F490707

General Info

Members Datasets Scaffolds Average Seq Length
1140 888 2280 311

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2977858184|2977862794
Length 356
Sequence DSQARFGRKQPKAFKIRAAQPAPPDEFRQMASVSEAGFQWEDFMKLTRRMTLAAFAGMLALGTAMPAYAADLIAIITPSHDNPFFKAEAVGAEAKAKELGYDTLVLVHDDDANKQSELIDTAIGRGAKAIILDNAGADATVAAVQKAKDAGVPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSKGYHDVIDDYPDLKMVAQQSANWSQTEAYSKMESILQANPDIKGVISGNDTMAMGAYAALAAAGRKDVIVVGFDGSNDVRDSITSGGIKATVLQPAYAQAQMAVEQANEYIKNKKSPEKEKQLMDCVLINGDNAPKLETFALKN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
75 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
78 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
135 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
136 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
144 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
149 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
152 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
157 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
161 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
239 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
240 2508501050 Microvirga lupini Lut6 Isolate Nodule
241 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
242 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
243 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
244 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
245 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
246 2509276019 Ensifer aridi TW10 Isolate Nodule
247 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
248 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
249 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
250 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
251 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
252 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
253 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
254 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
255 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
256 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
257 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
258 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
259 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
260 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
261 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
262 2512875024
263 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
264 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
265 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
266 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
267 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
268 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
269 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
270 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
271 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
272 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
273 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
274 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
275 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
276 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
277 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
278 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
279 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
280 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
281 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
282 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
283 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
284 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
285 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
286 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
287 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
288 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
289 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
290 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
291 2516143018 Ensifer sp. BR816 Isolate Nodule
292 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
293 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
294 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
295 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
296 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
297 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
298 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
299 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
300 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
301 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
302 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
303 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
304 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
305 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
306 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
307 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
308 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
309 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
310 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
311 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
312 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
313 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
314 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
315 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
316 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
317 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
318 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
319 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
320 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
321 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
322 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
323 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
324 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
325 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
326 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
327 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
328 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
329 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
330 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
331 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
332 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
333 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
334 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
335 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
336 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
337 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
338 2643221599 Rhizobium sp. Root708 Isolate Unclassified
339 2643221607 Rhizobium sp. Root73 Isolate Unclassified
340 2643221618 Ensifer sp. Root231 Isolate Unclassified
341 2643221626 Ensifer sp. Root31 Isolate Unclassified
342 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
343 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
344 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
345 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
346 2643221655 Ensifer sp. Root1252 Isolate Unclassified
347 2643221659 Ensifer sp. Root127 Isolate Unclassified
348 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
349 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
350 2643221698 Ensifer sp. Root142 Isolate Unclassified
351 2643221712 Ensifer sp. Root258 Isolate Unclassified
352 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
353 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
354 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
355 2718217882 Rhizobium sp. N741 Isolate Nodule
356 2718217927 Rhizobium sp. N324 Isolate Nodule
357 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
358 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
359 2718218009 Rhizobium sp. N561 Isolate Nodule
360 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
361 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
362 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
363 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
364 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
365 2718218363 Rhizobium sp. N113 Isolate Nodule
366 2718218365 Rhizobium sp. N731 Isolate Nodule
367 2718218366 Rhizobium sp. N621 Isolate Nodule
368 2718218423 Rhizobium sp. N941 Isolate Nodule
369 2721755514 Rhizobium sp. N6212 Isolate Nodule
370 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
371 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
372 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
373 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
374 2721755809 Rhizobium sp. N541 Isolate Nodule
375 2721755810 Rhizobium sp. N871 Isolate Nodule
376 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
377 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
378 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
379 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
380 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
381 2728369365 Rhizobium sp. N1341 Isolate Nodule
382 2728369397 Rhizobium sp. N1314 Isolate Nodule
383 2738541293 Rhizobium sp. GV031 Isolate Unclassified
384 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
385 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
386 2751185800 Brucella pituitosa AA2 Isolate Unclassified
387 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
388 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
389 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
390 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
391 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
392 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
393 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
394 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
395 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
396 2791355260 Rhizobium sp. L9 Isolate Nodule
397 2791355261 Rhizobium sp. J15 Isolate Nodule
398 2791355263 Rhizobium chutanense C5 Isolate Nodule
399 2791355264 Rhizobium sp. S9 Isolate Nodule
400 2791355266 Rhizobium sp. L43 Isolate Nodule
401 2791355267 Rhizobium sp. L18 Isolate Nodule
402 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
403 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
404 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
405 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
406 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
407 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
408 2802429633 Rhizobium anhuiense J3 Isolate Nodule
409 2802429634 Rhizobium anhuiense S10 Isolate Nodule
410 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
411 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
412 2802429637 Rhizobium anhuiense C15 Isolate Nodule
413 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
414 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
415 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
416 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
417 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
418 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
419 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
420 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
421 2838048938 Rhizobium pisi 27/80 Isolate Nodule
422 2838061910 Rhizobium phaseoli L15 Isolate Nodule
423 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
424 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
425 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
426 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
427 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
428 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
429 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
430 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
431 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
432 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
433 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
434 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
435 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
436 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
437 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
438 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
439 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
440 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
441 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
442 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
443 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
444 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
445 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
446 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
447 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
448 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
449 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
450 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
451 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
452 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
453 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
454 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
455 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
456 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
457 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
458 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
459 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
460 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
461 2844163670 Ensifer sp. 1H6 Isolate Unclassified
462 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
463 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
464 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
465 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
466 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
467 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
468 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
469 2854911287 Brucella lupini LUP21 Isolate Unclassified
470 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
471 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
472 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
473 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
474 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
475 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
476 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
477 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
478 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
479 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
480 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
481 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
482 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
483 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
484 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
485 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
486 2865014394 Pantoea sp. R-71966 Isolate Unclassified
487 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
488 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
489 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
490 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
491 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
492 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
493 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
494 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
495 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
496 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
497 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
498 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
499 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
500 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
501 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
502 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
503 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
504 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
505 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
506 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
507 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
508 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
509 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
510 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
511 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
512 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
513 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
514 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
515 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
516 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
517 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
518 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
519 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
520 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
521 2876601092 Pantoea endophytica 596 Isolate Unclassified
522 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
523 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
524 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
525 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
526 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
527 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
528 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
529 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
530 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
531 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
532 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
533 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
534 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
535 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
536 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
537 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
538 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
539 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
540 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
541 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
542 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
543 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
544 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
545 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
546 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
547 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
548 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
549 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
550 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
551 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
552 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
553 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
554 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
555 2909042592 Labrys sp. LIt4 Isolate Nodule
556 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
557 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
558 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
559 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
560 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
561 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
562 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
563 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
564 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
565 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
566 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
567 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
568 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
569 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
570 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
571 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
572 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
573 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
574 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
575 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
576 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
577 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
578 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
579 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
580 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
581 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
582 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
583 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
584 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
585 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
586 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
587 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
588 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
589 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
590 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
591 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
592 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
593 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
594 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
595 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
596 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
597 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
598 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
599 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
600 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
601 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
602 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
603 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
604 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
605 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
606 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
607 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
608 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
609 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
610 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
611 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
612 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
613 2933599457 Rhizobium phaseoli M3 Isolate Nodule
614 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
615 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
616 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
617 2936381700 Rhizobium chutanense C16 Isolate Unclassified
618 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
619 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
620 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
621 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
622 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
623 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
624 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
625 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
626 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
627 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
628 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
629 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
630 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
631 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
632 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
633 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
634 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
635 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
636 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
637 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
638 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
639 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
640 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
641 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
642 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
643 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
644 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
645 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
646 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
647 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
648 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
649 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
650 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
651 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
652 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
653 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
654 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
655 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
656 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
657 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
658 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
659 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
660 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
661 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
662 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
663 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
664 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
665 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
666 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
667 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
668 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
669 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
670 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
671 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
672 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
673 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
674 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
675 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
676 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
677 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
678 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
679 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
680 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
681 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
682 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
683 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
684 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
685 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
686 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
687 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
688 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
689 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
690 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
691 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
692 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
693 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
694 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
695 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
696 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
697 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
698 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
699 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
700 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
701 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
702 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
703 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
704 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
705 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
706 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
707 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
708 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
709 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
710 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
711 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
712 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
713 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
714 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
715 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
716 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
717 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
718 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
719 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
720 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
721 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
722 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
723 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
724 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
725 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
726 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
727 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
728 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
729 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
730 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
731 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
732 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
733 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
734 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
735 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
736 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
737 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
738 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
739 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
740 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
741 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
742 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
743 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
744 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
745 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
746 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
747 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
748 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
749 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
750 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
751 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
752 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
753 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
754 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
755 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
756 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
757 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
758 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
759 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
760 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
761 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
762 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
763 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
764 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
765 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
766 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
767 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
768 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
769 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
770 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
771 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
772 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
773 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
774 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
775 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
776 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
777 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
778 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
779 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
780 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
781 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
782 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
783 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
784 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
785 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
786 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
787 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
788 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
789 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
790 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
791 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
792 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
793 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
794 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
795 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
796 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
797 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
798 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
799 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
800 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
801 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
802 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
803 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
804 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
805 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
806 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
807 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
808 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
809 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
810 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
811 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
812 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
813 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
814 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
815 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
816 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
817 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
818 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
819 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
820 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
821 3004167301 Mesorhizobium loti 582 Isolate Unclassified
822 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
823 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
824 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
825 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
826 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
827 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
828 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
829 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
830 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
831 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
832 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
833 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
834 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
835 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
836 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
837 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
838 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
839 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
840 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
841 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
842 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
843 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
844 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
845 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
846 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
847 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
848 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
849 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
850 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
851 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
852 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
853 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
854 8005275841 Rhizobium sp. N4311 Isolate Nodule
855 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
856 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
857 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
858 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
859 8005382845 Rhizobium sp. R634 Isolate Nodule
860 8005395548 Rhizobium sp. R339 Isolate Nodule
861 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
862 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
863 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
864 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
865 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
866 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
867 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
868 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
869 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
870 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
871 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
872 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
873 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
874 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
875 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
876 8018176218 Rhizobium sp. N122 Isolate Nodule
877 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
878 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
879 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
880 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
881 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
882 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
883 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
884 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
885 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
886 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
887 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
888 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.54
Metatranscriptomes 0.26
Isolates 57.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.84
Nodule 46.67
Rhizoplane 1.75
Rhizosphere 24.39
Stem 0
Stem Tuber 0.35
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005683 3300001979 Bacteria 5251
2 JGI25162J39368_1003459 3300002737 Bacteria 4543
3 JGI25158J39367_1000619 3300002739 Bacteria 7054
4 JGI25157J39369_1003126 3300002741 Bacteria 3554
5 JGI25152J39213_1000465 3300002773 Bacteria 23613
6 JGI25152J39213_1000472 3300002773 Bacteria 23443
7 JGI25152J39213_1004792 3300002773 Bacteria 4151
8 JGI25150J39212_1000219 3300002774 Bacteria 31283
9 JGI25150J39212_1004081 3300002774 Bacteria 3303
10 JGI25159J45721_1000101 3300002987 Bacteria 41224
11 JGI25151J46595_10000007 3300003187 Bacteria 411751
12 JGI25151J46595_10000463 3300003187 Bacteria 38967
13 JGI25151J46595_10000667 3300003187 Bacteria 29187
14 JGI25151J46595_10021859 3300003187 Bacteria 2667
15 JGI25151J46595_10039482 3300003187 Bacteria 1742
16 JGI25153J46596_10000254 3300003215 Bacteria 43730
17 JGI25153J46596_10001626 3300003215 Bacteria 13317
18 JGI25153J46596_10002799 3300003215 Bacteria 9916
19 JGI25153J46596_10015061 3300003215 Bacteria 3173
20 JGI25153J46596_10030913 3300003215 Bacteria 1813
21 JGI25160J50197_1000060 3300003354 Bacteria 116870
22 JGI25160J50197_1003006 3300003354 Bacteria 7693
23 JGI25160J50197_1004431 3300003354 Bacteria 6072
24 JGI25160J50197_1011375 3300003354 Bacteria 3161
25 JGI25161J50226_1000085 3300003374 Bacteria 76182
26 Ga0055542_1000516 3300003762 Bacteria 34984
27 Ga0055529_1002054 3300003763 Bacteria 4355
28 Ga0055526_1010257 3300003771 Bacteria 4381
29 Ga0055526_1030927 3300003771 Bacteria 1549
30 Ga0055524_1000668 3300003775 Bacteria 24115
31 Ga0055524_1001911 3300003775 Bacteria 11282
32 Ga0055524_1003923 3300003775 Bacteria 7044
33 Ga0055528_1000098 3300003790 Bacteria 69408
34 Ga0055528_1004180 3300003790 Bacteria 7020
35 Ga0055528_1018480 3300003790 Bacteria 2360
36 Ga0055528_1024305 3300003790 Bacteria 1820
37 Ga0055540_1000209 3300003792 Bacteria 55602
38 Ga0055540_1000331 3300003792 Bacteria 41202
39 Ga0055540_1007076 3300003792 Bacteria 4311
40 Ga0055540_1010000 3300003792 Bacteria 3199
41 Ga0055540_1016417 3300003792 Bacteria 2108
42 Ga0058692_1000122 3300003856 Bacteria 50557
43 Ga0058692_1020206 3300003856 Bacteria 1404
44 Ga0055543_1000036 3300004625 Bacteria 126054
45 Ga0055543_1000456 3300004625 Bacteria 24226
46 Ga0055543_1001244 3300004625 Bacteria 10574
47 Ga0065165_1000160 3300005262 Bacteria 116908
48 Ga0065165_1004819 3300005262 Bacteria 8031
49 Ga0065165_1010462 3300005262 Bacteria 4005
50 Ga0065704_10076579 3300005289 Bacteria 5071
51 Ga0070658_10027027 3300005327 Bacteria 4607
52 Ga0070658_10084741 3300005327 Bacteria 2606
53 Ga0070660_100087227 3300005339 Bacteria 2456
54 Ga0070660_100287992 3300005339 Bacteria 1345
55 Ga0070661_100118217 3300005344 Bacteria 1983
56 Ga0070661_100155856 3300005344 Bacteria 1728
57 Ga0070668_100019704 3300005347 Bacteria 5080
58 Ga0070659_100046749 3300005366 Bacteria 3393
59 Ga0070713_100046253 3300005436 Bacteria 3570
60 Ga0070708_100010806 3300005445 Bacteria 7415
61 Ga0070663_100061340 3300005455 Bacteria 2708
62 Ga0070698_100002353 3300005471 Bacteria 20885
63 Ga0070699_100071468 3300005518 Bacteria 3018
64 Ga0068853_100021559 3300005539 Bacteria 5374
65 Ga0068853_100074089 3300005539 Bacteria 2970
66 Ga0070665_100277468 3300005548 Bacteria 1678
67 Ga0070665_100453665 3300005548 Bacteria 1292
68 Ga0068855_100168949 3300005563 Bacteria 2477
69 Ga0068855_100464084 3300005563 Bacteria 1380
70 Ga0068854_100040341 3300005578 Bacteria 3294
71 Ga0068854_100350760 3300005578 Bacteria 1208
72 Ga0068856_100106580 3300005614 Bacteria 2797
73 Ga0068856_100242215 3300005614 Bacteria 1818
74 Ga0068852_100016706 3300005616 Bacteria 5733
75 Ga0081455_10006529 3300005937 Bacteria 12485
76 Ga0081455_10154069 3300005937 Bacteria 1769
77 Ga0075365_10000172 3300006038 Bacteria 20817
78 Ga0075365_10001466 3300006038 Bacteria 10717
79 Ga0075365_10010202 3300006038 Bacteria 5456
80 Ga0075365_10026133 3300006038 Bacteria 3703
81 Ga0075365_10076510 3300006038 Bacteria 2260
82 Ga0075368_10018926 3300006042 Bacteria 2595
83 Ga0075363_100066744 3300006048 Bacteria 1948
84 Ga0075363_100143358 3300006048 Bacteria 1346
85 Ga0075364_10056644 3300006051 Bacteria 2567
86 Ga0075364_10167512 3300006051 Bacteria 1484
87 Ga0075362_10001315 3300006177 Bacteria 7871
88 Ga0075362_10063691 3300006177 Bacteria 1672
89 Ga0075367_10000610 3300006178 Bacteria 13715
90 Ga0075367_10010220 3300006178 Bacteria 4923
91 Ga0075369_10038703 3300006186 Bacteria 2035
92 Ga0075369_10040383 3300006186 Bacteria 1994
93 Ga0075366_10020620 3300006195 Bacteria 3826
94 Ga0075370_10012335 3300006353 Bacteria 4514
95 Ga0079104_1000572 3300006946 Bacteria 37334
96 Ga0079104_1016202 3300006946 Bacteria 2186
97 Ga0099826_10046495 3300006948 Bacteria 2957
98 Ga0105251_10000150 3300009011 Bacteria 71228
99 Ga0105251_10000178 3300009011 Bacteria 64062
100 Ga0105251_10002606 3300009011 Bacteria 13953
101 Ga0105251_10010068 3300009011 Bacteria 5520
102 Ga0105251_10075967 3300009011 Bacteria 1559
103 Ga0105244_10011349 3300009036 Bacteria 5352
104 Ga0105244_10015946 3300009036 Bacteria 4296
105 Ga0105244_10016622 3300009036 Bacteria 4186
106 Ga0105244_10018418 3300009036 Bacteria 3917
107 Ga0105244_10087099 3300009036 Bacteria 1539
108 Ga0105244_10089032 3300009036 Bacteria 1520
109 Ga0105250_10000483 3300009092 Bacteria 28043
110 Ga0105250_10014484 3300009092 Bacteria 3240
111 Ga0105250_10022902 3300009092 Bacteria 2517
112 Ga0105240_10061396 3300009093 Bacteria 4684
113 Ga0111539_10306348 3300009094 Bacteria 1848
114 Ga0105247_10281088 3300009101 Bacteria 1148
115 Ga0105241_10064760 3300009174 Bacteria 2823
116 Ga0105248_10055740 3300009177 Bacteria 4434
117 Ga0105237_10093671 3300009545 Bacteria 2993
118 Ga0105238_10026486 3300009551 Bacteria 5912
119 Ga0105238_10169338 3300009551 Bacteria 2160
120 Ga0105249_10287853 3300009553 Bacteria 1643
121 Ga0123342_1013959 3300009766 Bacteria 7848
122 Ga0105239_10088373 3300010375 Bacteria 3417
123 Ga0105239_10098741 3300010375 Bacteria 3228
124 Ga0105239_10241457 3300010375 Bacteria 2027
125 Ga0105239_10254200 3300010375 Bacteria 1974
126 Ga0105246_10054660 3300011119 Bacteria 2752
127 Ga0105246_10403718 3300011119 Bacteria 1135
128 Ga0157326_1002792 3300012513 Bacteria 1850
129 Ga0157373_10001535 3300013100 Bacteria 17618
130 Ga0157371_10004602 3300013102 Bacteria 11973
131 Ga0157371_10032788 3300013102 Bacteria 3736
132 Ga0157371_10035682 3300013102 Bacteria 3563
133 Ga0157371_10205907 3300013102 Bacteria 1411
134 Ga0157369_10043059 3300013105 Bacteria 4922
135 Ga0157369_10085095 3300013105 Bacteria 3379
136 Ga0157369_10401194 3300013105 Bacteria 1422
137 Ga0163162_10035381 3300013306 Bacteria 4975
138 Ga0163162_10446965 3300013306 Bacteria 1424
139 Ga0163162_10479017 3300013306 Bacteria 1376
140 Ga0157372_10040906 3300013307 Bacteria 5123
141 Ga0157372_10075330 3300013307 Bacteria 3807
142 Ga0157372_10086303 3300013307 Bacteria 3561
143 Ga0157372_10164613 3300013307 Bacteria 2564
144 Ga0182008_10011754 3300014497 Bacteria 4646
145 Ga0182008_10013713 3300014497 Bacteria 4259
146 Ga0182006_1025165 3300015261 Bacteria 2447
147 Ga0182007_10017559 3300015262 Bacteria 2610
148 Ga0163161_10046734 3300017792 Bacteria 3123
149 Ga0163161_10055512 3300017792 Bacteria 2876
150 Ga0214542_1017459 3300021321 Bacteria 6471
151 Ga0214543_1000025 3300021327 Bacteria 225351
152 Ga0213876_10000645 3300021384 Bacteria 25233
153 Ga0213876_10001281 3300021384 Bacteria 15870
154 Ga0213876_10010349 3300021384 Bacteria 5008
155 Ga0228711_1000005 3300022739 Bacteria 215594
156 Ga0228710_1000018 3300022740 Bacteria 118600
157 Ga0209436_100133 3300025208 Bacteria 36901
158 Ga0209436_100661 3300025208 Bacteria 14676
159 Ga0209437_100035 3300025233 Bacteria 481110
160 Ga0207425_1000018 3300025245 Bacteria 411841
161 Ga0207425_1003306 3300025245 Bacteria 5222
162 Ga0207425_1007310 3300025245 Bacteria 2927
163 Ga0209026_1000327 3300025250 Bacteria 48226
164 Ga0209148_1000078 3300025254 Bacteria 296101
165 Ga0209759_1000321 3300025256 Bacteria 63590
166 Ga0209129_1000019 3300025258 Bacteria 460802
167 Ga0209129_1000026 3300025258 Bacteria 411839
168 Ga0209129_1000355 3300025258 Bacteria 38491
169 Ga0209129_1009127 3300025258 Bacteria 2656
170 Ga0209455_1000193 3300025272 Bacteria 90413
171 Ga0209673_1000132 3300025273 Bacteria 162349
172 Ga0209673_1000294 3300025273 Bacteria 93050
173 Ga0209673_1000769 3300025273 Bacteria 43317
174 Ga0209673_1004058 3300025273 Bacteria 8094
175 Ga0209673_1009831 3300025273 Bacteria 4097
176 Ga0209673_1020714 3300025273 Bacteria 2321
177 Ga0209673_1031433 3300025273 Bacteria 1652
178 Ga0209130_1000019 3300025284 Bacteria 381993
179 Ga0209130_1000136 3300025284 Bacteria 116996
180 Ga0209130_1000880 3300025284 Bacteria 24560
181 Ga0209025_1000035 3300025294 Bacteria 411841
182 Ga0209025_1000086 3300025294 Bacteria 262586
183 Ga0209025_1000260 3300025294 Bacteria 124240
184 Ga0209025_1000429 3300025294 Bacteria 83306
185 Ga0209025_1001953 3300025294 Bacteria 23804
186 Ga0209025_1002615 3300025294 Bacteria 18501
187 Ga0209025_1007515 3300025294 Bacteria 8096
188 Ga0209564_1000336 3300025295 Bacteria 90930
189 Ga0209564_1003025 3300025295 Bacteria 12006
190 Ga0209564_1004439 3300025295 Bacteria 8589
191 Ga0209564_1015925 3300025295 Bacteria 3031
192 Ga0209758_1000005 3300025297 Bacteria 1368918
193 Ga0209758_1000040 3300025297 Bacteria 411841
194 Ga0209758_1000113 3300025297 Bacteria 202528
195 Ga0209758_1001643 3300025297 Bacteria 25398
196 Ga0209758_1001704 3300025297 Bacteria 24679
197 Ga0209758_1001926 3300025297 Bacteria 22572
198 Ga0209758_1003645 3300025297 Bacteria 13739
199 Ga0209758_1006987 3300025297 Bacteria 7858
200 Ga0209256_1000406 3300025299 Bacteria 68202
201 Ga0209256_1000458 3300025299 Bacteria 61611
202 Ga0209256_1002794 3300025299 Bacteria 13381
203 Ga0209256_1003916 3300025299 Bacteria 9837
204 Ga0209256_1005862 3300025299 Bacteria 6811
205 Ga0207426_1000005 3300025302 Bacteria 1037188
206 Ga0207426_1000085 3300025302 Bacteria 293171
207 Ga0207426_1000253 3300025302 Bacteria 116996
208 Ga0207426_1000282 3300025302 Bacteria 104108
209 Ga0207426_1001460 3300025302 Bacteria 19554
210 Ga0209051_1000027 3300025303 Bacteria 412172
211 Ga0209051_1000683 3300025303 Bacteria 37689
212 Ga0209051_1009482 3300025303 Bacteria 5012
213 Ga0209257_1002682 3300025304 Bacteria 17053
214 Ga0207696_1000003 3300025711 Bacteria 860639
215 Ga0207696_1000070 3300025711 Bacteria 227242
216 Ga0207696_1002293 3300025711 Bacteria 9506
217 Ga0207655_1015624 3300025728 Bacteria 4206
218 Ga0207655_1024733 3300025728 Bacteria 2934
219 Ga0207655_1029616 3300025728 Bacteria 2559
220 Ga0207713_1000001 3300025735 Bacteria 2295391
221 Ga0207713_1000021 3300025735 Bacteria 353108
222 Ga0207713_1044084 3300025735 Bacteria 1836
223 Ga0207647_10085655 3300025904 Bacteria 1884
224 Ga0207645_10111519 3300025907 Bacteria 1771
225 Ga0207705_10039774 3300025909 Bacteria 3371
226 Ga0207705_10169479 3300025909 Bacteria 1643
227 Ga0207654_10030452 3300025911 Bacteria 2962
228 Ga0207695_10073535 3300025913 Bacteria 3483
229 Ga0207695_10317768 3300025913 Bacteria 1447
230 Ga0207671_10093157 3300025914 Bacteria 2272
231 Ga0207671_10156562 3300025914 Bacteria 1763
232 Ga0207657_10012165 3300025919 Bacteria 8503
233 Ga0207694_10069679 3300025924 Bacteria 2748
234 Ga0207700_10073795 3300025928 Bacteria 2636
235 Ga0207664_10248855 3300025929 Bacteria 1550
236 Ga0207644_10081718 3300025931 Bacteria 2389
237 Ga0207690_10064900 3300025932 Bacteria 2495
238 Ga0207669_10058832 3300025937 Bacteria 2347
239 Ga0207711_10069552 3300025941 Bacteria 3052
240 Ga0207667_10011811 3300025949 Bacteria 10117
241 Ga0207712_10091990 3300025961 Bacteria 2235
242 Ga0207668_10013110 3300025972 Bacteria 5095
243 Ga0207668_10042277 3300025972 Bacteria 3085
244 Ga0207668_10478432 3300025972 Bacteria 1068
245 Ga0207639_10030476 3300026041 Bacteria 3956
246 Ga0207678_10046390 3300026067 Bacteria 3757
247 Ga0207702_10145459 3300026078 Bacteria 2150
248 Ga0207648_10223775 3300026089 Bacteria 1673
249 Ga0207674_10068478 3300026116 Bacteria 3571
250 Ga0207698_10101349 3300026142 Bacteria 2387
251 Ga0207698_10157606 3300026142 Bacteria 1980
252 Ga0209281_1000111 3300027111 Bacteria 215615
253 Ga0209281_1000114 3300027111 Bacteria 210536
254 Ga0209281_1000324 3300027111 Bacteria 84060
255 Ga0209371_1000010 3300027312 Bacteria 922021
256 Ga0209371_1000050 3300027312 Bacteria 278645
257 Ga0209371_1000112 3300027312 Bacteria 139930
258 Ga0209371_1000133 3300027312 Bacteria 122145
259 Ga0209371_1003278 3300027312 Bacteria 8017
260 Ga0209371_1008647 3300027312 Bacteria 3347
261 Ga0209282_1000012 3300027666 Bacteria 215614
262 Ga0268266_10403981 3300028379 Bacteria 1292
263 Ga0307515_10000600 3300028794 Bacteria 83981
264 Ga0307515_10009781 3300028794 Bacteria 18477
265 Ga0307515_10020996 3300028794 Bacteria 11605
266 Ga0307515_10346108 3300028794 Bacteria 1136
267 Ga0268256_1000017 3300030500 Bacteria 600718
268 Ga0268256_1000051 3300030500 Bacteria 283626
269 Ga0268256_1002619 3300030500 Bacteria 8943
270 Ga0268256_1006894 3300030500 Bacteria 4147
271 Ga0265325_10079801 3300031241 Bacteria 1628
272 Ga0307513_10011937 3300031456 Bacteria 10755
273 Ga0307513_10112466 3300031456 Bacteria 2713
274 Ga0307516_10253251 3300031730 Bacteria 1454
275 Ga0307405_10008618 3300031731 Bacteria 5182
276 Ga0307406_10131549 3300031901 Bacteria 1757
277 Ga0307412_10006770 3300031911 Bacteria 6497
278 Ga0307412_10092257 3300031911 Bacteria 2122
279 Ga0315914_1000007 3300031967 Bacteria 215597
280 Ga0315913_1000003 3300033430 Bacteria 215608
281 Ga0315915_1000011 3300033464 Bacteria 215597
282 Ga0395905_0002837 3300037471 Bacteria 18981
283 Ga0395905_0014703 3300037471 Bacteria 7464
284 Ga0436364_0030044 3300037853 Bacteria 3186
285 Ga0400483_068475 3300039062 Bacteria 5439
286 Ga0400483_160702 3300039062 Bacteria 25449
287 Ga0400483_260519 3300039062 Bacteria 24015
288 Ga0436365_0844410 3300039437 Bacteria 3369
289 Ga0436365_1352796 3300039437 Bacteria 16338
290 Ga0436365_1727605 3300039437 Bacteria 6558
291 Ga0436365_1869471 3300039437 Bacteria 71390
292 Ga0436360_0240208 3300039438 Unclassified 2863
293 Ga0436360_0832323 3300039438 Bacteria 1574
294 Ga0436360_0981324 3300039438 Unclassified 1989
295 Ga0436360_1037127 3300039438 Bacteria 2928
296 Ga0436361_0194326 3300039447 Bacteria 2363
297 Ga0436361_0482697 3300039447 Bacteria 1451
298 Ga0436361_0520991 3300039447 Bacteria 2909
299 Ga0439438_000315 3300041405 Bacteria 21834
300 Ga0439447_001620 3300041407 Bacteria 8256
301 Ga0439466_0000096 3300041411 Bacteria 34082
302 Ga0439465_0046354 3300041413 Bacteria 1415
303 Ga0451798_0957806 3300041458 Bacteria 1447
304 Ga0451833_0499860 3300041491 Bacteria 1281
305 Ga0451835_0278335 3300041492 Bacteria 1618
306 Ga0451835_0760265 3300041492 Bacteria 1191
307 Ga0451835_0841745 3300041492 Bacteria 1303
308 Ga0451835_0843660 3300041492 Bacteria 1305
309 Ga0451837_0916045 3300041494 Bacteria 2443
310 Ga0451847_0506633 3300041503 Bacteria 1175
311 Ga0451851_1211086 3300041507 Bacteria 1542
312 Ga0439431_0017493 3300041997 Bacteria 1687
313 Ga0439432_013418 3300042006 Bacteria 2787
314 Ga0439449_0009019 3300042007 Bacteria 3783
315 Ga0439449_0086542 3300042007 Bacteria 1157
316 Ga0450902_002194 3300042137 Bacteria 2749
317 Ga0450907_000123 3300042146 Bacteria 29392
318 Ga0466965_0003332 3300044683 Bacteria 7033
319 Ga0453684_0521241 3300044712 Bacteria 1313
320 Ga0495617_038831 3300046452 Bacteria 1592
321 Ga0495591_000075 3300046458 Bacteria 112616
322 Ga0495629_0092050 3300046459 Bacteria 2116
323 Ga0495638_0010418 3300046460 Bacteria 6457
324 Ga0495638_0036817 3300046460 Bacteria 3115
325 Ga0495638_0062422 3300046460 Bacteria 2300
326 Ga0495605_0010332 3300046474 Bacteria 5226
327 Ga0495583_0007023 3300046506 Bacteria 7203
328 Ga0495632_0000580 3300046519 Bacteria 33943
329 Ga0495643_0096961 3300046522 Bacteria 1515
330 Ga0495648_0000932 3300046524 Bacteria 30397
331 Ga0495648_0036333 3300046524 Bacteria 3181
332 Ga0495654_0000019 3300046530 Bacteria 289483
333 Ga0495609_0117833 3300046538 Bacteria 1143
334 Ga0495597_0001385 3300046542 Bacteria 17480
335 Ga0495597_0063417 3300046542 Bacteria 1606
336 Ga0495668_0021545 3300046616 Bacteria 3694
337 Ga0495668_0026359 3300046616 Bacteria 3299
338 Ga0495625_0003161 3300046660 Bacteria 16782
339 Ga0495625_0012254 3300046660 Bacteria 6954
340 Ga0495635_0175944 3300046663 Bacteria 1455
341 Ga0495588_0001292 3300046674 Bacteria 10727
342 Ga0495588_0046862 3300046674 Bacteria 2218
343 Ga0495657_0041489 3300046675 Bacteria 3148
344 Ga0495600_0049262 3300046809 Bacteria 2748
345 Ga0495660_0047137 3300046810 Bacteria 2361
346 Ga0495604_0007238 3300047317 Bacteria 8786
347 Ga0495672_0000084 3300047320 Bacteria 156238
348 Ga0495672_0000418 3300047320 Bacteria 51297
349 Ga0495679_000024 3300047446 Bacteria 205864
350 Ga0495679_002022 3300047446 Bacteria 10730
351 Ga0496100_0016706 3300048903 Bacteria 4316
352 Ga0496100_0016925 3300048903 Bacteria 4291
353 Ga0496101_0000105 3300048904 Bacteria 87453
354 Ga0496101_0014552 3300048904 Bacteria 5290
355 Ga0496102_0001158 3300048905 Bacteria 24093
356 Ga0496102_0096533 3300048905 Bacteria 2740
357 Ga0496102_0328112 3300048905 Bacteria 1441
358 Ga0496104_0006663 3300048907 Bacteria 10165
359 Ga0496105_0001936 3300048908 Bacteria 14876
360 Ga0496105_0013397 3300048908 Bacteria 6507
361 Ga0496116_0012255 3300048919 Bacteria 7012
362 Ga0496116_0015393 3300048919 Bacteria 6046
363 Ga0496116_0030088 3300048919 Bacteria 3906
364 Ga0496116_0093446 3300048919 Bacteria 1821
365 Ga0496117_0000004 3300048920 Bacteria 877131
366 Ga0496117_0000602 3300048920 Bacteria 58964
367 Ga0496117_0003731 3300048920 Bacteria 17468
368 Ga0496117_0020811 3300048920 Bacteria 5338
369 Ga0496117_0067030 3300048920 Bacteria 2431
370 Ga0496118_0000072 3300048921 Bacteria 201387
371 Ga0496118_0022542 3300048921 Bacteria 5499
372 Ga0496118_0032713 3300048921 Bacteria 4277
373 Ga0496119_0000064 3300048922 Bacteria 167571
374 Ga0496119_0000825 3300048922 Bacteria 41334
375 Ga0496119_0001100 3300048922 Bacteria 34059
376 Ga0496119_0005459 3300048922 Bacteria 12172
377 Ga0496119_0032244 3300048922 Bacteria 3495
378 Ga0496119_0114992 3300048922 Bacteria 1487
379 Ga0496120_0000067 3300048923 Bacteria 167571
380 Ga0496120_0000733 3300048923 Bacteria 48086
381 Ga0496120_0008161 3300048923 Bacteria 7679
382 Ga0496121_0000047 3300048924 Bacteria 335768
383 Ga0496121_0011972 3300048924 Bacteria 9539
384 Ga0496121_0012200 3300048924 Bacteria 9417
385 Ga0496122_0000032 3300048925 Bacteria 327099
386 Ga0496122_0000866 3300048925 Bacteria 57016
387 Ga0496122_0001245 3300048925 Bacteria 42799
388 Ga0496122_0005626 3300048925 Bacteria 14817
389 Ga0496122_0007214 3300048925 Bacteria 12439
390 Ga0496122_0010234 3300048925 Bacteria 9715
391 Ga0496122_0012353 3300048925 Bacteria 8520
392 Ga0496122_0096283 3300048925 Bacteria 1996
393 Ga0496122_0144555 3300048925 Bacteria 1480
394 Ga0496123_0000093 3300048926 Bacteria 179205
395 Ga0496123_0000413 3300048926 Bacteria 78006
396 Ga0496123_0000524 3300048926 Bacteria 66159
397 Ga0496123_0000620 3300048926 Bacteria 59624
398 Ga0496123_0001121 3300048926 Bacteria 39976
399 Ga0496123_0004256 3300048926 Bacteria 15237
400 Ga0496123_0069607 3300048926 Bacteria 2208
401 Ga0496123_0120140 3300048926 Bacteria 1480
402 Ga0496123_0160243 3300048926 Bacteria 1200
403 Ga0496124_0000462 3300048927 Bacteria 70383
404 Ga0496124_0002329 3300048927 Bacteria 25080
405 Ga0496124_0003187 3300048927 Bacteria 20266
406 Ga0496124_0006725 3300048927 Bacteria 12439
407 Ga0496124_0008689 3300048927 Bacteria 10562
408 Ga0496124_0020676 3300048927 Bacteria 6073
409 Ga0496124_0023640 3300048927 Bacteria 5606
410 Ga0496124_0033583 3300048927 Bacteria 4512
411 Ga0496124_0034231 3300048927 Bacteria 4461
412 Ga0496124_0037008 3300048927 Bacteria 4248
413 Ga0496124_0149202 3300048927 Bacteria 1836
414 Ga0496125_0000016 3300048928 Bacteria 512512
415 Ga0496125_0000041 3300048928 Bacteria 310158
416 Ga0496125_0025762 3300048928 Bacteria 5378
417 Ga0496126_0000299 3300048929 Bacteria 105208
418 Ga0496126_0012967 3300048929 Bacteria 8509
419 Ga0496126_0026786 3300048929 Bacteria 5520
420 Ga0496126_0042686 3300048929 Bacteria 4187
421 Ga0496126_0076533 3300048929 Bacteria 2968
422 Ga0496126_0184527 3300048929 Bacteria 1770
423 Ga0496126_0227585 3300048929 Bacteria 1563
424 Ga0501031_0005491 3300049568 Bacteria 8250
425 Ga0501031_0030394 3300049568 Bacteria 3523
426 Ga0501031_0041344 3300049568 Bacteria 3010
427 Ga0501032_0002804 3300049569 Bacteria 13554
428 Ga0501032_0065835 3300049569 Bacteria 2423
429 Ga0501033_0000230 3300049570 Bacteria 53911
430 Ga0501033_0003721 3300049570 Bacteria 12406
431 Ga0501033_0034559 3300049570 Bacteria 3791
432 Ga0501034_0006050 3300049571 Bacteria 13067
433 Ga0501034_0130047 3300049571 Bacteria 2501
434 Ga0501034_0169426 3300049571 Bacteria 2151
435 Ga0501036_0003490 3300049572 Bacteria 12566
436 Ga0501037_0000168 3300049573 Bacteria 61484
437 Ga0501037_0006255 3300049573 Bacteria 8703
438 Ga0501038_0006495 3300049574 Bacteria 10822
439 Ga0501038_0055430 3300049574 Bacteria 3405
440 Ga0501039_0002578 3300049575 Bacteria 13540
441 Ga0501039_0207166 3300049575 Bacteria 1542
442 Ga0501043_0000005 3300049579 Bacteria 254466
443 Ga0501043_0003499 3300049579 Bacteria 12912
444 Ga0501043_0020903 3300049579 Bacteria 5133
445 Ga0501043_0124370 3300049579 Bacteria 2023
446 Ga0501046_0001795 3300049580 Bacteria 20473
447 Ga0501046_0006859 3300049580 Bacteria 10049
448 Ga0501047_0003954 3300049581 Bacteria 13934
449 Ga0501067_0116081 3300049583 Bacteria 1489
450 Ga0501069_0000011 3300049585 Bacteria 153214
451 Ga0501070_0000055 3300049586 Bacteria 99156
452 Ga0501070_0095205 3300049586 Bacteria 2464
453 Ga0501071_0021385 3300049587 Bacteria 4504
454 Ga0501073_0006917 3300049589 Bacteria 8445
455 Ga0501074_0000039 3300049590 Bacteria 60866
456 Ga0501080_0003073 3300049742 Bacteria 14742
457 Ga0501083_0000180 3300049744 Bacteria 40737
458 Ga0501083_0013857 3300049744 Bacteria 5636
459 Ga0501035_0000938 3300049822 Bacteria 30768
460 Ga0501035_0003248 3300049822 Bacteria 15578
461 Ga0501035_0007519 3300049822 Bacteria 10180
462 Ga0501044_0001322 3300049823 Bacteria 29176
463 Ga0501044_0046688 3300049823 Bacteria 4483
464 Ga0501044_0093752 3300049823 Bacteria 3027
465 Ga0501044_0131874 3300049823 Bacteria 2492
466 Ga0501045_0422952 3300049824 Bacteria 991
467 nmdc:mga03n38_126507_c1 3300050490 Bacteria 1262
468 nmdc:mga00v17_26683_c1 3300050491 Bacteria 3368
469 nmdc:mga00v17_344820_c1 3300050491 Bacteria 968
470 nmdc:mga0yw44_7008_c1 3300050492 Bacteria 5512
471 nmdc:mga06z11_78819_c1 3300050494 Bacteria 1762
472 nmdc:mga07m45_23765_c1 3300050496 Bacteria 3352
473 nmdc:mga07m45_29843_c1 3300050496 Bacteria 3019
474 nmdc:mga06r32_290683_c1 3300050510 Bacteria 1621
475 Ga0495619_0027540 3300053085 Bacteria 3661
476 Ga0500556_0000022 3300053104 Bacteria 174894
477 Ga0500618_047278 3300053125 Bacteria 979
478 Ga0500568_0000070 3300053139 Bacteria 99663
479 Ga0500568_0006143 3300053139 Bacteria 6076
480 Ga0500590_017148 3300053148 Bacteria 3744
481 Ga0500604_0000846 3300053151 Bacteria 8455
482 Ga0500616_0007322 3300053153 Bacteria 7035
483 Ga0500622_0000207 3300053156 Bacteria 62384
484 Ga0500622_0003264 3300053156 Bacteria 11005
485 Ga0500609_001026 3300053731 Bacteria 4187
486 Ga0587083_0018247 3300059505 Bacteria 1266
487 Ga0587079_024089 3300059647 Bacteria 1119
488 Ga0587107_010249 3300059652 Bacteria 1124
489 2977862794 2977858184 Bacteria 6215359
490 2503203828 2503198000 Bacteria 6884444
491 2508732086 2508501050 Bacteria 9633614
492 2509074730 2508501114 Bacteria 7082538
493 2509110452 2508501122 Bacteria 6292184
494 2509117357 2508501123 Bacteria 6283661
495 2509141380 2508501127 Bacteria 7037543
496 2509369192 2509276018 Bacteria 6910194
497 2509379469 2509276019 Bacteria 6802256
498 2509391088 2509276021 Bacteria 7634384
499 2509398189 2509276022 Bacteria 6200534
500 2510135978 2510065019 Bacteria 6903379
501 2510247728 2510065045 Bacteria 7761063
502 2510303028 2510065057 Bacteria 6649661
503 2510316916 2510065059 Bacteria 6847884
504 2510843379 2510461069 Bacteria 5505000
505 2510892520 2510461076 Bacteria 8618824
506 2511181540 2510917028 Bacteria 6185411
507 2511197368 2510917030 Bacteria 7460662
508 2511381593 2511231025 Bacteria 5324661
509 2511436589 2511231035 Bacteria 5341610
510 2511497027 2511231052 Bacteria 6974333
511 2512529481 2512047086 Bacteria 6850303
512 2512929123 2512875016 Bacteria 6529530
513 2512963927 2512875024 Bacteria 7195110
514 2512968960 2512875026 Bacteria 6861065
515 2513568281 2513237084 Bacteria 7231967
516 2513578178 2513237085 Bacteria 7695351
517 2513582801 2513237086 Bacteria 7265287
518 2513605980 2513237089 Bacteria 6553624
519 2513611304 2513237090 Bacteria 7096802
520 2513614858 2513237091 Bacteria 6900273
521 2513634815 2513237093 Bacteria 7545552
522 2513713823 2513237103 Bacteria 7647401
523 2513866139 2513237138 Bacteria 7368160
524 2513882367 2513237140 Bacteria 7076289
525 2513901691 2513237143 Bacteria 6664116
526 2513911975 2513237144 Bacteria 7530820
527 2513923742 2513237146 Bacteria 7166346
528 2513985132 2513237156 Bacteria 6402557
529 2514000817 2513237159 Bacteria 6810126
530 2514005987 2513237160 Bacteria 6650282
531 2514021917 2513237162 Bacteria 7468464
532 2514035803 2513237164 Bacteria 7563725
533 2514421668 2513237305 Bacteria 7293571
534 2515109080 2515075009 Bacteria 7288508
535 2515611603 2515154107 Bacteria 6795637
536 2515632415 2515154113 Bacteria 7807172
537 2515640698 2515154114 Bacteria 7848616
538 2515661634 2515154116 Bacteria 7552979
539 2515689193 2515154123 Bacteria 6387382
540 2515737896 2515154134 Bacteria 7220242
541 2516020944 2515154189 Bacteria 9629850
542 2516207909 2516143018 Bacteria 6951533
543 2516895743 2516653046 Bacteria 6989037
544 2517041406 2516653077 Bacteria 7555578
545 2517079959 2516653085 Bacteria 7346596
546 2517097980 2517093000 Bacteria 7412387
547 2517566287 2517487022 Bacteria 7227575
548 2523466734 2523231067 Bacteria 5230452
549 2524449253 2524023207 Bacteria 6813453
550 2530648503 2529292951 Bacteria 6916614
551 2535520237 2534681796 Bacteria 7146037
552 2538426729 2537561728 Bacteria 5149301
553 2551678790 2551306084 Bacteria 8942552
554 2551682028 2551306084 Bacteria 8942552
555 2551683340 2551306085 Bacteria 7347181
556 2551696791 2551306086 Bacteria 6843938
557 2551700836 2551306087 Bacteria 7351905
558 2551727743 2551306091 Bacteria 7086830
559 2551735835 2551306092 Bacteria 6992595
560 2551744329 2551306093 Bacteria 7064773
561 2558861402 2558860100 Bacteria 8458965
562 2585167126 2582581283 Bacteria 6030556
563 2585200683 2582581294 Bacteria 6626667
564 2585226821 2582581298 Bacteria 7315509
565 2585230295 2582581299 Bacteria 6518058
566 2585255267 2582581304 Bacteria 5831370
567 2585270262 2582581306 Bacteria 6450535
568 2585390484 2582581865 Bacteria 6644329
569 2585397991 2582581866 Bacteria 6859583
570 2585404750 2582581867 Bacteria 7184437
571 2585525801 2585427526 Bacteria 7258840
572 2585541651 2585427528 Bacteria 6842387
573 2585550236 2585427529 Bacteria 7395659
574 2585823391 2585427590 Bacteria 6824633
575 2585840130 2585427593 Bacteria 7141551
576 2585842655 2585427594 Bacteria 6180594
577 2588514361 2588253730 Bacteria 6881675
578 2597815632 2597489875 Bacteria 7010078
579 2599335324 2599185156 Bacteria 5403036
580 2599415773 2599185170 Bacteria 7295545
581 2601531949 2600255256 Bacteria 5597742
582 2601537320 2600255257 Bacteria 5597196
583 2601755667 2600255310 Bacteria 5600903
584 2601761035 2600255311 Bacteria 5598766
585 2603638943 2602042046 Bacteria 5483348
586 2608669095 2608642108 Bacteria 4104624
587 2609913325 2609459761 Bacteria 5513740
588 2616294799 2615840624 Bacteria 6557588
589 2643986386 2643221595 Bacteria 6565519
590 2644003979 2643221599 Bacteria 6292121
591 2644048148 2643221607 Bacteria 6314006
592 2644105959 2643221618 Bacteria 7717186
593 2644147076 2643221626 Bacteria 8069654
594 2644152618 2643221627 Bacteria 6761570
595 2644195470 2643221634 Bacteria 6705461
596 2644203370 2643221636 Bacteria 6583769
597 2644237755 2643221643 Bacteria 5749658
598 2644310571 2643221655 Bacteria 7722067
599 2644334644 2643221659 Bacteria 7890716
600 2644480941 2643221686 Bacteria 6310811
601 2644497602 2643221689 Bacteria 6042950
602 2644545161 2643221698 Bacteria 7756764
603 2644612673 2643221712 Bacteria 7729434
604 2688600710 2687453392 Bacteria 6880454
605 2692319466 2690316117 Bacteria 6800650
606 2712470072 2711768156 Bacteria 4471618
607 2719184434 2718217882 Bacteria 6556348
608 2719389156 2718217927 Bacteria 6972593
609 2719638102 2718217991 Bacteria 7829542
610 2719669243 2718217997 Bacteria 6740740
611 2719728454 2718218009 Bacteria 6478651
612 2720489937 2718218199 Bacteria 6740745
613 2720610601 2718218232 Bacteria 6720332
614 2720618171 2718218233 Bacteria 6662049
615 2720629182 2718218235 Bacteria 6630699
616 2720773262 2718218269 Bacteria 6906114
617 2721144142 2718218363 Bacteria 6524337
618 2721156239 2718218365 Bacteria 6274507
619 2721161517 2718218366 Bacteria 6425255
620 2721401922 2718218423 Bacteria 6438183
621 2722842662 2721755514 Bacteria 6424414
622 2723030672 2721755556 Bacteria 6745503
623 2723565089 2721755684 Bacteria 6859907
624 2723570389 2721755685 Bacteria 6704835
625 2723578170 2721755686 Bacteria 7343952
626 2724035755 2721755809 Bacteria 6438790
627 2724041479 2721755810 Bacteria 6479005
628 2724093291 2721755819 Bacteria 6906405
629 2724101936 2721755822 Bacteria 6726041
630 2724113608 2721755823 Bacteria 6752556
631 2725947059 2724679232 Bacteria 7646494
632 2730111205 2728369352 Bacteria 6745171
633 2730160550 2728369365 Bacteria 6555560
634 2730295772 2728369397 Bacteria 6274511
635 2738799837 2738541293 Bacteria 7065685
636 2739036265 2738541333 Bacteria 7106503
637 2739351074 2738543031 Bacteria 5769731
638 2753357092 2751185800 Bacteria 5467370
639 2753461449 2751185821 Bacteria 6189929
640 2756672691 2756170246 Bacteria 7451806
641 2758639378 2758568016 Bacteria 5645291
642 2766069244 2765235942 Bacteria 7445910
643 2776263484 2775506901 Bacteria 9631051
644 2792624107 2791355091 Bacteria 6135441
645 2792629483 2791355092 Bacteria 6248105
646 2792640742 2791355094 Bacteria 7011481
647 2792745574 2791355123 Bacteria 8049106
648 2793323155 2791355260 Bacteria 6598818
649 2793330495 2791355261 Bacteria 6661293
650 2793342780 2791355263 Bacteria 6872478
651 2793345319 2791355264 Bacteria 6429314
652 2793363355 2791355266 Bacteria 7116587
653 2793365049 2791355267 Bacteria 7222458
654 2802719809 2802428858 Bacteria 6636079
655 2802727812 2802428859 Bacteria 6667919
656 2802733312 2802428860 Bacteria 6525526
657 2802738868 2802428861 Bacteria 6534206
658 2802745533 2802428862 Bacteria 6633353
659 2802751298 2802428863 Bacteria 6410669
660 2806046368 2802429633 Bacteria 7341974
661 2806053096 2802429634 Bacteria 7083200
662 2806059696 2802429635 Bacteria 7650140
663 2806068566 2802429636 Bacteria 7597525
664 2806074988 2802429637 Bacteria 7067217
665 2813730004 2811995292 Bacteria 5303342
666 2814697496 2814123068 Bacteria 5687681
667 2821449680 2821443989 Bacteria 7658172
668 2835189239 2835188231 Bacteria 3476928
669 2835319956 2835312727 Bacteria 7413381
670 2837654030 2837651117 Bacteria 3772164
671 2838016555 2838016132 Bacteria 6577831
672 2838035890 2838035591 Bacteria 7166484
673 2838050006 2838048938 Bacteria 6044578
674 2838064338 2838061910 Bacteria 6794874
675 2838069089 2838068647 Bacteria 6208656
676 2838665076 2838661181 Bacteria 7385261
677 2838687686 2838686498 Bacteria 7807632
678 2838735573 2838729681 Bacteria 7400765
679 2838748475 2838742623 Bacteria 7396178
680 2841735257 2841734538 Bacteria 6784580
681 2841854233 2841851746 Bacteria 7532261
682 2841865575 2841864319 Bacteria 6742987
683 2842111369 2842110456 Bacteria 7656360
684 2842159399 2842156927 Bacteria 6894975
685 2842163838 2842163707 Bacteria 6916235
686 2842183032 2842180545 Bacteria 6888678
687 2842223830 2842217011 Bacteria 7497767
688 2842232743 2842229732 Bacteria 7475766
689 2842247014 2842243621 Bacteria 7421798
690 2842259300 2842257432 Bacteria 7401195
691 2842265429 2842264693 Bacteria 6472963
692 2842272282 2842271015 Bacteria 7807131
693 2842287869 2842285085 Bacteria 6011953
694 2842309258 2842304105 Bacteria 7023636
695 2842313579 2842311132 Bacteria 6616990
696 2842345505 2842341865 Bacteria 7003929
697 2842363801 2842363717 Bacteria 6844742
698 2842397264 2842395702 Bacteria 6780583
699 2842405135 2842402390 Bacteria 6681310
700 2842412108 2842409023 Bacteria 6687331
701 2842418365 2842415677 Bacteria 6596907
702 2842422279 2842422224 Bacteria 6239196
703 2842428520 2842428310 Bacteria 6767288
704 2842435134 2842434925 Bacteria 6502746
705 2842442003 2842441272 Bacteria 6769273
706 2842447950 2842447887 Bacteria 6754142
707 2842462946 2842462802 Bacteria 6588055
708 2842469466 2842469257 Bacteria 6752936
709 2842525444 2842521101 Bacteria 6569494
710 2842927052 2842922631 Bacteria 5824079
711 2844005147 2844002411 Bacteria 7168230
712 2844016060 2844009547 Bacteria 6728125
713 2844165659 2844163670 Bacteria 7266046
714 2844460681 2844454524 Bacteria 7952546
715 2844530615 2844528606 Bacteria 4733806
716 2844539899 2844533157 Bacteria 7517899
717 2847422033 2847417321 Bacteria 6913799
718 2847672774 2847670302 Bacteria 6165597
719 2848997010 2848992105 Bacteria 6810864
720 2850084632 2850079185 Bacteria 6848280
721 2854915006 2854911287 Bacteria 5582813
722 2855196062 2855195626 Bacteria 4927512
723 2855829440 2855825444 Bacteria 6785811
724 2855844539 2855839649 Bacteria 7135830
725 2855875004 2855872281 Bacteria 6964271
726 2856314725 2856314179 Bacteria 6477897
727 2856326470 2856320880 Bacteria 7263508
728 2856330158 2856328259 Bacteria 6528202
729 2856339580 2856334872 Bacteria 7037011
730 2856346084 2856342000 Bacteria 7176905
731 2856362869 2856356410 Bacteria 6297484
732 2856371483 2856364286 Bacteria 6939991
733 2857349543 2857349434 Bacteria 7926032
734 2857374635 2857367948 Bacteria 6965560
735 2857518241 2857516855 Bacteria 7787325
736 2858468855 2858466076 Bacteria 4722413
737 2858806000 2858800743 Bacteria 6603254
738 2865018547 2865014394 Bacteria 4764573
739 2869170705 2869169390 Bacteria 6659796
740 2869234931 2869234852 Bacteria 6654993
741 2869248462 2869242130 Bacteria 6609239
742 2869255246 2869249662 Bacteria 6868783
743 2869259158 2869256925 Bacteria 6981691
744 2869265066 2869264136 Bacteria 6880765
745 2869274895 2869271264 Bacteria 6908218
746 2869283907 2869278585 Bacteria 7077053
747 2869289596 2869285874 Bacteria 6901219
748 2871272665 2871272651 Bacteria 5042015
749 2871284780 2871282230 Bacteria 4917173
750 2871431662 2871429161 Bacteria 6547891
751 2871437327 2871435913 Bacteria 6880295
752 2871455762 2871451962 Bacteria 7336357
753 2871460315 2871459585 Bacteria 6866887
754 2871468819 2871466892 Bacteria 6923287
755 2871479227 2871474448 Bacteria 6806570
756 2871485088 2871481445 Bacteria 6700002
757 2874110424 2874109183 Bacteria 6517025
758 2874117265 2874116593 Bacteria 6674494
759 2874131382 2874123672 Bacteria 7238285
760 2874135556 2874131515 Bacteria 6820270
761 2874144526 2874139085 Bacteria 7021506
762 2874154804 2874146452 Bacteria 7533118
763 2874162185 2874155637 Bacteria 6724144
764 2874164141 2874162495 Bacteria 6174670
765 2874171145 2874168670 Bacteria 8062617
766 2876367319 2876363079 Bacteria 6544991
767 2876374167 2876369609 Bacteria 6807521
768 2876387627 2876386047 Bacteria 6698674
769 2876401799 2876399893 Bacteria 6927900
770 2876411553 2876406927 Bacteria 6191900
771 2876420370 2876413966 Bacteria 6831344
772 2876425574 2876420981 Bacteria 6687741
773 2876601909 2876601092 Bacteria 5114497
774 2878036194 2878035449 Bacteria 6555736
775 2878735809 2878730984 Bacteria 6380721
776 2878744098 2878738818 Bacteria 7136951
777 2878748268 2878745973 Bacteria 6867388
778 2878774943 2878774303 Bacteria 6108671
779 2878781055 2878781027 Bacteria 6834456
780 2878796014 2878788777 Bacteria 6567085
781 2881151089 2881147464 Bacteria 7779814
782 2881863069 2881861095 Bacteria 7128710
783 2882637538 2882632389 Bacteria 8154593
784 2885315669 2885312484 Bacteria 6415165
785 2885323297 2885318864 Bacteria 6729568
786 2888341622 2888337043 Bacteria 6629336
787 2888349272 2888343758 Bacteria 6611049
788 2889794631 2889790730 Bacteria 5689708
789 2891375910 2891373044 Bacteria 5202277
790 2894820757 2894817345 Bacteria 4892941
791 2903453211 2903448605 Bacteria 7357801
792 2903505840 2903492973 Bacteria 13473544
793 2903514515 2903513507 Bacteria 6344008
794 2903526810 2903521522 Bacteria 6525694
795 2903530571 2903528002 Bacteria 6586099
796 2906311885 2906308376 Bacteria 6841989
797 2906323622 2906321335 Bacteria 6579571
798 2906364952 2906363423 Bacteria 6856682
799 2906371415 2906370794 Bacteria 6881062
800 2906391075 2906386501 Bacteria 5977019
801 2906394924 2906393657 Bacteria 6790866
802 2906403404 2906401398 Bacteria 6693206
803 2906409828 2906408224 Bacteria 6162342
804 2906414914 2906414383 Bacteria 6580790
805 2906432950 2906427513 Bacteria 6375796
806 2908670251 2908669403 Bacteria 5740494
807 2909045437 2909042592 Bacteria 6499737
808 2915654481 2915650412 Bacteria 4288180
809 2915984088 2915980308 Bacteria 6624279
810 2915989917 2915986958 Bacteria 6739310
811 2915993915 2915993759 Bacteria 7016183
812 2916003330 2916000859 Bacteria 6865702
813 2916007842 2916007675 Bacteria 6898660
814 2916015725 2916014648 Bacteria 6946486
815 2916021748 2916021584 Bacteria 6854472
816 2916028442 2916028427 Bacteria 6748433
817 2916037444 2916035215 Bacteria 6755766
818 2916042099 2916041962 Bacteria 6820487
819 2916048872 2916048683 Bacteria 6543552
820 2916059779 2916055098 Bacteria 6758838
821 2916063397 2916061851 Bacteria 6737736
822 2916071025 2916068649 Bacteria 6943657
823 2916081254 2916076590 Bacteria 6596108
824 2919102181 2919100787 Bacteria 7710546
825 2919680549 2919679072 Bacteria 4629602
826 2921202201 2921201388 Bacteria 6926299
827 2921212692 2921208531 Bacteria 6745326
828 2921237420 2921237296 Bacteria 6876710
829 2921250050 2921244191 Bacteria 6568419
830 2921256623 2921250672 Bacteria 6677771
831 2921259373 2921257292 Bacteria 6808382
832 2921268178 2921263974 Bacteria 6864552
833 2921282952 2921282425 Bacteria 6826397
834 2921294662 2921289301 Bacteria 7316391
835 2921301146 2921296804 Bacteria 7176999
836 2922153122 2922151315 Bacteria 6902399
837 2922176267 2922172374 Bacteria 6167644
838 2922179646 2922178524 Bacteria 6025201
839 2923562412 2923556063 Bacteria 6793593
840 2924148061 2924144063 Bacteria 6883928
841 2924157100 2924150972 Bacteria 7169444
842 2924161789 2924158325 Bacteria 7188855
843 2924165625 2924165586 Bacteria 7260590
844 2924174955 2924172951 Bacteria 6749356
845 2924181023 2924179722 Bacteria 6843264
846 2924188208 2924186466 Bacteria 6876637
847 2924196901 2924193448 Bacteria 6955718
848 2924200618 2924200457 Bacteria 6757188
849 2924207241 2924207177 Bacteria 6917007
850 2924217303 2924214083 Bacteria 7080103
851 2924224166 2924221636 Bacteria 7113495
852 2924228958 2924228884 Bacteria 6633132
853 2924719272 2924718760 Bacteria 6331356
854 2924737538 2924733363 Bacteria 7574837
855 2924741476 2924741084 Bacteria 6661321
856 2924752481 2924748358 Bacteria 6154725
857 2924758461 2924754689 Bacteria 6774424
858 2924769085 2924762789 Bacteria 6561353
859 2924782015 2924776078 Bacteria 7492003
860 2924786106 2924784321 Bacteria 7416538
861 2928526058 2928521798 Bacteria 4960112
862 2933017720 2933016740 Bacteria 6355406
863 2933575641 2933570622 Bacteria 7023390
864 2933587923 2933586486 Bacteria 7667493
865 2933599756 2933599457 Bacteria 5858799
866 2935902938 2935901341 Bacteria 7341747
867 2936374158 2936367885 Bacteria 7324495
868 2936375323 2936375103 Bacteria 6652732
869 2936387047 2936381700 Bacteria 7006523
870 2936999044 2936996657 Bacteria 6298727
871 2937003081 2937002841 Bacteria 6934057
872 2937009930 2937009748 Bacteria 6746052
873 2937020367 2937016420 Bacteria 6782579
874 2937025249 2937023124 Bacteria 6815156
875 2937033210 2937029754 Bacteria 6424026
876 2937037661 2937036028 Bacteria 6846469
877 2937047248 2937042894 Bacteria 6741576
878 2937050668 2937049772 Bacteria 6757901
879 2937058467 2937056579 Bacteria 7107896
880 2937064008 2937063883 Bacteria 7199456
881 2937072337 2937071275 Bacteria 6984483
882 2937084499 2937078374 Bacteria 6610289
883 2937087080 2937084907 Bacteria 6618516
884 2937094334 2937091812 Bacteria 6979387
885 2937101526 2937098957 Bacteria 7249374
886 2937110128 2937106411 Bacteria 6947143
887 2937115511 2937113482 Bacteria 6505872
888 2937120008 2937119839 Bacteria 6597547
889 2937128126 2937126314 Bacteria 6771275
890 2937818296 2937813078 Bacteria 7783518
891 2937839553 2937836603 Bacteria 6811263
892 2937850906 2937848649 Bacteria 6983481
893 2937866987 2937861824 Bacteria 6660327
894 2937875312 2937868953 Bacteria 6639878
895 2937884658 2937877337 Bacteria 7246526
896 2937977929 2937972304 Bacteria 7532020
897 2937983465 2937980651 Bacteria 6517427
898 2939574764 2939573065 Bacteria 4926053
899 2939610684 2939607340 Bacteria 4719256
900 2941505460 2941499720 Bacteria 7599444
901 2945879082 2945874760 Bacteria 5527237
902 2945953389 2945951305 Bacteria 4918162
903 2954011849 2954011201 Bacteria 4762601
904 2957381253 2957375807 Bacteria 6425588
905 2957382357 2957382221 Bacteria 6737050
906 2957395434 2957388812 Bacteria 6778072
907 2957400802 2957395598 Bacteria 6822399
908 2957404197 2957402308 Bacteria 6741770
909 2957414870 2957408893 Bacteria 6558585
910 2957421197 2957415311 Bacteria 6991633
911 2957429744 2957422303 Bacteria 7172205
912 2957432118 2957430029 Bacteria 7022557
913 2957437749 2957437181 Bacteria 6568994
914 2957445922 2957443900 Bacteria 6869977
915 2957451026 2957450854 Bacteria 6765715
916 2957461666 2957457609 Bacteria 6967680
917 2957467988 2957464669 Bacteria 6568877
918 2957474602 2957471148 Bacteria 6797643
919 2957483380 2957478035 Bacteria 6756658
920 2957487251 2957484790 Bacteria 6703082
921 2957496489 2957491536 Bacteria 6695180
922 2957504823 2957498199 Bacteria 7126688
923 2957505624 2957505466 Bacteria 7253085
924 2958040297 2958034702 Bacteria 6989922
925 2958055145 2958041894 Bacteria 13082850
926 2958075746 2958071322 Bacteria 6815895
927 2958091966 2958084443 Bacteria 7312792
928 2958096276 2958092219 Bacteria 6861151
929 2958111767 2958108152 Bacteria 6681128
930 2958128407 2958122699 Bacteria 7280457
931 2958133969 2958130278 Bacteria 6897202
932 2958141811 2958137437 Bacteria 6050276
933 2958151462 2958144490 Bacteria 6677056
934 2958159171 2958158011 Bacteria 6058449
935 2958183615 2958179912 Bacteria 6874908
936 2960584199 2960584000 Bacteria 6864594
937 2960596909 2960591022 Bacteria 6622873
938 2960603010 2960597568 Bacteria 6550735
939 2960604077 2960603979 Bacteria 6898737
940 2960611030 2960610863 Bacteria 6691244
941 2960622395 2960617483 Bacteria 6727748
942 2960625256 2960624210 Bacteria 6875384
943 2960631589 2960631154 Bacteria 6732508
944 2960639809 2960637947 Bacteria 7296468
945 2960649151 2960645483 Bacteria 7211087
946 2960659681 2960652885 Bacteria 7083688
947 2960663778 2960660292 Bacteria 7041660
948 2960667589 2960667422 Bacteria 6763020
949 2960676500 2960674078 Bacteria 6609048
950 2960684740 2960680706 Bacteria 6624464
951 2960699899 2960693952 Bacteria 6749742
952 2961081581 2961077736 Bacteria 7079850
953 2961139658 2961136820 Bacteria 6775228
954 2961186190 2961183825 Bacteria 6688536
955 2963650112 2963644680 Bacteria 6530403
956 2964610094 2964607997 Bacteria 7101408
957 2964615552 2964615318 Bacteria 6809089
958 2964626090 2964621998 Bacteria 6834995
959 2964629045 2964628898 Bacteria 7083044
960 2964636152 2964636051 Bacteria 7091832
961 2964643346 2964643177 Bacteria 6820887
962 2964653885 2964649959 Bacteria 6675118
963 2964656754 2964656573 Bacteria 7100150
964 2964663972 2964663802 Bacteria 7019362
965 2964676610 2964670856 Bacteria 6851364
966 2964678121 2964678106 Bacteria 6792020
967 2964688999 2964685014 Bacteria 6839111
968 2964694100 2964691889 Bacteria 6802758
969 2964698941 2964698721 Bacteria 6765331
970 2964711168 2964705432 Bacteria 7114648
971 2964717856 2964712639 Bacteria 6695970
972 2964723374 2964719344 Bacteria 7286602
973 2965027398 2965025482 Bacteria 6532201
974 2965039700 2965032056 Bacteria 6887443
975 2965044051 2965040258 Bacteria 6855979
976 2965065199 2965062239 Bacteria 7412989
977 2965092717 2965089291 Bacteria 6866420
978 2965106687 2965102966 Bacteria 6800987
979 2965111007 2965110997 Bacteria 6693150
980 2967664594 2967664464 Bacteria 6948836
981 2967671741 2967671571 Bacteria 7021409
982 2967681340 2967678726 Bacteria 7264382
983 2967689421 2967686174 Bacteria 6678622
984 2967698485 2967693043 Bacteria 6804451
985 2967699834 2967699805 Bacteria 6854538
986 2967714073 2967706974 Bacteria 7186053
987 2967718557 2967714385 Bacteria 7000047
988 2967721439 2967721400 Bacteria 7073753
989 2967730766 2967728569 Bacteria 6641507
990 2967737377 2967735183 Bacteria 6827012
991 2967744402 2967742019 Bacteria 6794534
992 2967749142 2967748971 Bacteria 6733771
993 2967755893 2967755722 Bacteria 6814706
994 2967762450 2967762386 Bacteria 6923502
995 2967769482 2967769361 Bacteria 6587838
996 2967775995 2967775926 Bacteria 6738189
997 2968022076 2968016561 Bacteria 7022047
998 2968086577 2968083720 Bacteria 7351627
999 2968094570 2968091066 Bacteria 6052692
1000 2968145950 2968138860 Bacteria 6605449
1001 2970019777 2970019648 Bacteria 7072033
1002 2970028551 2970026789 Bacteria 6785236
1003 2970033821 2970033650 Bacteria 7118744
1004 2970044002 2970040964 Bacteria 6731123
1005 2970053145 2970047711 Bacteria 7088379
1006 2970055644 2970054988 Bacteria 6611507
1007 2970063822 2970061556 Bacteria 7099761
1008 2970068997 2970068827 Bacteria 7123112
1009 2970078045 2970076120 Bacteria 6697332
1010 2970084429 2970082768 Bacteria 6183754
1011 2970091935 2970088815 Bacteria 6933825
1012 2970095936 2970095765 Bacteria 6936963
1013 2970102848 2970102677 Bacteria 6812532
1014 2970111309 2970109326 Bacteria 6863976
1015 2970119090 2970116247 Bacteria 6501857
1016 2970125585 2970122695 Bacteria 6625855
1017 2970135296 2970129317 Bacteria 6806560
1018 2970136091 2970136068 Bacteria 7207982
1019 2970146099 2970143518 Bacteria 6446480
1020 2970152093 2970149975 Bacteria 6779706
1021 2970159941 2970156795 Bacteria 7168044
1022 2970165515 2970164137 Bacteria 6861252
1023 2970171152 2970170962 Bacteria 6876229
1024 2970180053 2970177841 Bacteria 6768001
1025 2970188177 2970184632 Bacteria 7054431
1026 2970191889 2970191845 Bacteria 7032787
1027 2970474666 2970469710 Bacteria 6969209
1028 2970491796 2970489779 Bacteria 6517260
1029 2970511006 2970510686 Bacteria 7006402
1030 2970531134 2970524798 Bacteria 6840927
1031 2970536019 2970532167 Bacteria 6553173
1032 2970540794 2970540015 Bacteria 6977556
1033 2970549653 2970547951 Bacteria 6931819
1034 2970598520 2970593180 Bacteria 7073582
1035 2970620766 2970619444 Bacteria 6986144
1036 2970629057 2970627176 Bacteria 6680862
1037 2977519505 2977516862 Bacteria 6940108
1038 2977525905 2977523885 Bacteria 6960446
1039 2977534820 2977530762 Bacteria 6951399
1040 2977539801 2977537788 Bacteria 6929320
1041 2977545334 2977544691 Bacteria 6875412
1042 2977556121 2977551784 Bacteria 7125765
1043 2977559035 2977558990 Bacteria 6863948
1044 2977566114 2977565890 Bacteria 6901543
1045 2977573581 2977572785 Bacteria 6763888
1046 2977585063 2977579622 Bacteria 6772100
1047 2977850952 2977843712 Bacteria 6753583
1048 2977855747 2977851361 Bacteria 6694324
1049 2977868519 2977864932 Bacteria 7534097
1050 2977877312 2977872689 Bacteria 7270173
1051 2977904454 2977898635 Bacteria 6675551
1052 2977909275 2977907340 Bacteria 6577984
1053 2977922095 2977915119 Bacteria 6829656
1054 2977923882 2977922695 Bacteria 6956781
1055 2977937366 2977935797 Bacteria 6252826
1056 2977944275 2977942078 Bacteria 7570577
1057 2977951201 2977950692 Bacteria 6893264
1058 2977959585 2977957713 Bacteria 6877875
1059 2979766932 2979764755 Bacteria 6610066
1060 2979774169 2979772303 Bacteria 6618277
1061 2979796806 2979793036 Bacteria 6808957
1062 2987645450 2987636660 Bacteria 8088555
1063 2987649854 2987645492 Bacteria 6117018
1064 2987672937 2987666974 Bacteria 6509233
1065 2987676140 2987673487 Bacteria 6884027
1066 2989354426 2989349275 Bacteria 6349068
1067 2989772892 2989771324 Bacteria 5605128
1068 2995394546 2995392953 Bacteria 4539380
1069 2996354075 2996348954 Bacteria 7239054
1070 2996391175 2996386984 Bacteria 6978667
1071 3000141150 3000135777 Bacteria 6891109
1072 3003931804 3003930520 Bacteria 5667563
1073 3004171597 3004167301 Bacteria 8330599
1074 3004201978 3004195979 Bacteria 6776956
1075 3004206357 3004203850 Bacteria 7307914
1076 3004213320 3004211236 Bacteria 7417683
1077 3004221392 3004218560 Bacteria 7421728
1078 3004235828 3004232784 Bacteria 6662140
1079 3004246557 3004239961 Bacteria 6892290
1080 3004255596 3004248173 Bacteria 6563236
1081 3004270192 3004268573 Bacteria 7043476
1082 3004280743 3004275668 Bacteria 7114440
1083 3004293292 3004289098 Bacteria 6135450
1084 3004338887 3004334049 Bacteria 8449246
1085 3005414677 3005409236 Bacteria 7188837
1086 3005452030 3005445848 Bacteria 6906074
1087 3005458522 3005452660 Bacteria 5889319
1088 637078883 637000159 Bacteria 7596297
1089 639645154 639633055 Bacteria 7751309
1090 643824057 643692032 Bacteria 6891900
1091 648735551 648276728 Bacteria 6968865
1092 649875163 649633066 Bacteria 6690028
1093 8003997063 8003992118 Bacteria 7266902
1094 8004004757 8003999396 Bacteria 7063185
1095 8004307047 8004300914 Bacteria 6132239
1096 8004314864 8004312739 Bacteria 7444653
1097 8004369210 8004361976 Bacteria 6858373
1098 8004391474 8004387939 Bacteria 7049250
1099 8004401144 8004395343 Bacteria 6620908
1100 8004446403 8004445564 Bacteria 6322258
1101 8004638658 8004633249 Bacteria 6723080
1102 8004643757 8004640170 Bacteria 6723001
1103 8004702835 8004695233 Bacteria 6731676
1104 8004716843 8004714634 Bacteria 6776161
1105 8004733613 8004727605 Bacteria 6643904
1106 8005277496 8005275841 Bacteria 6929066
1107 8005285000 8005282627 Bacteria 6675747
1108 8005306370 8005301065 Bacteria 6614431
1109 8005307710 8005307578 Bacteria 7395396
1110 8005380028 8005376324 Bacteria 6590079
1111 8005383550 8005382845 Bacteria 6732062
1112 8005399085 8005395548 Bacteria 6806915
1113 8005433549 8005430974 Bacteria 6689030
1114 8005467431 8005460587 Bacteria 7157962
1115 8005502441 8005497431 Bacteria 6477605
1116 8005547975 8005542996 Bacteria 7077758
1117 8005563550 8005556819 Bacteria 6908598
1118 8005565326 8005563573 Bacteria 7153261
1119 8005572373 8005570704 Bacteria 6957481
1120 8005624803 8005619151 Bacteria 7030230
1121 8005626203 8005626139 Bacteria 6534237
1122 8005673868 8005668836 Bacteria 6953162
1123 8005693934 8005688590 Bacteria 6610080
1124 8005701304 8005695170 Bacteria 6912330
1125 8016736227 8016733728 Bacteria 5274317
1126 8018131845 8018127388 Bacteria 7351159
1127 8018165716 8018163183 Bacteria 7277977
1128 8018179156 8018176218 Bacteria 6896178
1129 8019502957 8019499862 Bacteria 5169538
1130 8023687897 8023680758 Bacteria 7729763
1131 8024484836 8024479707 Bacteria 6954785
1132 8054560429 8054558443 Bacteria 5204801
1133 8054845891 8054844752 Bacteria 4450330
1134 8055091351 8055087960 Bacteria 4784273
1135 8055094897 8055092621 Bacteria 4873875
1136 8055102291 8055097453 Bacteria 4865496
1137 8055623702 8055617313 Bacteria 7548464
1138 8056377791 8056375014 Bacteria 7006639
1139 8057162549 8057160832 Bacteria 3268302
1140 8057877810 8057874678 Bacteria 7494653
1141 JGI24740J21852_10005683
1142 JGI25162J39368_1003459
1143 JGI25158J39367_1000619
1144 JGI25157J39369_1003126
1145 JGI25152J39213_1000465
1146 JGI25152J39213_1000472
1147 JGI25152J39213_1004792
1148 JGI25150J39212_1000219
1149 JGI25150J39212_1004081
1150 JGI25159J45721_1000101
1151 JGI25151J46595_10000007
1152 JGI25151J46595_10000463
1153 JGI25151J46595_10000667
1154 JGI25151J46595_10021859
1155 JGI25151J46595_10039482
1156 JGI25153J46596_10000254
1157 JGI25153J46596_10001626
1158 JGI25153J46596_10002799
1159 JGI25153J46596_10015061
1160 JGI25153J46596_10030913
1161 JGI25160J50197_1000060
1162 JGI25160J50197_1003006
1163 JGI25160J50197_1004431
1164 JGI25160J50197_1011375
1165 JGI25161J50226_1000085
1166 Ga0055542_1000516
1167 Ga0055529_1002054
1168 Ga0055526_1010257
1169 Ga0055526_1030927
1170 Ga0055524_1000668
1171 Ga0055524_1001911
1172 Ga0055524_1003923
1173 Ga0055528_1000098
1174 Ga0055528_1004180
1175 Ga0055528_1018480
1176 Ga0055528_1024305
1177 Ga0055540_1000209
1178 Ga0055540_1000331
1179 Ga0055540_1007076
1180 Ga0055540_1010000
1181 Ga0055540_1016417
1182 Ga0058692_1000122
1183 Ga0058692_1020206
1184 Ga0055543_1000036
1185 Ga0055543_1000456
1186 Ga0055543_1001244
1187 Ga0065165_1000160
1188 Ga0065165_1004819
1189 Ga0065165_1010462
1190 Ga0065704_10076579
1191 Ga0070658_10027027
1192 Ga0070658_10084741
1193 Ga0070660_100087227
1194 Ga0070660_100287992
1195 Ga0070661_100118217
1196 Ga0070661_100155856
1197 Ga0070668_100019704
1198 Ga0070659_100046749
1199 Ga0070713_100046253
1200 Ga0070708_100010806
1201 Ga0070663_100061340
1202 Ga0070698_100002353
1203 Ga0070699_100071468
1204 Ga0068853_100021559
1205 Ga0068853_100074089
1206 Ga0070665_100277468
1207 Ga0070665_100453665
1208 Ga0068855_100168949
1209 Ga0068855_100464084
1210 Ga0068854_100040341
1211 Ga0068854_100350760
1212 Ga0068856_100106580
1213 Ga0068856_100242215
1214 Ga0068852_100016706
1215 Ga0081455_10006529
1216 Ga0081455_10154069
1217 Ga0075365_10000172
1218 Ga0075365_10001466
1219 Ga0075365_10010202
1220 Ga0075365_10026133
1221 Ga0075365_10076510
1222 Ga0075368_10018926
1223 Ga0075363_100066744
1224 Ga0075363_100143358
1225 Ga0075364_10056644
1226 Ga0075364_10167512
1227 Ga0075362_10001315
1228 Ga0075362_10063691
1229 Ga0075367_10000610
1230 Ga0075367_10010220
1231 Ga0075369_10038703
1232 Ga0075369_10040383
1233 Ga0075366_10020620
1234 Ga0075370_10012335
1235 Ga0079104_1000572
1236 Ga0079104_1016202
1237 Ga0099826_10046495
1238 Ga0105251_10000150
1239 Ga0105251_10000178
1240 Ga0105251_10002606
1241 Ga0105251_10010068
1242 Ga0105251_10075967
1243 Ga0105244_10011349
1244 Ga0105244_10015946
1245 Ga0105244_10016622
1246 Ga0105244_10018418
1247 Ga0105244_10087099
1248 Ga0105244_10089032
1249 Ga0105250_10000483
1250 Ga0105250_10014484
1251 Ga0105250_10022902
1252 Ga0105240_10061396
1253 Ga0111539_10306348
1254 Ga0105247_10281088
1255 Ga0105241_10064760
1256 Ga0105248_10055740
1257 Ga0105237_10093671
1258 Ga0105238_10026486
1259 Ga0105238_10169338
1260 Ga0105249_10287853
1261 Ga0123342_1013959
1262 Ga0105239_10088373
1263 Ga0105239_10098741
1264 Ga0105239_10241457
1265 Ga0105239_10254200
1266 Ga0105246_10054660
1267 Ga0105246_10403718
1268 Ga0157326_1002792
1269 Ga0157373_10001535
1270 Ga0157371_10004602
1271 Ga0157371_10032788
1272 Ga0157371_10035682
1273 Ga0157371_10205907
1274 Ga0157369_10043059
1275 Ga0157369_10085095
1276 Ga0157369_10401194
1277 Ga0163162_10035381
1278 Ga0163162_10446965
1279 Ga0163162_10479017
1280 Ga0157372_10040906
1281 Ga0157372_10075330
1282 Ga0157372_10086303
1283 Ga0157372_10164613
1284 Ga0182008_10011754
1285 Ga0182008_10013713
1286 Ga0182006_1025165
1287 Ga0182007_10017559
1288 Ga0163161_10046734
1289 Ga0163161_10055512
1290 Ga0214542_1017459
1291 Ga0214543_1000025
1292 Ga0213876_10000645
1293 Ga0213876_10001281
1294 Ga0213876_10010349
1295 Ga0228711_1000005
1296 Ga0228710_1000018
1297 Ga0209436_100133
1298 Ga0209436_100661
1299 Ga0209437_100035
1300 Ga0207425_1000018
1301 Ga0207425_1003306
1302 Ga0207425_1007310
1303 Ga0209026_1000327
1304 Ga0209148_1000078
1305 Ga0209759_1000321
1306 Ga0209129_1000019
1307 Ga0209129_1000026
1308 Ga0209129_1000355
1309 Ga0209129_1009127
1310 Ga0209455_1000193
1311 Ga0209673_1000132
1312 Ga0209673_1000294
1313 Ga0209673_1000769
1314 Ga0209673_1004058
1315 Ga0209673_1009831
1316 Ga0209673_1020714
1317 Ga0209673_1031433
1318 Ga0209130_1000019
1319 Ga0209130_1000136
1320 Ga0209130_1000880
1321 Ga0209025_1000035
1322 Ga0209025_1000086
1323 Ga0209025_1000260
1324 Ga0209025_1000429
1325 Ga0209025_1001953
1326 Ga0209025_1002615
1327 Ga0209025_1007515
1328 Ga0209564_1000336
1329 Ga0209564_1003025
1330 Ga0209564_1004439
1331 Ga0209564_1015925
1332 Ga0209758_1000005
1333 Ga0209758_1000040
1334 Ga0209758_1000113
1335 Ga0209758_1001643
1336 Ga0209758_1001704
1337 Ga0209758_1001926
1338 Ga0209758_1003645
1339 Ga0209758_1006987
1340 Ga0209256_1000406
1341 Ga0209256_1000458
1342 Ga0209256_1002794
1343 Ga0209256_1003916
1344 Ga0209256_1005862
1345 Ga0207426_1000005
1346 Ga0207426_1000085
1347 Ga0207426_1000253
1348 Ga0207426_1000282
1349 Ga0207426_1001460
1350 Ga0209051_1000027
1351 Ga0209051_1000683
1352 Ga0209051_1009482
1353 Ga0209257_1002682
1354 Ga0207696_1000003
1355 Ga0207696_1000070
1356 Ga0207696_1002293
1357 Ga0207655_1015624
1358 Ga0207655_1024733
1359 Ga0207655_1029616
1360 Ga0207713_1000001
1361 Ga0207713_1000021
1362 Ga0207713_1044084
1363 Ga0207647_10085655
1364 Ga0207645_10111519
1365 Ga0207705_10039774
1366 Ga0207705_10169479
1367 Ga0207654_10030452
1368 Ga0207695_10073535
1369 Ga0207695_10317768
1370 Ga0207671_10093157
1371 Ga0207671_10156562
1372 Ga0207657_10012165
1373 Ga0207694_10069679
1374 Ga0207700_10073795
1375 Ga0207664_10248855
1376 Ga0207644_10081718
1377 Ga0207690_10064900
1378 Ga0207669_10058832
1379 Ga0207711_10069552
1380 Ga0207667_10011811
1381 Ga0207712_10091990
1382 Ga0207668_10013110
1383 Ga0207668_10042277
1384 Ga0207668_10478432
1385 Ga0207639_10030476
1386 Ga0207678_10046390
1387 Ga0207702_10145459
1388 Ga0207648_10223775
1389 Ga0207674_10068478
1390 Ga0207698_10101349
1391 Ga0207698_10157606
1392 Ga0209281_1000111
1393 Ga0209281_1000114
1394 Ga0209281_1000324
1395 Ga0209371_1000010
1396 Ga0209371_1000050
1397 Ga0209371_1000112
1398 Ga0209371_1000133
1399 Ga0209371_1003278
1400 Ga0209371_1008647
1401 Ga0209282_1000012
1402 Ga0268266_10403981
1403 Ga0307515_10000600
1404 Ga0307515_10009781
1405 Ga0307515_10020996
1406 Ga0307515_10346108
1407 Ga0268256_1000017
1408 Ga0268256_1000051
1409 Ga0268256_1002619
1410 Ga0268256_1006894
1411 Ga0265325_10079801
1412 Ga0307513_10011937
1413 Ga0307513_10112466
1414 Ga0307516_10253251
1415 Ga0307405_10008618
1416 Ga0307406_10131549
1417 Ga0307412_10006770
1418 Ga0307412_10092257
1419 Ga0315914_1000007
1420 Ga0315913_1000003
1421 Ga0315915_1000011
1422 Ga0395905_0002837
1423 Ga0395905_0014703
1424 Ga0436364_0030044
1425 Ga0400483_068475
1426 Ga0400483_160702
1427 Ga0400483_260519
1428 Ga0436365_0844410
1429 Ga0436365_1352796
1430 Ga0436365_1727605
1431 Ga0436365_1869471
1432 Ga0436360_0240208
1433 Ga0436360_0832323
1434 Ga0436360_0981324
1435 Ga0436360_1037127
1436 Ga0436361_0194326
1437 Ga0436361_0482697
1438 Ga0436361_0520991
1439 Ga0439438_000315
1440 Ga0439447_001620
1441 Ga0439466_0000096
1442 Ga0439465_0046354
1443 Ga0451798_0957806
1444 Ga0451833_0499860
1445 Ga0451835_0278335
1446 Ga0451835_0760265
1447 Ga0451835_0841745
1448 Ga0451835_0843660
1449 Ga0451837_0916045
1450 Ga0451847_0506633
1451 Ga0451851_1211086
1452 Ga0439431_0017493
1453 Ga0439432_013418
1454 Ga0439449_0009019
1455 Ga0439449_0086542
1456 Ga0450902_002194
1457 Ga0450907_000123
1458 Ga0466965_0003332
1459 Ga0453684_0521241
1460 Ga0495617_038831
1461 Ga0495591_000075
1462 Ga0495629_0092050
1463 Ga0495638_0010418
1464 Ga0495638_0036817
1465 Ga0495638_0062422
1466 Ga0495605_0010332
1467 Ga0495583_0007023
1468 Ga0495632_0000580
1469 Ga0495643_0096961
1470 Ga0495648_0000932
1471 Ga0495648_0036333
1472 Ga0495654_0000019
1473 Ga0495609_0117833
1474 Ga0495597_0001385
1475 Ga0495597_0063417
1476 Ga0495668_0021545
1477 Ga0495668_0026359
1478 Ga0495625_0003161
1479 Ga0495625_0012254
1480 Ga0495635_0175944
1481 Ga0495588_0001292
1482 Ga0495588_0046862
1483 Ga0495657_0041489
1484 Ga0495600_0049262
1485 Ga0495660_0047137
1486 Ga0495604_0007238
1487 Ga0495672_0000084
1488 Ga0495672_0000418
1489 Ga0495679_000024
1490 Ga0495679_002022
1491 Ga0496100_0016706
1492 Ga0496100_0016925
1493 Ga0496101_0000105
1494 Ga0496101_0014552
1495 Ga0496102_0001158
1496 Ga0496102_0096533
1497 Ga0496102_0328112
1498 Ga0496104_0006663
1499 Ga0496105_0001936
1500 Ga0496105_0013397
1501 Ga0496116_0012255
1502 Ga0496116_0015393
1503 Ga0496116_0030088
1504 Ga0496116_0093446
1505 Ga0496117_0000004
1506 Ga0496117_0000602
1507 Ga0496117_0003731
1508 Ga0496117_0020811
1509 Ga0496117_0067030
1510 Ga0496118_0000072
1511 Ga0496118_0022542
1512 Ga0496118_0032713
1513 Ga0496119_0000064
1514 Ga0496119_0000825
1515 Ga0496119_0001100
1516 Ga0496119_0005459
1517 Ga0496119_0032244
1518 Ga0496119_0114992
1519 Ga0496120_0000067
1520 Ga0496120_0000733
1521 Ga0496120_0008161
1522 Ga0496121_0000047
1523 Ga0496121_0011972
1524 Ga0496121_0012200
1525 Ga0496122_0000032
1526 Ga0496122_0000866
1527 Ga0496122_0001245
1528 Ga0496122_0005626
1529 Ga0496122_0007214
1530 Ga0496122_0010234
1531 Ga0496122_0012353
1532 Ga0496122_0096283
1533 Ga0496122_0144555
1534 Ga0496123_0000093
1535 Ga0496123_0000413
1536 Ga0496123_0000524
1537 Ga0496123_0000620
1538 Ga0496123_0001121
1539 Ga0496123_0004256
1540 Ga0496123_0069607
1541 Ga0496123_0120140
1542 Ga0496123_0160243
1543 Ga0496124_0000462
1544 Ga0496124_0002329
1545 Ga0496124_0003187
1546 Ga0496124_0006725
1547 Ga0496124_0008689
1548 Ga0496124_0020676
1549 Ga0496124_0023640
1550 Ga0496124_0033583
1551 Ga0496124_0034231
1552 Ga0496124_0037008
1553 Ga0496124_0149202
1554 Ga0496125_0000016
1555 Ga0496125_0000041
1556 Ga0496125_0025762
1557 Ga0496126_0000299
1558 Ga0496126_0012967
1559 Ga0496126_0026786
1560 Ga0496126_0042686
1561 Ga0496126_0076533
1562 Ga0496126_0184527
1563 Ga0496126_0227585
1564 Ga0501031_0005491
1565 Ga0501031_0030394
1566 Ga0501031_0041344
1567 Ga0501032_0002804
1568 Ga0501032_0065835
1569 Ga0501033_0000230
1570 Ga0501033_0003721
1571 Ga0501033_0034559
1572 Ga0501034_0006050
1573 Ga0501034_0130047
1574 Ga0501034_0169426
1575 Ga0501036_0003490
1576 Ga0501037_0000168
1577 Ga0501037_0006255
1578 Ga0501038_0006495
1579 Ga0501038_0055430
1580 Ga0501039_0002578
1581 Ga0501039_0207166
1582 Ga0501043_0000005
1583 Ga0501043_0003499
1584 Ga0501043_0020903
1585 Ga0501043_0124370
1586 Ga0501046_0001795
1587 Ga0501046_0006859
1588 Ga0501047_0003954
1589 Ga0501067_0116081
1590 Ga0501069_0000011
1591 Ga0501070_0000055
1592 Ga0501070_0095205
1593 Ga0501071_0021385
1594 Ga0501073_0006917
1595 Ga0501074_0000039
1596 Ga0501080_0003073
1597 Ga0501083_0000180
1598 Ga0501083_0013857
1599 Ga0501035_0000938
1600 Ga0501035_0003248
1601 Ga0501035_0007519
1602 Ga0501044_0001322
1603 Ga0501044_0046688
1604 Ga0501044_0093752
1605 Ga0501044_0131874
1606 Ga0501045_0422952
1607 nmdc:mga03n38_126507_c1
1608 nmdc:mga00v17_26683_c1
1609 nmdc:mga00v17_344820_c1
1610 nmdc:mga0yw44_7008_c1
1611 nmdc:mga06z11_78819_c1
1612 nmdc:mga07m45_23765_c1
1613 nmdc:mga07m45_29843_c1
1614 nmdc:mga06r32_290683_c1
1615 Ga0495619_0027540
1616 Ga0500556_0000022
1617 Ga0500618_047278
1618 Ga0500568_0000070
1619 Ga0500568_0006143
1620 Ga0500590_017148
1621 Ga0500604_0000846
1622 Ga0500616_0007322
1623 Ga0500622_0000207
1624 Ga0500622_0003264
1625 Ga0500609_001026
1626 Ga0587083_0018247
1627 Ga0587079_024089
1628 Ga0587107_010249
1629 2977862794
1630 2503203828
1631 2508732086
1632 2509074730
1633 2509110452
1634 2509117357
1635 2509141380
1636 2509369192
1637 2509379469
1638 2509391088
1639 2509398189
1640 2510135978
1641 2510247728
1642 2510303028
1643 2510316916
1644 2510843379
1645 2510892520
1646 2511181540
1647 2511197368
1648 2511381593
1649 2511436589
1650 2511497027
1651 2512529481
1652 2512929123
1653 2512963927
1654 2512968960
1655 2513568281
1656 2513578178
1657 2513582801
1658 2513605980
1659 2513611304
1660 2513614858
1661 2513634815
1662 2513713823
1663 2513866139
1664 2513882367
1665 2513901691
1666 2513911975
1667 2513923742
1668 2513985132
1669 2514000817
1670 2514005987
1671 2514021917
1672 2514035803
1673 2514421668
1674 2515109080
1675 2515611603
1676 2515632415
1677 2515640698
1678 2515661634
1679 2515689193
1680 2515737896
1681 2516020944
1682 2516207909
1683 2516895743
1684 2517041406
1685 2517079959
1686 2517097980
1687 2517566287
1688 2523466734
1689 2524449253
1690 2530648503
1691 2535520237
1692 2538426729
1693 2551678790
1694 2551682028
1695 2551683340
1696 2551696791
1697 2551700836
1698 2551727743
1699 2551735835
1700 2551744329
1701 2558861402
1702 2585167126
1703 2585200683
1704 2585226821
1705 2585230295
1706 2585255267
1707 2585270262
1708 2585390484
1709 2585397991
1710 2585404750
1711 2585525801
1712 2585541651
1713 2585550236
1714 2585823391
1715 2585840130
1716 2585842655
1717 2588514361
1718 2597815632
1719 2599335324
1720 2599415773
1721 2601531949
1722 2601537320
1723 2601755667
1724 2601761035
1725 2603638943
1726 2608669095
1727 2609913325
1728 2616294799
1729 2643986386
1730 2644003979
1731 2644048148
1732 2644105959
1733 2644147076
1734 2644152618
1735 2644195470
1736 2644203370
1737 2644237755
1738 2644310571
1739 2644334644
1740 2644480941
1741 2644497602
1742 2644545161
1743 2644612673
1744 2688600710
1745 2692319466
1746 2712470072
1747 2719184434
1748 2719389156
1749 2719638102
1750 2719669243
1751 2719728454
1752 2720489937
1753 2720610601
1754 2720618171
1755 2720629182
1756 2720773262
1757 2721144142
1758 2721156239
1759 2721161517
1760 2721401922
1761 2722842662
1762 2723030672
1763 2723565089
1764 2723570389
1765 2723578170
1766 2724035755
1767 2724041479
1768 2724093291
1769 2724101936
1770 2724113608
1771 2725947059
1772 2730111205
1773 2730160550
1774 2730295772
1775 2738799837
1776 2739036265
1777 2739351074
1778 2753357092
1779 2753461449
1780 2756672691
1781 2758639378
1782 2766069244
1783 2776263484
1784 2792624107
1785 2792629483
1786 2792640742
1787 2792745574
1788 2793323155
1789 2793330495
1790 2793342780
1791 2793345319
1792 2793363355
1793 2793365049
1794 2802719809
1795 2802727812
1796 2802733312
1797 2802738868
1798 2802745533
1799 2802751298
1800 2806046368
1801 2806053096
1802 2806059696
1803 2806068566
1804 2806074988
1805 2813730004
1806 2814697496
1807 2821449680
1808 2835189239
1809 2835319956
1810 2837654030
1811 2838016555
1812 2838035890
1813 2838050006
1814 2838064338
1815 2838069089
1816 2838665076
1817 2838687686
1818 2838735573
1819 2838748475
1820 2841735257
1821 2841854233
1822 2841865575
1823 2842111369
1824 2842159399
1825 2842163838
1826 2842183032
1827 2842223830
1828 2842232743
1829 2842247014
1830 2842259300
1831 2842265429
1832 2842272282
1833 2842287869
1834 2842309258
1835 2842313579
1836 2842345505
1837 2842363801
1838 2842397264
1839 2842405135
1840 2842412108
1841 2842418365
1842 2842422279
1843 2842428520
1844 2842435134
1845 2842442003
1846 2842447950
1847 2842462946
1848 2842469466
1849 2842525444
1850 2842927052
1851 2844005147
1852 2844016060
1853 2844165659
1854 2844460681
1855 2844530615
1856 2844539899
1857 2847422033
1858 2847672774
1859 2848997010
1860 2850084632
1861 2854915006
1862 2855196062
1863 2855829440
1864 2855844539
1865 2855875004
1866 2856314725
1867 2856326470
1868 2856330158
1869 2856339580
1870 2856346084
1871 2856362869
1872 2856371483
1873 2857349543
1874 2857374635
1875 2857518241
1876 2858468855
1877 2858806000
1878 2865018547
1879 2869170705
1880 2869234931
1881 2869248462
1882 2869255246
1883 2869259158
1884 2869265066
1885 2869274895
1886 2869283907
1887 2869289596
1888 2871272665
1889 2871284780
1890 2871431662
1891 2871437327
1892 2871455762
1893 2871460315
1894 2871468819
1895 2871479227
1896 2871485088
1897 2874110424
1898 2874117265
1899 2874131382
1900 2874135556
1901 2874144526
1902 2874154804
1903 2874162185
1904 2874164141
1905 2874171145
1906 2876367319
1907 2876374167
1908 2876387627
1909 2876401799
1910 2876411553
1911 2876420370
1912 2876425574
1913 2876601909
1914 2878036194
1915 2878735809
1916 2878744098
1917 2878748268
1918 2878774943
1919 2878781055
1920 2878796014
1921 2881151089
1922 2881863069
1923 2882637538
1924 2885315669
1925 2885323297
1926 2888341622
1927 2888349272
1928 2889794631
1929 2891375910
1930 2894820757
1931 2903453211
1932 2903505840
1933 2903514515
1934 2903526810
1935 2903530571
1936 2906311885
1937 2906323622
1938 2906364952
1939 2906371415
1940 2906391075
1941 2906394924
1942 2906403404
1943 2906409828
1944 2906414914
1945 2906432950
1946 2908670251
1947 2909045437
1948 2915654481
1949 2915984088
1950 2915989917
1951 2915993915
1952 2916003330
1953 2916007842
1954 2916015725
1955 2916021748
1956 2916028442
1957 2916037444
1958 2916042099
1959 2916048872
1960 2916059779
1961 2916063397
1962 2916071025
1963 2916081254
1964 2919102181
1965 2919680549
1966 2921202201
1967 2921212692
1968 2921237420
1969 2921250050
1970 2921256623
1971 2921259373
1972 2921268178
1973 2921282952
1974 2921294662
1975 2921301146
1976 2922153122
1977 2922176267
1978 2922179646
1979 2923562412
1980 2924148061
1981 2924157100
1982 2924161789
1983 2924165625
1984 2924174955
1985 2924181023
1986 2924188208
1987 2924196901
1988 2924200618
1989 2924207241
1990 2924217303
1991 2924224166
1992 2924228958
1993 2924719272
1994 2924737538
1995 2924741476
1996 2924752481
1997 2924758461
1998 2924769085
1999 2924782015
2000 2924786106
2001 2928526058
2002 2933017720
2003 2933575641
2004 2933587923
2005 2933599756
2006 2935902938
2007 2936374158
2008 2936375323
2009 2936387047
2010 2936999044
2011 2937003081
2012 2937009930
2013 2937020367
2014 2937025249
2015 2937033210
2016 2937037661
2017 2937047248
2018 2937050668
2019 2937058467
2020 2937064008
2021 2937072337
2022 2937084499
2023 2937087080
2024 2937094334
2025 2937101526
2026 2937110128
2027 2937115511
2028 2937120008
2029 2937128126
2030 2937818296
2031 2937839553
2032 2937850906
2033 2937866987
2034 2937875312
2035 2937884658
2036 2937977929
2037 2937983465
2038 2939574764
2039 2939610684
2040 2941505460
2041 2945879082
2042 2945953389
2043 2954011849
2044 2957381253
2045 2957382357
2046 2957395434
2047 2957400802
2048 2957404197
2049 2957414870
2050 2957421197
2051 2957429744
2052 2957432118
2053 2957437749
2054 2957445922
2055 2957451026
2056 2957461666
2057 2957467988
2058 2957474602
2059 2957483380
2060 2957487251
2061 2957496489
2062 2957504823
2063 2957505624
2064 2958040297
2065 2958055145
2066 2958075746
2067 2958091966
2068 2958096276
2069 2958111767
2070 2958128407
2071 2958133969
2072 2958141811
2073 2958151462
2074 2958159171
2075 2958183615
2076 2960584199
2077 2960596909
2078 2960603010
2079 2960604077
2080 2960611030
2081 2960622395
2082 2960625256
2083 2960631589
2084 2960639809
2085 2960649151
2086 2960659681
2087 2960663778
2088 2960667589
2089 2960676500
2090 2960684740
2091 2960699899
2092 2961081581
2093 2961139658
2094 2961186190
2095 2963650112
2096 2964610094
2097 2964615552
2098 2964626090
2099 2964629045
2100 2964636152
2101 2964643346
2102 2964653885
2103 2964656754
2104 2964663972
2105 2964676610
2106 2964678121
2107 2964688999
2108 2964694100
2109 2964698941
2110 2964711168
2111 2964717856
2112 2964723374
2113 2965027398
2114 2965039700
2115 2965044051
2116 2965065199
2117 2965092717
2118 2965106687
2119 2965111007
2120 2967664594
2121 2967671741
2122 2967681340
2123 2967689421
2124 2967698485
2125 2967699834
2126 2967714073
2127 2967718557
2128 2967721439
2129 2967730766
2130 2967737377
2131 2967744402
2132 2967749142
2133 2967755893
2134 2967762450
2135 2967769482
2136 2967775995
2137 2968022076
2138 2968086577
2139 2968094570
2140 2968145950
2141 2970019777
2142 2970028551
2143 2970033821
2144 2970044002
2145 2970053145
2146 2970055644
2147 2970063822
2148 2970068997
2149 2970078045
2150 2970084429
2151 2970091935
2152 2970095936
2153 2970102848
2154 2970111309
2155 2970119090
2156 2970125585
2157 2970135296
2158 2970136091
2159 2970146099
2160 2970152093
2161 2970159941
2162 2970165515
2163 2970171152
2164 2970180053
2165 2970188177
2166 2970191889
2167 2970474666
2168 2970491796
2169 2970511006
2170 2970531134
2171 2970536019
2172 2970540794
2173 2970549653
2174 2970598520
2175 2970620766
2176 2970629057
2177 2977519505
2178 2977525905
2179 2977534820
2180 2977539801
2181 2977545334
2182 2977556121
2183 2977559035
2184 2977566114
2185 2977573581
2186 2977585063
2187 2977850952
2188 2977855747
2189 2977868519
2190 2977877312
2191 2977904454
2192 2977909275
2193 2977922095
2194 2977923882
2195 2977937366
2196 2977944275
2197 2977951201
2198 2977959585
2199 2979766932
2200 2979774169
2201 2979796806
2202 2987645450
2203 2987649854
2204 2987672937
2205 2987676140
2206 2989354426
2207 2989772892
2208 2995394546
2209 2996354075
2210 2996391175
2211 3000141150
2212 3003931804
2213 3004171597
2214 3004201978
2215 3004206357
2216 3004213320
2217 3004221392
2218 3004235828
2219 3004246557
2220 3004255596
2221 3004270192
2222 3004280743
2223 3004293292
2224 3004338887
2225 3005414677
2226 3005452030
2227 3005458522
2228 637078883
2229 639645154
2230 643824057
2231 648735551
2232 649875163
2233 8003997063
2234 8004004757
2235 8004307047
2236 8004314864
2237 8004369210
2238 8004391474
2239 8004401144
2240 8004446403
2241 8004638658
2242 8004643757
2243 8004702835
2244 8004716843
2245 8004733613
2246 8005277496
2247 8005285000
2248 8005306370
2249 8005307710
2250 8005380028
2251 8005383550
2252 8005399085
2253 8005433549
2254 8005467431
2255 8005502441
2256 8005547975
2257 8005563550
2258 8005565326
2259 8005572373
2260 8005624803
2261 8005626203
2262 8005673868
2263 8005693934
2264 8005701304
2265 8016736227
2266 8018131845
2267 8018165716
2268 8018179156
2269 8019502957
2270 8023687897
2271 8024484836
2272 8054560429
2273 8054845891
2274 8055091351
2275 8055094897
2276 8055102291
2277 8055623702
2278 8056377791
2279 8057162549
2280 8057877810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

73

327

0.97

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

70

341

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ry0-assembly1.cif.gz_A crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose 0.9966 27 311
4ry0-assembly1.cif.gz_A crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose 0.9863 27 311
2ioy-assembly2.cif.gz_B crystal structure of thermoanaerobacter tengcongensis ribose binding protein 0.9747 29 303
1drk-assembly1.cif.gz_A probing protein-protein interactions: the ribose-binding protein in bacterial transport and chemotaxis 0.9715 28 299
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.9714 27 299
ID Description Score Start End Superfamily
5ibqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9968 27 293 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9961 131 311 3.40.50.2300
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9837 131 311 3.40.50.2300
2fn9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9832 29 127 3.40.50.2300
5ibqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.982 27 293 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A5F2HWL8-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.9916 84 192 GO:0030246
GO:0030313
AF-A0A5F2HWL8-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.9826 84 192 GO:0030246
GO:0030313
AF-A0A6P2B264-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9639 29 301 GO:0030246
GO:0030313
AF-A0A356E4P5-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9567 130 304 GO:0030246
GO:0030313
AF-A0A1W1H5F1-F1-model_v4 D-ribose-binding protein (Modular protein) 0.9524 27 299 GO:0030246
GO:0030313

Map