | JGI25150J39212_1000855 | 3300002774 | Bacteria | 10133 |
| 29 | JGI25165J46597_1000024 | 3300003214 | Bacteria | 335150 |
| 30 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 31 | JGI25153J46596_10000091 | 3300003215 | Bacteria | 105614 |
| 32 | JGI25153J46596_10000186 | 3300003215 | Bacteria | 60427 |
| 33 | JGI25153J46596_10004838 | 3300003215 | Bacteria | 7177 |
| 34 | Ga0055542_1004222 | 3300003762 | Bacteria | 3565 |
| 35 | Ga0055537_1001760 | 3300003773 | Bacteria | 7934 |
| 36 | Ga0055537_1002910 | 3300003773 | Bacteria | 5462 |
| 37 | Ga0055524_1000118 | 3300003775 | Bacteria | 93202 |
| 38 | Ga0055530_10000072 | 3300003791 | Bacteria | 85675 |
| 39 | Ga0055530_10019126 | 3300003791 | Bacteria | 2083 |
| 40 | Ga0055540_1001847 | 3300003792 | Bacteria | 11935 |
| 41 | Ga0055531_10000114 | 3300003794 | Bacteria | 88453 |
| 42 | Ga0055531_10001624 | 3300003794 | Bacteria | 16296 |
| 43 | Ga0065165_1002052 | 3300005262 | Bacteria | 18661 |
| 44 | Ga0065165_1012710 | 3300005262 | Bacteria | 3406 |
| 45 | Ga0065704_10097475 | 3300005289 | Bacteria | 2393 |
| 46 | Ga0065712_10079995 | 3300005290 | Bacteria | 3157 |
| 47 | Ga0065707_10082467 | 3300005295 | Bacteria | 14795 |
| 48 | Ga0065707_10082564 | 3300005295 | Bacteria | 13708 |
| 49 | Ga0070658_10000181 | 3300005327 | Bacteria | 55191 |
| 50 | Ga0070658_10001561 | 3300005327 | Bacteria | 19422 |
| 51 | Ga0070658_10007616 | 3300005327 | Bacteria | 8731 |
| 52 | Ga0070658_10028040 | 3300005327 | Bacteria | 4520 |
| 53 | Ga0070658_10079969 | 3300005327 | Bacteria | 2684 |
| 54 | Ga0070658_10192660 | 3300005327 | Bacteria | 1718 |
| 55 | Ga0070676_10005147 | 3300005328 | Bacteria | 6940 |
| 56 | Ga0070676_10091881 | 3300005328 | Bacteria | 1861 |
| 57 | Ga0070676_10217451 | 3300005328 | Bacteria | 1260 |
| 58 | Ga0070683_100006563 | 3300005329 | Bacteria | 9770 |
| 59 | Ga0070683_100122456 | 3300005329 | Bacteria | 2457 |
| 60 | Ga0070683_100195833 | 3300005329 | Bacteria | 1919 |
| 61 | Ga0070690_100000012 | 3300005330 | Bacteria | 91852 |
| 62 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 63 | Ga0070670_100000169 | 3300005331 | Bacteria | 59093 |
| 64 | Ga0070670_100000528 | 3300005331 | Bacteria | 30641 |
| 65 | Ga0070670_100002960 | 3300005331 | Bacteria | 14072 |
| 66 | Ga0070670_100036176 | 3300005331 | Bacteria | 4250 |
| 67 | Ga0070670_100049951 | 3300005331 | Bacteria | 3595 |
| 68 | Ga0070677_10061237 | 3300005333 | Bacteria | 1553 |
| 69 | Ga0068869_100000635 | 3300005334 | Bacteria | 19852 |
| 70 | Ga0070666_10000014 | 3300005335 | Bacteria | 224479 |
| 71 | Ga0070666_10004574 | 3300005335 | Bacteria | 8436 |
| 72 | Ga0070666_10012077 | 3300005335 | Bacteria | 5438 |
| 73 | Ga0070680_100414715 | 3300005336 | Bacteria | 1149 |
| 74 | Ga0068868_100000049 | 3300005338 | Bacteria | 67274 |
| 75 | Ga0068868_100119637 | 3300005338 | Bacteria | 2147 |
| 76 | Ga0070660_100003617 | 3300005339 | Bacteria | 10682 |
| 77 | Ga0070660_100024707 | 3300005339 | Bacteria | 4459 |
| 78 | Ga0070660_100031552 | 3300005339 | Bacteria | 3980 |
| 79 | Ga0070660_100045703 | 3300005339 | Bacteria | 3353 |
| 80 | Ga0070660_100193300 | 3300005339 | Bacteria | 1649 |
| 81 | Ga0070660_100550573 | 3300005339 | Bacteria | 962 |
| 82 | Ga0070689_100029687 | 3300005340 | Bacteria | 4142 |
| 83 | Ga0070691_10000763 | 3300005341 | Bacteria | 12747 |
| 84 | Ga0070661_100005116 | 3300005344 | Bacteria | 9042 |
| 85 | Ga0070661_100015407 | 3300005344 | Bacteria | 5396 |
| 86 | Ga0070661_100022812 | 3300005344 | Bacteria | 4482 |
| 87 | Ga0070661_100029811 | 3300005344 | Bacteria | 3940 |
| 88 | Ga0070661_100036547 | 3300005344 | Bacteria | 3570 |
| 89 | Ga0070661_100138860 | 3300005344 | Bacteria | 1830 |
| 90 | Ga0070692_10060955 | 3300005345 | Bacteria | 1987 |
| 91 | Ga0070692_10125102 | 3300005345 | Bacteria | 1439 |
| 92 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 93 | Ga0070668_100002131 | 3300005347 | Bacteria | 14472 |
| 94 | Ga0070668_100011256 | 3300005347 | Bacteria | 6662 |
| 95 | Ga0070668_100021509 | 3300005347 | Bacteria | 4873 |
| 96 | Ga0070668_100124704 | 3300005347 | Bacteria | 2062 |
| 97 | Ga0070668_100399676 | 3300005347 | Bacteria | 1173 |
| 98 | Ga0070669_100000195 | 3300005353 | Bacteria | 53791 |
| 99 | Ga0070669_100000351 | 3300005353 | Bacteria | 35974 |
| 100 | Ga0070669_100034494 | 3300005353 | Bacteria | 3663 |
| 101 | Ga0070669_100291587 | 3300005353 | Bacteria | 1310 |
| 102 | Ga0070675_100002343 | 3300005354 | Bacteria | 14076 |
| 103 | Ga0070675_100013583 | 3300005354 | Bacteria | 6403 |
| 104 | Ga0070671_100000388 | 3300005355 | Bacteria | 30256 |
| 105 | Ga0070671_100000461 | 3300005355 | Bacteria | 28331 |
| 106 | Ga0070671_100014361 | 3300005355 | Bacteria | 6397 |
| 107 | Ga0070671_100020224 | 3300005355 | Bacteria | 5426 |
| 108 | Ga0070671_100078984 | 3300005355 | Bacteria | 2750 |
| 109 | Ga0070671_100121302 | 3300005355 | Bacteria | 2200 |
| 110 | Ga0070671_100239139 | 3300005355 | Bacteria | 1541 |
| 111 | Ga0070674_100032561 | 3300005356 | Bacteria | 3462 |
| 112 | Ga0070674_100215623 | 3300005356 | Bacteria | 1490 |
| 113 | Ga0070674_100218977 | 3300005356 | Bacteria | 1480 |
| 114 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 115 | Ga0070673_100020191 | 3300005364 | Bacteria | 4801 |
| 116 | Ga0070673_100024623 | 3300005364 | Bacteria | 4417 |
| 117 | Ga0070673_100045414 | 3300005364 | Bacteria | 3406 |
| 118 | Ga0070673_100065042 | 3300005364 | Bacteria | 2907 |
| 119 | Ga0070688_100010920 | 3300005365 | Bacteria | 5029 |
| 120 | Ga0070659_100005974 | 3300005366 | Bacteria | 8778 |
| 121 | Ga0070659_100007753 | 3300005366 | Bacteria | 7808 |
| 122 | Ga0070659_100031286 | 3300005366 | Bacteria | 4121 |
| 123 | Ga0070659_100059821 | 3300005366 | Bacteria | 3008 |
| 124 | Ga0070659_100151979 | 3300005366 | Bacteria | 1889 |
| 125 | Ga0070659_100235550 | 3300005366 | Bacteria | 1513 |
| 126 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 127 | Ga0070667_100000327 | 3300005367 | Bacteria | 52972 |
| 128 | Ga0070667_100000873 | 3300005367 | Bacteria | 27955 |
| 129 | Ga0070667_100001850 | 3300005367 | Bacteria | 18783 |
| 130 | Ga0070667_100022481 | 3300005367 | Bacteria | 5230 |
| 131 | Ga0070667_100033868 | 3300005367 | Bacteria | 4273 |
| 132 | Ga0070667_100113824 | 3300005367 | Bacteria | 2348 |
| 133 | Ga0070667_100674259 | 3300005367 | Bacteria | 955 |
| 134 | Ga0070714_100188223 | 3300005435 | Bacteria | 1882 |
| 135 | Ga0070713_100502716 | 3300005436 | Bacteria | 1144 |
| 136 | Ga0070705_100710137 | 3300005440 | Bacteria | 791 |
| 137 | Ga0070663_100016888 | 3300005455 | Bacteria | 4750 |
| 138 | Ga0070663_100028223 | 3300005455 | Bacteria | 3819 |
| 139 | Ga0070663_100051649 | 3300005455 | Bacteria | 2930 |
| 140 | Ga0070663_100113967 | 3300005455 | Bacteria | 2035 |
| 141 | Ga0070663_100671073 | 3300005455 | Bacteria | 878 |
| 142 | Ga0070663_100695733 | 3300005455 | Bacteria | 864 |
| 143 | Ga0070678_100000505 | 3300005456 | Bacteria | 18820 |
| 144 | Ga0070678_100008600 | 3300005456 | Bacteria | 6119 |
| 145 | Ga0070678_100166600 | 3300005456 | Bacteria | 1791 |
| 146 | Ga0070662_100005871 | 3300005457 | Bacteria | 7879 |
| 147 | Ga0070662_100006250 | 3300005457 | Bacteria | 7670 |
| 148 | Ga0070662_100021277 | 3300005457 | Bacteria | 4427 |
| 149 | Ga0070662_100131956 | 3300005457 | Bacteria | 1927 |
| 150 | Ga0070662_100228129 | 3300005457 | Bacteria | 1489 |
| 151 | Ga0070681_10029966 | 3300005458 | Bacteria | 5461 |
| 152 | Ga0070681_10069647 | 3300005458 | Bacteria | 3484 |
| 153 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 154 | Ga0068867_100029493 | 3300005459 | Bacteria | 3953 |
| 155 | Ga0068867_100524361 | 3300005459 | Bacteria | 1022 |
| 156 | Ga0070685_10002655 | 3300005466 | Bacteria | 9156 |
| 157 | Ga0070679_100033561 | 3300005530 | Bacteria | 5082 |
| 158 | Ga0070679_100153616 | 3300005530 | Bacteria | 2278 |
| 159 | Ga0070684_100004255 | 3300005535 | Bacteria | 10845 |
| 160 | Ga0070684_100125792 | 3300005535 | Bacteria | 2309 |
| 161 | Ga0070684_100143776 | 3300005535 | Bacteria | 2158 |
| 162 | Ga0068853_100016963 | 3300005539 | Bacteria | 6003 |
| 163 | Ga0068853_100035156 | 3300005539 | Bacteria | 4255 |
| 164 | Ga0068853_100064038 | 3300005539 | Bacteria | 3186 |
| 165 | Ga0068853_100066503 | 3300005539 | Bacteria | 3130 |
| 166 | Ga0068853_100106522 | 3300005539 | Bacteria | 2485 |
| 167 | Ga0068853_100191840 | 3300005539 | Bacteria | 1857 |
| 168 | Ga0068853_100261358 | 3300005539 | Bacteria | 1591 |
| 169 | Ga0068853_100289580 | 3300005539 | Bacteria | 1512 |
| 170 | Ga0070672_100006310 | 3300005543 | Bacteria | 7951 |
| 171 | Ga0070672_100014230 | 3300005543 | Bacteria | 5633 |
| 172 | Ga0070672_100064036 | 3300005543 | Bacteria | 2904 |
| 173 | Ga0070672_100185299 | 3300005543 | Bacteria | 1736 |
| 174 | Ga0070686_100000002 | 3300005544 | Bacteria | 336303 |
| 175 | Ga0070686_100046913 | 3300005544 | Bacteria | 2729 |
| 176 | Ga0070695_100011571 | 3300005545 | Bacteria | 5279 |
| 177 | Ga0070696_100003877 | 3300005546 | Bacteria | 9991 |
| 178 | Ga0070696_100006531 | 3300005546 | Bacteria | 7787 |
| 179 | Ga0070665_100000025 | 3300005548 | Bacteria | 367488 |
| 180 | Ga0070665_100000471 | 3300005548 | Bacteria | 58097 |
| 181 | Ga0070665_100009495 | 3300005548 | Bacteria | 9838 |
| 182 | Ga0070665_100050070 | 3300005548 | Bacteria | 4192 |
| 183 | Ga0070665_100069910 | 3300005548 | Bacteria | 3518 |
| 184 | Ga0070665_100597007 | 3300005548 | Bacteria | 1117 |
| 185 | Ga0068855_100000023 | 3300005563 | Bacteria | 190440 |
| 186 | Ga0068855_100003431 | 3300005563 | Bacteria | 19388 |
| 187 | Ga0068855_100058591 | 3300005563 | Bacteria | 4509 |
| 188 | Ga0068855_100256310 | 3300005563 | Bacteria | 1950 |
| 189 | Ga0068855_100259344 | 3300005563 | Bacteria | 1937 |
| 190 | Ga0070664_100000093 | 3300005564 | Bacteria | 57415 |
| 191 | Ga0070664_100003267 | 3300005564 | Bacteria | 13100 |
| 192 | Ga0070664_100006241 | 3300005564 | Bacteria | 9626 |
| 193 | Ga0070664_100062965 | 3300005564 | Bacteria | 3162 |
| 194 | Ga0070664_100073476 | 3300005564 | Bacteria | 2934 |
| 195 | Ga0070664_100081692 | 3300005564 | Bacteria | 2786 |
| 196 | Ga0070664_100168737 | 3300005564 | Bacteria | 1940 |
| 197 | Ga0068857_100015202 | 3300005577 | Bacteria | 6716 |
| 198 | Ga0068857_100015964 | 3300005577 | Bacteria | 6577 |
| 199 | Ga0068857_100288529 | 3300005577 | Bacteria | 1510 |
| 200 | Ga0068854_100000722 | 3300005578 | Bacteria | 19534 |
| 201 | Ga0068854_100005206 | 3300005578 | Bacteria | 8205 |
| 202 | Ga0068854_100027141 | 3300005578 | Bacteria | 3944 |
| 203 | Ga0068854_100029193 | 3300005578 | Bacteria | 3817 |
| 204 | Ga0068854_100095691 | 3300005578 | Bacteria | 2217 |
| 205 | Ga0068854_100100723 | 3300005578 | Bacteria | 2166 |
| 206 | Ga0068854_100121256 | 3300005578 | Bacteria | 1985 |
| 207 | Ga0068854_100164056 | 3300005578 | Bacteria | 1723 |
| 208 | Ga0068854_100247681 | 3300005578 | Bacteria | 1421 |
| 209 | Ga0068856_100033806 | 3300005614 | Bacteria | 5007 |
| 210 | Ga0068856_100042299 | 3300005614 | Bacteria | 4481 |
| 211 | Ga0068856_100063293 | 3300005614 | Bacteria | 3655 |
| 212 | Ga0068856_100275276 | 3300005614 | Bacteria | 1700 |
| 213 | Ga0068856_100290640 | 3300005614 | Bacteria | 1651 |
| 214 | Ga0068852_100001538 | 3300005616 | Bacteria | 15655 |
| 215 | Ga0068852_100021306 | 3300005616 | Bacteria | 5172 |
| 216 | Ga0068852_100043422 | 3300005616 | Bacteria | 3813 |
| 217 | Ga0068852_100049064 | 3300005616 | Bacteria | 3610 |
| 218 | Ga0068859_100007110 | 3300005617 | Bacteria | 11360 |
| 219 | Ga0068859_100008939 | 3300005617 | Bacteria | 10118 |
| 220 | Ga0068859_100014394 | 3300005617 | Bacteria | 7938 |
| 221 | Ga0068859_100021440 | 3300005617 | Bacteria | 6485 |
| 222 | Ga0068859_100029142 | 3300005617 | Bacteria | 5540 |
| 223 | Ga0068859_100065318 | 3300005617 | Bacteria | 3673 |
| 224 | Ga0068859_100127874 | 3300005617 | Bacteria | 2611 |
| 225 | Ga0068859_100256410 | 3300005617 | Bacteria | 1840 |
| 226 | Ga0068859_100358221 | 3300005617 | Bacteria | 1554 |
| 227 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 228 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 229 | Ga0068864_100000078 | 3300005618 | Bacteria | 103622 |
| 230 | Ga0068864_100003288 | 3300005618 | Bacteria | 13355 |
| 231 | Ga0068864_100012174 | 3300005618 | Bacteria | 7111 |
| 232 | Ga0068864_100017806 | 3300005618 | Bacteria | 5927 |
| 233 | Ga0068864_100070649 | 3300005618 | Bacteria | 3038 |
| 234 | Ga0068866_10001322 | 3300005718 | Bacteria | 10746 |
| 235 | Ga0068861_100000132 | 3300005719 | Bacteria | 38465 |
| 236 | Ga0068861_100000629 | 3300005719 | Bacteria | 20887 |
| 237 | Ga0068861_100017934 | 3300005719 | Bacteria | 5033 |
| 238 | Ga0068861_100233353 | 3300005719 | Bacteria | 1561 |
| 239 | Ga0068851_10005578 | 3300005834 | Bacteria | 5708 |
| 240 | Ga0068851_10025486 | 3300005834 | Bacteria | 2901 |
| 241 | Ga0068851_10027636 | 3300005834 | Bacteria | 2797 |
| 242 | Ga0068851_10078004 | 3300005834 | Bacteria | 1725 |
| 243 | Ga0068851_10090935 | 3300005834 | Bacteria | 1606 |
| 244 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 245 | Ga0068863_100000270 | 3300005841 | Bacteria | 54081 |
| 246 | Ga0068863_100001062 | 3300005841 | Bacteria | 27480 |
| 247 | Ga0068863_100001939 | 3300005841 | Bacteria | 20551 |
| 248 | Ga0068863_100002169 | 3300005841 | Bacteria | 19450 |
| 249 | Ga0068863_100003398 | 3300005841 | Bacteria | 15704 |
| 250 | Ga0068863_100004607 | 3300005841 | Bacteria | 13580 |
| 251 | Ga0068863_100017965 | 3300005841 | Bacteria | 6769 |
| 252 | Ga0068863_100053028 | 3300005841 | Bacteria | 3843 |
| 253 | Ga0068863_100076334 | 3300005841 | Bacteria | 3170 |
| 254 | Ga0068863_100370262 | 3300005841 | Bacteria | 1398 |
| 255 | Ga0068858_100000181 | 3300005842 | Bacteria | 66254 |
| 256 | Ga0068858_100000832 | 3300005842 | Bacteria | 32118 |
| 257 | Ga0068858_100006226 | 3300005842 | Bacteria | 11628 |
| 258 | Ga0068858_100006347 | 3300005842 | Bacteria | 11512 |
| 259 | Ga0068858_100007133 | 3300005842 | Bacteria | 10854 |
| 260 | Ga0068858_100180276 | 3300005842 | Bacteria | 1994 |
| 261 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 262 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 263 | Ga0068860_100000834 | 3300005843 | Bacteria | 34494 |
| 264 | Ga0068860_100004334 | 3300005843 | Bacteria | 14504 |
| 265 | Ga0068860_100016501 | 3300005843 | Bacteria | 7203 |
| 266 | Ga0068860_100060507 | 3300005843 | Bacteria | 3599 |
| 267 | Ga0068860_100076230 | 3300005843 | Bacteria | 3189 |
| 268 | Ga0068860_100080027 | 3300005843 | Bacteria | 3107 |
| 269 | Ga0068860_100347777 | 3300005843 | Bacteria | 1458 |
| 270 | Ga0068860_100423460 | 3300005843 | Bacteria | 1320 |
| 271 | Ga0068860_100693098 | 3300005843 | Bacteria | 1028 |
| 272 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 273 | Ga0068862_100000011 | 3300005844 | Bacteria | 270105 |
| 274 | Ga0068862_100000032 | 3300005844 | Bacteria | 179887 |
| 275 | Ga0068862_100000048 | 3300005844 | Bacteria | 150043 |
| 276 | Ga0068862_100000989 | 3300005844 | Bacteria | 27179 |
| 277 | Ga0068862_100007656 | 3300005844 | Bacteria | 8943 |
| 278 | Ga0068862_100009813 | 3300005844 | Bacteria | 7911 |
| 279 | Ga0068862_100199992 | 3300005844 | Bacteria | 1801 |
| 280 | Ga0070712_100210454 | 3300006175 | Bacteria | 1533 |
| 281 | Ga0097621_100002557 | 3300006237 | Bacteria | 12458 |
| 282 | Ga0068871_100031090 | 3300006358 | Bacteria | 4207 |
| 283 | Ga0075430_100038654 | 3300006846 | Bacteria | 4042 |
| 284 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 285 | Ga0097620_100007111 | 3300006931 | Bacteria | 11360 |
| 286 | Ga0097620_100008939 | 3300006931 | Bacteria | 10118 |
| 287 | Ga0097620_100014392 | 3300006931 | Bacteria | 7938 |
| 288 | Ga0097620_100021440 | 3300006931 | Bacteria | 6485 |
| 289 | Ga0097620_100029143 | 3300006931 | Bacteria | 5540 |
| 290 | Ga0097620_100065319 | 3300006931 | Bacteria | 3673 |
| 291 | Ga0097620_100127861 | 3300006931 | Bacteria | 2611 |
| 292 | Ga0097620_100256395 | 3300006931 | Bacteria | 1840 |
| 293 | Ga0097620_100358208 | 3300006931 | Bacteria | 1554 |
| 294 | Ga0105251_10000342 | 3300009011 | Bacteria | 46221 |
| 295 | Ga0105250_10005428 | 3300009092 | Bacteria | 5719 |
| 296 | Ga0105240_10009282 | 3300009093 | Bacteria | 13947 |
| 297 | Ga0105240_10011291 | 3300009093 | Bacteria | 12447 |
| 298 | Ga0105240_10040268 | 3300009093 | Bacteria | 5978 |
| 299 | Ga0105240_10075745 | 3300009093 | Bacteria | 4150 |
| 300 | Ga0105240_10079587 | 3300009093 | Bacteria | 4032 |
| 301 | Ga0111539_10073522 | 3300009094 | Bacteria | 4030 |
| 302 | Ga0105245_10001536 | 3300009098 | Bacteria | 20925 |
| 303 | Ga0105245_10006243 | 3300009098 | Bacteria | 10483 |
| 304 | Ga0105245_10031992 | 3300009098 | Bacteria | 4657 |
| 305 | Ga0105247_10012347 | 3300009101 | Bacteria | 5130 |
| 306 | Ga0105247_10155492 | 3300009101 | Bacteria | 1510 |
| 307 | Ga0105243_10000611 | 3300009148 | Bacteria | 35583 |
| 308 | Ga0105243_10001363 | 3300009148 | Bacteria | 21679 |
| 309 | Ga0105243_10412562 | 3300009148 | Bacteria | 1257 |
| 310 | Ga0105241_10011404 | 3300009174 | Bacteria | 6515 |
| 311 | Ga0105242_10000818 | 3300009176 | Bacteria | 24172 |
| 312 | Ga0105242_10003633 | 3300009176 | Bacteria | 12007 |
| 313 | Ga0105242_10258590 | 3300009176 | Bacteria | 1572 |
| 314 | Ga0105242_10719686 | 3300009176 | Bacteria | 979 |
| 315 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 316 | Ga0105248_10000069 | 3300009177 | Bacteria | 120989 |
| 317 | Ga0105248_10002223 | 3300009177 | Bacteria | 21450 |
| 318 | Ga0105248_10002773 | 3300009177 | Bacteria | 19480 |
| 319 | Ga0105248_10014376 | 3300009177 | Bacteria | 8711 |
| 320 | Ga0105248_10026331 | 3300009177 | Bacteria | 6470 |
| 321 | Ga0105248_10033496 | 3300009177 | Bacteria | 5739 |
| 322 | Ga0105248_10046730 | 3300009177 | Bacteria | 4853 |
| 323 | Ga0105248_10065059 | 3300009177 | Bacteria | 4093 |
| 324 | Ga0105248_10069459 | 3300009177 | Bacteria | 3955 |
| 325 | Ga0105248_10155231 | 3300009177 | Bacteria | 2583 |
| 326 | Ga0105248_10374757 | 3300009177 | Bacteria | 1602 |
| 327 | Ga0105248_10426907 | 3300009177 | Bacteria | 1493 |
| 328 | Ga0105248_10471263 | 3300009177 | Bacteria | 1415 |
| 329 | Ga0105237_10030869 | 3300009545 | Bacteria | 5438 |
| 330 | Ga0105237_10032851 | 3300009545 | Bacteria | 5253 |
| 331 | Ga0105237_10054983 | 3300009545 | Bacteria | 3987 |
| 332 | Ga0105237_10155275 | 3300009545 | Bacteria | 2285 |
| 333 | Ga0105237_10570343 | 3300009545 | Bacteria | 1138 |
| 334 | Ga0105238_10003703 | 3300009551 | Bacteria | 15217 |
| 335 | Ga0105238_10016971 | 3300009551 | Bacteria | 7389 |
| 336 | Ga0105238_10020220 | 3300009551 | Bacteria | 6776 |
| 337 | Ga0105238_10025509 | 3300009551 | Bacteria | 6026 |
| 338 | Ga0105238_10056843 | 3300009551 | Bacteria | 3924 |
| 339 | Ga0105238_10067233 | 3300009551 | Bacteria | 3585 |
| 340 | Ga0105238_10154632 | 3300009551 | Bacteria | 2269 |
| 341 | Ga0105238_10367966 | 3300009551 | Bacteria | 1428 |
| 342 | Ga0105238_10633714 | 3300009551 | Bacteria | 1078 |
| 343 | Ga0105238_10969517 | 3300009551 | Bacteria | 870 |
| 344 | Ga0105249_10000005 | 3300009553 | Bacteria | 362467 |
| 345 | Ga0105249_10000017 | 3300009553 | Bacteria | 277115 |
| 346 | Ga0105249_10000106 | 3300009553 | Bacteria | 115526 |
| 347 | Ga0105249_10005694 | 3300009553 | Bacteria | 10774 |
| 348 | Ga0105249_10166446 | 3300009553 | Bacteria | 2134 |
| 349 | Ga0105249_10266691 | 3300009553 | Bacteria | 1704 |
| 350 | Ga0105239_10070023 | 3300010375 | Bacteria | 3853 |
| 351 | Ga0105239_10098131 | 3300010375 | Bacteria | 3238 |
| 352 | Ga0105246_10000620 | 3300011119 | Bacteria | 19799 |
| 353 | Ga0157373_10028624 | 3300013100 | Bacteria | 4019 |
| 354 | Ga0157373_10085988 | 3300013100 | Bacteria | 2216 |
| 355 | Ga0157373_10102585 | 3300013100 | Bacteria | 2013 |
| 356 | Ga0157373_10136279 | 3300013100 | Bacteria | 1726 |
| 357 | Ga0157373_10272680 | 3300013100 | Bacteria | 1198 |
| 358 | Ga0157373_10429189 | 3300013100 | Bacteria | 949 |
| 359 | Ga0157373_10537277 | 3300013100 | Bacteria | 847 |
| 360 | Ga0157371_10000110 | 3300013102 | Bacteria | 124933 |
| 361 | Ga0157371_10037024 | 3300013102 | Bacteria | 3494 |
| 362 | Ga0157371_10040991 | 3300013102 | Bacteria | 3306 |
| 363 | Ga0157371_10128541 | 3300013102 | Bacteria | 1802 |
| 364 | Ga0157371_10152424 | 3300013102 | Bacteria | 1649 |
| 365 | Ga0157370_10012605 | 3300013104 | Bacteria | 8761 |
| 366 | Ga0157370_10041223 | 3300013104 | Bacteria | 4456 |
| 367 | Ga0157370_10112118 | 3300013104 | Bacteria | 2549 |
| 368 | Ga0157369_10002495 | 3300013105 | Bacteria | 22057 |
| 369 | Ga0157369_10003524 | 3300013105 | Bacteria | 18600 |
| 370 | Ga0157369_10008669 | 3300013105 | Bacteria | 11658 |
| 371 | Ga0157369_10008947 | 3300013105 | Bacteria | 11468 |
| 372 | Ga0157369_10009057 | 3300013105 | Bacteria | 11398 |
| 373 | Ga0157369_10068610 | 3300013105 | Bacteria | 3810 |
| 374 | Ga0157369_10094805 | 3300013105 | Bacteria | 3186 |
| 375 | Ga0157374_10006203 | 3300013296 | Bacteria | 10133 |
| 376 | Ga0157374_10046810 | 3300013296 | Bacteria | 4007 |
| 377 | Ga0157374_10070052 | 3300013296 | Bacteria | 3303 |
| 378 | Ga0157374_10080623 | 3300013296 | Bacteria | 3087 |
| 379 | Ga0157374_10090575 | 3300013296 | Bacteria | 2916 |
| 380 | Ga0157374_11346219 | 3300013296 | Bacteria | 736 |
| 381 | Ga0157378_10008062 | 3300013297 | Bacteria | 9195 |
| 382 | Ga0157378_10033143 | 3300013297 | Bacteria | 4566 |
| 383 | Ga0157378_10042832 | 3300013297 | Bacteria | 4019 |
| 384 | Ga0157378_10217265 | 3300013297 | Bacteria | 1816 |
| 385 | Ga0163162_10005086 | 3300013306 | Bacteria | 12670 |
| 386 | Ga0163162_10048885 | 3300013306 | Bacteria | 4238 |
| 387 | Ga0163162_10050115 | 3300013306 | Bacteria | 4187 |
| 388 | Ga0163162_10081335 | 3300013306 | Bacteria | 3310 |
| 389 | Ga0163162_10091245 | 3300013306 | Bacteria | 3129 |
| 390 | Ga0163162_10250436 | 3300013306 | Bacteria | 1903 |
| 391 | Ga0157372_10064804 | 3300013307 | Bacteria | 4100 |
| 392 | Ga0157372_10085245 | 3300013307 | Bacteria | 3583 |
| 393 | Ga0157372_10107945 | 3300013307 | Bacteria | 3185 |
| 394 | Ga0157372_10116707 | 3300013307 | Bacteria | 3061 |
| 395 | Ga0157372_10305248 | 3300013307 | Bacteria | 1852 |
| 396 | Ga0157372_10494116 | 3300013307 | Bacteria | 1427 |
| 397 | Ga0157372_10510680 | 3300013307 | Bacteria | 1401 |
| 398 | Ga0157372_10512443 | 3300013307 | Bacteria | 1399 |
| 399 | Ga0157372_10605423 | 3300013307 | Bacteria | 1277 |
| 400 | Ga0157375_10004152 | 3300013308 | Bacteria | 12569 |
| 401 | Ga0157375_10035911 | 3300013308 | Bacteria | 4735 |
| 402 | Ga0157375_10037485 | 3300013308 | Bacteria | 4646 |
| 403 | Ga0157375_10435869 | 3300013308 | Bacteria | 1476 |
| 404 | Ga0163163_10000588 | 3300014325 | Bacteria | 32034 |
| 405 | Ga0163163_10039738 | 3300014325 | Bacteria | 4593 |
| 406 | Ga0163163_10095415 | 3300014325 | Bacteria | 2994 |
| 407 | Ga0163163_10346614 | 3300014325 | Bacteria | 1541 |
| 408 | Ga0163163_11008936 | 3300014325 | Bacteria | 896 |
| 409 | Ga0157380_10000363 | 3300014326 | Bacteria | 27231 |
| 410 | Ga0157380_10001569 | 3300014326 | Bacteria | 15028 |
| 411 | Ga0157380_10024926 | 3300014326 | Bacteria | 4532 |
| 412 | Ga0157379_10031170 | 3300014968 | Bacteria | 4749 |
| 413 | Ga0157379_10034380 | 3300014968 | Bacteria | 4520 |
| 414 | Ga0157379_10154402 | 3300014968 | Bacteria | 2070 |
| 415 | Ga0157379_10181989 | 3300014968 | Bacteria | 1899 |
| 416 | Ga0157376_10000955 | 3300014969 | Bacteria | 18842 |
| 417 | Ga0157376_10001235 | 3300014969 | Bacteria | 16843 |
| 418 | Ga0163161_10000509 | 3300017792 | Bacteria | 31722 |
| 419 | Ga0163161_10007048 | 3300017792 | Bacteria | 7777 |
| 420 | Ga0163161_10294282 | 3300017792 | Bacteria | 1277 |
| 421 | Ga0206356_10636768 | 3300020070 | Bacteria | 2955 |
| 422 | Ga0206356_10794718 | 3300020070 | Bacteria | 2159 |
| 423 | Ga0206354_10580221 | 3300020081 | Bacteria | 4717 |
| 424 | Ga0206353_11160495 | 3300020082 | Bacteria | 3360 |
| 425 | Ga0213876_10000714 | 3300021384 | Bacteria | 23269 |
| 426 | Ga0213875_10001461 | 3300021388 | Bacteria | 15300 |
| 427 | Ga0213875_10002933 | 3300021388 | Bacteria | 9939 |
| 428 | Ga0207672_1001571 | 3300025223 | Bacteria | 1656 |
| 429 | Ga0209563_100130 | 3300025230 | Bacteria | 98627 |
| 430 | Ga0209677_107479 | 3300025253 | Bacteria | 2314 |
| 431 | Ga0209148_1000171 | 3300025254 | Bacteria | 131700 |
| 432 | Ga0209129_1003658 | 3300025258 | Bacteria | 6544 |
| 433 | Ga0209233_1000084 | 3300025261 | Bacteria | 335222 |
| 434 | Ga0209233_1018102 | 3300025261 | Bacteria | 1905 |
| 435 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 436 | Ga0209565_1000170 | 3300025263 | Bacteria | 84580 |
| 437 | Ga0209455_1001814 | 3300025272 | Bacteria | 8967 |
| 438 | Ga0209455_1009677 | 3300025272 | Bacteria | 2511 |
| 439 | Ga0209673_1000827 | 3300025273 | Bacteria | 40748 |
| 440 | Ga0209673_1008761 | 3300025273 | Bacteria | 4463 |
| 441 | Ga0209676_1006991 | 3300025292 | Bacteria | 5422 |
| 442 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 443 | Ga0209564_1000335 | 3300025295 | Bacteria | 91079 |
| 444 | Ga0209564_1016363 | 3300025295 | Bacteria | 2957 |
| 445 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 446 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 447 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 448 | Ga0209050_1000108 | 3300025298 | Bacteria | 222534 |
| 449 | Ga0209050_1000209 | 3300025298 | Bacteria | 130884 |
| 450 | Ga0209050_1009517 | 3300025298 | Bacteria | 4957 |
| 451 | Ga0209050_1009555 | 3300025298 | Bacteria | 4945 |
| 452 | Ga0209050_1019060 | 3300025298 | Bacteria | 2629 |
| 453 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 454 | Ga0209051_1000239 | 3300025303 | Bacteria | 92575 |
| 455 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 456 | Ga0209257_1001066 | 3300025304 | Bacteria | 36225 |
| 457 | Ga0209257_1001071 | 3300025304 | Bacteria | 36088 |
| 458 | Ga0209257_1001515 | 3300025304 | Bacteria | 27237 |
| 459 | Ga0209257_1013597 | 3300025304 | Bacteria | 3597 |
| 460 | Ga0207697_10045640 | 3300025315 | Bacteria | 1804 |
| 461 | Ga0207656_10001422 | 3300025321 | Bacteria | 7919 |
| 462 | Ga0207656_10005083 | 3300025321 | Bacteria | 4626 |
| 463 | Ga0207656_10028661 | 3300025321 | Bacteria | 2287 |
| 464 | Ga0207656_10029028 | 3300025321 | Bacteria | 2275 |
| 465 | Ga0207656_10039998 | 3300025321 | Bacteria | 1986 |
| 466 | Ga0207656_10112987 | 3300025321 | Bacteria | 1257 |
| 467 | Ga0207713_1003473 | 3300025735 | Bacteria | 10729 |
| 468 | Ga0207642_10007833 | 3300025899 | Bacteria | 3628 |
| 469 | Ga0207710_10068749 | 3300025900 | Bacteria | 1620 |
| 470 | Ga0207710_10075666 | 3300025900 | Bacteria | 1552 |
| 471 | Ga0207688_10015331 | 3300025901 | Bacteria | 4158 |
| 472 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 473 | Ga0207680_10002571 | 3300025903 | Bacteria | 8464 |
| 474 | Ga0207680_10009078 | 3300025903 | Bacteria | 4915 |
| 475 | Ga0207680_10175237 | 3300025903 | Bacteria | 1447 |
| 476 | Ga0207647_10000805 | 3300025904 | Bacteria | 24314 |
| 477 | Ga0207647_10005630 | 3300025904 | Bacteria | 9147 |
| 478 | Ga0207647_10078400 | 3300025904 | Bacteria | 1984 |
| 479 | Ga0207647_10084282 | 3300025904 | Bacteria | 1902 |
| 480 | Ga0207647_10088179 | 3300025904 | Bacteria | 1853 |
| 481 | Ga0207647_10117171 | 3300025904 | Bacteria | 1572 |
| 482 | Ga0207647_10251248 | 3300025904 | Bacteria | 1014 |
| 483 | Ga0207645_10015238 | 3300025907 | Bacteria | 5117 |
| 484 | Ga0207645_10026774 | 3300025907 | Bacteria | 3725 |
| 485 | Ga0207645_10080062 | 3300025907 | Bacteria | 2094 |
| 486 | Ga0207645_10086739 | 3300025907 | Bacteria | 2011 |
| 487 | Ga0207645_10110473 | 3300025907 | Bacteria | 1779 |
| 488 | Ga0207705_10000121 | 3300025909 | Bacteria | 86649 |
| 489 | Ga0207705_10000592 | 3300025909 | Bacteria | 30427 |
| 490 | Ga0207705_10017650 | 3300025909 | Bacteria | 5106 |
| 491 | Ga0207705_10024003 | 3300025909 | Bacteria | 4351 |
| 492 | Ga0207705_10031278 | 3300025909 | Bacteria | 3797 |
| 493 | Ga0207705_10042845 | 3300025909 | Bacteria | 3250 |
| 494 | Ga0207705_10043256 | 3300025909 | Bacteria | 3235 |
| 495 | Ga0207705_10079630 | 3300025909 | Bacteria | 2386 |
| 496 | Ga0207654_10003722 | 3300025911 | Bacteria | 7699 |
| 497 | Ga0207654_10011547 | 3300025911 | Bacteria | 4507 |
| 498 | Ga0207707_10008275 | 3300025912 | Bacteria | 9025 |
| 499 | Ga0207707_10096899 | 3300025912 | Bacteria | 2577 |
| 500 | Ga0207707_10344103 | 3300025912 | Bacteria | 1285 |
| 501 | Ga0207695_10002715 | 3300025913 | Bacteria | 25830 |
| 502 | Ga0207695_10007597 | 3300025913 | Bacteria | 13744 |
| 503 | Ga0207695_10016512 | 3300025913 | Bacteria | 8631 |
| 504 | Ga0207695_10038816 | 3300025913 | Bacteria | 5122 |
| 505 | Ga0207671_10001479 | 3300025914 | Bacteria | 27142 |
| 506 | Ga0207671_10011623 | 3300025914 | Bacteria | 7144 |
| 507 | Ga0207671_10013100 | 3300025914 | Bacteria | 6625 |
| 508 | Ga0207671_10175338 | 3300025914 | Bacteria | 1666 |
| 509 | Ga0207671_10254387 | 3300025914 | Bacteria | 1381 |
| 510 | Ga0207671_10694554 | 3300025914 | Bacteria | 809 |
| 511 | Ga0207693_10210615 | 3300025915 | Bacteria | 1528 |
| 512 | Ga0207660_10038492 | 3300025917 | Bacteria | 3339 |
| 513 | Ga0207660_10161905 | 3300025917 | Bacteria | 1727 |
| 514 | Ga0207660_10181164 | 3300025917 | Bacteria | 1636 |
| 515 | Ga0207657_10002178 | 3300025919 | Bacteria | 21220 |
| 516 | Ga0207657_10003582 | 3300025919 | Bacteria | 16572 |
| 517 | Ga0207657_10008376 | 3300025919 | Bacteria | 10500 |
| 518 | Ga0207657_10012964 | 3300025919 | Bacteria | 8196 |
| 519 | Ga0207657_10014496 | 3300025919 | Bacteria | 7691 |
| 520 | Ga0207657_10016571 | 3300025919 | Bacteria | 7100 |
| 521 | Ga0207657_10023959 | 3300025919 | Bacteria | 5667 |
| 522 | Ga0207657_10035869 | 3300025919 | Bacteria | 4442 |
| 523 | Ga0207657_10167232 | 3300025919 | Bacteria | 1783 |
| 524 | Ga0207657_10247796 | 3300025919 | Bacteria | 1421 |
| 525 | Ga0207657_10382327 | 3300025919 | Bacteria | 1108 |
| 526 | Ga0207649_10000475 | 3300025920 | Bacteria | 28671 |
| 527 | Ga0207649_10006830 | 3300025920 | Bacteria | 6201 |
| 528 | Ga0207649_10015845 | 3300025920 | Bacteria | 4238 |
| 529 | Ga0207649_10153329 | 3300025920 | Bacteria | 1589 |
| 530 | Ga0207652_10037349 | 3300025921 | Bacteria | 4111 |
| 531 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 532 | Ga0207681_10000038 | 3300025923 | Bacteria | 153694 |
| 533 | Ga0207681_10049750 | 3300025923 | Bacteria | 2834 |
| 534 | Ga0207681_10054598 | 3300025923 | Bacteria | 2717 |
| 535 | Ga0207681_10059426 | 3300025923 | Bacteria | 2621 |
| 536 | Ga0207681_10229385 | 3300025923 | Bacteria | 1440 |
| 537 | Ga0207681_10250157 | 3300025923 | Bacteria | 1383 |
| 538 | Ga0207681_10293046 | 3300025923 | Bacteria | 1285 |
| 539 | Ga0207694_10001050 | 3300025924 | Bacteria | 24056 |
| 540 | Ga0207694_10004743 | 3300025924 | Bacteria | 10571 |
| 541 | Ga0207694_10009796 | 3300025924 | Bacteria | 7232 |
| 542 | Ga0207694_10014424 | 3300025924 | Bacteria | 5957 |
| 543 | Ga0207694_10021743 | 3300025924 | Bacteria | 4861 |
| 544 | Ga0207694_10026198 | 3300025924 | Bacteria | 4433 |
| 545 | Ga0207694_10053932 | 3300025924 | Bacteria | 3118 |
| 546 | Ga0207694_10183155 | 3300025924 | Bacteria | 1699 |
| 547 | Ga0207694_10512327 | 3300025924 | Bacteria | 1005 |
| 548 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 549 | Ga0207650_10000294 | 3300025925 | Bacteria | 50141 |
| 550 | Ga0207650_10004568 | 3300025925 | Bacteria | 9467 |
| 551 | Ga0207650_10024760 | 3300025925 | Bacteria | 4271 |
| 552 | Ga0207650_10080057 | 3300025925 | Bacteria | 2476 |
| 553 | Ga0207650_10121113 | 3300025925 | Bacteria | 2037 |
| 554 | Ga0207650_10200919 | 3300025925 | Bacteria | 1597 |
| 555 | Ga0207650_10287302 | 3300025925 | Bacteria | 1340 |
| 556 | Ga0207659_10000922 | 3300025926 | Bacteria | 17511 |
| 557 | Ga0207659_10271913 | 3300025926 | Bacteria | 1382 |
| 558 | Ga0207687_10004504 | 3300025927 | Bacteria | 9272 |
| 559 | Ga0207644_10000039 | 3300025931 | Bacteria | 121348 |
| 560 | Ga0207644_10000197 | 3300025931 | Bacteria | 42679 |
| 561 | Ga0207644_10000214 | 3300025931 | Bacteria | 39975 |
| 562 | Ga0207644_10000863 | 3300025931 | Bacteria | 19167 |
| 563 | Ga0207644_10002893 | 3300025931 | Bacteria | 11065 |
| 564 | Ga0207644_10010201 | 3300025931 | Bacteria | 6189 |
| 565 | Ga0207644_10020550 | 3300025931 | Bacteria | 4490 |
| 566 | Ga0207644_10022249 | 3300025931 | Bacteria | 4330 |
| 567 | Ga0207644_10031319 | 3300025931 | Bacteria | 3705 |
| 568 | Ga0207644_10036676 | 3300025931 | Bacteria | 3444 |
| 569 | Ga0207644_10537220 | 3300025931 | Bacteria | 967 |
| 570 | Ga0207690_10002990 | 3300025932 | Bacteria | 10182 |
| 571 | Ga0207690_10007682 | 3300025932 | Bacteria | 6398 |
| 572 | Ga0207690_10008018 | 3300025932 | Bacteria | 6270 |
| 573 | Ga0207690_10012702 | 3300025932 | Bacteria | 5047 |
| 574 | Ga0207690_10056672 | 3300025932 | Bacteria | 2644 |
| 575 | Ga0207690_10107312 | 3300025932 | Bacteria | 2005 |
| 576 | Ga0207690_10363951 | 3300025932 | Bacteria | 1146 |
| 577 | Ga0207706_10004569 | 3300025933 | Bacteria | 12991 |
| 578 | Ga0207706_10005341 | 3300025933 | Bacteria | 11974 |
| 579 | Ga0207706_10009419 | 3300025933 | Bacteria | 8966 |
| 580 | Ga0207706_10011916 | 3300025933 | Bacteria | 7916 |
| 581 | Ga0207706_10022091 | 3300025933 | Bacteria | 5710 |
| 582 | Ga0207706_10028785 | 3300025933 | Bacteria | 4960 |
| 583 | Ga0207706_10047492 | 3300025933 | Bacteria | 3798 |
| 584 | Ga0207706_10051583 | 3300025933 | Bacteria | 3632 |
| 585 | Ga0207706_10062580 | 3300025933 | Bacteria | 3277 |
| 586 | Ga0207706_10373486 | 3300025933 | Bacteria | 1238 |
| 587 | Ga0207686_10002145 | 3300025934 | Bacteria | 10850 |
| 588 | Ga0207686_10013436 | 3300025934 | Bacteria | 4532 |
| 589 | Ga0207709_10000629 | 3300025935 | Bacteria | 28906 |
| 590 | Ga0207709_10000951 | 3300025935 | Bacteria | 21659 |
| 591 | Ga0207709_10058533 | 3300025935 | Bacteria | 2395 |
| 592 | Ga0207709_10614511 | 3300025935 | Bacteria | 862 |
| 593 | Ga0207670_10106249 | 3300025936 | Bacteria | 2014 |
| 594 | Ga0207669_10000755 | 3300025937 | Bacteria | 13988 |
| 595 | Ga0207669_10005841 | 3300025937 | Bacteria | 5566 |
| 596 | Ga0207669_10069602 | 3300025937 | Bacteria | 2202 |
| 597 | Ga0207669_10209644 | 3300025937 | Bacteria | 1421 |
| 598 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 599 | Ga0207704_10061836 | 3300025938 | Bacteria | 2325 |
| 600 | Ga0207704_10665084 | 3300025938 | Bacteria | 859 |
| 601 | Ga0207691_10003283 | 3300025940 | Bacteria | 15755 |
| 602 | Ga0207691_10056417 | 3300025940 | Bacteria | 3578 |
| 603 | Ga0207691_10099573 | 3300025940 | Bacteria | 2595 |
| 604 | Ga0207691_10704127 | 3300025940 | Bacteria | 852 |
| 605 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 606 | Ga0207711_10000042 | 3300025941 | Bacteria | 158782 |
| 607 | Ga0207711_10001064 | 3300025941 | Bacteria | 26287 |
| 608 | Ga0207711_10002492 | 3300025941 | Bacteria | 16434 |
| 609 | Ga0207711_10012589 | 3300025941 | Bacteria | 7025 |
| 610 | Ga0207711_10047359 | 3300025941 | Bacteria | 3675 |
| 611 | Ga0207711_10063922 | 3300025941 | Bacteria | 3178 |
| 612 | Ga0207711_10088519 | 3300025941 | Bacteria | 2719 |
| 613 | Ga0207711_10209286 | 3300025941 | Bacteria | 1781 |
| 614 | Ga0207711_10256413 | 3300025941 | Bacteria | 1607 |
| 615 | Ga0207711_10371094 | 3300025941 | Bacteria | 1327 |
| 616 | Ga0207689_10001710 | 3300025942 | Bacteria | 20764 |
| 617 | Ga0207689_10069129 | 3300025942 | Bacteria | 2902 |
| 618 | Ga0207689_10117639 | 3300025942 | Bacteria | 2185 |
| 619 | Ga0207661_10228734 | 3300025944 | Bacteria | 1646 |
| 620 | Ga0207661_10481259 | 3300025944 | Bacteria | 1133 |
| 621 | Ga0207679_10002349 | 3300025945 | Bacteria | 11640 |
| 622 | Ga0207679_10014116 | 3300025945 | Bacteria | 5244 |
| 623 | Ga0207679_10014928 | 3300025945 | Bacteria | 5118 |
| 624 | Ga0207679_10041360 | 3300025945 | Bacteria | 3305 |
| 625 | Ga0207679_10058126 | 3300025945 | Bacteria | 2864 |
| 626 | Ga0207679_10074849 | 3300025945 | Bacteria | 2567 |
| 627 | Ga0207679_10222304 | 3300025945 | Bacteria | 1589 |
| 628 | Ga0207679_10303461 | 3300025945 | Bacteria | 1377 |
| 629 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 630 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 631 | Ga0207667_10000651 | 3300025949 | Bacteria | 45008 |
| 632 | Ga0207667_10000692 | 3300025949 | Bacteria | 43754 |
| 633 | Ga0207667_10010455 | 3300025949 | Bacteria | 10845 |
| 634 | Ga0207667_10021125 | 3300025949 | Bacteria | 7220 |
| 635 | Ga0207667_10172630 | 3300025949 | Bacteria | 2222 |
| 636 | Ga0207667_10367666 | 3300025949 | Bacteria | 1466 |
| 637 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 638 | Ga0207651_10003812 | 3300025960 | Bacteria | 7472 |
| 639 | Ga0207651_10003837 | 3300025960 | Bacteria | 7452 |
| 640 | Ga0207651_10011490 | 3300025960 | Bacteria | 4960 |
| 641 | Ga0207651_10411755 | 3300025960 | Bacteria | 1152 |
| 642 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 643 | Ga0207712_10000012 | 3300025961 | Bacteria | 392363 |
| 644 | Ga0207712_10000224 | 3300025961 | Bacteria | 55674 |
| 645 | Ga0207712_10030985 | 3300025961 | Bacteria | 3599 |
| 646 | Ga0207712_10101759 | 3300025961 | Bacteria | 2137 |
| 647 | Ga0207712_10433445 | 3300025961 | Bacteria | 1111 |
| 648 | Ga0207712_10733493 | 3300025961 | Bacteria | 864 |
| 649 | Ga0207668_10000026 | 3300025972 | Bacteria | 128309 |
| 650 | Ga0207668_10000228 | 3300025972 | Bacteria | 37684 |
| 651 | Ga0207668_10000490 | 3300025972 | Bacteria | 24826 |
| 652 | Ga0207668_10013664 | 3300025972 | Bacteria | 5008 |
| 653 | Ga0207668_10014529 | 3300025972 | Bacteria | 4875 |
| 654 | Ga0207668_10203323 | 3300025972 | Bacteria | 1579 |
| 655 | Ga0207668_10548058 | 3300025972 | Bacteria | 1001 |
| 656 | Ga0207640_10000891 | 3300025981 | Bacteria | 16939 |
| 657 | Ga0207640_10004646 | 3300025981 | Bacteria | 7453 |
| 658 | Ga0207640_10005537 | 3300025981 | Bacteria | 6881 |
| 659 | Ga0207640_10037340 | 3300025981 | Bacteria | 3055 |
| 660 | Ga0207640_10046863 | 3300025981 | Bacteria | 2785 |
| 661 | Ga0207640_10047485 | 3300025981 | Bacteria | 2769 |
| 662 | Ga0207640_10086439 | 3300025981 | Bacteria | 2159 |
| 663 | Ga0207640_10095691 | 3300025981 | Bacteria | 2068 |
| 664 | Ga0207640_10208530 | 3300025981 | Bacteria | 1487 |
| 665 | Ga0207640_10281484 | 3300025981 | Bacteria | 1306 |
| 666 | Ga0207640_10500198 | 3300025981 | Bacteria | 1012 |
| 667 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 668 | Ga0207658_10000364 | 3300025986 | Bacteria | 44527 |
| 669 | Ga0207658_10000545 | 3300025986 | Bacteria | 34100 |
| 670 | Ga0207658_10000902 | 3300025986 | Bacteria | 24720 |
| 671 | Ga0207658_10009480 | 3300025986 | Bacteria | 6606 |
| 672 | Ga0207658_10009613 | 3300025986 | Bacteria | 6562 |
| 673 | Ga0207658_10009967 | 3300025986 | Bacteria | 6457 |
| 674 | Ga0207658_10049116 | 3300025986 | Bacteria | 3098 |
| 675 | Ga0207658_10225527 | 3300025986 | Bacteria | 1579 |
| 676 | Ga0207677_10000030 | 3300026023 | Bacteria | 120692 |
| 677 | Ga0207677_10009857 | 3300026023 | Bacteria | 5385 |
| 678 | Ga0207703_10000135 | 3300026035 | Bacteria | 89779 |
| 679 | Ga0207703_10000404 | 3300026035 | Bacteria | 46297 |
| 680 | Ga0207703_10001087 | 3300026035 | Bacteria | 25874 |
| 681 | Ga0207703_10015254 | 3300026035 | Bacteria | 5995 |
| 682 | Ga0207703_10054327 | 3300026035 | Bacteria | 3257 |
| 683 | Ga0207639_10002074 | 3300026041 | Bacteria | 13509 |
| 684 | Ga0207639_10007490 | 3300026041 | Bacteria | 7447 |
| 685 | Ga0207639_10008847 | 3300026041 | Bacteria | 6924 |
| 686 | Ga0207639_10044857 | 3300026041 | Bacteria | 3327 |
| 687 | Ga0207639_10051972 | 3300026041 | Bacteria | 3120 |
| 688 | Ga0207639_10095900 | 3300026041 | Bacteria | 2385 |
| 689 | Ga0207639_10187075 | 3300026041 | Bacteria | 1766 |
| 690 | Ga0207639_10254497 | 3300026041 | Bacteria | 1533 |
| 691 | Ga0207678_10006676 | 3300026067 | Bacteria | 10229 |
| 692 | Ga0207678_10008727 | 3300026067 | Bacteria | 8925 |
| 693 | Ga0207678_10036870 | 3300026067 | Bacteria | 4256 |
| 694 | Ga0207678_10048089 | 3300026067 | Bacteria | 3688 |
| 695 | Ga0207678_10067448 | 3300026067 | Bacteria | 3071 |
| 696 | Ga0207678_10076194 | 3300026067 | Bacteria | 2873 |
| 697 | Ga0207678_10257733 | 3300026067 | Bacteria | 1494 |
| 698 | Ga0207702_10000462 | 3300026078 | Bacteria | 45995 |
| 699 | Ga0207702_10016406 | 3300026078 | Bacteria | 6131 |
| 700 | Ga0207702_10052596 | 3300026078 | Bacteria | 3447 |
| 701 | Ga0207702_10185626 | 3300026078 | Bacteria | 1918 |
| 702 | Ga0207702_10198470 | 3300026078 | Bacteria | 1858 |
| 703 | Ga0207702_10201102 | 3300026078 | Bacteria | 1847 |
| 704 | Ga0207702_10414569 | 3300026078 | Bacteria | 1301 |
| 705 | Ga0207702_10449235 | 3300026078 | Bacteria | 1250 |
| 706 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 707 | Ga0207641_10000024 | 3300026088 | Bacteria | 250751 |
| 708 | Ga0207641_10000033 | 3300026088 | Bacteria | 219261 |
| 709 | Ga0207641_10000277 | 3300026088 | Bacteria | 64441 |
| 710 | Ga0207641_10000626 | 3300026088 | Bacteria | 38602 |
| 711 | Ga0207641_10001261 | 3300026088 | Bacteria | 25224 |
| 712 | Ga0207641_10002117 | 3300026088 | Bacteria | 18786 |
| 713 | Ga0207641_10004973 | 3300026088 | Bacteria | 11403 |
| 714 | Ga0207641_10005398 | 3300026088 | Bacteria | 10920 |
| 715 | Ga0207641_10006503 | 3300026088 | Bacteria | 9839 |
| 716 | Ga0207641_10017421 | 3300026088 | Bacteria | 5880 |
| 717 | Ga0207641_10173019 | 3300026088 | Bacteria | 1972 |
| 718 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 719 | Ga0207648_10003494 | 3300026089 | Bacteria | 16462 |
| 720 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 721 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 722 | Ga0207676_10000340 | 3300026095 | Bacteria | 40187 |
| 723 | Ga0207676_10000600 | 3300026095 | Bacteria | 29522 |
| 724 | Ga0207676_10002850 | 3300026095 | Bacteria | 12309 |
| 725 | Ga0207676_10006287 | 3300026095 | Bacteria | 8388 |
| 726 | Ga0207676_10042482 | 3300026095 | Bacteria | 3497 |
| 727 | Ga0207676_10080658 | 3300026095 | Bacteria | 2641 |
| 728 | Ga0207676_10107993 | 3300026095 | Bacteria | 2322 |
| 729 | Ga0207674_10003716 | 3300026116 | Bacteria | 18636 |
| 730 | Ga0207674_10010165 | 3300026116 | Bacteria | 10693 |
| 731 | Ga0207674_10012150 | 3300026116 | Bacteria | 9640 |
| 732 | Ga0207674_10014103 | 3300026116 | Bacteria | 8829 |
| 733 | Ga0207674_10058492 | 3300026116 | Bacteria | 3904 |
| 734 | Ga0207675_100000071 | 3300026118 | Bacteria | 77575 |
| 735 | Ga0207675_100000171 | 3300026118 | Bacteria | 58198 |
| 736 | Ga0207675_100004115 | 3300026118 | Bacteria | 14077 |
| 737 | Ga0207675_100074164 | 3300026118 | Bacteria | 3184 |
| 738 | Ga0207675_100275287 | 3300026118 | Bacteria | 1634 |
| 739 | Ga0207675_100690505 | 3300026118 | Bacteria | 1029 |
| 740 | Ga0207683_10030752 | 3300026121 | Bacteria | 4654 |
| 741 | Ga0207683_10038419 | 3300026121 | Bacteria | 4172 |
| 742 | Ga0207683_10059873 | 3300026121 | Bacteria | 3346 |
| 743 | Ga0207683_10204941 | 3300026121 | Bacteria | 1794 |
| 744 | Ga0207698_10008400 | 3300026142 | Bacteria | 6529 |
| 745 | Ga0207698_10009783 | 3300026142 | Bacteria | 6125 |
| 746 | Ga0207698_10013046 | 3300026142 | Bacteria | 5467 |
| 747 | Ga0207698_10035886 | 3300026142 | Bacteria | 3632 |
| 748 | Ga0207698_10064919 | 3300026142 | Bacteria | 2864 |
| 749 | Ga0207698_10089859 | 3300026142 | Bacteria | 2510 |
| 750 | Ga0207698_10158574 | 3300026142 | Bacteria | 1975 |
| 751 | Ga0207698_10172860 | 3300026142 | Bacteria | 1904 |
| 752 | Ga0207698_10207361 | 3300026142 | Bacteria | 1760 |
| 753 | Ga0268266_10000028 | 3300028379 | Bacteria | 425294 |
| 754 | Ga0268266_10398752 | 3300028379 | Bacteria | 1300 |
| 755 | Ga0268266_10664587 | 3300028379 | Bacteria | 1003 |
| 756 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 757 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 758 | Ga0268265_10000071 | 3300028380 | Bacteria | 132890 |
| 759 | Ga0268265_10000081 | 3300028380 | Bacteria | 120869 |
| 760 | Ga0268265_10001985 | 3300028380 | Bacteria | 16188 |
| 761 | Ga0268265_10070456 | 3300028380 | Bacteria | 2719 |
| 762 | Ga0268265_10155686 | 3300028380 | Bacteria | 1933 |
| 763 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 764 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 765 | Ga0268264_10000277 | 3300028381 | Bacteria | 86740 |
| 766 | Ga0268264_10002895 | 3300028381 | Bacteria | 14925 |
| 767 | Ga0268264_10007584 | 3300028381 | Bacteria | 9048 |
| 768 | Ga0268264_10017268 | 3300028381 | Bacteria | 5912 |
| 769 | Ga0268264_10046924 | 3300028381 | Bacteria | 3590 |
| 770 | Ga0268264_10046935 | 3300028381 | Bacteria | 3590 |
| 771 | Ga0268264_10513770 | 3300028381 | Bacteria | 1170 |
| 772 | Ga0268264_10648904 | 3300028381 | Bacteria | 1044 |
| 773 | Ga0307517_10017543 | 3300028786 | Bacteria | 9325 |
| 774 | Ga0314311_1253059 | 3300030733 | Bacteria | 1106 |
| 775 | Ga0307513_10038050 | 3300031456 | Bacteria | 5347 |
| 776 | Ga0307513_10062253 | 3300031456 | Bacteria | 3945 |
| 777 | Ga0307408_100159239 | 3300031548 | Bacteria | 1791 |
| 778 | Ga0307408_100375434 | 3300031548 | Bacteria | 1214 |
| 779 | Ga0307405_10010820 | 3300031731 | Bacteria | 4749 |
| 780 | Ga0307405_10019377 | 3300031731 | Bacteria | 3777 |
| 781 | Ga0307413_10011043 | 3300031824 | Bacteria | 4417 |
| 782 | Ga0307413_10177020 | 3300031824 | Bacteria | 1516 |
| 783 | Ga0307413_10326141 | 3300031824 | Bacteria | 1175 |
| 784 | Ga0307410_10051488 | 3300031852 | Bacteria | 2775 |
| 785 | Ga0307410_10060530 | 3300031852 | Bacteria | 2588 |
| 786 | Ga0307410_10101091 | 3300031852 | Bacteria | 2066 |
| 787 | Ga0307410_10301796 | 3300031852 | Bacteria | 1264 |
| 788 | Ga0307406_10107594 | 3300031901 | Bacteria | 1912 |
| 789 | Ga0307406_10220312 | 3300031901 | Bacteria | 1410 |
| 790 | Ga0307406_10833827 | 3300031901 | Bacteria | 780 |
| 791 | Ga0307407_10014810 | 3300031903 | Bacteria | 3830 |
| 792 | Ga0307412_10014384 | 3300031911 | Bacteria | 4665 |
| 793 | Ga0307412_10119740 | 3300031911 | Bacteria | 1893 |
| 794 | Ga0307412_10530911 | 3300031911 | Bacteria | 985 |
| 795 | Ga0307409_100048881 | 3300031995 | Bacteria | 3222 |
| 796 | Ga0307409_100309460 | 3300031995 | Bacteria | 1473 |
| 797 | Ga0307409_100484735 | 3300031995 | Bacteria | 1201 |
| 798 | Ga0307409_100510853 | 3300031995 | Bacteria | 1172 |
| 799 | Ga0307416_100009723 | 3300032002 | Bacteria | 6315 |
| 800 | Ga0307416_101033116 | 3300032002 | Bacteria | 925 |
| 801 | Ga0307414_10001499 | 3300032004 | Bacteria | 12124 |
| 802 | Ga0307414_10025253 | 3300032004 | Bacteria | 3802 |
| 803 | Ga0307414_10070847 | 3300032004 | Bacteria | 2512 |
| 804 | Ga0307414_10081762 | 3300032004 | Bacteria | 2366 |
| 805 | Ga0307414_10159855 | 3300032004 | Bacteria | 1788 |
| 806 | Ga0307411_10012651 | 3300032005 | Bacteria | 4617 |
| 807 | Ga0307411_10040331 | 3300032005 | Bacteria | 2961 |
| 808 | Ga0307411_10060206 | 3300032005 | Bacteria | 2520 |
| 809 | Ga0307411_10070385 | 3300032005 | Bacteria | 2367 |
| 810 | Ga0307411_10101841 | 3300032005 | Bacteria | 2033 |
| 811 | Ga0307411_10207482 | 3300032005 | Bacteria | 1510 |
| 812 | Ga0307411_10252169 | 3300032005 | Bacteria | 1388 |
| 813 | Ga0307411_10347093 | 3300032005 | Bacteria | 1208 |
| 814 | Ga0307411_10572468 | 3300032005 | Bacteria | 967 |
| 815 | Ga0307415_100020974 | 3300032126 | Bacteria | 4003 |
| 816 | Ga0307415_100100012 | 3300032126 | Bacteria | 2124 |
| 817 | Ga0307510_10219879 | 3300033180 | Bacteria | 1412 |
| 818 | Ga0307510_10238088 | 3300033180 | Bacteria | 1317 |
| 819 | Ga0373941_0085440 | 3300035115 | Bacteria | 1073 |
| 820 | Ga0373931_0246318 | 3300035691 | Bacteria | 1085 |
| 821 | Ga0395899_0018782 | 3300037312 | Bacteria | 5252 |
| 822 | Ga0395899_0037136 | 3300037312 | Bacteria | 3652 |
| 823 | Ga0395900_0000764 | 3300037418 | Bacteria | 42836 |
| 824 | Ga0395900_0081537 | 3300037418 | Bacteria | 3323 |
| 825 | Ga0395900_0094288 | 3300037418 | Bacteria | 3074 |
| 826 | Ga0395900_0178364 | 3300037418 | Bacteria | 2160 |
| 827 | Ga0395900_0359544 | 3300037418 | Bacteria | 1427 |
| 828 | Ga0395900_0579831 | 3300037418 | Bacteria | 1064 |
| 829 | Ga0395900_0630950 | 3300037418 | Bacteria | 1010 |
| 830 | Ga0395898_0021463 | 3300037466 | Bacteria | 6548 |
| 831 | Ga0395898_0028931 | 3300037466 | Bacteria | 5553 |
| 832 | Ga0395898_0058445 | 3300037466 | Bacteria | 3753 |
| 833 | Ga0395898_0117307 | 3300037466 | Bacteria | 2550 |
| 834 | Ga0395905_0003045 | 3300037471 | Bacteria | 18153 |
| 835 | Ga0395905_0004674 | 3300037471 | Bacteria | 14154 |
| 836 | Ga0395905_0013463 | 3300037471 | Bacteria | 7838 |
| 837 | Ga0395905_0017316 | 3300037471 | Bacteria | 6842 |
| 838 | Ga0395905_0033153 | 3300037471 | Bacteria | 4853 |
| 839 | Ga0395905_0043534 | 3300037471 | Bacteria | 4211 |
| 840 | Ga0395905_0044710 | 3300037471 | Bacteria | 4155 |
| 841 | Ga0395905_0117126 | 3300037471 | Bacteria | 2503 |
| 842 | Ga0395905_0158282 | 3300037471 | Bacteria | 2130 |
| 843 | Ga0395905_0328782 | 3300037471 | Bacteria | 1419 |
| 844 | Ga0395905_0742484 | 3300037471 | Bacteria | 884 |
| 845 | Ga0395905_0755988 | 3300037471 | Bacteria | 874 |
| 846 | Ga0395905_0794686 | 3300037471 | Bacteria | 849 |
| 847 | Ga0436364_0612163 | 3300037853 | Bacteria | 25384 |
| 848 | Ga0436364_0852694 | 3300037853 | Bacteria | 36694 |
| 849 | Ga0395901_0005146 | 3300038443 | Bacteria | 13202 |
| 850 | Ga0395901_0009829 | 3300038443 | Bacteria | 9698 |
| 851 | Ga0395901_0118405 | 3300038443 | Bacteria | 2782 |
| 852 | Ga0395901_0343089 | 3300038443 | Bacteria | 1543 |
| 853 | Ga0395901_0438477 | 3300038443 | Bacteria | 1337 |
| 854 | Ga0436365_0866041 | 3300039437 | Bacteria | 911 |
| 855 | Ga0436363_1386082 | 3300039450 | Bacteria | 1243 |
| 856 | Ga0439436_0044005 | 3300041404 | Bacteria | 1272 |
| 857 | Ga0439439_0003354 | 3300041406 | Bacteria | 3524 |
| 858 | Ga0439461_0000202 | 3300041410 | Bacteria | 8326 |
| 859 | Ga0439461_0016751 | 3300041410 | Bacteria | 1418 |
| 860 | Ga0439465_0000274 | 3300041413 | Bacteria | 14388 |
| 861 | Ga0451807_0150684 | 3300041486 | Bacteria | 1517 |
| 862 | Ga0439431_0000103 | 3300041997 | Bacteria | 14374 |
| 863 | Ga0439445_0025915 | 3300042004 | Bacteria | 1498 |
| 864 | Ga0439448_0013838 | 3300042005 | Bacteria | 2429 |
| 865 | Ga0439432_012147 | 3300042006 | Bacteria | 2954 |
| 866 | Ga0439432_030753 | 3300042006 | Bacteria | 1740 |
| 867 | Ga0439432_032372 | 3300042006 | Bacteria | 1686 |
| 868 | Ga0450919_005818 | 3300042121 | Bacteria | 1473 |
| 869 | Ga0450905_001171 | 3300042142 | Bacteria | 3319 |
| 870 | Ga0450889_002955 | 3300042144 | Bacteria | 1679 |
| 871 | Ga0439458_0000559 | 3300042157 | Bacteria | 9582 |
| 872 | Ga0439434_0021611 | 3300042435 | Bacteria | 1933 |
| 873 | Ga0466972_0027337 | 3300044658 | Bacteria | 2823 |
| 874 | Ga0466961_0011363 | 3300044693 | Bacteria | 5693 |
| 875 | Ga0466961_0028348 | 3300044693 | Bacteria | 3600 |
| 876 | Ga0466963_0015006 | 3300044694 | Bacteria | 4788 |
| 877 | Ga0466963_0024760 | 3300044694 | Bacteria | 3822 |
| 878 | Ga0466963_0034218 | 3300044694 | Bacteria | 3305 |
| 879 | Ga0466963_0459130 | 3300044694 | Bacteria | 899 |
| 880 | Ga0466968_0010515 | 3300044735 | Bacteria | 3590 |
| 881 | Ga0466968_0253574 | 3300044735 | Bacteria | 836 |
| 882 | Ga0466970_0177239 | 3300044765 | Bacteria | 1182 |
| 883 | Ga0466957_0002027 | 3300044842 | Bacteria | 10800 |
| 884 | Ga0466960_0025899 | 3300044901 | Bacteria | 2659 |
| 885 | Ga0466959_0013667 | 3300045049 | Bacteria | 5890 |
| 886 | Ga0466959_0033855 | 3300045049 | Bacteria | 3779 |
| 887 | Ga0466959_0068216 | 3300045049 | Bacteria | 2577 |
| 888 | Ga0451576_0064272 | 3300045051 | Bacteria | 3823 |
| 889 | Ga0466958_0025243 | 3300045836 | Bacteria | 3502 |
| 890 | Ga0466958_0246927 | 3300045836 | Bacteria | 1141 |
| 891 | Ga0466967_0015627 | 3300045976 | Bacteria | 5956 |
| 892 | Ga0466967_0037136 | 3300045976 | Bacteria | 4165 |
| 893 | Ga0466967_0086428 | 3300045976 | Bacteria | 2841 |
| 894 | Ga0466967_0146406 | 3300045976 | Bacteria | 2203 |
| 895 | Ga0466967_0313871 | 3300045976 | Bacteria | 1511 |
| 896 | Ga0466967_0402204 | 3300045976 | Bacteria | 1332 |
| 897 | Ga0466967_0558545 | 3300045976 | Bacteria | 1127 |
| 898 | Ga0495627_003594 | 3300046453 | Bacteria | 6757 |
| 899 | Ga0495629_0237250 | 3300046459 | Bacteria | 1256 |
| 900 | Ga0495638_0032605 | 3300046460 | Bacteria | 3338 |
| 901 | Ga0495638_0325835 | 3300046460 | Bacteria | 819 |
| 902 | Ga0495650_0000428 | 3300046471 | Bacteria | 68082 |
| 903 | Ga0495582_0443271 | 3300046473 | Bacteria | 750 |
| 904 | Ga0495662_0063501 | 3300046476 | Bacteria | 1784 |
| 905 | Ga0495584_0162164 | 3300046491 | Bacteria | 1136 |
| 906 | Ga0495585_0039184 | 3300046492 | Bacteria | 2664 |
| 907 | Ga0495585_0041703 | 3300046492 | Bacteria | 2573 |
| 908 | Ga0495583_0000023 | 3300046506 | Bacteria | 280019 |
| 909 | Ga0495583_0001895 | 3300046506 | Bacteria | 19369 |
| 910 | Ga0495583_0003188 | 3300046506 | Bacteria | 12867 |
| 911 | Ga0495583_0069191 | 3300046506 | Bacteria | 1555 |
| 912 | Ga0495606_0000383 | 3300046507 | Bacteria | 75070 |
| 913 | Ga0495606_0007942 | 3300046507 | Bacteria | 9347 |
| 914 | Ga0495606_0031914 | 3300046507 | Bacteria | 3656 |
| 915 | Ga0495610_0000146 | 3300046512 | Bacteria | 77326 |
| 916 | Ga0495610_0132277 | 3300046512 | Bacteria | 1082 |
| 917 | Ga0495616_0189655 | 3300046513 | Bacteria | 909 |
| 918 | Ga0495631_0001928 | 3300046518 | Bacteria | 12186 |
| 919 | Ga0495637_0001942 | 3300046520 | Bacteria | 11707 |
| 920 | Ga0495637_0011424 | 3300046520 | Bacteria | 4267 |
| 921 | Ga0495643_0004145 | 3300046522 | Bacteria | 10301 |
| 922 | Ga0495643_0006878 | 3300046522 | Bacteria | 7409 |
| 923 | Ga0495643_0084923 | 3300046522 | Bacteria | 1642 |
| 924 | Ga0495643_0236448 | 3300046522 | Bacteria | 859 |
| 925 | Ga0495648_0001391 | 3300046524 | Bacteria | 23802 |
| 926 | Ga0495663_0002898 | 3300046525 | Bacteria | 5065 |
| 927 | Ga0495654_0066436 | 3300046530 | Bacteria | 1719 |
| 928 | Ga0495654_0080270 | 3300046530 | Bacteria | 1531 |
| 929 | Ga0495587_0153556 | 3300046536 | Bacteria | 1312 |
| 930 | Ga0495609_0113675 | 3300046538 | Bacteria | 1167 |
| 931 | Ga0495621_0002284 | 3300046539 | Bacteria | 5135 |
| 932 | Ga0495621_0030722 | 3300046539 | Bacteria | 1839 |
| 933 | Ga0495597_0012717 | 3300046542 | Bacteria | 4054 |
| 934 | Ga0495633_0002596 | 3300046558 | Bacteria | 12647 |
| 935 | Ga0495633_0003946 | 3300046558 | Bacteria | 9655 |
| 936 | Ga0495633_0013402 | 3300046558 | Bacteria | 4322 |
| 937 | Ga0495633_0029090 | 3300046558 | Bacteria | 2688 |
| 938 | Ga0495668_0000218 | 3300046616 | Bacteria | 83540 |
| 939 | Ga0495668_0023087 | 3300046616 | Bacteria | 3551 |
| 940 | Ga0495668_0169808 | 3300046616 | Bacteria | 1195 |
| 941 | Ga0495668_0246353 | 3300046616 | Bacteria | 978 |
| 942 | Ga0495611_0007098 | 3300046648 | Bacteria | 4758 |
| 943 | Ga0495625_0000496 | 3300046660 | Bacteria | 58853 |
| 944 | Ga0495625_0001071 | 3300046660 | Bacteria | 35534 |
| 945 | Ga0495625_0011582 | 3300046660 | Bacteria | 7178 |
| 946 | Ga0495625_0044610 | 3300046660 | Bacteria | 3209 |
| 947 | Ga0495625_0154925 | 3300046660 | Bacteria | 1538 |
| 948 | Ga0495661_0012693 | 3300046665 | Bacteria | 5687 |
| 949 | Ga0495661_0029644 | 3300046665 | Bacteria | 3491 |
| 950 | Ga0495588_0318398 | 3300046674 | Bacteria | 818 |
| 951 | Ga0495669_0000241 | 3300046684 | Bacteria | 32038 |
| 952 | Ga0495669_0008608 | 3300046684 | Bacteria | 4294 |
| 953 | Ga0495669_0017147 | 3300046684 | Bacteria | 3105 |
| 954 | Ga0495669_0098652 | 3300046684 | Bacteria | 1355 |
| 955 | Ga0495670_0000028 | 3300046691 | Bacteria | 90085 |
| 956 | Ga0495670_0024419 | 3300046691 | Bacteria | 2987 |
| 957 | Ga0495649_0237533 | 3300046694 | Bacteria | 939 |
| 958 | Ga0495600_0049411 | 3300046809 | Bacteria | 2744 |
| 959 | Ga0495660_0118787 | 3300046810 | Bacteria | 1340 |
| 960 | Ga0495660_0142058 | 3300046810 | Bacteria | 1193 |
| 961 | Ga0495683_0010498 | 3300047323 | Bacteria | 4890 |
| 962 | Ga0495687_001043 | 3300047443 | Bacteria | 27520 |
| 963 | Ga0495687_001672 | 3300047443 | Bacteria | 19833 |
| 964 | Ga0495677_0005009 | 3300047445 | Bacteria | 5054 |
| 965 | Ga0495677_0151658 | 3300047445 | Bacteria | 892 |
| 966 | Ga0495681_0000214 | 3300047470 | Bacteria | 48192 |
| 967 | Ga0495681_0025540 | 3300047470 | Bacteria | 3088 |
| 968 | Ga0495686_0001053 | 3300047472 | Bacteria | 32974 |
| 969 | Ga0495686_0002522 | 3300047472 | Bacteria | 17141 |
| 970 | Ga0495686_0004950 | 3300047472 | Bacteria | 10718 |
| 971 | Ga0495686_0083568 | 3300047472 | Bacteria | 1947 |
| 972 | Ga0495686_0099470 | 3300047472 | Bacteria | 1756 |
| 973 | Ga0496100_0005362 | 3300048903 | Bacteria | 6896 |
| 974 | Ga0496100_0132399 | 3300048903 | Bacteria | 1758 |
| 975 | Ga0496101_0001845 | 3300048904 | Bacteria | 12772 |
| 976 | Ga0496101_0020761 | 3300048904 | Bacteria | 4505 |
| 977 | Ga0496101_0141793 | 3300048904 | Bacteria | 1832 |
| 978 | Ga0496101_0265316 | 3300048904 | Bacteria | 1340 |
| 979 | Ga0496102_0000719 | 3300048905 | Bacteria | 32658 |
| 980 | Ga0496102_0000756 | 3300048905 | Bacteria | 31601 |
| 981 | Ga0496102_0004530 | 3300048905 | Bacteria | 11741 |
| 982 | Ga0496102_0357322 | 3300048905 | Bacteria | 1375 |
| 983 | Ga0496102_0583481 | 3300048905 | Bacteria | 1041 |
| 984 | Ga0496103_0000562 | 3300048906 | Bacteria | 29450 |
| 985 | Ga0496103_0002302 | 3300048906 | Bacteria | 12068 |
| 986 | Ga0496103_0007333 | 3300048906 | Bacteria | 6572 |
| 987 | Ga0496103_0014624 | 3300048906 | Bacteria | 4663 |
| 988 | Ga0496103_0070972 | 3300048906 | Bacteria | 2179 |
| 989 | Ga0496103_0423131 | 3300048906 | Bacteria | 855 |
| 990 | Ga0496104_0017339 | 3300048907 | Bacteria | 6555 |
| 991 | Ga0496104_0063254 | 3300048907 | Bacteria | 3509 |
| 992 | Ga0496105_0009443 | 3300048908 | Bacteria | 7630 |
| 993 | Ga0496105_0035375 | 3300048908 | Bacteria | 4111 |
| 994 | Ga0496105_0086958 | 3300048908 | Bacteria | 2583 |
| 995 | Ga0496105_0156845 | 3300048908 | Bacteria | 1869 |
| 996 | Ga0496106_0024920 | 3300048909 | Bacteria | 4448 |
| 997 | Ga0496106_0397289 | 3300048909 | Bacteria | 1108 |
| 998 | Ga0496107_0002051 | 3300048910 | Bacteria | 12880 |
| 999 | Ga0496107_0047010 | 3300048910 | Bacteria | 3107 |
| 1000 | Ga0496107_0165819 | 3300048910 | Bacteria | 1638 |
| 1001 | Ga0496108_0014779 | 3300048911 | Bacteria | 6372 |
| 1002 | Ga0496108_0051888 | 3300048911 | Bacteria | 3435 |
| 1003 | Ga0496109_0030292 | 3300048912 | Bacteria | 4850 |
| 1004 | Ga0496109_0038420 | 3300048912 | Bacteria | 4327 |
| 1005 | Ga0496109_0064818 | 3300048912 | Bacteria | 3344 |
| 1006 | Ga0496109_0071775 | 3300048912 | Bacteria | 3180 |
| 1007 | Ga0496110_0000948 | 3300048913 | Bacteria | 20317 |
| 1008 | Ga0496110_0009431 | 3300048913 | Bacteria | 7906 |
| 1009 | Ga0496110_0029480 | 3300048913 | Bacteria | 4724 |
| 1010 | Ga0496110_0083631 | 3300048913 | Bacteria | 2848 |
| 1011 | Ga0496110_0275824 | 3300048913 | Bacteria | 1531 |
| 1012 | Ga0496110_0471574 | 3300048913 | Bacteria | 1144 |
| 1013 | Ga0496111_0001035 | 3300048914 | Bacteria | 15288 |
| 1014 | Ga0496111_0004529 | 3300048914 | Bacteria | 8794 |
| 1015 | Ga0496111_0022502 | 3300048914 | Bacteria | 4414 |
| 1016 | Ga0496111_0074293 | 3300048914 | Bacteria | 2476 |
| 1017 | Ga0496112_0013316 | 3300048915 | Bacteria | 7592 |
| 1018 | Ga0496112_0554255 | 3300048915 | Bacteria | 1083 |
| 1019 | Ga0496113_0025057 | 3300048916 | Bacteria | 4248 |
| 1020 | Ga0496113_0284930 | 3300048916 | Bacteria | 1321 |
| 1021 | Ga0496114_0022765 | 3300048917 | Bacteria | 5107 |
| 1022 | Ga0496115_0000464 | 3300048918 | Bacteria | 32447 |
| 1023 | Ga0496115_0005489 | 3300048918 | Bacteria | 9229 |
| 1024 | Ga0496116_0002037 | 3300048919 | Bacteria | 21676 |
| 1025 | Ga0496116_0009864 | 3300048919 | Bacteria | 8081 |
| 1026 | Ga0496116_0056694 | 3300048919 | Bacteria | 2566 |
| 1027 | Ga0496117_0000519 | 3300048920 | Bacteria | 63633 |
| 1028 | Ga0496117_0001114 | 3300048920 | Bacteria | 40518 |
| 1029 | Ga0496117_0011627 | 3300048920 | Bacteria | 7867 |
| 1030 | Ga0496117_0021825 | 3300048920 | Bacteria | 5163 |
| 1031 | Ga0496117_0037145 | 3300048920 | Bacteria | 3633 |
| 1032 | Ga0496117_0040426 | 3300048920 | Bacteria | 3429 |
| 1033 | Ga0496118_0000127 | 3300048921 | Bacteria | 135377 |
| 1034 | Ga0496118_0000193 | 3300048921 | Bacteria | 107307 |
| 1035 | Ga0496118_0001703 | 3300048921 | Bacteria | 32166 |
| 1036 | Ga0496118_0004860 | 3300048921 | Bacteria | 15648 |
| 1037 | Ga0496118_0009117 | 3300048921 | Bacteria | 10095 |
| 1038 | Ga0496118_0029470 | 3300048921 | Bacteria | 4601 |
| 1039 | Ga0496119_0027214 | 3300048922 | Bacteria | 3937 |
| 1040 | Ga0496119_0036669 | 3300048922 | Bacteria | 3197 |
| 1041 | Ga0496119_0040560 | 3300048922 | Bacteria | 2975 |
| 1042 | Ga0496120_0049671 | 3300048923 | Bacteria | 2406 |
| 1043 | Ga0496121_0005712 | 3300048924 | Bacteria | 15799 |
| 1044 | Ga0496121_0010096 | 3300048924 | Bacteria | 10710 |
| 1045 | Ga0496121_0051385 | 3300048924 | Bacteria | 3472 |
| 1046 | Ga0496122_0016138 | 3300048925 | Bacteria | 7094 |
| 1047 | Ga0496123_0030686 | 3300048926 | Bacteria | 3930 |
| 1048 | Ga0496124_0000011 | 3300048927 | Bacteria | 524145 |
| 1049 | Ga0496124_0000237 | 3300048927 | Bacteria | 107270 |
| 1050 | Ga0496124_0067342 | 3300048927 | Bacteria | 2980 |
| 1051 | Ga0496125_0001918 | 3300048928 | Bacteria | 28461 |
| 1052 | Ga0496125_0062178 | 3300048928 | Bacteria | 2988 |
| 1053 | Ga0496126_0007282 | 3300048929 | Bacteria | 12162 |
| 1054 | Ga0496126_0008126 | 3300048929 | Bacteria | 11358 |
| 1055 | Ga0496126_0341185 | 3300048929 | Bacteria | 1227 |
| 1056 | Ga0495682_0023253 | 3300049460 | Bacteria | 2314 |
| 1057 | Ga0501290_002973 | 3300049513 | Bacteria | 2156 |
| 1058 | Ga0501290_011399 | 3300049513 | Bacteria | 1145 |
| 1059 | Ga0501292_000040 | 3300049515 | Bacteria | 31058 |
| 1060 | Ga0501043_0099754 | 3300049579 | Bacteria | 2282 |
| 1061 | Ga0501047_0000402 | 3300049581 | Bacteria | 48648 |
| 1062 | Ga0501206_001042 | 3300049653 | Bacteria | 3455 |
| 1063 | Ga0501208_006654 | 3300049655 | Bacteria | 1483 |
| 1064 | Ga0501222_002113 | 3300049662 | Bacteria | 2752 |
| 1065 | Ga0501223_001533 | 3300049663 | Bacteria | 5329 |
| 1066 | Ga0501224_001796 | 3300049664 | Bacteria | 2885 |
| 1067 | Ga0501235_003681 | 3300049669 | Bacteria | 3310 |
| 1068 | Ga0501249_000545 | 3300049679 | Bacteria | 9066 |
| 1069 | Ga0501257_000093 | 3300049686 | Bacteria | 21754 |
| 1070 | Ga0501261_000110 | 3300049690 | Bacteria | 12389 |
| 1071 | Ga0501221_001519 | 3300049704 | Bacteria | 3840 |
| 1072 | Ga0501225_0027884 | 3300049705 | Bacteria | 1552 |
| 1073 | Ga0501245_002143 | 3300049708 | Bacteria | 2622 |
| 1074 | Ga0501080_0971614 | 3300049742 | Bacteria | 738 |
| 1075 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 1076 | Ga0501280_000233 | 3300049776 | Bacteria | 13988 |
| 1077 | Ga0501280_000772 | 3300049776 | Bacteria | 6988 |
| 1078 | Ga0501281_00064 | 3300049777 | Bacteria | 12462 |
| 1079 | Ga0501282_000614 | 3300049778 | Bacteria | 4119 |
| 1080 | Ga0501204_005049 | 3300049850 | Bacteria | 1434 |
| 1081 | nmdc:mga0qj67_621834_c1 | 3300050509 | Bacteria | 863 |
| 1082 | nmdc:mga08y16_94019_c1 | 3300050511 | Bacteria | 3123 |
| 1083 | nmdc:mga0sz30_41051_c1 | 3300050516 | Bacteria | 1945 |
| 1084 | Ga0500610_0000668 | 3300053079 | Bacteria | 10580 |
| 1085 | Ga0500643_000136 | 3300053087 | Bacteria | 74292 |
| 1086 | Ga0500643_000338 | 3300053087 | Bacteria | 37288 |
| 1087 | Ga0500643_001250 | 3300053087 | Bacteria | 15061 |
| 1088 | Ga0500643_001549 | 3300053087 | Bacteria | 13025 |
| 1089 | Ga0500643_002056 | 3300053087 | Bacteria | 10762 |
| 1090 | Ga0500643_002934 | 3300053087 | Bacteria | 8461 |
| 1091 | Ga0500643_007149 | 3300053087 | Bacteria | 4564 |
| 1092 | Ga0500647_0092524 | 3300053091 | Bacteria | 1447 |
| 1093 | Ga0500651_0042612 | 3300053093 | Bacteria | 2860 |
| 1094 | Ga0500566_0000877 | 3300053094 | Bacteria | 17172 |
| 1095 | Ga0500555_000164 | 3300053103 | Bacteria | 30996 |
| 1096 | Ga0500592_000232 | 3300053116 | Bacteria | 10092 |
| 1097 | Ga0500592_002720 | 3300053116 | Bacteria | 2846 |
| 1098 | Ga0500592_022616 | 3300053116 | Bacteria | 1013 |
| 1099 | Ga0500595_002635 | 3300053119 | Bacteria | 8733 |
| 1100 | Ga0500608_076391 | 3300053122 | Bacteria | 1586 |
| 1101 | Ga0500608_192747 | 3300053122 | Bacteria | 850 |
| 1102 | Ga0500642_0000751 | 3300053130 | Bacteria | 9519 |
| 1103 | Ga0500642_0018625 | 3300053130 | Bacteria | 2690 |
| 1104 | Ga0500655_000159 | 3300053133 | Bacteria | 16704 |
| 1105 | Ga0500658_0002920 | 3300053134 | Bacteria | 6563 |
| 1106 | Ga0500658_0185545 | 3300053134 | Bacteria | 948 |
| 1107 | Ga0500559_0031963 | 3300053136 | Bacteria | 2259 |
| 1108 | Ga0500559_0110284 | 3300053136 | Bacteria | 1274 |
| 1109 | Ga0500564_057764 | 3300053138 | Bacteria | 1764 |
| 1110 | Ga0500568_0015114 | 3300053139 | Bacteria | 3462 |
| 1111 | Ga0500573_0000019 | 3300053140 | Bacteria | 173601 |
| 1112 | Ga0500573_0175726 | 3300053140 | Bacteria | 1155 |
| 1113 | Ga0500577_0032742 | 3300053142 | Bacteria | 1831 |
| 1114 | Ga0500590_005065 | 3300053148 | Bacteria | 6310 |
| 1115 | Ga0500616_0002503 | 3300053153 | Bacteria | 15215 |
| 1116 | Ga0500624_000009 | 3300053157 | Bacteria | 178763 |
| 1117 | Ga0500627_0000091 | 3300053158 | Bacteria | 30128 |
| 1118 | Ga0500636_0319596 | 3300053177 | Bacteria | 755 |
| 1119 | Ga0500570_001921 | 3300053724 | Bacteria | 9977 |
| 1120 | Ga0500625_000011 | 3300053729 | Bacteria | 133655 |
| 1121 | Ga0500645_000237 | 3300053730 | Bacteria | 41544 |
| 1122 | Ga0500645_001144 | 3300053730 | Bacteria | 14373 |
| 1123 | Ga0500645_011613 | 3300053730 | Bacteria | 2870 |
| 1124 | Ga0500645_020770 | 3300053730 | Bacteria | 2032 |
| 1125 | Ga0466962_0036472 | 3300061719 | Bacteria | 2353 |
| 1126 | 2600202819 | 2599185354 | Bacteria | 4398675 |
| 1127 | 2600228189 | 2599185359 | Bacteria | 4772316 |
| 1128 | 2643730531 | 2643221541 | Bacteria | 5498788 |
| 1129 | 2644037506 | 2643221605 | Bacteria | 4772303 |
| 1130 | 2644043700 | 2643221606 | Bacteria | 5588032 |
| 1131 | 2644128132 | 2643221622 | Bacteria | 4212502 |
| 1132 | 2644393859 | 2643221671 | Bacteria | 5496681 |
| 1133 | 2819716234 | 2818991466 | Bacteria | 4748179 |
| 1134 | 2879163813 | 2879163058 | Bacteria | 4223965 |
| 1135 | 2885430514 | 2885429604 | Bacteria | 3642894 |
| 1136 | 2928528963 | 2928526807 | Bacteria | 4760224 |
| 1137 | 2928971198 | 2928968154 | Bacteria | 4633371 |
| 1138 | 2990265880 | 2990265787 | Bacteria | 3943888 |
| 1139 | 2993696329 | 2993693658 | Bacteria | 4040749 |
| 1140 | 8057101643 | 8057101203 | Bacteria | 5034064 |
| 1141 | Ga0268266_10473503 | |||
| 1142 | JGI24736J21556_1000030 | |||
| 1143 | JGI24741J21665_1001317 | |||
| 1144 | JGI24741J21665_1004089 | |||
| 1145 | JGI24752J21851_1004310 | |||
| 1146 | JGI24740J21852_10003058 | |||
| 1147 | JGI24740J21852_10030569 | |||
| 1148 | JGI24739J22299_10001692 | |||
| 1149 | JGI24739J22299_10006535 | |||
| 1150 | JGI24739J22299_10047732 | |||
| 1151 | JGI24737J22298_10002390 | |||
| 1152 | JGI24737J22298_10005137 | |||
| 1153 | JGI24737J22298_10039840 | |||
| 1154 | JGI24735J21928_10000944 | |||
| 1155 | JGI24735J21928_10014907 | |||
| 1156 | JGI24735J21928_10021243 | |||
| 1157 | JGI24735J21928_10023346 | |||
| 1158 | JGI24735J21928_10051268 | |||
| 1159 | JGI24750J21931_1000713 | |||
| 1160 | JGI24748J21848_1000015 | |||
| 1161 | JGI24738J21930_10000900 | |||
| 1162 | JGI24738J21930_10034667 | |||
| 1163 | JGI24034J26672_10000006 | |||
| 1164 | JGI24034J26672_10011930 | |||
| 1165 | JGI24742J22300_10002123 | |||
| 1166 | JGI24751J29686_10000093 | |||
| 1167 | JGI24751J29686_10004337 | |||
| 1168 | JGI25150J39212_1000855 | |||
| 1169 | JGI25165J46597_1000024 | |||
| 1170 | JGI25153J46596_10000008 | |||
| 1171 | JGI25153J46596_10000091 | |||
| 1172 | JGI25153J46596_10000186 | |||
| 1173 | JGI25153J46596_10004838 | |||
| 1174 | Ga0055542_1004222 | |||
| 1175 | Ga0055537_1001760 | |||
| 1176 | Ga0055537_1002910 | |||
| 1177 | Ga0055524_1000118 | |||
| 1178 | Ga0055530_10000072 | |||
| 1179 | Ga0055530_10019126 | |||
| 1180 | Ga0055540_1001847 | |||
| 1181 | Ga0055531_10000114 | |||
| 1182 | Ga0055531_10001624 | |||
| 1183 | Ga0065165_1002052 | |||
| 1184 | Ga0065165_1012710 | |||
| 1185 | Ga0065704_10097475 | |||
| 1186 | Ga0065712_10079995 | |||
| 1187 | Ga0065707_10082467 | |||
| 1188 | Ga0065707_10082564 | |||
| 1189 | Ga0070658_10000181 | |||
| 1190 | Ga0070658_10001561 | |||
| 1191 | Ga0070658_10007616 | |||
| 1192 | Ga0070658_10028040 | |||
| 1193 | Ga0070658_10079969 | |||
| 1194 | Ga0070658_10192660 | |||
| 1195 | Ga0070676_10005147 | |||
| 1196 | Ga0070676_10091881 | |||
| 1197 | Ga0070676_10217451 | |||
| 1198 | Ga0070683_100006563 | |||
| 1199 | Ga0070683_100122456 | |||
| 1200 | Ga0070683_100195833 | |||
| 1201 | Ga0070690_100000012 | |||
| 1202 | Ga0070670_100000005 | |||
| 1203 | Ga0070670_100000169 | |||
| 1204 | Ga0070670_100000528 | |||
| 1205 | Ga0070670_100002960 | |||
| 1206 | Ga0070670_100036176 | |||
| 1207 | Ga0070670_100049951 | |||
| 1208 | Ga0070677_10061237 | |||
| 1209 | Ga0068869_100000635 | |||
| 1210 | Ga0070666_10000014 | |||
| 1211 | Ga0070666_10004574 | |||
| 1212 | Ga0070666_10012077 | |||
| 1213 | Ga0070680_100414715 | |||
| 1214 | Ga0068868_100000049 | |||
| 1215 | Ga0068868_100119637 | |||
| 1216 | Ga0070660_100003617 | |||
| 1217 | Ga0070660_100024707 | |||
| 1218 | Ga0070660_100031552 | |||
| 1219 | Ga0070660_100045703 | |||
| 1220 | Ga0070660_100193300 | |||
| 1221 | Ga0070660_100550573 | |||
| 1222 | Ga0070689_100029687 | |||
| 1223 | Ga0070691_10000763 | |||
| 1224 | Ga0070661_100005116 | |||
| 1225 | Ga0070661_100015407 | |||
| 1226 | Ga0070661_100022812 | |||
| 1227 | Ga0070661_100029811 | |||
| 1228 | Ga0070661_100036547 | |||
| 1229 | Ga0070661_100138860 | |||
| 1230 | Ga0070692_10060955 | |||
| 1231 | Ga0070692_10125102 | |||
| 1232 | Ga0070668_100000007 | |||
| 1233 | Ga0070668_100002131 | |||
| 1234 | Ga0070668_100011256 | |||
| 1235 | Ga0070668_100021509 | |||
| 1236 | Ga0070668_100124704 | |||
| 1237 | Ga0070668_100399676 | |||
| 1238 | Ga0070669_100000195 | |||
| 1239 | Ga0070669_100000351 | |||
| 1240 | Ga0070669_100034494 | |||
| 1241 | Ga0070669_100291587 | |||
| 1242 | Ga0070675_100002343 | |||
| 1243 | Ga0070675_100013583 | |||
| 1244 | Ga0070671_100000388 | |||
| 1245 | Ga0070671_100000461 | |||
| 1246 | Ga0070671_100014361 | |||
| 1247 | Ga0070671_100020224 | |||
| 1248 | Ga0070671_100078984 | |||
| 1249 | Ga0070671_100121302 | |||
| 1250 | Ga0070671_100239139 | |||
| 1251 | Ga0070674_100032561 | |||
| 1252 | Ga0070674_100215623 | |||
| 1253 | Ga0070674_100218977 | |||
| 1254 | Ga0070673_100000006 | |||
| 1255 | Ga0070673_100020191 | |||
| 1256 | Ga0070673_100024623 | |||
| 1257 | Ga0070673_100045414 | |||
| 1258 | Ga0070673_100065042 | |||
| 1259 | Ga0070688_100010920 | |||
| 1260 | Ga0070659_100005974 | |||
| 1261 | Ga0070659_100007753 | |||
| 1262 | Ga0070659_100031286 | |||
| 1263 | Ga0070659_100059821 | |||
| 1264 | Ga0070659_100151979 | |||
| 1265 | Ga0070659_100235550 | |||
| 1266 | Ga0070667_100000003 | |||
| 1267 | Ga0070667_100000327 | |||
| 1268 | Ga0070667_100000873 | |||
| 1269 | Ga0070667_100001850 | |||
| 1270 | Ga0070667_100022481 | |||
| 1271 | Ga0070667_100033868 | |||
| 1272 | Ga0070667_100113824 | |||
| 1273 | Ga0070667_100674259 | |||
| 1274 | Ga0070714_100188223 | |||
| 1275 | Ga0070713_100502716 | |||
| 1276 | Ga0070705_100710137 | |||
| 1277 | Ga0070663_100016888 | |||
| 1278 | Ga0070663_100028223 | |||
| 1279 | Ga0070663_100051649 | |||
| 1280 | Ga0070663_100113967 | |||
| 1281 | Ga0070663_100671073 | |||
| 1282 | Ga0070663_100695733 | |||
| 1283 | Ga0070678_100000505 | |||
| 1284 | Ga0070678_100008600 | |||
| 1285 | Ga0070678_100166600 | |||
| 1286 | Ga0070662_100005871 | |||
| 1287 | Ga0070662_100006250 | |||
| 1288 | Ga0070662_100021277 | |||
| 1289 | Ga0070662_100131956 | |||
| 1290 | Ga0070662_100228129 | |||
| 1291 | Ga0070681_10029966 | |||
| 1292 | Ga0070681_10069647 | |||
| 1293 | Ga0068867_100000001 | |||
| 1294 | Ga0068867_100029493 | |||
| 1295 | Ga0068867_100524361 | |||
| 1296 | Ga0070685_10002655 | |||
| 1297 | Ga0070679_100033561 | |||
| 1298 | Ga0070679_100153616 | |||
| 1299 | Ga0070684_100004255 | |||
| 1300 | Ga0070684_100125792 | |||
| 1301 | Ga0070684_100143776 | |||
| 1302 | Ga0068853_100016963 | |||
| 1303 | Ga0068853_100035156 | |||
| 1304 | Ga0068853_100064038 | |||
| 1305 | Ga0068853_100066503 | |||
| 1306 | Ga0068853_100106522 | |||
| 1307 | Ga0068853_100191840 | |||
| 1308 | Ga0068853_100261358 | |||
| 1309 | Ga0068853_100289580 | |||
| 1310 | Ga0070672_100006310 | |||
| 1311 | Ga0070672_100014230 | |||
| 1312 | Ga0070672_100064036 | |||
| 1313 | Ga0070672_100185299 | |||
| 1314 | Ga0070686_100000002 | |||
| 1315 | Ga0070686_100046913 | |||
| 1316 | Ga0070695_100011571 | |||
| 1317 | Ga0070696_100003877 | |||
| 1318 | Ga0070696_100006531 | |||
| 1319 | Ga0070665_100000025 | |||
| 1320 | Ga0070665_100000471 | |||
| 1321 | Ga0070665_100009495 | |||
| 1322 | Ga0070665_100050070 | |||
| 1323 | Ga0070665_100069910 | |||
| 1324 | Ga0070665_100597007 | |||
| 1325 | Ga0068855_100000023 | |||
| 1326 | Ga0068855_100003431 | |||
| 1327 | Ga0068855_100058591 | |||
| 1328 | Ga0068855_100256310 | |||
| 1329 | Ga0068855_100259344 | |||
| 1330 | Ga0070664_100000093 | |||
| 1331 | Ga0070664_100003267 | |||
| 1332 | Ga0070664_100006241 | |||
| 1333 | Ga0070664_100062965 | |||
| 1334 | Ga0070664_100073476 | |||
| 1335 | Ga0070664_100081692 | |||
| 1336 | Ga0070664_100168737 | |||
| 1337 | Ga0068857_100015202 | |||
| 1338 | Ga0068857_100015964 | |||
| 1339 | Ga0068857_100288529 | |||
| 1340 | Ga0068854_100000722 | |||
| 1341 | Ga0068854_100005206 | |||
| 1342 | Ga0068854_100027141 | |||
| 1343 | Ga0068854_100029193 | |||
| 1344 | Ga0068854_100095691 | |||
| 1345 | Ga0068854_100100723 | |||
| 1346 | Ga0068854_100121256 | |||
| 1347 | Ga0068854_100164056 | |||
| 1348 | Ga0068854_100247681 | |||
| 1349 | Ga0068856_100033806 | |||
| 1350 | Ga0068856_100042299 | |||
| 1351 | Ga0068856_100063293 | |||
| 1352 | Ga0068856_100275276 | |||
| 1353 | Ga0068856_100290640 | |||
| 1354 | Ga0068852_100001538 | |||
| 1355 | Ga0068852_100021306 | |||
| 1356 | Ga0068852_100043422 | |||
| 1357 | Ga0068852_100049064 | |||
| 1358 | Ga0068859_100007110 | |||
| 1359 | Ga0068859_100008939 | |||
| 1360 | Ga0068859_100014394 | |||
| 1361 | Ga0068859_100021440 | |||
| 1362 | Ga0068859_100029142 | |||
| 1363 | Ga0068859_100065318 | |||
| 1364 | Ga0068859_100127874 | |||
| 1365 | Ga0068859_100256410 | |||
| 1366 | Ga0068859_100358221 | |||
| 1367 | Ga0068864_100000004 | |||
| 1368 | Ga0068864_100000011 | |||
| 1369 | Ga0068864_100000078 | |||
| 1370 | Ga0068864_100003288 | |||
| 1371 | Ga0068864_100012174 | |||
| 1372 | Ga0068864_100017806 | |||
| 1373 | Ga0068864_100070649 | |||
| 1374 | Ga0068866_10001322 | |||
| 1375 | Ga0068861_100000132 | |||
| 1376 | Ga0068861_100000629 | |||
| 1377 | Ga0068861_100017934 | |||
| 1378 | Ga0068861_100233353 | |||
| 1379 | Ga0068851_10005578 | |||
| 1380 | Ga0068851_10025486 | |||
| 1381 | Ga0068851_10027636 | |||
| 1382 | Ga0068851_10078004 | |||
| 1383 | Ga0068851_10090935 | |||
| 1384 | Ga0068863_100000002 | |||
| 1385 | Ga0068863_100000270 | |||
| 1386 | Ga0068863_100001062 | |||
| 1387 | Ga0068863_100001939 | |||
| 1388 | Ga0068863_100002169 | |||
| 1389 | Ga0068863_100003398 | |||
| 1390 | Ga0068863_100004607 | |||
| 1391 | Ga0068863_100017965 | |||
| 1392 | Ga0068863_100053028 | |||
| 1393 | Ga0068863_100076334 | |||
| 1394 | Ga0068863_100370262 | |||
| 1395 | Ga0068858_100000181 | |||
| 1396 | Ga0068858_100000832 | |||
| 1397 | Ga0068858_100006226 | |||
| 1398 | Ga0068858_100006347 | |||
| 1399 | Ga0068858_100007133 | |||
| 1400 | Ga0068858_100180276 | |||
| 1401 | Ga0068860_100000001 | |||
| 1402 | Ga0068860_100000045 | |||
| 1403 | Ga0068860_100000834 | |||
| 1404 | Ga0068860_100004334 | |||
| 1405 | Ga0068860_100016501 | |||
| 1406 | Ga0068860_100060507 | |||
| 1407 | Ga0068860_100076230 | |||
| 1408 | Ga0068860_100080027 | |||
| 1409 | Ga0068860_100347777 | |||
| 1410 | Ga0068860_100423460 | |||
| 1411 | Ga0068860_100693098 | |||
| 1412 | Ga0068862_100000002 | |||
| 1413 | Ga0068862_100000011 | |||
| 1414 | Ga0068862_100000032 | |||
| 1415 | Ga0068862_100000048 | |||
| 1416 | Ga0068862_100000989 | |||
| 1417 | Ga0068862_100007656 | |||
| 1418 | Ga0068862_100009813 | |||
| 1419 | Ga0068862_100199992 | |||
| 1420 | Ga0070712_100210454 | |||
| 1421 | Ga0097621_100002557 | |||
| 1422 | Ga0068871_100031090 | |||
| 1423 | Ga0075430_100038654 | |||
| 1424 | Ga0068865_100000003 | |||
| 1425 | Ga0097620_100007111 | |||
| 1426 | Ga0097620_100008939 | |||
| 1427 | Ga0097620_100014392 | |||
| 1428 | Ga0097620_100021440 | |||
| 1429 | Ga0097620_100029143 | |||
| 1430 | Ga0097620_100065319 | |||
| 1431 | Ga0097620_100127861 | |||
| 1432 | Ga0097620_100256395 | |||
| 1433 | Ga0097620_100358208 | |||
| 1434 | Ga0105251_10000342 | |||
| 1435 | Ga0105250_10005428 | |||
| 1436 | Ga0105240_10009282 | |||
| 1437 | Ga0105240_10011291 | |||
| 1438 | Ga0105240_10040268 | |||
| 1439 | Ga0105240_10075745 | |||
| 1440 | Ga0105240_10079587 | |||
| 1441 | Ga0111539_10073522 | |||
| 1442 | Ga0105245_10001536 | |||
| 1443 | Ga0105245_10006243 | |||
| 1444 | Ga0105245_10031992 | |||
| 1445 | Ga0105247_10012347 | |||
| 1446 | Ga0105247_10155492 | |||
| 1447 | Ga0105243_10000611 | |||
| 1448 | Ga0105243_10001363 | |||
| 1449 | Ga0105243_10412562 | |||
| 1450 | Ga0105241_10011404 | |||
| 1451 | Ga0105242_10000818 | |||
| 1452 | Ga0105242_10003633 | |||
| 1453 | Ga0105242_10258590 | |||
| 1454 | Ga0105242_10719686 | |||
| 1455 | Ga0105248_10000016 | |||
| 1456 | Ga0105248_10000069 | |||
| 1457 | Ga0105248_10002223 | |||
| 1458 | Ga0105248_10002773 | |||
| 1459 | Ga0105248_10014376 | |||
| 1460 | Ga0105248_10026331 | |||
| 1461 | Ga0105248_10033496 | |||
| 1462 | Ga0105248_10046730 | |||
| 1463 | Ga0105248_10065059 | |||
| 1464 | Ga0105248_10069459 | |||
| 1465 | Ga0105248_10155231 | |||
| 1466 | Ga0105248_10374757 | |||
| 1467 | Ga0105248_10426907 | |||
| 1468 | Ga0105248_10471263 | |||
| 1469 | Ga0105237_10030869 | |||
| 1470 | Ga0105237_10032851 | |||
| 1471 | Ga0105237_10054983 | |||
| 1472 | Ga0105237_10155275 | |||
| 1473 | Ga0105237_10570343 | |||
| 1474 | Ga0105238_10003703 | |||
| 1475 | Ga0105238_10016971 | |||
| 1476 | Ga0105238_10020220 | |||
| 1477 | Ga0105238_10025509 | |||
| 1478 | Ga0105238_10056843 | |||
| 1479 | Ga0105238_10067233 | |||
| 1480 | Ga0105238_10154632 | |||
| 1481 | Ga0105238_10367966 | |||
| 1482 | Ga0105238_10633714 | |||
| 1483 | Ga0105238_10969517 | |||
| 1484 | Ga0105249_10000005 | |||
| 1485 | Ga0105249_10000017 | |||
| 1486 | Ga0105249_10000106 | |||
| 1487 | Ga0105249_10005694 | |||
| 1488 | Ga0105249_10166446 | |||
| 1489 | Ga0105249_10266691 | |||
| 1490 | Ga0105239_10070023 | |||
| 1491 | Ga0105239_10098131 | |||
| 1492 | Ga0105246_10000620 | |||
| 1493 | Ga0157373_10028624 | |||
| 1494 | Ga0157373_10085988 | |||
| 1495 | Ga0157373_10102585 | |||
| 1496 | Ga0157373_10136279 | |||
| 1497 | Ga0157373_10272680 | |||
| 1498 | Ga0157373_10429189 | |||
| 1499 | Ga0157373_10537277 | |||
| 1500 | Ga0157371_10000110 | |||
| 1501 | Ga0157371_10037024 | |||
| 1502 | Ga0157371_10040991 | |||
| 1503 | Ga0157371_10128541 | |||
| 1504 | Ga0157371_10152424 | |||
| 1505 | Ga0157370_10012605 | |||
| 1506 | Ga0157370_10041223 | |||
| 1507 | Ga0157370_10112118 | |||
| 1508 | Ga0157369_10002495 | |||
| 1509 | Ga0157369_10003524 | |||
| 1510 | Ga0157369_10008669 | |||
| 1511 | Ga0157369_10008947 | |||
| 1512 | Ga0157369_10009057 | |||
| 1513 | Ga0157369_10068610 | |||
| 1514 | Ga0157369_10094805 | |||
| 1515 | Ga0157374_10006203 | |||
| 1516 | Ga0157374_10046810 | |||
| 1517 | Ga0157374_10070052 | |||
| 1518 | Ga0157374_10080623 | |||
| 1519 | Ga0157374_10090575 | |||
| 1520 | Ga0157374_11346219 | |||
| 1521 | Ga0157378_10008062 | |||
| 1522 | Ga0157378_10033143 | |||
| 1523 | Ga0157378_10042832 | |||
| 1524 | Ga0157378_10217265 | |||
| 1525 | Ga0163162_10005086 | |||
| 1526 | Ga0163162_10048885 | |||
| 1527 | Ga0163162_10050115 | |||
| 1528 | Ga0163162_10081335 | |||
| 1529 | Ga0163162_10091245 | |||
| 1530 | Ga0163162_10250436 | |||
| 1531 | Ga0157372_10064804 | |||
| 1532 | Ga0157372_10085245 | |||
| 1533 | Ga0157372_10107945 | |||
| 1534 | Ga0157372_10116707 | |||
| 1535 | Ga0157372_10305248 | |||
| 1536 | Ga0157372_10494116 | |||
| 1537 | Ga0157372_10510680 | |||
| 1538 | Ga0157372_10512443 | |||
| 1539 | Ga0157372_10605423 | |||
| 1540 | Ga0157375_10004152 | |||
| 1541 | Ga0157375_10035911 | |||
| 1542 | Ga0157375_10037485 | |||
| 1543 | Ga0157375_10435869 | |||
| 1544 | Ga0163163_10000588 | |||
| 1545 | Ga0163163_10039738 | |||
| 1546 | Ga0163163_10095415 | |||
| 1547 | Ga0163163_10346614 | |||
| 1548 | Ga0163163_11008936 | |||
| 1549 | Ga0157380_10000363 | |||
| 1550 | Ga0157380_10001569 | |||
| 1551 | Ga0157380_10024926 | |||
| 1552 | Ga0157379_10031170 | |||
| 1553 | Ga0157379_10034380 | |||
| 1554 | Ga0157379_10154402 | |||
| 1555 | Ga0157379_10181989 | |||
| 1556 | Ga0157376_10000955 | |||
| 1557 | Ga0157376_10001235 | |||
| 1558 | Ga0163161_10000509 | |||
| 1559 | Ga0163161_10007048 | |||
| 1560 | Ga0163161_10294282 | |||
| 1561 | Ga0206356_10636768 | |||
| 1562 | Ga0206356_10794718 | |||
| 1563 | Ga0206354_10580221 | |||
| 1564 | Ga0206353_11160495 | |||
| 1565 | Ga0213876_10000714 | |||
| 1566 | Ga0213875_10001461 | |||
| 1567 | Ga0213875_10002933 | |||
| 1568 | Ga0207672_1001571 | |||
| 1569 | Ga0209563_100130 | |||
| 1570 | Ga0209677_107479 | |||
| 1571 | Ga0209148_1000171 | |||
| 1572 | Ga0209129_1003658 | |||
| 1573 | Ga0209233_1000084 | |||
| 1574 | Ga0209233_1018102 | |||
| 1575 | Ga0209565_1000011 | |||
| 1576 | Ga0209565_1000170 | |||
| 1577 | Ga0209455_1001814 | |||
| 1578 | Ga0209455_1009677 | |||
| 1579 | Ga0209673_1000827 | |||
| 1580 | Ga0209673_1008761 | |||
| 1581 | Ga0209676_1006991 | |||
| 1582 | Ga0209025_1000068 | |||
| 1583 | Ga0209564_1000335 | |||
| 1584 | Ga0209564_1016363 | |||
| 1585 | Ga0209758_1000017 | |||
| 1586 | Ga0209758_1000019 | |||
| 1587 | Ga0209050_1000001 | |||
| 1588 | Ga0209050_1000108 | |||
| 1589 | Ga0209050_1000209 | |||
| 1590 | Ga0209050_1009517 | |||
| 1591 | Ga0209050_1009555 | |||
| 1592 | Ga0209050_1019060 | |||
| 1593 | Ga0209256_1000016 | |||
| 1594 | Ga0209051_1000239 | |||
| 1595 | Ga0209257_1000027 | |||
| 1596 | Ga0209257_1001066 | |||
| 1597 | Ga0209257_1001071 | |||
| 1598 | Ga0209257_1001515 | |||
| 1599 | Ga0209257_1013597 | |||
| 1600 | Ga0207697_10045640 | |||
| 1601 | Ga0207656_10001422 | |||
| 1602 | Ga0207656_10005083 | |||
| 1603 | Ga0207656_10028661 | |||
| 1604 | Ga0207656_10029028 | |||
| 1605 | Ga0207656_10039998 | |||
| 1606 | Ga0207656_10112987 | |||
| 1607 | Ga0207713_1003473 | |||
| 1608 | Ga0207642_10007833 | |||
| 1609 | Ga0207710_10068749 | |||
| 1610 | Ga0207710_10075666 | |||
| 1611 | Ga0207688_10015331 | |||
| 1612 | Ga0207680_10000004 | |||
| 1613 | Ga0207680_10002571 | |||
| 1614 | Ga0207680_10009078 | |||
| 1615 | Ga0207680_10175237 | |||
| 1616 | Ga0207647_10000805 | |||
| 1617 | Ga0207647_10005630 | |||
| 1618 | Ga0207647_10078400 | |||
| 1619 | Ga0207647_10084282 | |||
| 1620 | Ga0207647_10088179 | |||
| 1621 | Ga0207647_10117171 | |||
| 1622 | Ga0207647_10251248 | |||
| 1623 | Ga0207645_10015238 | |||
| 1624 | Ga0207645_10026774 | |||
| 1625 | Ga0207645_10080062 | |||
| 1626 | Ga0207645_10086739 | |||
| 1627 | Ga0207645_10110473 | |||
| 1628 | Ga0207705_10000121 | |||
| 1629 | Ga0207705_10000592 | |||
| 1630 | Ga0207705_10017650 | |||
| 1631 | Ga0207705_10024003 | |||
| 1632 | Ga0207705_10031278 | |||
| 1633 | Ga0207705_10042845 | |||
| 1634 | Ga0207705_10043256 | |||
| 1635 | Ga0207705_10079630 | |||
| 1636 | Ga0207654_10003722 | |||
| 1637 | Ga0207654_10011547 | |||
| 1638 | Ga0207707_10008275 | |||
| 1639 | Ga0207707_10096899 | |||
| 1640 | Ga0207707_10344103 | |||
| 1641 | Ga0207695_10002715 | |||
| 1642 | Ga0207695_10007597 | |||
| 1643 | Ga0207695_10016512 | |||
| 1644 | Ga0207695_10038816 | |||
| 1645 | Ga0207671_10001479 | |||
| 1646 | Ga0207671_10011623 | |||
| 1647 | Ga0207671_10013100 | |||
| 1648 | Ga0207671_10175338 | |||
| 1649 | Ga0207671_10254387 | |||
| 1650 | Ga0207671_10694554 | |||
| 1651 | Ga0207693_10210615 | |||
| 1652 | Ga0207660_10038492 | |||
| 1653 | Ga0207660_10161905 | |||
| 1654 | Ga0207660_10181164 | |||
| 1655 | Ga0207657_10002178 | |||
| 1656 | Ga0207657_10003582 | |||
| 1657 | Ga0207657_10008376 | |||
| 1658 | Ga0207657_10012964 | |||
| 1659 | Ga0207657_10014496 | |||
| 1660 | Ga0207657_10016571 | |||
| 1661 | Ga0207657_10023959 | |||
| 1662 | Ga0207657_10035869 | |||
| 1663 | Ga0207657_10167232 | |||
| 1664 | Ga0207657_10247796 | |||
| 1665 | Ga0207657_10382327 | |||
| 1666 | Ga0207649_10000475 | |||
| 1667 | Ga0207649_10006830 | |||
| 1668 | Ga0207649_10015845 | |||
| 1669 | Ga0207649_10153329 | |||
| 1670 | Ga0207652_10037349 | |||
| 1671 | Ga0207681_10000001 | |||
| 1672 | Ga0207681_10000038 | |||
| 1673 | Ga0207681_10049750 | |||
| 1674 | Ga0207681_10054598 | |||
| 1675 | Ga0207681_10059426 | |||
| 1676 | Ga0207681_10229385 | |||
| 1677 | Ga0207681_10250157 | |||
| 1678 | Ga0207681_10293046 | |||
| 1679 | Ga0207694_10001050 | |||
| 1680 | Ga0207694_10004743 | |||
| 1681 | Ga0207694_10009796 | |||
| 1682 | Ga0207694_10014424 | |||
| 1683 | Ga0207694_10021743 | |||
| 1684 | Ga0207694_10026198 | |||
| 1685 | Ga0207694_10053932 | |||
| 1686 | Ga0207694_10183155 | |||
| 1687 | Ga0207694_10512327 | |||
| 1688 | Ga0207650_10000018 | |||
| 1689 | Ga0207650_10000294 | |||
| 1690 | Ga0207650_10004568 | |||
| 1691 | Ga0207650_10024760 | |||
| 1692 | Ga0207650_10080057 | |||
| 1693 | Ga0207650_10121113 | |||
| 1694 | Ga0207650_10200919 | |||
| 1695 | Ga0207650_10287302 | |||
| 1696 | Ga0207659_10000922 | |||
| 1697 | Ga0207659_10271913 | |||
| 1698 | Ga0207687_10004504 | |||
| 1699 | Ga0207644_10000039 | |||
| 1700 | Ga0207644_10000197 | |||
| 1701 | Ga0207644_10000214 | |||
| 1702 | Ga0207644_10000863 | |||
| 1703 | Ga0207644_10002893 | |||
| 1704 | Ga0207644_10010201 | |||
| 1705 | Ga0207644_10020550 | |||
| 1706 | Ga0207644_10022249 | |||
| 1707 | Ga0207644_10031319 | |||
| 1708 | Ga0207644_10036676 | |||
| 1709 | Ga0207644_10537220 | |||
| 1710 | Ga0207690_10002990 | |||
| 1711 | Ga0207690_10007682 | |||
| 1712 | Ga0207690_10008018 | |||
| 1713 | Ga0207690_10012702 | |||
| 1714 | Ga0207690_10056672 | |||
| 1715 | Ga0207690_10107312 | |||
| 1716 | Ga0207690_10363951 | |||
| 1717 | Ga0207706_10004569 | |||
| 1718 | Ga0207706_10005341 | |||
| 1719 | Ga0207706_10009419 | |||
| 1720 | Ga0207706_10011916 | |||
| 1721 | Ga0207706_10022091 | |||
| 1722 | Ga0207706_10028785 | |||
| 1723 | Ga0207706_10047492 | |||
| 1724 | Ga0207706_10051583 | |||
| 1725 | Ga0207706_10062580 | |||
| 1726 | Ga0207706_10373486 | |||
| 1727 | Ga0207686_10002145 | |||
| 1728 | Ga0207686_10013436 | |||
| 1729 | Ga0207709_10000629 | |||
| 1730 | Ga0207709_10000951 | |||
| 1731 | Ga0207709_10058533 | |||
| 1732 | Ga0207709_10614511 | |||
| 1733 | Ga0207670_10106249 | |||
| 1734 | Ga0207669_10000755 | |||
| 1735 | Ga0207669_10005841 | |||
| 1736 | Ga0207669_10069602 | |||
| 1737 | Ga0207669_10209644 | |||
| 1738 | Ga0207704_10000001 | |||
| 1739 | Ga0207704_10061836 | |||
| 1740 | Ga0207704_10665084 | |||
| 1741 | Ga0207691_10003283 | |||
| 1742 | Ga0207691_10056417 | |||
| 1743 | Ga0207691_10099573 | |||
| 1744 | Ga0207691_10704127 | |||
| 1745 | Ga0207711_10000022 | |||
| 1746 | Ga0207711_10000042 | |||
| 1747 | Ga0207711_10001064 | |||
| 1748 | Ga0207711_10002492 | |||
| 1749 | Ga0207711_10012589 | |||
| 1750 | Ga0207711_10047359 | |||
| 1751 | Ga0207711_10063922 | |||
| 1752 | Ga0207711_10088519 | |||
| 1753 | Ga0207711_10209286 | |||
| 1754 | Ga0207711_10256413 | |||
| 1755 | Ga0207711_10371094 | |||
| 1756 | Ga0207689_10001710 | |||
| 1757 | Ga0207689_10069129 | |||
| 1758 | Ga0207689_10117639 | |||
| 1759 | Ga0207661_10228734 | |||
| 1760 | Ga0207661_10481259 | |||
| 1761 | Ga0207679_10002349 | |||
| 1762 | Ga0207679_10014116 | |||
| 1763 | Ga0207679_10014928 | |||
| 1764 | Ga0207679_10041360 | |||
| 1765 | Ga0207679_10058126 | |||
| 1766 | Ga0207679_10074849 | |||
| 1767 | Ga0207679_10222304 | |||
| 1768 | Ga0207679_10303461 | |||
| 1769 | Ga0207667_10000001 | |||
| 1770 | Ga0207667_10000016 | |||
| 1771 | Ga0207667_10000651 | |||
| 1772 | Ga0207667_10000692 | |||
| 1773 | Ga0207667_10010455 | |||
| 1774 | Ga0207667_10021125 | |||
| 1775 | Ga0207667_10172630 | |||
| 1776 | Ga0207667_10367666 | |||
| 1777 | Ga0207651_10000002 | |||
| 1778 | Ga0207651_10003812 | |||
| 1779 | Ga0207651_10003837 | |||
| 1780 | Ga0207651_10011490 | |||
| 1781 | Ga0207651_10411755 | |||
| 1782 | Ga0207712_10000001 | |||
| 1783 | Ga0207712_10000012 | |||
| 1784 | Ga0207712_10000224 | |||
| 1785 | Ga0207712_10030985 | |||
| 1786 | Ga0207712_10101759 | |||
| 1787 | Ga0207712_10433445 | |||
| 1788 | Ga0207712_10733493 | |||
| 1789 | Ga0207668_10000026 | |||
| 1790 | Ga0207668_10000228 | |||
| 1791 | Ga0207668_10000490 | |||
| 1792 | Ga0207668_10013664 | |||
| 1793 | Ga0207668_10014529 | |||
| 1794 | Ga0207668_10203323 | |||
| 1795 | Ga0207668_10548058 | |||
| 1796 | Ga0207640_10000891 | |||
| 1797 | Ga0207640_10004646 | |||
| 1798 | Ga0207640_10005537 | |||
| 1799 | Ga0207640_10037340 | |||
| 1800 | Ga0207640_10046863 | |||
| 1801 | Ga0207640_10047485 | |||
| 1802 | Ga0207640_10086439 | |||
| 1803 | Ga0207640_10095691 | |||
| 1804 | Ga0207640_10208530 | |||
| 1805 | Ga0207640_10281484 | |||
| 1806 | Ga0207640_10500198 | |||
| 1807 | Ga0207658_10000002 | |||
| 1808 | Ga0207658_10000364 | |||
| 1809 | Ga0207658_10000545 | |||
| 1810 | Ga0207658_10000902 | |||
| 1811 | Ga0207658_10009480 | |||
| 1812 | Ga0207658_10009613 | |||
| 1813 | Ga0207658_10009967 | |||
| 1814 | Ga0207658_10049116 | |||
| 1815 | Ga0207658_10225527 | |||
| 1816 | Ga0207677_10000030 | |||
| 1817 | Ga0207677_10009857 | |||
| 1818 | Ga0207703_10000135 | |||
| 1819 | Ga0207703_10000404 | |||
| 1820 | Ga0207703_10001087 | |||
| 1821 | Ga0207703_10015254 | |||
| 1822 | Ga0207703_10054327 | |||
| 1823 | Ga0207639_10002074 | |||
| 1824 | Ga0207639_10007490 | |||
| 1825 | Ga0207639_10008847 | |||
| 1826 | Ga0207639_10044857 | |||
| 1827 | Ga0207639_10051972 | |||
| 1828 | Ga0207639_10095900 | |||
| 1829 | Ga0207639_10187075 | |||
| 1830 | Ga0207639_10254497 | |||
| 1831 | Ga0207678_10006676 | |||
| 1832 | Ga0207678_10008727 | |||
| 1833 | Ga0207678_10036870 | |||
| 1834 | Ga0207678_10048089 | |||
| 1835 | Ga0207678_10067448 | |||
| 1836 | Ga0207678_10076194 | |||
| 1837 | Ga0207678_10257733 | |||
| 1838 | Ga0207702_10000462 | |||
| 1839 | Ga0207702_10016406 | |||
| 1840 | Ga0207702_10052596 | |||
| 1841 | Ga0207702_10185626 | |||
| 1842 | Ga0207702_10198470 | |||
| 1843 | Ga0207702_10201102 | |||
| 1844 | Ga0207702_10414569 | |||
| 1845 | Ga0207702_10449235 | |||
| 1846 | Ga0207641_10000002 | |||
| 1847 | Ga0207641_10000024 | |||
| 1848 | Ga0207641_10000033 | |||
| 1849 | Ga0207641_10000277 | |||
| 1850 | Ga0207641_10000626 | |||
| 1851 | Ga0207641_10001261 | |||
| 1852 | Ga0207641_10002117 | |||
| 1853 | Ga0207641_10004973 | |||
| 1854 | Ga0207641_10005398 | |||
| 1855 | Ga0207641_10006503 | |||
| 1856 | Ga0207641_10017421 | |||
| 1857 | Ga0207641_10173019 | |||
| 1858 | Ga0207648_10000001 | |||
| 1859 | Ga0207648_10003494 | |||
| 1860 | Ga0207676_10000004 | |||
| 1861 | Ga0207676_10000040 | |||
| 1862 | Ga0207676_10000340 | |||
| 1863 | Ga0207676_10000600 | |||
| 1864 | Ga0207676_10002850 | |||
| 1865 | Ga0207676_10006287 | |||
| 1866 | Ga0207676_10042482 | |||
| 1867 | Ga0207676_10080658 | |||
| 1868 | Ga0207676_10107993 | |||
| 1869 | Ga0207674_10003716 | |||
| 1870 | Ga0207674_10010165 | |||
| 1871 | Ga0207674_10012150 | |||
| 1872 | Ga0207674_10014103 | |||
| 1873 | Ga0207674_10058492 | |||
| 1874 | Ga0207675_100000071 | |||
| 1875 | Ga0207675_100000171 | |||
| 1876 | Ga0207675_100004115 | |||
| 1877 | Ga0207675_100074164 | |||
| 1878 | Ga0207675_100275287 | |||
| 1879 | Ga0207675_100690505 | |||
| 1880 | Ga0207683_10030752 | |||
| 1881 | Ga0207683_10038419 | |||
| 1882 | Ga0207683_10059873 | |||
| 1883 | Ga0207683_10204941 | |||
| 1884 | Ga0207698_10008400 | |||
| 1885 | Ga0207698_10009783 | |||
| 1886 | Ga0207698_10013046 | |||
| 1887 | Ga0207698_10035886 | |||
| 1888 | Ga0207698_10064919 | |||
| 1889 | Ga0207698_10089859 | |||
| 1890 | Ga0207698_10158574 | |||
| 1891 | Ga0207698_10172860 | |||
| 1892 | Ga0207698_10207361 | |||
| 1893 | Ga0268266_10000028 | |||
| 1894 | Ga0268266_10398752 | |||
| 1895 | Ga0268266_10664587 | |||
| 1896 | Ga0268265_10000002 | |||
| 1897 | Ga0268265_10000003 | |||
| 1898 | Ga0268265_10000071 | |||
| 1899 | Ga0268265_10000081 | |||
| 1900 | Ga0268265_10001985 | |||
| 1901 | Ga0268265_10070456 | |||
| 1902 | Ga0268265_10155686 | |||
| 1903 | Ga0268264_10000006 | |||
| 1904 | Ga0268264_10000101 | |||
| 1905 | Ga0268264_10000277 | |||
| 1906 | Ga0268264_10002895 | |||
| 1907 | Ga0268264_10007584 | |||
| 1908 | Ga0268264_10017268 | |||
| 1909 | Ga0268264_10046924 | |||
| 1910 | Ga0268264_10046935 | |||
| 1911 | Ga0268264_10513770 | |||
| 1912 | Ga0268264_10648904 | |||
| 1913 | Ga0307517_10017543 | |||
| 1914 | Ga0314311_1253059 | |||
| 1915 | Ga0307513_10038050 | |||
| 1916 | Ga0307513_10062253 | |||
| 1917 | Ga0307408_100159239 | |||
| 1918 | Ga0307408_100375434 | |||
| 1919 | Ga0307405_10010820 | |||
| 1920 | Ga0307405_10019377 | |||
| 1921 | Ga0307413_10011043 | |||
| 1922 | Ga0307413_10177020 | |||
| 1923 | Ga0307413_10326141 | |||
| 1924 | Ga0307410_10051488 | |||
| 1925 | Ga0307410_10060530 | |||
| 1926 | Ga0307410_10101091 | |||
| 1927 | Ga0307410_10301796 | |||
| 1928 | Ga0307406_10107594 | |||
| 1929 | Ga0307406_10220312 | |||
| 1930 | Ga0307406_10833827 | |||
| 1931 | Ga0307407_10014810 | |||
| 1932 | Ga0307412_10014384 | |||
| 1933 | Ga0307412_10119740 | |||
| 1934 | Ga0307412_10530911 | |||
| 1935 | Ga0307409_100048881 | |||
| 1936 | Ga0307409_100309460 | |||
| 1937 | Ga0307409_100484735 | |||
| 1938 | Ga0307409_100510853 | |||
| 1939 | Ga0307416_100009723 | |||
| 1940 | Ga0307416_101033116 | |||
| 1941 | Ga0307414_10001499 | |||
| 1942 | Ga0307414_10025253 | |||
| 1943 | Ga0307414_10070847 | |||
| 1944 | Ga0307414_10081762 | |||
| 1945 | Ga0307414_10159855 | |||
| 1946 | Ga0307411_10012651 | |||
| 1947 | Ga0307411_10040331 | |||
| 1948 | Ga0307411_10060206 | |||
| 1949 | Ga0307411_10070385 | |||
| 1950 | Ga0307411_10101841 | |||
| 1951 | Ga0307411_10207482 | |||
| 1952 | Ga0307411_10252169 | |||
| 1953 | Ga0307411_10347093 | |||
| 1954 | Ga0307411_10572468 | |||
| 1955 | Ga0307415_100020974 | |||
| 1956 | Ga0307415_100100012 | |||
| 1957 | Ga0307510_10219879 | |||
| 1958 | Ga0307510_10238088 | |||
| 1959 | Ga0373941_0085440 | |||
| 1960 | Ga0373931_0246318 | |||
| 1961 | Ga0395899_0018782 | |||
| 1962 | Ga0395899_0037136 | |||
| 1963 | Ga0395900_0000764 | |||
| 1964 | Ga0395900_0081537 | |||
| 1965 | Ga0395900_0094288 | |||
| 1966 | Ga0395900_0178364 | |||
| 1967 | Ga0395900_0359544 | |||
| 1968 | Ga0395900_0579831 | |||
| 1969 | Ga0395900_0630950 | |||
| 1970 | Ga0395898_0021463 | |||
| 1971 | Ga0395898_0028931 | |||
| 1972 | Ga0395898_0058445 | |||
| 1973 | Ga0395898_0117307 | |||
| 1974 | Ga0395905_0003045 | |||
| 1975 | Ga0395905_0004674 | |||
| 1976 | Ga0395905_0013463 | |||
| 1977 | Ga0395905_0017316 | |||
| 1978 | Ga0395905_0033153 | |||
| 1979 | Ga0395905_0043534 | |||
| 1980 | Ga0395905_0044710 | |||
| 1981 | Ga0395905_0117126 | |||
| 1982 | Ga0395905_0158282 | |||
| 1983 | Ga0395905_0328782 | |||
| 1984 | Ga0395905_0742484 | |||
| 1985 | Ga0395905_0755988 | |||
| 1986 | Ga0395905_0794686 | |||
| 1987 | Ga0436364_0612163 | |||
| 1988 | Ga0436364_0852694 | |||
| 1989 | Ga0395901_0005146 | |||
| 1990 | Ga0395901_0009829 | |||
| 1991 | Ga0395901_0118405 | |||
| 1992 | Ga0395901_0343089 | |||
| 1993 | Ga0395901_0438477 | |||
| 1994 | Ga0436365_0866041 | |||
| 1995 | Ga0436363_1386082 | |||
| 1996 | Ga0439436_0044005 | |||
| 1997 | Ga0439439_0003354 | |||
| 1998 | Ga0439461_0000202 | |||
| 1999 | Ga0439461_0016751 | |||
| 2000 | Ga0439465_0000274 | |||
| 2001 | Ga0451807_0150684 | |||
| 2002 | Ga0439431_0000103 | |||
| 2003 | Ga0439445_0025915 | |||
| 2004 | Ga0439448_0013838 | |||
| 2005 | Ga0439432_012147 | |||
| 2006 | Ga0439432_030753 | |||
| 2007 | Ga0439432_032372 | |||
| 2008 | Ga0450919_005818 | |||
| 2009 | Ga0450905_001171 | |||
| 2010 | Ga0450889_002955 | |||
| 2011 | Ga0439458_0000559 | |||
| 2012 | Ga0439434_0021611 | |||
| 2013 | Ga0466972_0027337 | |||
| 2014 | Ga0466961_0011363 | |||
| 2015 | Ga0466961_0028348 | |||
| 2016 | Ga0466963_0015006 | |||
| 2017 | Ga0466963_0024760 | |||
| 2018 | Ga0466963_0034218 | |||
| 2019 | Ga0466963_0459130 | |||
| 2020 | Ga0466968_0010515 | |||
| 2021 | Ga0466968_0253574 | |||
| 2022 | Ga0466970_0177239 | |||
| 2023 | Ga0466957_0002027 | |||
| 2024 | Ga0466960_0025899 | |||
| 2025 | Ga0466959_0013667 | |||
| 2026 | Ga0466959_0033855 | |||
| 2027 | Ga0466959_0068216 | |||
| 2028 | Ga0451576_0064272 | |||
| 2029 | Ga0466958_0025243 | |||
| 2030 | Ga0466958_0246927 | |||
| 2031 | Ga0466967_0015627 | |||
| 2032 | Ga0466967_0037136 | |||
| 2033 | Ga0466967_0086428 | |||
| 2034 | Ga0466967_0146406 | |||
| 2035 | Ga0466967_0313871 | |||
| 2036 | Ga0466967_0402204 | |||
| 2037 | Ga0466967_0558545 | |||
| 2038 | Ga0495627_003594 | |||
| 2039 | Ga0495629_0237250 | |||
| 2040 | Ga0495638_0032605 | |||
| 2041 | Ga0495638_0325835 | |||
| 2042 | Ga0495650_0000428 | |||
| 2043 | Ga0495582_0443271 | |||
| 2044 | Ga0495662_0063501 | |||
| 2045 | Ga0495584_0162164 | |||
| 2046 | Ga0495585_0039184 | |||
| 2047 | Ga0495585_0041703 | |||
| 2048 | Ga0495583_0000023 | |||
| 2049 | Ga0495583_0001895 | |||
| 2050 | Ga0495583_0003188 | |||
| 2051 | Ga0495583_0069191 | |||
| 2052 | Ga0495606_0000383 | |||
| 2053 | Ga0495606_0007942 | |||
| 2054 | Ga0495606_0031914 | |||
| 2055 | Ga0495610_0000146 | |||
| 2056 | Ga0495610_0132277 | |||
| 2057 | Ga0495616_0189655 | |||
| 2058 | Ga0495631_0001928 | |||
| 2059 | Ga0495637_0001942 | |||
| 2060 | Ga0495637_0011424 | |||
| 2061 | Ga0495643_0004145 | |||
| 2062 | Ga0495643_0006878 | |||
| 2063 | Ga0495643_0084923 | |||
| 2064 | Ga0495643_0236448 | |||
| 2065 | Ga0495648_0001391 | |||
| 2066 | Ga0495663_0002898 | |||
| 2067 | Ga0495654_0066436 | |||
| 2068 | Ga0495654_0080270 | |||
| 2069 | Ga0495587_0153556 | |||
| 2070 | Ga0495609_0113675 | |||
| 2071 | Ga0495621_0002284 | |||
| 2072 | Ga0495621_0030722 | |||
| 2073 | Ga0495597_0012717 | |||
| 2074 | Ga0495633_0002596 | |||
| 2075 | Ga0495633_0003946 | |||
| 2076 | Ga0495633_0013402 | |||
| 2077 | Ga0495633_0029090 | |||
| 2078 | Ga0495668_0000218 | |||
| 2079 | Ga0495668_0023087 | |||
| 2080 | Ga0495668_0169808 | |||
| 2081 | Ga0495668_0246353 | |||
| 2082 | Ga0495611_0007098 | |||
| 2083 | Ga0495625_0000496 | |||
| 2084 | Ga0495625_0001071 | |||
| 2085 | Ga0495625_0011582 | |||
| 2086 | Ga0495625_0044610 | |||
| 2087 | Ga0495625_0154925 | |||
| 2088 | Ga0495661_0012693 | |||
| 2089 | Ga0495661_0029644 | |||
| 2090 | Ga0495588_0318398 | |||
| 2091 | Ga0495669_0000241 | |||
| 2092 | Ga0495669_0008608 | |||
| 2093 | Ga0495669_0017147 | |||
| 2094 | Ga0495669_0098652 | |||
| 2095 | Ga0495670_0000028 | |||
| 2096 | Ga0495670_0024419 | |||
| 2097 | Ga0495649_0237533 | |||
| 2098 | Ga0495600_0049411 | |||
| 2099 | Ga0495660_0118787 | |||
| 2100 | Ga0495660_0142058 | |||
| 2101 | Ga0495683_0010498 | |||
| 2102 | Ga0495687_001043 | |||
| 2103 | Ga0495687_001672 | |||
| 2104 | Ga0495677_0005009 | |||
| 2105 | Ga0495677_0151658 | |||
| 2106 | Ga0495681_0000214 | |||
| 2107 | Ga0495681_0025540 | |||
| 2108 | Ga0495686_0001053 | |||
| 2109 | Ga0495686_0002522 | |||
| 2110 | Ga0495686_0004950 | |||
| 2111 | Ga0495686_0083568 | |||
| 2112 | Ga0495686_0099470 | |||
| 2113 | Ga0496100_0005362 | |||
| 2114 | Ga0496100_0132399 | |||
| 2115 | Ga0496101_0001845 | |||
| 2116 | Ga0496101_0020761 | |||
| 2117 | Ga0496101_0141793 | |||
| 2118 | Ga0496101_0265316 | |||
| 2119 | Ga0496102_0000719 | |||
| 2120 | Ga0496102_0000756 | |||
| 2121 | Ga0496102_0004530 | |||
| 2122 | Ga0496102_0357322 | |||
| 2123 | Ga0496102_0583481 | |||
| 2124 | Ga0496103_0000562 | |||
| 2125 | Ga0496103_0002302 | |||
| 2126 | Ga0496103_0007333 | |||
| 2127 | Ga0496103_0014624 | |||
| 2128 | Ga0496103_0070972 | |||
| 2129 | Ga0496103_0423131 | |||
| 2130 | Ga0496104_0017339 | |||
| 2131 | Ga0496104_0063254 | |||
| 2132 | Ga0496105_0009443 | |||
| 2133 | Ga0496105_0035375 | |||
| 2134 | Ga0496105_0086958 | |||
| 2135 | Ga0496105_0156845 | |||
| 2136 | Ga0496106_0024920 | |||
| 2137 | Ga0496106_0397289 | |||
| 2138 | Ga0496107_0002051 | |||
| 2139 | Ga0496107_0047010 | |||
| 2140 | Ga0496107_0165819 | |||
| 2141 | Ga0496108_0014779 | |||
| 2142 | Ga0496108_0051888 | |||
| 2143 | Ga0496109_0030292 | |||
| 2144 | Ga0496109_0038420 | |||
| 2145 | Ga0496109_0064818 | |||
| 2146 | Ga0496109_0071775 | |||
| 2147 | Ga0496110_0000948 | |||
| 2148 | Ga0496110_0009431 | |||
| 2149 | Ga0496110_0029480 | |||
| 2150 | Ga0496110_0083631 | |||
| 2151 | Ga0496110_0275824 | |||
| 2152 | Ga0496110_0471574 | |||
| 2153 | Ga0496111_0001035 | |||
| 2154 | Ga0496111_0004529 | |||
| 2155 | Ga0496111_0022502 | |||
| 2156 | Ga0496111_0074293 | |||
| 2157 | Ga0496112_0013316 | |||
| 2158 | Ga0496112_0554255 | |||
| 2159 | Ga0496113_0025057 | |||
| 2160 | Ga0496113_0284930 | |||
| 2161 | Ga0496114_0022765 | |||
| 2162 | Ga0496115_0000464 | |||
| 2163 | Ga0496115_0005489 | |||
| 2164 | Ga0496116_0002037 | |||
| 2165 | Ga0496116_0009864 | |||
| 2166 | Ga0496116_0056694 | |||
| 2167 | Ga0496117_0000519 | |||
| 2168 | Ga0496117_0001114 | |||
| 2169 | Ga0496117_0011627 | |||
| 2170 | Ga0496117_0021825 | |||
| 2171 | Ga0496117_0037145 | |||
| 2172 | Ga0496117_0040426 | |||
| 2173 | Ga0496118_0000127 | |||
| 2174 | Ga0496118_0000193 | |||
| 2175 | Ga0496118_0001703 | |||
| 2176 | Ga0496118_0004860 | |||
| 2177 | Ga0496118_0009117 | |||
| 2178 | Ga0496118_0029470 | |||
| 2179 | Ga0496119_0027214 | |||
| 2180 | Ga0496119_0036669 | |||
| 2181 | Ga0496119_0040560 | |||
| 2182 | Ga0496120_0049671 | |||
| 2183 | Ga0496121_0005712 | |||
| 2184 | Ga0496121_0010096 | |||
| 2185 | Ga0496121_0051385 | |||
| 2186 | Ga0496122_0016138 | |||
| 2187 | Ga0496123_0030686 | |||
| 2188 | Ga0496124_0000011 | |||
| 2189 | Ga0496124_0000237 | |||
| 2190 | Ga0496124_0067342 | |||
| 2191 | Ga0496125_0001918 | |||
| 2192 | Ga0496125_0062178 | |||
| 2193 | Ga0496126_0007282 | |||
| 2194 | Ga0496126_0008126 | |||
| 2195 | Ga0496126_0341185 | |||
| 2196 | Ga0495682_0023253 | |||
| 2197 | Ga0501290_002973 | |||
| 2198 | Ga0501290_011399 | |||
| 2199 | Ga0501292_000040 | |||
| 2200 | Ga0501043_0099754 | |||
| 2201 | Ga0501047_0000402 | |||
| 2202 | Ga0501206_001042 | |||
| 2203 | Ga0501208_006654 | |||
| 2204 | Ga0501222_002113 | |||
| 2205 | Ga0501223_001533 | |||
| 2206 | Ga0501224_001796 | |||
| 2207 | Ga0501235_003681 | |||
| 2208 | Ga0501249_000545 | |||
| 2209 | Ga0501257_000093 | |||
| 2210 | Ga0501261_000110 | |||
| 2211 | Ga0501221_001519 | |||
| 2212 | Ga0501225_0027884 | |||
| 2213 | Ga0501245_002143 | |||
| 2214 | Ga0501080_0971614 | |||
| 2215 | Ga0501279_000008 | |||
| 2216 | Ga0501280_000233 | |||
| 2217 | Ga0501280_000772 | |||
| 2218 | Ga0501281_00064 | |||
| 2219 | Ga0501282_000614 | |||
| 2220 | Ga0501204_005049 | |||
| 2221 | nmdc:mga0qj67_621834_c1 | |||
| 2222 | nmdc:mga08y16_94019_c1 | |||
| 2223 | nmdc:mga0sz30_41051_c1 | |||
| 2224 | Ga0500610_0000668 | |||
| 2225 | Ga0500643_000136 | |||
| 2226 | Ga0500643_000338 | |||
| 2227 | Ga0500643_001250 | |||
| 2228 | Ga0500643_001549 | |||
| 2229 | Ga0500643_002056 | |||
| 2230 | Ga0500643_002934 | |||
| 2231 | Ga0500643_007149 | |||
| 2232 | Ga0500647_0092524 | |||
| 2233 | Ga0500651_0042612 | |||
| 2234 | Ga0500566_0000877 | |||
| 2235 | Ga0500555_000164 | |||
| 2236 | Ga0500592_000232 | |||
| 2237 | Ga0500592_002720 | |||
| 2238 | Ga0500592_022616 | |||
| 2239 | Ga0500595_002635 | |||
| 2240 | Ga0500608_076391 | |||
| 2241 | Ga0500608_192747 | |||
| 2242 | Ga0500642_0000751 | |||
| 2243 | Ga0500642_0018625 | |||
| 2244 | Ga0500655_000159 | |||
| 2245 | Ga0500658_0002920 | |||
| 2246 | Ga0500658_0185545 | |||
| 2247 | Ga0500559_0031963 | |||
| 2248 | Ga0500559_0110284 | |||
| 2249 | Ga0500564_057764 | |||
| 2250 | Ga0500568_0015114 | |||
| 2251 | Ga0500573_0000019 | |||
| 2252 | Ga0500573_0175726 | |||
| 2253 | Ga0500577_0032742 | |||
| 2254 | Ga0500590_005065 | |||
| 2255 | Ga0500616_0002503 | |||
| 2256 | Ga0500624_000009 | |||
| 2257 | Ga0500627_0000091 | |||
| 2258 | Ga0500636_0319596 | |||
| 2259 | Ga0500570_001921 | |||
| 2260 | Ga0500625_000011 | |||
| 2261 | Ga0500645_000237 | |||
| 2262 | Ga0500645_001144 | |||
| 2263 | Ga0500645_011613 | |||
| 2264 | Ga0500645_020770 | |||
| 2265 | Ga0466962_0036472 | |||
| 2266 | 2600202819 | |||
| 2267 | 2600228189 | |||
| 2268 | 2643730531 | |||
| 2269 | 2644037506 | |||
| 2270 | 2644043700 | |||
| 2271 | 2644128132 | |||
| 2272 | 2644393859 | |||
| 2273 | 2819716234 | |||
| 2274 | 2879163813 | |||
| 2275 | 2885430514 | |||
| 2276 | 2928528963 | |||
| 2277 | 2928971198 | |||
| 2278 | 2990265880 | |||
| 2279 | 2993696329 | |||
| 2280 | 8057101643 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy