F490729

General Info

Members Datasets Scaffolds Average Seq Length
1142 365 2284 109

Family's Representative Sequence

Representative Sequence 3300049654|Ga0501207_006080|Ga0501207_006080_90_470
Length 126
Sequence MLHSKIFCQTLILIVKSTLALHISAVACLSAIESALDRLHEQDMVDVECSRSGNVLEIEFCHNGSKVIVNSQAAMQEIWVAARSGGFHYKRVDGKWVDTRTGKELFQALSDITTEQGGAPVVVSEQ

Samples

Sample ID Description Type Environment
1 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
149 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
150 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
151 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
261 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
290 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
291 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
292 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
296 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
297 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
298 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
301 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
311 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
312 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
313 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
314 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
323 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
324 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
325 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
326 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
327 2643221556 Massilia sp. Root1485 Isolate Unclassified
328 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
329 2643221638 Duganella sp. Root336D2 Isolate Unclassified
330 2643221684 Massilia sp. Root133 Isolate Unclassified
331 2738541297 Duganella sp. GV083 Isolate Unclassified
332 2738541357 Duganella sp. GV053 Isolate Unclassified
333 2738543003 Duganella sp. GV066 Isolate Unclassified
334 2738543026 Duganella sp. GV089 Isolate Unclassified
335 2738543029 Duganella sp. GV039 Isolate Unclassified
336 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
337 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
338 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
339 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
340 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
341 2818991436 Collimonas arenae 515 Isolate Unclassified
342 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
343 2821131069 Duganella sp. 1224 Isolate Unclassified
344 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
345 2842711865 Duganella sp. R-73148 Isolate Unclassified
346 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
347 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
348 2857558681 Duganella sp. R-74565 Isolate Unclassified
349 2857564685 Duganella sp. R-74599 Isolate Unclassified
350 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
351 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
352 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
353 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
354 2904424332 Duganella sp. 1411 Isolate Rhizosphere
355 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
356 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
357 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
358 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
359 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
360 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
361 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
362 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
363 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
364 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
365 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0.88
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.72
Nodule 0.26
Rhizoplane 4.82
Rhizosphere 78.37
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501207_006080 3300049654 Bacteria 1687
2 JGI25162J39368_1000154 3300002737 Bacteria 75240
3 JGI25154J39366_1001447 3300002738 Bacteria 8408
4 JGI25158J39367_1007537 3300002739 Bacteria 1532
5 JGI25163J39215_1002015 3300002771 Bacteria 2482
6 JGI25164J39214_1007553 3300002772 Bacteria 1103
7 JGI25152J39213_1000374 3300002773 Bacteria 27497
8 JGI25150J39212_1001750 3300002774 Bacteria 5798
9 JGI25150J39212_1006283 3300002774 Bacteria 2464
10 JGI25159J45721_1007555 3300002987 Bacteria 3101
11 JGI25159J45721_1011067 3300002987 Bacteria 2240
12 JGI25159J45721_1037479 3300002987 Bacteria 727
13 JGI25165J46597_1000239 3300003214 Bacteria 75240
14 JGI25153J46596_10002862 3300003215 Bacteria 9802
15 rootH1_10109671 3300003316 Bacteria 1156
16 rootH2_10061216 3300003320 Bacteria 1466
17 rootL2_10011429 3300003322 Bacteria 1194
18 rootL2_10107398 3300003322 Bacteria 2892
19 JGI25160J50197_1063591 3300003354 Bacteria 727
20 JGI25160J50197_1063628 3300003354 Bacteria 727
21 JGI25161J50226_1001059 3300003374 Bacteria 9420
22 JGI25161J50226_1013389 3300003374 Bacteria 951
23 Ga0055538_1000094 3300003751 Bacteria 75240
24 Ga0055539_1000136 3300003752 Bacteria 76284
25 Ga0055533_1000143 3300003756 Bacteria 75240
26 Ga0055525_1000018 3300003759 Bacteria 393974
27 Ga0055525_1000188 3300003759 Bacteria 75240
28 Ga0055529_1000079 3300003763 Bacteria 149370
29 Ga0055526_1000228 3300003771 Bacteria 47559
30 Ga0055526_1000337 3300003771 Bacteria 38516
31 Ga0055526_1017107 3300003771 Bacteria 2792
32 Ga0055526_1022923 3300003771 Bacteria 2103
33 Ga0055526_1072047 3300003771 Bacteria 697
34 Ga0055537_1009540 3300003773 Bacteria 2129
35 Ga0055537_1041054 3300003773 Bacteria 554
36 Ga0055524_1004910 3300003775 Bacteria 6069
37 Ga0055524_1013791 3300003775 Bacteria 3028
38 Ga0055524_1040539 3300003775 Bacteria 1186
39 Ga0055534_1005007 3300003784 Bacteria 3670
40 Ga0055534_1018454 3300003784 Bacteria 1213
41 Ga0055528_1001043 3300003790 Bacteria 18281
42 Ga0055530_10011939 3300003791 Bacteria 3068
43 Ga0055540_1097790 3300003792 Bacteria 549
44 Ga0055531_10026536 3300003794 Bacteria 2062
45 Ga0055541_1000092 3300003841 Bacteria 75240
46 Ga0055543_1003187 3300004625 Bacteria 4999
47 Ga0055543_1042320 3300004625 Bacteria 765
48 Ga0055543_1042321 3300004625 Bacteria 765
49 Ga0065165_1000504 3300005262 Bacteria 60378
50 Ga0065165_1001236 3300005262 Bacteria 29209
51 Ga0065165_1004323 3300005262 Bacteria 8933
52 Ga0065165_1046272 3300005262 Bacteria 1263
53 Ga0065165_1048503 3300005262 Bacteria 1219
54 Ga0065165_1092928 3300005262 Bacteria 765
55 Ga0065165_1092938 3300005262 Bacteria 765
56 Ga0070666_11076622 3300005335 Bacteria 597
57 Ga0070680_100126936 3300005336 Bacteria 2132
58 Ga0070682_100005634 3300005337 Bacteria 6980
59 Ga0070660_100074620 3300005339 Bacteria 2654
60 Ga0070660_100278426 3300005339 Bacteria 1368
61 Ga0070661_100077924 3300005344 Bacteria 2444
62 Ga0070661_101311167 3300005344 Bacteria 607
63 Ga0070661_101590204 3300005344 Bacteria 552
64 Ga0070669_102017114 3300005353 Bacteria 504
65 Ga0070659_100067965 3300005366 Bacteria 2826
66 Ga0070659_100311983 3300005366 Bacteria 1313
67 Ga0070667_101358481 3300005367 Bacteria 666
68 Ga0070663_100075503 3300005455 Bacteria 2463
69 Ga0070662_100345231 3300005457 Bacteria 1218
70 Ga0070662_100392638 3300005457 Bacteria 1144
71 Ga0070662_100770909 3300005457 Bacteria 816
72 Ga0070679_100961830 3300005530 Bacteria 798
73 Ga0068853_100177663 3300005539 Bacteria 1929
74 Ga0068855_100046806 3300005563 Bacteria 5112
75 Ga0068855_100378064 3300005563 Bacteria 1556
76 Ga0068855_100551555 3300005563 Bacteria 1247
77 Ga0070664_100077380 3300005564 Bacteria 2860
78 Ga0070664_100113798 3300005564 Bacteria 2363
79 Ga0070664_101244359 3300005564 Bacteria 703
80 Ga0068857_100753667 3300005577 Bacteria 927
81 Ga0068854_100621313 3300005578 Bacteria 925
82 Ga0068852_100171986 3300005616 Bacteria 2031
83 Ga0068851_10598669 3300005834 Bacteria 671
84 Ga0075363_100407879 3300006048 Bacteria 799
85 Ga0075362_10038496 3300006177 Bacteria 2101
86 Ga0068871_100080081 3300006358 Bacteria 2704
87 Ga0068865_100162242 3300006881 Bacteria 1706
88 Ga0068865_100497942 3300006881 Bacteria 1015
89 Ga0079104_1016527 3300006946 Bacteria 2155
90 Ga0105244_10000158 3300009036 Bacteria 70253
91 Ga0105244_10001394 3300009036 Bacteria 19646
92 Ga0105244_10037873 3300009036 Bacteria 2518
93 Ga0105244_10078940 3300009036 Bacteria 1632
94 Ga0105244_10347293 3300009036 Bacteria 684
95 Ga0105240_10374847 3300009093 Bacteria 1608
96 Ga0105245_10791326 3300009098 Bacteria 986
97 Ga0105243_10048423 3300009148 Bacteria 3350
98 Ga0105243_10490850 3300009148 Bacteria 1161
99 Ga0105241_10033225 3300009174 Bacteria 3871
100 Ga0105242_10028512 3300009176 Bacteria 4446
101 Ga0105242_11309595 3300009176 Bacteria 748
102 Ga0105237_10160460 3300009545 Bacteria 2247
103 Ga0105238_10608836 3300009551 Bacteria 1101
104 Ga0105239_10655637 3300010375 Bacteria 1199
105 Ga0105239_12334590 3300010375 Bacteria 623
106 Ga0105246_10481800 3300011119 Bacteria 1050
107 Ga0157373_10126982 3300013100 Bacteria 1794
108 Ga0157371_10000018 3300013102 Bacteria 310522
109 Ga0157371_10472602 3300013102 Bacteria 923
110 Ga0157370_11199250 3300013104 Bacteria 685
111 Ga0157369_11409063 3300013105 Bacteria 709
112 Ga0157374_10603283 3300013296 Bacteria 1108
113 Ga0157372_10391402 3300013307 Bacteria 1619
114 Ga0157372_10402229 3300013307 Bacteria 1596
115 Ga0182008_10070575 3300014497 Bacteria 1718
116 Ga0182008_10109765 3300014497 Bacteria 1367
117 Ga0182008_10126984 3300014497 Bacteria 1270
118 Ga0182006_1000274 3300015261 Bacteria 46140
119 Ga0182006_1064968 3300015261 Bacteria 1367
120 Ga0182006_1264168 3300015261 Bacteria 565
121 Ga0182007_10000196 3300015262 Bacteria 40434
122 Ga0182007_10000677 3300015262 Bacteria 19595
123 Ga0182007_10003072 3300015262 Bacteria 8036
124 Ga0182007_10046258 3300015262 Bacteria 1441
125 Ga0182007_10058171 3300015262 Bacteria 1268
126 Ga0182005_1000163 3300015265 Bacteria 46142
127 Ga0182005_1000609 3300015265 Bacteria 17340
128 Ga0163161_10114411 3300017792 Bacteria 2021
129 Ga0163161_11193382 3300017792 Bacteria 658
130 Ga0209760_101883 3300025207 Bacteria 2069
131 Ga0209436_101159 3300025208 Bacteria 9727
132 Ga0209436_116762 3300025208 Bacteria 1090
133 Ga0209436_123307 3300025208 Bacteria 779
134 Ga0209436_123308 3300025208 Bacteria 779
135 Ga0209784_100010 3300025224 Bacteria 683664
136 Ga0209566_100008 3300025225 Bacteria 683664
137 Ga0209674_100019 3300025226 Bacteria 683664
138 Ga0209563_100011 3300025230 Bacteria 1187808
139 Ga0209563_100021 3300025230 Bacteria 683764
140 Ga0207427_100342 3300025231 Bacteria 30270
141 Ga0209437_100019 3300025233 Bacteria 683764
142 Ga0209437_108314 3300025233 Bacteria 1662
143 Ga0207425_1000021 3300025245 Bacteria 367537
144 Ga0207425_1000223 3300025245 Bacteria 44555
145 Ga0207425_1001942 3300025245 Bacteria 7782
146 Ga0209646_1000068 3300025246 Bacteria 233765
147 Ga0209677_100011 3300025253 Bacteria 683664
148 Ga0209677_101881 3300025253 Bacteria 8511
149 Ga0209148_1000444 3300025254 Bacteria 45400
150 Ga0209129_1000020 3300025258 Bacteria 457053
151 Ga0209233_1000025 3300025261 Bacteria 683764
152 Ga0209565_1002894 3300025263 Bacteria 5869
153 Ga0209565_1003269 3300025263 Bacteria 5339
154 Ga0209565_1010191 3300025263 Bacteria 2342
155 Ga0209565_1024551 3300025263 Bacteria 1226
156 Ga0209565_1033739 3300025263 Bacteria 984
157 Ga0209565_1043693 3300025263 Bacteria 826
158 Ga0209455_1000070 3300025272 Bacteria 307867
159 Ga0209673_1002575 3300025273 Bacteria 12297
160 Ga0209130_1000290 3300025284 Bacteria 61271
161 Ga0209130_1002175 3300025284 Bacteria 10331
162 Ga0209130_1008439 3300025284 Bacteria 3044
163 Ga0209130_1008440 3300025284 Bacteria 3044
164 Ga0209675_1000650 3300025291 Bacteria 24546
165 Ga0209675_1003691 3300025291 Bacteria 7143
166 Ga0209025_1016392 3300025294 Bacteria 4377
167 Ga0209564_1000027 3300025295 Bacteria 518458
168 Ga0209564_1000047 3300025295 Bacteria 368031
169 Ga0209564_1000780 3300025295 Bacteria 44199
170 Ga0209564_1006698 3300025295 Bacteria 6124
171 Ga0209758_1000077 3300025297 Bacteria 268195
172 Ga0209758_1000322 3300025297 Bacteria 92458
173 Ga0209050_1000050 3300025298 Bacteria 362578
174 Ga0209050_1000795 3300025298 Bacteria 44648
175 Ga0209256_1000674 3300025299 Bacteria 46225
176 Ga0209256_1001001 3300025299 Bacteria 33573
177 Ga0207426_1004227 3300025302 Bacteria 7136
178 Ga0209051_1061051 3300025303 Bacteria 1186
179 Ga0209257_1000075 3300025304 Bacteria 324855
180 Ga0207656_10646801 3300025321 Bacteria 540
181 Ga0207655_1000710 3300025728 Bacteria 38274
182 Ga0207655_1002319 3300025728 Bacteria 15634
183 Ga0207655_1086484 3300025728 Bacteria 1115
184 Ga0207705_10002781 3300025909 Bacteria 13376
185 Ga0207705_11322993 3300025909 Bacteria 550
186 Ga0207654_10006595 3300025911 Bacteria 5835
187 Ga0207671_10180112 3300025914 Bacteria 1644
188 Ga0207657_11061112 3300025919 Bacteria 620
189 Ga0207649_10045679 3300025920 Bacteria 2686
190 Ga0207652_10850560 3300025921 Bacteria 808
191 Ga0207690_10068168 3300025932 Bacteria 2443
192 Ga0207690_10195044 3300025932 Bacteria 1534
193 Ga0207706_10061786 3300025933 Bacteria 3299
194 Ga0207686_10022336 3300025934 Bacteria 3643
195 Ga0207686_10070390 3300025934 Bacteria 2247
196 Ga0207709_10382338 3300025935 Bacteria 1072
197 Ga0207704_10165429 3300025938 Bacteria 1579
198 Ga0207691_10853426 3300025940 Bacteria 763
199 Ga0207679_10093428 3300025945 Bacteria 2333
200 Ga0207679_10980492 3300025945 Bacteria 774
201 Ga0207667_10105571 3300025949 Bacteria 2906
202 Ga0207667_10509631 3300025949 Bacteria 1220
203 Ga0207640_10485763 3300025981 Bacteria 1025
204 Ga0207658_11480760 3300025986 Bacteria 621
205 Ga0207677_12196999 3300026023 Bacteria 513
206 Ga0207639_11116337 3300026041 Bacteria 740
207 Ga0207674_10077146 3300026116 Bacteria 3338
208 Ga0207698_10133842 3300026142 Bacteria 2123
209 Ga0307515_10255477 3300028794 Bacteria 1498
210 Ga0316178_1012872 3300030735 Bacteria 793
211 Ga0316181_1169117 3300030744 Bacteria 2820
212 Ga0316182_1330858 3300030745 Bacteria 737
213 Ga0307408_100000531 3300031548 Bacteria 32967
214 Ga0307408_100001492 3300031548 Bacteria 17360
215 Ga0307408_100006732 3300031548 Bacteria 7619
216 Ga0307408_100015316 3300031548 Bacteria 5105
217 Ga0307408_100051823 3300031548 Bacteria 2958
218 Ga0265314_10094322 3300031711 Bacteria 1940
219 Ga0307412_10347881 3300031911 Bacteria 1189
220 Ga0307412_11154384 3300031911 Bacteria 692
221 Ga0307412_12306728 3300031911 Bacteria 502
222 Ga0307416_100013187 3300032002 Bacteria 5607
223 Ga0307414_10868918 3300032004 Bacteria 825
224 Ga0307414_11038412 3300032004 Bacteria 755
225 Ga0307411_12027951 3300032005 Bacteria 537
226 Ga0307415_100801850 3300032126 Bacteria 860
227 Ga0395899_0000218 3300037312 Bacteria 79718
228 Ga0395899_0002301 3300037312 Bacteria 15580
229 Ga0395899_0006313 3300037312 Bacteria 9173
230 Ga0395899_0013563 3300037312 Bacteria 6229
231 Ga0395899_0036338 3300037312 Bacteria 3695
232 Ga0395899_0069707 3300037312 Bacteria 2574
233 Ga0395899_0140162 3300037312 Bacteria 1721
234 Ga0395899_0234819 3300037312 Bacteria 1264
235 Ga0395899_0732024 3300037312 Bacteria 617
236 Ga0395900_0000556 3300037418 Bacteria 51857
237 Ga0395900_0032092 3300037418 Bacteria 5399
238 Ga0395900_0033288 3300037418 Bacteria 5305
239 Ga0395900_0092370 3300037418 Bacteria 3109
240 Ga0395900_0313396 3300037418 Bacteria 1551
241 Ga0395900_0328641 3300037418 Bacteria 1507
242 Ga0395900_0629166 3300037418 Bacteria 1011
243 Ga0395900_0734644 3300037418 Bacteria 918
244 Ga0395900_0803915 3300037418 Bacteria 868
245 Ga0395898_0002707 3300037466 Bacteria 20464
246 Ga0395898_0189446 3300037466 Bacteria 1965
247 Ga0395898_0296605 3300037466 Bacteria 1542
248 Ga0395898_0389534 3300037466 Bacteria 1329
249 Ga0395898_1063524 3300037466 Bacteria 743
250 Ga0395905_0019147 3300037471 Bacteria 6491
251 Ga0395905_0026672 3300037471 Bacteria 5447
252 Ga0395905_0069822 3300037471 Bacteria 3290
253 Ga0395905_0286641 3300037471 Bacteria 1534
254 Ga0395905_0370524 3300037471 Bacteria 1325
255 Ga0395905_0426607 3300037471 Bacteria 1222
256 Ga0395905_0532113 3300037471 Bacteria 1076
257 Ga0395905_0651648 3300037471 Bacteria 955
258 Ga0395905_0956674 3300037471 Bacteria 759
259 Ga0395905_1570587 3300037471 Bacteria 563
260 Ga0395901_0000187 3300038443 Bacteria 79696
261 Ga0395901_0004253 3300038443 Bacteria 14445
262 Ga0395901_0031790 3300038443 Bacteria 5442
263 Ga0395901_0042000 3300038443 Bacteria 4739
264 Ga0395901_0084078 3300038443 Bacteria 3326
265 Ga0395901_0157570 3300038443 Bacteria 2384
266 Ga0395901_0295087 3300038443 Bacteria 1681
267 Ga0395901_0299859 3300038443 Bacteria 1666
268 Ga0395901_1831590 3300038443 Bacteria 555
269 Ga0439439_0202133 3300041406 Bacteria 578
270 Ga0439453_0021371 3300041408 Bacteria 1167
271 Ga0451835_0420587 3300041492 Bacteria 542
272 Ga0439442_042175 3300042002 Bacteria 960
273 Ga0439448_0002308 3300042005 Bacteria 5161
274 Ga0439432_033330 3300042006 Bacteria 1658
275 Ga0439450_002876 3300042008 Bacteria 2772
276 Ga0439450_024308 3300042008 Bacteria 1320
277 Ga0439455_0003663 3300042012 Bacteria 2964
278 Ga0439455_0208254 3300042012 Bacteria 567
279 Ga0450911_006285 3300042115 Bacteria 1778
280 Ga0450906_031340 3300042145 Bacteria 940
281 Ga0439458_0009946 3300042157 Bacteria 2118
282 Ga0439458_0075281 3300042157 Bacteria 856
283 Ga0439458_0081481 3300042157 Bacteria 826
284 Ga0450893_0063576 3300042532 Bacteria 708
285 Ga0466969_0003319 3300044656 Bacteria 8561
286 Ga0466969_0146066 3300044656 Bacteria 1091
287 Ga0466969_0436272 3300044656 Bacteria 595
288 Ga0466969_0549261 3300044656 Bacteria 528
289 Ga0466965_0016066 3300044683 Bacteria 3556
290 Ga0466965_0019483 3300044683 Bacteria 3257
291 Ga0466965_0024620 3300044683 Bacteria 2912
292 Ga0466965_0033961 3300044683 Bacteria 2494
293 Ga0466965_0047290 3300044683 Bacteria 2130
294 Ga0466966_0041777 3300044684 Bacteria 2945
295 Ga0466966_0054553 3300044684 Bacteria 2532
296 Ga0466966_0214580 3300044684 Bacteria 1162
297 Ga0466966_0489661 3300044684 Bacteria 739
298 Ga0466966_0937321 3300044684 Bacteria 522
299 Ga0466961_0221272 3300044693 Bacteria 1166
300 Ga0466961_0246900 3300044693 Bacteria 1096
301 Ga0466963_0287666 3300044694 Bacteria 1155
302 Ga0466963_0472565 3300044694 Bacteria 885
303 Ga0466964_0000936 3300044706 Bacteria 9636
304 Ga0466964_0014020 3300044706 Bacteria 3045
305 Ga0466964_0195866 3300044706 Bacteria 967
306 Ga0466971_0048867 3300044719 Bacteria 1902
307 Ga0466971_0169432 3300044719 Bacteria 1024
308 Ga0466971_0441304 3300044719 Bacteria 638
309 Ga0466968_0003542 3300044735 Bacteria 5777
310 Ga0466968_0288341 3300044735 Bacteria 787
311 Ga0466968_0555984 3300044735 Bacteria 576
312 Ga0466957_0019220 3300044842 Bacteria 4018
313 Ga0466957_0033031 3300044842 Bacteria 3102
314 Ga0466957_0050188 3300044842 Bacteria 2538
315 Ga0466957_0069129 3300044842 Bacteria 2181
316 Ga0466960_0066746 3300044901 Bacteria 1780
317 Ga0466960_0286449 3300044901 Bacteria 924
318 Ga0466959_0008127 3300045049 Bacteria 7402
319 Ga0466959_0138774 3300045049 Bacteria 1719
320 Ga0466959_0837381 3300045049 Bacteria 614
321 Ga0466958_0222781 3300045836 Bacteria 1203
322 Ga0466958_0330913 3300045836 Bacteria 979
323 Ga0466967_0078926 3300045976 Bacteria 2966
324 Ga0466967_0293135 3300045976 Bacteria 1563
325 Ga0466967_1458691 3300045976 Bacteria 681
326 Ga0466967_1799542 3300045976 Bacteria 610
327 Ga0495617_000027 3300046452 Bacteria 157385
328 Ga0495617_000284 3300046452 Bacteria 29235
329 Ga0495617_002801 3300046452 Bacteria 6729
330 Ga0495617_003312 3300046452 Bacteria 6097
331 Ga0495627_000457 3300046453 Bacteria 35474
332 Ga0495627_040483 3300046453 Bacteria 1434
333 Ga0495627_054056 3300046453 Bacteria 1201
334 Ga0495592_0011898 3300046454 Bacteria 6596
335 Ga0495603_0000675 3300046455 Bacteria 19337
336 Ga0495603_0025946 3300046455 Bacteria 3542
337 Ga0495590_0000020 3300046457 Bacteria 212352
338 Ga0495590_0000053 3300046457 Bacteria 103329
339 Ga0495590_0001165 3300046457 Bacteria 11524
340 Ga0495590_0001791 3300046457 Bacteria 9116
341 Ga0495590_0009791 3300046457 Bacteria 3629
342 Ga0495590_0020073 3300046457 Bacteria 2375
343 Ga0495590_0021211 3300046457 Bacteria 2304
344 Ga0495590_0038077 3300046457 Bacteria 1676
345 Ga0495590_0327625 3300046457 Bacteria 579
346 Ga0495629_0001463 3300046459 Bacteria 18603
347 Ga0495629_0003071 3300046459 Bacteria 12687
348 Ga0495638_0000235 3300046460 Bacteria 75760
349 Ga0495638_0019424 3300046460 Bacteria 4497
350 Ga0495638_0030273 3300046460 Bacteria 3486
351 Ga0495638_0088307 3300046460 Bacteria 1872
352 Ga0495638_0313087 3300046460 Bacteria 841
353 Ga0495638_0374164 3300046460 Bacteria 746
354 Ga0495651_0006186 3300046462 Bacteria 9145
355 Ga0495651_0156168 3300046462 Bacteria 1639
356 Ga0495653_0000067 3300046463 Bacteria 90116
357 Ga0495653_0000728 3300046463 Bacteria 25107
358 Ga0495653_0002463 3300046463 Bacteria 14718
359 Ga0495653_0015836 3300046463 Bacteria 6146
360 Ga0495653_0267906 3300046463 Bacteria 1126
361 Ga0495653_0717181 3300046463 Bacteria 606
362 Ga0495650_0000200 3300046471 Bacteria 130223
363 Ga0495650_0000436 3300046471 Bacteria 67167
364 Ga0495650_0000483 3300046471 Bacteria 60911
365 Ga0495650_0000864 3300046471 Bacteria 36231
366 Ga0495650_0000903 3300046471 Bacteria 34949
367 Ga0495650_0007727 3300046471 Bacteria 6406
368 Ga0495650_0008629 3300046471 Bacteria 5909
369 Ga0495650_0010320 3300046471 Bacteria 5221
370 Ga0495650_0120052 3300046471 Bacteria 968
371 Ga0495580_0169376 3300046472 Bacteria 1510
372 Ga0495580_0186502 3300046472 Bacteria 1431
373 Ga0495580_0203119 3300046472 Bacteria 1365
374 Ga0495582_0012500 3300046473 Bacteria 4679
375 Ga0495582_0023988 3300046473 Bacteria 3335
376 Ga0495582_0082282 3300046473 Bacteria 1788
377 Ga0495582_0086547 3300046473 Bacteria 1744
378 Ga0495605_0000061 3300046474 Bacteria 145286
379 Ga0495605_0000263 3300046474 Bacteria 60765
380 Ga0495605_0000385 3300046474 Bacteria 40742
381 Ga0495605_0005596 3300046474 Bacteria 7303
382 Ga0495605_0020672 3300046474 Bacteria 3496
383 Ga0495605_0033658 3300046474 Bacteria 2599
384 Ga0495605_0037213 3300046474 Bacteria 2449
385 Ga0495605_0039499 3300046474 Bacteria 2363
386 Ga0495605_0070027 3300046474 Bacteria 1659
387 Ga0495605_0139064 3300046474 Bacteria 1090
388 Ga0495605_0336625 3300046474 Bacteria 634
389 Ga0495639_0037130 3300046475 Bacteria 2184
390 Ga0495639_0115536 3300046475 Bacteria 1277
391 Ga0495639_0180755 3300046475 Bacteria 1027
392 Ga0495664_0351329 3300046477 Bacteria 888
393 Ga0495664_0568847 3300046477 Bacteria 675
394 Ga0495584_0000005 3300046491 Bacteria 306957
395 Ga0495584_0000308 3300046491 Bacteria 34325
396 Ga0495584_0001309 3300046491 Bacteria 15123
397 Ga0495584_0002363 3300046491 Bacteria 10755
398 Ga0495584_0012334 3300046491 Bacteria 4362
399 Ga0495584_0016560 3300046491 Bacteria 3758
400 Ga0495584_0021303 3300046491 Bacteria 3294
401 Ga0495584_0061652 3300046491 Bacteria 1885
402 Ga0495584_0062216 3300046491 Bacteria 1876
403 Ga0495584_0067387 3300046491 Bacteria 1799
404 Ga0495584_0120333 3300046491 Bacteria 1329
405 Ga0495584_0139018 3300046491 Bacteria 1233
406 Ga0495584_0511987 3300046491 Bacteria 611
407 Ga0495585_0000497 3300046492 Bacteria 37109
408 Ga0495585_0000599 3300046492 Bacteria 33707
409 Ga0495585_0001915 3300046492 Bacteria 15590
410 Ga0495585_0001990 3300046492 Bacteria 15167
411 Ga0495585_0002632 3300046492 Bacteria 12644
412 Ga0495585_0006962 3300046492 Bacteria 6961
413 Ga0495585_0010644 3300046492 Bacteria 5464
414 Ga0495585_0041466 3300046492 Bacteria 2581
415 Ga0495585_0043249 3300046492 Bacteria 2520
416 Ga0495585_0060580 3300046492 Bacteria 2082
417 Ga0495585_0068399 3300046492 Bacteria 1940
418 Ga0495585_0100693 3300046492 Bacteria 1545
419 Ga0495585_0125773 3300046492 Bacteria 1352
420 Ga0495585_0129000 3300046492 Bacteria 1332
421 Ga0495594_0001208 3300046499 Bacteria 13499
422 Ga0495594_0005976 3300046499 Bacteria 6252
423 Ga0495594_0006113 3300046499 Bacteria 6189
424 Ga0495594_0069077 3300046499 Bacteria 1962
425 Ga0495594_0136689 3300046499 Bacteria 1389
426 Ga0495594_0314011 3300046499 Bacteria 893
427 Ga0495594_0474018 3300046499 Bacteria 711
428 Ga0495596_0002361 3300046500 Bacteria 10212
429 Ga0495596_0003205 3300046500 Bacteria 8414
430 Ga0495596_0006158 3300046500 Bacteria 5570
431 Ga0495596_0009812 3300046500 Bacteria 4198
432 Ga0495596_0027017 3300046500 Bacteria 2311
433 Ga0495596_0035675 3300046500 Bacteria 1971
434 Ga0495596_0037630 3300046500 Bacteria 1912
435 Ga0495596_0050269 3300046500 Bacteria 1633
436 Ga0495596_0060321 3300046500 Bacteria 1478
437 Ga0495596_0076210 3300046500 Bacteria 1302
438 Ga0495596_0245244 3300046500 Bacteria 695
439 Ga0495596_0383643 3300046500 Bacteria 547
440 Ga0495607_0000514 3300046501 Bacteria 38263
441 Ga0495607_0001557 3300046501 Bacteria 20088
442 Ga0495607_0002090 3300046501 Bacteria 16681
443 Ga0495607_0003571 3300046501 Bacteria 11832
444 Ga0495607_0003749 3300046501 Bacteria 11497
445 Ga0495607_0003887 3300046501 Bacteria 11252
446 Ga0495607_0004928 3300046501 Bacteria 9700
447 Ga0495607_0005825 3300046501 Bacteria 8765
448 Ga0495607_0006025 3300046501 Bacteria 8596
449 Ga0495607_0050255 3300046501 Bacteria 2428
450 Ga0495607_0087578 3300046501 Bacteria 1694
451 Ga0495607_0122425 3300046501 Bacteria 1363
452 Ga0495607_0278680 3300046501 Bacteria 794
453 Ga0495583_0000158 3300046506 Bacteria 113645
454 Ga0495583_0000214 3300046506 Bacteria 97639
455 Ga0495583_0000817 3300046506 Bacteria 38095
456 Ga0495583_0000834 3300046506 Bacteria 37746
457 Ga0495583_0000900 3300046506 Bacteria 35357
458 Ga0495583_0007827 3300046506 Bacteria 6638
459 Ga0495583_0009870 3300046506 Bacteria 5648
460 Ga0495583_0037979 3300046506 Bacteria 2279
461 Ga0495583_0060231 3300046506 Bacteria 1698
462 Ga0495583_0223738 3300046506 Bacteria 760
463 Ga0495583_0392467 3300046506 Bacteria 545
464 Ga0495583_0397602 3300046506 Bacteria 541
465 Ga0495606_0000120 3300046507 Bacteria 133907
466 Ga0495606_0000262 3300046507 Bacteria 92896
467 Ga0495606_0000433 3300046507 Bacteria 69506
468 Ga0495606_0002393 3300046507 Bacteria 21960
469 Ga0495606_0002563 3300046507 Bacteria 20868
470 Ga0495606_0003569 3300046507 Bacteria 16403
471 Ga0495606_0007053 3300046507 Bacteria 10179
472 Ga0495606_0020004 3300046507 Bacteria 4954
473 Ga0495606_0020094 3300046507 Bacteria 4938
474 Ga0495606_0057905 3300046507 Bacteria 2493
475 Ga0495606_0081642 3300046507 Bacteria 2009
476 Ga0495606_0119094 3300046507 Bacteria 1582
477 Ga0495606_0134058 3300046507 Bacteria 1469
478 Ga0495606_0136154 3300046507 Bacteria 1454
479 Ga0495606_0201123 3300046507 Bacteria 1135
480 Ga0495606_0549350 3300046507 Bacteria 575
481 Ga0495608_0002978 3300046511 Bacteria 12112
482 Ga0495608_0012837 3300046511 Bacteria 5813
483 Ga0495610_0000017 3300046512 Bacteria 365675
484 Ga0495610_0002788 3300046512 Bacteria 14311
485 Ga0495610_0003279 3300046512 Bacteria 12756
486 Ga0495610_0003795 3300046512 Bacteria 11523
487 Ga0495610_0072112 3300046512 Bacteria 1608
488 Ga0495610_0154982 3300046512 Bacteria 973
489 Ga0495610_0239694 3300046512 Bacteria 723
490 Ga0495610_0247326 3300046512 Bacteria 708
491 Ga0495610_0289498 3300046512 Bacteria 635
492 Ga0495616_0000234 3300046513 Bacteria 45006
493 Ga0495616_0001575 3300046513 Bacteria 15690
494 Ga0495616_0003595 3300046513 Bacteria 9909
495 Ga0495616_0007658 3300046513 Bacteria 6458
496 Ga0495616_0011003 3300046513 Bacteria 5205
497 Ga0495616_0011724 3300046513 Bacteria 5009
498 Ga0495616_0019228 3300046513 Bacteria 3730
499 Ga0495616_0026058 3300046513 Bacteria 3116
500 Ga0495616_0031869 3300046513 Bacteria 2757
501 Ga0495616_0046973 3300046513 Bacteria 2176
502 Ga0495616_0075434 3300046513 Bacteria 1623
503 Ga0495616_0075683 3300046513 Bacteria 1619
504 Ga0495616_0411044 3300046513 Bacteria 554
505 Ga0495618_0020807 3300046514 Bacteria 4038
506 Ga0495620_0001227 3300046515 Bacteria 15668
507 Ga0495620_0140543 3300046515 Bacteria 944
508 Ga0495628_0000109 3300046516 Bacteria 67425
509 Ga0495628_0002255 3300046516 Bacteria 17421
510 Ga0495630_0006488 3300046517 Bacteria 8328
511 Ga0495630_0024582 3300046517 Bacteria 4452
512 Ga0495631_0000538 3300046518 Bacteria 25449
513 Ga0495631_0002275 3300046518 Bacteria 11000
514 Ga0495631_0002872 3300046518 Bacteria 9565
515 Ga0495631_0003696 3300046518 Bacteria 8346
516 Ga0495631_0003905 3300046518 Bacteria 8059
517 Ga0495631_0004474 3300046518 Bacteria 7443
518 Ga0495631_0005526 3300046518 Bacteria 6608
519 Ga0495631_0007002 3300046518 Bacteria 5771
520 Ga0495631_0029358 3300046518 Bacteria 2501
521 Ga0495631_0041908 3300046518 Bacteria 2024
522 Ga0495631_0053698 3300046518 Bacteria 1758
523 Ga0495631_0071628 3300046518 Bacteria 1497
524 Ga0495631_0075028 3300046518 Bacteria 1460
525 Ga0495632_0000069 3300046519 Bacteria 107707
526 Ga0495632_0000407 3300046519 Bacteria 40604
527 Ga0495632_0000418 3300046519 Bacteria 40317
528 Ga0495632_0001896 3300046519 Bacteria 16728
529 Ga0495632_0014117 3300046519 Bacteria 4532
530 Ga0495632_0014874 3300046519 Bacteria 4385
531 Ga0495637_0000053 3300046520 Bacteria 99739
532 Ga0495637_0000179 3300046520 Bacteria 49260
533 Ga0495637_0007631 3300046520 Bacteria 5352
534 Ga0495637_0121111 3300046520 Bacteria 1006
535 Ga0495643_0001481 3300046522 Bacteria 21409
536 Ga0495643_0001510 3300046522 Bacteria 21024
537 Ga0495643_0002282 3300046522 Bacteria 15491
538 Ga0495643_0003504 3300046522 Bacteria 11433
539 Ga0495643_0003680 3300046522 Bacteria 11116
540 Ga0495643_0026429 3300046522 Bacteria 3276
541 Ga0495643_0035539 3300046522 Bacteria 2743
542 Ga0495643_0041757 3300046522 Bacteria 2500
543 Ga0495643_0088606 3300046522 Bacteria 1599
544 Ga0495643_0127836 3300046522 Bacteria 1278
545 Ga0495643_0276322 3300046522 Bacteria 774
546 Ga0495644_0002891 3300046523 Bacteria 6811
547 Ga0495644_0010748 3300046523 Bacteria 3527
548 Ga0495644_0012303 3300046523 Bacteria 3290
549 Ga0495644_0023965 3300046523 Bacteria 2322
550 Ga0495644_0201886 3300046523 Bacteria 766
551 Ga0495644_0446510 3300046523 Bacteria 514
552 Ga0495648_0000350 3300046524 Bacteria 50788
553 Ga0495648_0000616 3300046524 Bacteria 38074
554 Ga0495648_0002854 3300046524 Bacteria 15558
555 Ga0495648_0003263 3300046524 Bacteria 14371
556 Ga0495648_0006205 3300046524 Bacteria 9786
557 Ga0495648_0009345 3300046524 Bacteria 7613
558 Ga0495648_0010195 3300046524 Bacteria 7179
559 Ga0495648_0011746 3300046524 Bacteria 6571
560 Ga0495648_0020036 3300046524 Bacteria 4678
561 Ga0495648_0044241 3300046524 Bacteria 2781
562 Ga0495648_0046941 3300046524 Bacteria 2674
563 Ga0495648_0047805 3300046524 Bacteria 2640
564 Ga0495648_0052456 3300046524 Bacteria 2477
565 Ga0495648_0058824 3300046524 Bacteria 2296
566 Ga0495648_0097772 3300046524 Bacteria 1627
567 Ga0495648_0204263 3300046524 Bacteria 986
568 Ga0495663_0035936 3300046525 Bacteria 1490
569 Ga0495663_0306101 3300046525 Bacteria 573
570 Ga0495666_0000722 3300046526 Bacteria 15103
571 Ga0495666_0014058 3300046526 Bacteria 3991
572 Ga0495666_0218816 3300046526 Bacteria 872
573 Ga0495666_0456490 3300046526 Bacteria 572
574 Ga0495642_0000714 3300046528 Bacteria 16528
575 Ga0495642_0008421 3300046528 Bacteria 3947
576 Ga0495642_0010442 3300046528 Bacteria 3557
577 Ga0495642_0010854 3300046528 Bacteria 3491
578 Ga0495642_0012068 3300046528 Bacteria 3329
579 Ga0495642_0013362 3300046528 Bacteria 3174
580 Ga0495642_0024692 3300046528 Bacteria 2379
581 Ga0495642_0055862 3300046528 Bacteria 1630
582 Ga0495642_0067617 3300046528 Bacteria 1490
583 Ga0495642_0071764 3300046528 Bacteria 1449
584 Ga0495642_0095638 3300046528 Bacteria 1260
585 Ga0495642_0147674 3300046528 Bacteria 1016
586 Ga0495642_0196736 3300046528 Bacteria 878
587 Ga0495642_0387249 3300046528 Bacteria 616
588 Ga0495652_0021087 3300046529 Bacteria 5791
589 Ga0495652_0021800 3300046529 Bacteria 5695
590 Ga0495652_0033902 3300046529 Bacteria 4453
591 Ga0495654_0000060 3300046530 Bacteria 134307
592 Ga0495654_0002805 3300046530 Bacteria 10980
593 Ga0495654_0007594 3300046530 Bacteria 6042
594 Ga0495654_0011270 3300046530 Bacteria 4847
595 Ga0495654_0035032 3300046530 Bacteria 2530
596 Ga0495654_0163056 3300046530 Bacteria 977
597 Ga0495665_0010947 3300046531 Bacteria 4908
598 Ga0495665_0066251 3300046531 Bacteria 1906
599 Ga0495640_0009761 3300046533 Bacteria 7457
600 Ga0495640_0322914 3300046533 Bacteria 956
601 Ga0495586_0003191 3300046535 Bacteria 8818
602 Ga0495586_0005134 3300046535 Bacteria 7007
603 Ga0495586_0014799 3300046535 Bacteria 4147
604 Ga0495586_0269862 3300046535 Bacteria 972
605 Ga0495587_0007269 3300046536 Bacteria 7181
606 Ga0495587_0051685 3300046536 Bacteria 2428
607 Ga0495587_0103105 3300046536 Bacteria 1642
608 Ga0495609_0000007 3300046538 Bacteria 398812
609 Ga0495609_0001337 3300046538 Bacteria 16700
610 Ga0495609_0001362 3300046538 Bacteria 16459
611 Ga0495609_0001749 3300046538 Bacteria 13974
612 Ga0495609_0002344 3300046538 Bacteria 11689
613 Ga0495609_0004700 3300046538 Bacteria 7391
614 Ga0495609_0013242 3300046538 Bacteria 3900
615 Ga0495609_0014546 3300046538 Bacteria 3696
616 Ga0495609_0019736 3300046538 Bacteria 3116
617 Ga0495609_0025042 3300046538 Bacteria 2736
618 Ga0495609_0036229 3300046538 Bacteria 2228
619 Ga0495609_0040776 3300046538 Bacteria 2088
620 Ga0495609_0101186 3300046538 Bacteria 1248
621 Ga0495609_0143878 3300046538 Bacteria 1016
622 Ga0495609_0344999 3300046538 Bacteria 601
623 Ga0495621_0165120 3300046539 Bacteria 877
624 Ga0495597_0000556 3300046542 Bacteria 31021
625 Ga0495597_0001085 3300046542 Bacteria 20660
626 Ga0495597_0001723 3300046542 Bacteria 15087
627 Ga0495597_0002020 3300046542 Bacteria 13586
628 Ga0495597_0002424 3300046542 Bacteria 11847
629 Ga0495597_0025715 3300046542 Bacteria 2709
630 Ga0495597_0038641 3300046542 Bacteria 2138
631 Ga0495597_0054113 3300046542 Bacteria 1763
632 Ga0495597_0075102 3300046542 Bacteria 1451
633 Ga0495597_0080134 3300046542 Bacteria 1397
634 Ga0495597_0252526 3300046542 Bacteria 693
635 Ga0495597_0300725 3300046542 Bacteria 622
636 Ga0495597_0363122 3300046542 Bacteria 554
637 Ga0495645_0041965 3300046543 Bacteria 3336
638 Ga0495645_0074402 3300046543 Bacteria 2446
639 Ga0495645_0397478 3300046543 Bacteria 879
640 Ga0495622_0000210 3300046557 Bacteria 46319
641 Ga0495622_0000292 3300046557 Bacteria 37769
642 Ga0495622_0008494 3300046557 Bacteria 4755
643 Ga0495622_0115088 3300046557 Bacteria 1230
644 Ga0495622_0139456 3300046557 Bacteria 1101
645 Ga0495622_0142119 3300046557 Bacteria 1089
646 Ga0495622_0257440 3300046557 Bacteria 766
647 Ga0495633_0000231 3300046558 Bacteria 68096
648 Ga0495633_0001200 3300046558 Bacteria 20826
649 Ga0495633_0001329 3300046558 Bacteria 19396
650 Ga0495633_0002397 3300046558 Bacteria 13276
651 Ga0495633_0002578 3300046558 Bacteria 12688
652 Ga0495633_0003410 3300046558 Bacteria 10595
653 Ga0495633_0009275 3300046558 Bacteria 5450
654 Ga0495633_0010586 3300046558 Bacteria 5026
655 Ga0495633_0012493 3300046558 Bacteria 4513
656 Ga0495633_0014097 3300046558 Bacteria 4190
657 Ga0495633_0017868 3300046558 Bacteria 3612
658 Ga0495633_0023119 3300046558 Bacteria 3081
659 Ga0495633_0038490 3300046558 Bacteria 2284
660 Ga0495633_0047267 3300046558 Bacteria 2034
661 Ga0495633_0085995 3300046558 Bacteria 1462
662 Ga0495633_0102780 3300046558 Bacteria 1326
663 Ga0495633_0161883 3300046558 Bacteria 1032
664 Ga0495667_0245182 3300046559 Bacteria 1141
665 Ga0495656_0024019 3300046615 Bacteria 2403
666 Ga0495656_0166678 3300046615 Bacteria 1074
667 Ga0495656_0215854 3300046615 Bacteria 957
668 Ga0495656_0521194 3300046615 Unclassified 632
669 Ga0495668_0000162 3300046616 Bacteria 101114
670 Ga0495668_0000427 3300046616 Bacteria 54797
671 Ga0495668_0000769 3300046616 Bacteria 37454
672 Ga0495668_0001457 3300046616 Bacteria 22767
673 Ga0495668_0001893 3300046616 Bacteria 18744
674 Ga0495668_0002467 3300046616 Bacteria 15224
675 Ga0495668_0002786 3300046616 Bacteria 13924
676 Ga0495668_0002980 3300046616 Bacteria 13229
677 Ga0495668_0008820 3300046616 Bacteria 6249
678 Ga0495668_0023037 3300046616 Bacteria 3556
679 Ga0495668_0038211 3300046616 Bacteria 2683
680 Ga0495668_0038291 3300046616 Bacteria 2680
681 Ga0495668_0040840 3300046616 Bacteria 2586
682 Ga0495668_0070968 3300046616 Bacteria 1914
683 Ga0495668_0073386 3300046616 Bacteria 1879
684 Ga0495668_0126068 3300046616 Bacteria 1401
685 Ga0495668_0581472 3300046616 Bacteria 618
686 Ga0495634_0006375 3300046642 Bacteria 8971
687 Ga0495611_0003342 3300046648 Bacteria 7084
688 Ga0495611_0005369 3300046648 Bacteria 5487
689 Ga0495611_0006791 3300046648 Bacteria 4862
690 Ga0495611_0017338 3300046648 Bacteria 3080
691 Ga0495611_0023912 3300046648 Bacteria 2654
692 Ga0495611_0025621 3300046648 Bacteria 2571
693 Ga0495611_0039492 3300046648 Bacteria 2101
694 Ga0495611_0064552 3300046648 Bacteria 1667
695 Ga0495611_0312157 3300046648 Bacteria 724
696 Ga0495611_0315851 3300046648 Bacteria 719
697 Ga0495611_0426069 3300046648 Bacteria 605
698 Ga0495625_0001372 3300046660 Bacteria 29946
699 Ga0495625_0001954 3300046660 Bacteria 23300
700 Ga0495625_0003171 3300046660 Bacteria 16730
701 Ga0495625_0003285 3300046660 Bacteria 16318
702 Ga0495625_0029379 3300046660 Bacteria 4112
703 Ga0495625_0049173 3300046660 Bacteria 3032
704 Ga0495625_0058472 3300046660 Bacteria 2740
705 Ga0495625_0068571 3300046660 Bacteria 2493
706 Ga0495625_0201648 3300046660 Bacteria 1313
707 Ga0495625_0216756 3300046660 Bacteria 1256
708 Ga0495625_0275893 3300046660 Bacteria 1083
709 Ga0495635_0000360 3300046663 Bacteria 28945
710 Ga0495635_0109607 3300046663 Bacteria 1886
711 Ga0495659_0001470 3300046664 Bacteria 7989
712 Ga0495659_0140201 3300046664 Bacteria 964
713 Ga0495659_0260850 3300046664 Bacteria 724
714 Ga0495661_0000343 3300046665 Bacteria 50849
715 Ga0495661_0000744 3300046665 Bacteria 31597
716 Ga0495661_0000965 3300046665 Bacteria 26094
717 Ga0495661_0003744 3300046665 Bacteria 11135
718 Ga0495661_0004599 3300046665 Bacteria 9935
719 Ga0495661_0004782 3300046665 Bacteria 9716
720 Ga0495661_0006054 3300046665 Bacteria 8522
721 Ga0495661_0006085 3300046665 Bacteria 8503
722 Ga0495661_0008594 3300046665 Bacteria 7057
723 Ga0495661_0014032 3300046665 Bacteria 5370
724 Ga0495661_0017434 3300046665 Bacteria 4743
725 Ga0495661_0017716 3300046665 Bacteria 4696
726 Ga0495661_0019247 3300046665 Bacteria 4477
727 Ga0495661_0023595 3300046665 Bacteria 3991
728 Ga0495661_0037924 3300046665 Bacteria 3006
729 Ga0495661_0051835 3300046665 Bacteria 2476
730 Ga0495661_0059259 3300046665 Bacteria 2279
731 Ga0495661_0141327 3300046665 Bacteria 1309
732 Ga0495661_0219171 3300046665 Bacteria 986
733 Ga0495661_0248668 3300046665 Bacteria 908
734 Ga0495661_0318876 3300046665 Bacteria 773
735 Ga0495588_0000199 3300046674 Bacteria 60892
736 Ga0495588_0005278 3300046674 Bacteria 5743
737 Ga0495588_0007319 3300046674 Bacteria 5018
738 Ga0495588_0009039 3300046674 Bacteria 4591
739 Ga0495588_0014477 3300046674 Bacteria 3776
740 Ga0495588_0019180 3300046674 Bacteria 3347
741 Ga0495588_0021436 3300046674 Bacteria 3183
742 Ga0495588_0024826 3300046674 Bacteria 2980
743 Ga0495588_0057833 3300046674 Bacteria 2003
744 Ga0495588_0074914 3300046674 Bacteria 1763
745 Ga0495588_0309991 3300046674 Bacteria 830
746 Ga0495588_0642405 3300046674 Bacteria 555
747 Ga0495657_0223054 3300046675 Bacteria 1142
748 Ga0495657_0336259 3300046675 Bacteria 895
749 Ga0495599_0009744 3300046678 Bacteria 5880
750 Ga0495599_0103526 3300046678 Bacteria 1774
751 Ga0495599_0223512 3300046678 Bacteria 1151
752 Ga0495623_0007538 3300046679 Bacteria 7062
753 Ga0495623_0009364 3300046679 Bacteria 6363
754 Ga0495623_0010373 3300046679 Bacteria 6031
755 Ga0495623_0038396 3300046679 Bacteria 3062
756 Ga0495623_0062178 3300046679 Bacteria 2340
757 Ga0495646_0050670 3300046680 Bacteria 2516
758 Ga0495646_0110075 3300046680 Bacteria 1569
759 Ga0495646_0250243 3300046680 Bacteria 949
760 Ga0495669_0000254 3300046684 Bacteria 30941
761 Ga0495669_0006345 3300046684 Bacteria 4941
762 Ga0495669_0006869 3300046684 Bacteria 4765
763 Ga0495669_0010332 3300046684 Bacteria 3944
764 Ga0495669_0020526 3300046684 Bacteria 2860
765 Ga0495669_0049217 3300046684 Bacteria 1886
766 Ga0495669_0088503 3300046684 Bacteria 1427
767 Ga0495669_0594557 3300046684 Bacteria 538
768 Ga0495613_0026427 3300046689 Bacteria 4324
769 Ga0495613_0114266 3300046689 Bacteria 1943
770 Ga0495624_0056775 3300046690 Bacteria 2462
771 Ga0495670_0002551 3300046691 Bacteria 8996
772 Ga0495670_0006457 3300046691 Bacteria 5760
773 Ga0495670_0008524 3300046691 Bacteria 5045
774 Ga0495670_0014034 3300046691 Bacteria 3941
775 Ga0495670_0014412 3300046691 Bacteria 3886
776 Ga0495670_0021601 3300046691 Bacteria 3175
777 Ga0495670_0027579 3300046691 Bacteria 2814
778 Ga0495670_0050389 3300046691 Bacteria 2084
779 Ga0495670_0070745 3300046691 Bacteria 1765
780 Ga0495670_0074931 3300046691 Bacteria 1717
781 Ga0495670_0133386 3300046691 Bacteria 1295
782 Ga0495670_0173755 3300046691 Bacteria 1135
783 Ga0495670_0197640 3300046691 Bacteria 1064
784 Ga0495670_0802101 3300046691 Bacteria 514
785 Ga0495671_0000037 3300046692 Bacteria 177605
786 Ga0495671_0000587 3300046692 Bacteria 26875
787 Ga0495671_0001906 3300046692 Bacteria 13379
788 Ga0495671_0012172 3300046692 Bacteria 4702
789 Ga0495671_0012455 3300046692 Bacteria 4645
790 Ga0495671_0045828 3300046692 Bacteria 2188
791 Ga0495671_0132051 3300046692 Bacteria 1217
792 Ga0495671_0142658 3300046692 Bacteria 1167
793 Ga0495671_0152622 3300046692 Bacteria 1124
794 Ga0495649_0004357 3300046694 Bacteria 9269
795 Ga0495649_0011442 3300046694 Bacteria 5202
796 Ga0495649_0030887 3300046694 Bacteria 2956
797 Ga0495649_0037550 3300046694 Bacteria 2658
798 Ga0495649_0047011 3300046694 Bacteria 2348
799 Ga0495649_0116485 3300046694 Bacteria 1414
800 Ga0495649_0197540 3300046694 Bacteria 1045
801 Ga0495649_0205003 3300046694 Bacteria 1023
802 Ga0495649_0206190 3300046694 Bacteria 1020
803 Ga0495589_0000081 3300046794 Bacteria 88067
804 Ga0495589_0000497 3300046794 Bacteria 27910
805 Ga0495589_0005629 3300046794 Bacteria 6607
806 Ga0495589_0011642 3300046794 Bacteria 4566
807 Ga0495589_0015128 3300046794 Bacteria 3973
808 Ga0495589_0019987 3300046794 Bacteria 3425
809 Ga0495589_0051367 3300046794 Bacteria 2038
810 Ga0495589_0081717 3300046794 Bacteria 1571
811 Ga0495589_0209297 3300046794 Bacteria 918
812 Ga0495600_0004717 3300046809 Bacteria 8181
813 Ga0495600_0005559 3300046809 Bacteria 7608
814 Ga0495600_0158279 3300046809 Bacteria 1465
815 Ga0495600_0272152 3300046809 Bacteria 1074
816 Ga0495660_0000409 3300046810 Bacteria 36610
817 Ga0495660_0007794 3300046810 Bacteria 6287
818 Ga0495660_0011391 3300046810 Bacteria 5163
819 Ga0495660_0040087 3300046810 Bacteria 2597
820 Ga0495660_0053177 3300046810 Bacteria 2199
821 Ga0495660_0118053 3300046810 Bacteria 1345
822 Ga0495660_0146349 3300046810 Bacteria 1170
823 Ga0495660_0182757 3300046810 Bacteria 1013
824 Ga0495660_0202003 3300046810 Bacteria 948
825 Ga0495581_0040884 3300047315 Bacteria 2682
826 Ga0495581_0044629 3300047315 Bacteria 2563
827 Ga0495604_0004740 3300047317 Bacteria 10776
828 Ga0495604_0019402 3300047317 Bacteria 5442
829 Ga0495604_0024539 3300047317 Bacteria 4810
830 Ga0495604_0026025 3300047317 Bacteria 4659
831 Ga0495604_0038733 3300047317 Bacteria 3751
832 Ga0495604_0076400 3300047317 Bacteria 2519
833 Ga0495604_0506599 3300047317 Bacteria 782
834 Ga0495636_0028117 3300047318 Bacteria 2291
835 Ga0495636_0060270 3300047318 Bacteria 1603
836 Ga0495636_0099568 3300047318 Bacteria 1269
837 Ga0495636_0100201 3300047318 Bacteria 1266
838 Ga0495636_0172020 3300047318 Bacteria 980
839 Ga0495636_0214191 3300047318 Bacteria 882
840 Ga0495674_0062290 3300047319 Bacteria 3249
841 Ga0495674_0229500 3300047319 Bacteria 1532
842 Ga0495672_0000013 3300047320 Bacteria 511827
843 Ga0495672_0000135 3300047320 Bacteria 110114
844 Ga0495672_0000353 3300047320 Bacteria 58748
845 Ga0495672_0000528 3300047320 Bacteria 43698
846 Ga0495672_0001258 3300047320 Bacteria 25430
847 Ga0495672_0001996 3300047320 Bacteria 19281
848 Ga0495672_0095397 3300047320 Bacteria 1624
849 Ga0495672_0101004 3300047320 Bacteria 1564
850 Ga0495676_0000939 3300047321 Bacteria 24462
851 Ga0495676_0055687 3300047321 Bacteria 3134
852 Ga0495676_0077678 3300047321 Bacteria 2531
853 Ga0495676_0200840 3300047321 Bacteria 1385
854 Ga0495676_0449148 3300047321 Bacteria 851
855 Ga0495676_0518134 3300047321 Bacteria 781
856 Ga0495676_0929680 3300047321 Bacteria 556
857 Ga0495680_0005612 3300047322 Bacteria 11759
858 Ga0495680_0049238 3300047322 Bacteria 3301
859 Ga0495680_0571586 3300047322 Bacteria 759
860 Ga0495680_0740254 3300047322 Bacteria 646
861 Ga0495683_0000589 3300047323 Bacteria 27334
862 Ga0495683_0003280 3300047323 Bacteria 9460
863 Ga0495683_0016121 3300047323 Bacteria 3880
864 Ga0495683_0021467 3300047323 Bacteria 3327
865 Ga0495683_0035656 3300047323 Bacteria 2528
866 Ga0495683_0046561 3300047323 Bacteria 2176
867 Ga0495683_0176315 3300047323 Bacteria 979
868 Ga0495683_0184900 3300047323 Bacteria 949
869 Ga0495687_000030 3300047443 Bacteria 279992
870 Ga0495687_000120 3300047443 Bacteria 120987
871 Ga0495687_000426 3300047443 Bacteria 51993
872 Ga0495687_001506 3300047443 Bacteria 21224
873 Ga0495687_002456 3300047443 Bacteria 14835
874 Ga0495687_003056 3300047443 Bacteria 12554
875 Ga0495687_004675 3300047443 Bacteria 9129
876 Ga0495687_013218 3300047443 Bacteria 4321
877 Ga0495687_021117 3300047443 Bacteria 3159
878 Ga0495687_171105 3300047443 Bacteria 719
879 Ga0495687_250113 3300047443 Bacteria 529
880 Ga0495675_0019028 3300047444 Bacteria 4361
881 Ga0495675_0019609 3300047444 Bacteria 4295
882 Ga0495675_0029982 3300047444 Bacteria 3470
883 Ga0495675_0166557 3300047444 Bacteria 1355
884 Ga0495677_0000051 3300047445 Bacteria 67038
885 Ga0495677_0000394 3300047445 Bacteria 18658
886 Ga0495677_0002953 3300047445 Bacteria 6611
887 Ga0495677_0003486 3300047445 Bacteria 6102
888 Ga0495677_0003739 3300047445 Bacteria 5887
889 Ga0495677_0004721 3300047445 Bacteria 5194
890 Ga0495677_0005793 3300047445 Bacteria 4674
891 Ga0495677_0006236 3300047445 Bacteria 4503
892 Ga0495677_0013074 3300047445 Bacteria 3020
893 Ga0495677_0023577 3300047445 Bacteria 2233
894 Ga0495677_0027436 3300047445 Bacteria 2066
895 Ga0495677_0093816 3300047445 Bacteria 1132
896 Ga0495677_0191116 3300047445 Bacteria 795
897 Ga0495679_003087 3300047446 Bacteria 8167
898 Ga0495679_004935 3300047446 Bacteria 6017
899 Ga0495679_006008 3300047446 Bacteria 5303
900 Ga0495679_011743 3300047446 Bacteria 3365
901 Ga0495679_012423 3300047446 Bacteria 3243
902 Ga0495679_028500 3300047446 Bacteria 1832
903 Ga0495685_006733 3300047447 Bacteria 3774
904 Ga0495685_008098 3300047447 Bacteria 3482
905 Ga0495685_018073 3300047447 Bacteria 2417
906 Ga0495685_128545 3300047447 Bacteria 829
907 Ga0495685_263599 3300047447 Bacteria 545
908 Ga0495673_0000179 3300047469 Bacteria 102128
909 Ga0495673_0000201 3300047469 Bacteria 92885
910 Ga0495673_0000248 3300047469 Bacteria 75224
911 Ga0495673_0006288 3300047469 Bacteria 6998
912 Ga0495681_0000343 3300047470 Bacteria 36522
913 Ga0495681_0001977 3300047470 Bacteria 14977
914 Ga0495681_0003190 3300047470 Bacteria 11440
915 Ga0495681_0003211 3300047470 Bacteria 11407
916 Ga0495681_0005351 3300047470 Bacteria 8610
917 Ga0495681_0011950 3300047470 Bacteria 5130
918 Ga0495681_0013051 3300047470 Bacteria 4847
919 Ga0495681_0019783 3300047470 Bacteria 3666
920 Ga0495681_0050805 3300047470 Bacteria 1952
921 Ga0495684_0513179 3300047471 Bacteria 822
922 Ga0495686_0000787 3300047472 Bacteria 41374
923 Ga0495686_0001233 3300047472 Bacteria 29192
924 Ga0495686_0086092 3300047472 Bacteria 1912
925 Ga0495686_0156464 3300047472 Bacteria 1334
926 Ga0495593_0002400 3300047673 Bacteria 11271
927 Ga0495593_0009906 3300047673 Bacteria 5525
928 Ga0495593_0089974 3300047673 Bacteria 1581
929 Ga0495602_0011139 3300048088 Bacteria 9310
930 Ga0495602_0013017 3300048088 Bacteria 8512
931 Ga0495602_0293503 3300048088 Bacteria 1192
932 Ga0495614_0010941 3300048089 Bacteria 3993
933 Ga0495614_0015178 3300048089 Bacteria 3360
934 Ga0495614_0033096 3300048089 Bacteria 2223
935 Ga0495614_0066516 3300048089 Bacteria 1550
936 Ga0495615_0013667 3300048090 Bacteria 1700
937 Ga0495615_0028460 3300048090 Bacteria 1319
938 Ga0495626_0000105 3300048091 Bacteria 109725
939 Ga0495626_0000227 3300048091 Bacteria 66048
940 Ga0495626_0001076 3300048091 Bacteria 23259
941 Ga0495626_0003064 3300048091 Bacteria 10969
942 Ga0495626_0005848 3300048091 Bacteria 7094
943 Ga0495626_0013033 3300048091 Bacteria 4335
944 Ga0495626_0014324 3300048091 Bacteria 4095
945 Ga0495626_0016490 3300048091 Bacteria 3750
946 Ga0495626_0020057 3300048091 Bacteria 3336
947 Ga0495626_0021325 3300048091 Bacteria 3215
948 Ga0495626_0038657 3300048091 Bacteria 2261
949 Ga0495626_0049867 3300048091 Bacteria 1936
950 Ga0495626_0075488 3300048091 Bacteria 1506
951 Ga0495626_0079359 3300048091 Bacteria 1460
952 Ga0495626_0114637 3300048091 Bacteria 1163
953 Ga0496100_0096448 3300048903 Bacteria 2029
954 Ga0496100_0183205 3300048903 Bacteria 1515
955 Ga0496100_0352534 3300048903 Bacteria 1112
956 Ga0496101_0038244 3300048904 Bacteria 3407
957 Ga0496101_0067537 3300048904 Bacteria 2611
958 Ga0496101_0118202 3300048904 Bacteria 2002
959 Ga0496102_0000262 3300048905 Bacteria 67362
960 Ga0496102_0017262 3300048905 Bacteria 6321
961 Ga0496102_0090127 3300048905 Bacteria 2837
962 Ga0496102_0251827 3300048905 Bacteria 1665
963 Ga0496102_0408371 3300048905 Bacteria 1276
964 Ga0496102_0504997 3300048905 Bacteria 1131
965 Ga0496102_0724369 3300048905 Bacteria 917
966 Ga0496102_0738137 3300048905 Bacteria 907
967 Ga0496102_1044022 3300048905 Bacteria 737
968 Ga0496103_0002217 3300048906 Bacteria 12309
969 Ga0496103_0055053 3300048906 Bacteria 2466
970 Ga0496103_0092734 3300048906 Bacteria 1906
971 Ga0496103_0131357 3300048906 Bacteria 1599
972 Ga0496104_0132769 3300048907 Bacteria 2392
973 Ga0496104_0153232 3300048907 Bacteria 2212
974 Ga0496104_0600089 3300048907 Bacteria 1011
975 Ga0496105_0125922 3300048908 Bacteria 2112
976 Ga0496105_0203660 3300048908 Bacteria 1615
977 Ga0496105_0846445 3300048908 Bacteria 692
978 Ga0496106_0009261 3300048909 Bacteria 7276
979 Ga0496106_0680653 3300048909 Bacteria 821
980 Ga0496107_0028042 3300048910 Bacteria 4001
981 Ga0496107_0093520 3300048910 Bacteria 2198
982 Ga0496107_0242841 3300048910 Bacteria 1340
983 Ga0496107_0277264 3300048910 Bacteria 1248
984 Ga0496107_0669679 3300048910 Bacteria 764
985 Ga0496108_0866080 3300048911 Bacteria 777
986 Ga0496108_1416043 3300048911 Bacteria 581
987 Ga0496109_0040722 3300048912 Bacteria 4208
988 Ga0496110_0000161 3300048913 Bacteria 40531
989 Ga0496110_0026821 3300048913 Bacteria 4933
990 Ga0496110_0704741 3300048913 Bacteria 911
991 Ga0496110_1606104 3300048913 Bacteria 560
992 Ga0496111_0027384 3300048914 Bacteria 4032
993 Ga0496111_0262522 3300048914 Bacteria 1281
994 Ga0496112_1031582 3300048915 Bacteria 742
995 Ga0496112_1845907 3300048915 Bacteria 516
996 Ga0496113_0005723 3300048916 Bacteria 7787
997 Ga0496113_0181091 3300048916 Bacteria 1670
998 Ga0496113_0423500 3300048916 Bacteria 1069
999 Ga0496114_0055171 3300048917 Bacteria 3314
1000 Ga0496114_0067266 3300048917 Bacteria 3005
1001 Ga0496114_0192441 3300048917 Bacteria 1785
1002 Ga0496115_0262507 3300048918 Bacteria 1420
1003 Ga0496115_0414223 3300048918 Bacteria 1092
1004 Ga0496115_0470410 3300048918 Bacteria 1013
1005 Ga0496115_0943599 3300048918 Bacteria 663
1006 Ga0496115_1266225 3300048918 Bacteria 551
1007 Ga0496116_0041525 3300048919 Bacteria 3155
1008 Ga0496116_0122245 3300048919 Bacteria 1504
1009 Ga0496117_0000005 3300048920 Bacteria 777468
1010 Ga0496118_0000031 3300048921 Bacteria 339329
1011 Ga0496118_0479799 3300048921 Bacteria 624
1012 Ga0496120_0277337 3300048923 Bacteria 776
1013 Ga0496121_0046355 3300048924 Bacteria 3722
1014 Ga0496121_0175206 3300048924 Bacteria 1553
1015 Ga0496121_0314699 3300048924 Bacteria 1056
1016 Ga0496121_0423659 3300048924 Bacteria 865
1017 Ga0496122_0001099 3300048925 Bacteria 46763
1018 Ga0496122_0001947 3300048925 Bacteria 30965
1019 Ga0496122_0007607 3300048925 Bacteria 11975
1020 Ga0496122_0031225 3300048925 Bacteria 4439
1021 Ga0496122_0089331 3300048925 Bacteria 2107
1022 Ga0496122_0180567 3300048925 Bacteria 1259
1023 Ga0496122_0225217 3300048925 Bacteria 1072
1024 Ga0496122_0287744 3300048925 Bacteria 894
1025 Ga0496123_0001733 3300048926 Bacteria 28920
1026 Ga0496123_0004566 3300048926 Bacteria 14439
1027 Ga0496123_0007917 3300048926 Bacteria 9870
1028 Ga0496123_0043679 3300048926 Bacteria 3075
1029 Ga0496123_0334283 3300048926 Bacteria 710
1030 Ga0496123_0511613 3300048926 Bacteria 522
1031 Ga0496124_0005414 3300048927 Bacteria 14386
1032 Ga0496124_0006391 3300048927 Bacteria 12848
1033 Ga0496124_0060609 3300048927 Bacteria 3174
1034 Ga0496124_0086762 3300048927 Bacteria 2561
1035 Ga0496124_0151230 3300048927 Bacteria 1820
1036 Ga0496124_0171091 3300048927 Bacteria 1682
1037 Ga0496124_0222250 3300048927 Bacteria 1419
1038 Ga0496124_0233470 3300048927 Bacteria 1373
1039 Ga0496124_0292202 3300048927 Bacteria 1182
1040 Ga0496124_0347070 3300048927 Bacteria 1051
1041 Ga0496124_0433591 3300048927 Bacteria 901
1042 Ga0496124_0991766 3300048927 Bacteria 501
1043 Ga0496125_0000455 3300048928 Bacteria 73934
1044 Ga0496125_0012237 3300048928 Bacteria 8535
1045 Ga0496125_0097208 3300048928 Bacteria 2182
1046 Ga0496125_0116285 3300048928 Bacteria 1921
1047 Ga0496125_0423668 3300048928 Bacteria 770
1048 Ga0496126_0006579 3300048929 Bacteria 12945
1049 Ga0496126_0277926 3300048929 Bacteria 1388
1050 Ga0496126_0840827 3300048929 Bacteria 701
1051 Ga0501308_003575 3300049128 Bacteria 1448
1052 Ga0495678_000245 3300049459 Bacteria 60853
1053 Ga0495678_000323 3300049459 Bacteria 50951
1054 Ga0495678_001298 3300049459 Bacteria 20180
1055 Ga0495678_001366 3300049459 Bacteria 19457
1056 Ga0495678_004502 3300049459 Bacteria 8036
1057 Ga0495678_005660 3300049459 Bacteria 6811
1058 Ga0495678_006948 3300049459 Bacteria 5940
1059 Ga0495678_008989 3300049459 Bacteria 4990
1060 Ga0495682_0001159 3300049460 Bacteria 15145
1061 Ga0495682_0001815 3300049460 Bacteria 10740
1062 Ga0495682_0019708 3300049460 Bacteria 2535
1063 Ga0495682_0194581 3300049460 Bacteria 719
1064 Ga0501302_015336 3300049525 Bacteria 609
1065 Ga0501315_007394 3300049531 Bacteria 1250
1066 Ga0501316_061625 3300049532 Bacteria 556
1067 Ga0501036_0142862 3300049572 Bacteria 2019
1068 Ga0501214_022937 3300049659 Bacteria 807
1069 Ga0501217_109619 3300049661 Bacteria 792
1070 Ga0501222_007068 3300049662 Bacteria 1503
1071 Ga0501227_001380 3300049665 Bacteria 5447
1072 Ga0501249_025636 3300049679 Bacteria 1301
1073 Ga0501269_067515 3300049766 Bacteria 514
1074 Ga0501279_000387 3300049775 Bacteria 5836
1075 Ga0501279_004013 3300049775 Bacteria 1928
1076 Ga0501035_0003819 3300049822 Bacteria 14356
1077 Ga0501044_0028495 3300049823 Bacteria 5895
1078 nmdc:mga07m45_228798_c1 3300050496 Bacteria 1082
1079 Ga0495601_0016713 3300053077 Bacteria 4448
1080 Ga0500594_0019294 3300053118 Bacteria 1689
1081 Ga0500594_0034499 3300053118 Bacteria 1352
1082 Ga0500595_002580 3300053119 Bacteria 8850
1083 Ga0500618_000139 3300053125 Bacteria 60811
1084 Ga0500618_055938 3300053125 Bacteria 889
1085 Ga0500559_0322415 3300053136 Bacteria 724
1086 Ga0500573_0075029 3300053140 Bacteria 1926
1087 Ga0500574_002349 3300053141 Bacteria 3094
1088 Ga0500586_000201 3300053145 Bacteria 11570
1089 Ga0500619_000403 3300053154 Bacteria 7886
1090 Ga0587080_164725 3300059503 Bacteria 522
1091 Ga0587082_058213 3300059504 Bacteria 755
1092 Ga0587083_0193524 3300059505 Bacteria 577
1093 Ga0587088_033140 3300059508 Bacteria 935
1094 Ga0587091_143099 3300059511 Bacteria 601
1095 Ga0587067_076912 3300059640 Bacteria 731
1096 Ga0587068_003543 3300059641 Bacteria 2003
1097 Ga0466962_0091010 3300061719 Bacteria 1461
1098 Ga0466962_0359396 3300061719 Bacteria 726
1099 2511384918 2511231026 Bacteria 5225445
1100 2521560943 2521172590 Bacteria 5047645
1101 2553006172 2551306416 Bacteria 6152985
1102 2601667043 2600255292 Bacteria 6300551
1103 2643792047 2643221554 Bacteria 6603920
1104 2643799458 2643221556 Bacteria 7251154
1105 2644026968 2643221603 Bacteria 6147767
1106 2644216472 2643221638 Bacteria 6579467
1107 2644471548 2643221684 Bacteria 7145183
1108 2738826817 2738541297 Bacteria 6549566
1109 2739150614 2738541357 Bacteria 6549408
1110 2739192533 2738543003 Bacteria 6549560
1111 2739319010 2738543026 Bacteria 6549408
1112 2739337251 2738543029 Bacteria 6549249
1113 2765567372 2765235838 Bacteria 5445269
1114 2808985034 2808606386 Bacteria 4471946
1115 2809132175 2808606415 Bacteria 4576710
1116 2809145860 2808606418 Bacteria 6724496
1117 2809151799 2808606419 Bacteria 4576925
1118 2819543858 2818991436 Bacteria 5376622
1119 2819617328 2818991449 Bacteria 5518009
1120 2821135850 2821131069 Bacteria 6108407
1121 2839095286 2839094727 Bacteria 5534556
1122 2842712312 2842711865 Bacteria 7155354
1123 2852621915 2852618963 Bacteria 4577824
1124 2857549088 2857547612 Bacteria 6179999
1125 2857560827 2857558681 Bacteria 6617694
1126 2857568027 2857564685 Bacteria 6290584
1127 2884838227 2884836552 Bacteria 5219991
1128 2884854519 2884852848 Bacteria 5221161
1129 2885084349 2885080285 Bacteria 6355622
1130 2896159224 2896154374 Bacteria 5221518
1131 2904428834 2904424332 Bacteria 7633521
1132 2904442438 2904439833 Bacteria 5931679
1133 2904533705 2904530477 Bacteria 5876334
1134 2904586662 2904584206 Bacteria 6028872
1135 2904591524 2904589729 Bacteria 6113573
1136 2904602338 2904601388 Bacteria 5884906
1137 2919083337 2919079590 Bacteria 5946433
1138 2923514781 2923510766 Bacteria 5926163
1139 2928133713 2928130867 Bacteria 5467269
1140 2932416138 2932410948 Bacteria 6312192
1141 2932422186 2932416698 Bacteria 6315112
1142 8047676050 8047673197 Bacteria 7395230
1143 Ga0501207_006080
1144 JGI25162J39368_1000154
1145 JGI25154J39366_1001447
1146 JGI25158J39367_1007537
1147 JGI25163J39215_1002015
1148 JGI25164J39214_1007553
1149 JGI25152J39213_1000374
1150 JGI25150J39212_1001750
1151 JGI25150J39212_1006283
1152 JGI25159J45721_1007555
1153 JGI25159J45721_1011067
1154 JGI25159J45721_1037479
1155 JGI25165J46597_1000239
1156 JGI25153J46596_10002862
1157 rootH1_10109671
1158 rootH2_10061216
1159 rootL2_10011429
1160 rootL2_10107398
1161 JGI25160J50197_1063591
1162 JGI25160J50197_1063628
1163 JGI25161J50226_1001059
1164 JGI25161J50226_1013389
1165 Ga0055538_1000094
1166 Ga0055539_1000136
1167 Ga0055533_1000143
1168 Ga0055525_1000018
1169 Ga0055525_1000188
1170 Ga0055529_1000079
1171 Ga0055526_1000228
1172 Ga0055526_1000337
1173 Ga0055526_1017107
1174 Ga0055526_1022923
1175 Ga0055526_1072047
1176 Ga0055537_1009540
1177 Ga0055537_1041054
1178 Ga0055524_1004910
1179 Ga0055524_1013791
1180 Ga0055524_1040539
1181 Ga0055534_1005007
1182 Ga0055534_1018454
1183 Ga0055528_1001043
1184 Ga0055530_10011939
1185 Ga0055540_1097790
1186 Ga0055531_10026536
1187 Ga0055541_1000092
1188 Ga0055543_1003187
1189 Ga0055543_1042320
1190 Ga0055543_1042321
1191 Ga0065165_1000504
1192 Ga0065165_1001236
1193 Ga0065165_1004323
1194 Ga0065165_1046272
1195 Ga0065165_1048503
1196 Ga0065165_1092928
1197 Ga0065165_1092938
1198 Ga0070666_11076622
1199 Ga0070680_100126936
1200 Ga0070682_100005634
1201 Ga0070660_100074620
1202 Ga0070660_100278426
1203 Ga0070661_100077924
1204 Ga0070661_101311167
1205 Ga0070661_101590204
1206 Ga0070669_102017114
1207 Ga0070659_100067965
1208 Ga0070659_100311983
1209 Ga0070667_101358481
1210 Ga0070663_100075503
1211 Ga0070662_100345231
1212 Ga0070662_100392638
1213 Ga0070662_100770909
1214 Ga0070679_100961830
1215 Ga0068853_100177663
1216 Ga0068855_100046806
1217 Ga0068855_100378064
1218 Ga0068855_100551555
1219 Ga0070664_100077380
1220 Ga0070664_100113798
1221 Ga0070664_101244359
1222 Ga0068857_100753667
1223 Ga0068854_100621313
1224 Ga0068852_100171986
1225 Ga0068851_10598669
1226 Ga0075363_100407879
1227 Ga0075362_10038496
1228 Ga0068871_100080081
1229 Ga0068865_100162242
1230 Ga0068865_100497942
1231 Ga0079104_1016527
1232 Ga0105244_10000158
1233 Ga0105244_10001394
1234 Ga0105244_10037873
1235 Ga0105244_10078940
1236 Ga0105244_10347293
1237 Ga0105240_10374847
1238 Ga0105245_10791326
1239 Ga0105243_10048423
1240 Ga0105243_10490850
1241 Ga0105241_10033225
1242 Ga0105242_10028512
1243 Ga0105242_11309595
1244 Ga0105237_10160460
1245 Ga0105238_10608836
1246 Ga0105239_10655637
1247 Ga0105239_12334590
1248 Ga0105246_10481800
1249 Ga0157373_10126982
1250 Ga0157371_10000018
1251 Ga0157371_10472602
1252 Ga0157370_11199250
1253 Ga0157369_11409063
1254 Ga0157374_10603283
1255 Ga0157372_10391402
1256 Ga0157372_10402229
1257 Ga0182008_10070575
1258 Ga0182008_10109765
1259 Ga0182008_10126984
1260 Ga0182006_1000274
1261 Ga0182006_1064968
1262 Ga0182006_1264168
1263 Ga0182007_10000196
1264 Ga0182007_10000677
1265 Ga0182007_10003072
1266 Ga0182007_10046258
1267 Ga0182007_10058171
1268 Ga0182005_1000163
1269 Ga0182005_1000609
1270 Ga0163161_10114411
1271 Ga0163161_11193382
1272 Ga0209760_101883
1273 Ga0209436_101159
1274 Ga0209436_116762
1275 Ga0209436_123307
1276 Ga0209436_123308
1277 Ga0209784_100010
1278 Ga0209566_100008
1279 Ga0209674_100019
1280 Ga0209563_100011
1281 Ga0209563_100021
1282 Ga0207427_100342
1283 Ga0209437_100019
1284 Ga0209437_108314
1285 Ga0207425_1000021
1286 Ga0207425_1000223
1287 Ga0207425_1001942
1288 Ga0209646_1000068
1289 Ga0209677_100011
1290 Ga0209677_101881
1291 Ga0209148_1000444
1292 Ga0209129_1000020
1293 Ga0209233_1000025
1294 Ga0209565_1002894
1295 Ga0209565_1003269
1296 Ga0209565_1010191
1297 Ga0209565_1024551
1298 Ga0209565_1033739
1299 Ga0209565_1043693
1300 Ga0209455_1000070
1301 Ga0209673_1002575
1302 Ga0209130_1000290
1303 Ga0209130_1002175
1304 Ga0209130_1008439
1305 Ga0209130_1008440
1306 Ga0209675_1000650
1307 Ga0209675_1003691
1308 Ga0209025_1016392
1309 Ga0209564_1000027
1310 Ga0209564_1000047
1311 Ga0209564_1000780
1312 Ga0209564_1006698
1313 Ga0209758_1000077
1314 Ga0209758_1000322
1315 Ga0209050_1000050
1316 Ga0209050_1000795
1317 Ga0209256_1000674
1318 Ga0209256_1001001
1319 Ga0207426_1004227
1320 Ga0209051_1061051
1321 Ga0209257_1000075
1322 Ga0207656_10646801
1323 Ga0207655_1000710
1324 Ga0207655_1002319
1325 Ga0207655_1086484
1326 Ga0207705_10002781
1327 Ga0207705_11322993
1328 Ga0207654_10006595
1329 Ga0207671_10180112
1330 Ga0207657_11061112
1331 Ga0207649_10045679
1332 Ga0207652_10850560
1333 Ga0207690_10068168
1334 Ga0207690_10195044
1335 Ga0207706_10061786
1336 Ga0207686_10022336
1337 Ga0207686_10070390
1338 Ga0207709_10382338
1339 Ga0207704_10165429
1340 Ga0207691_10853426
1341 Ga0207679_10093428
1342 Ga0207679_10980492
1343 Ga0207667_10105571
1344 Ga0207667_10509631
1345 Ga0207640_10485763
1346 Ga0207658_11480760
1347 Ga0207677_12196999
1348 Ga0207639_11116337
1349 Ga0207674_10077146
1350 Ga0207698_10133842
1351 Ga0307515_10255477
1352 Ga0316178_1012872
1353 Ga0316181_1169117
1354 Ga0316182_1330858
1355 Ga0307408_100000531
1356 Ga0307408_100001492
1357 Ga0307408_100006732
1358 Ga0307408_100015316
1359 Ga0307408_100051823
1360 Ga0265314_10094322
1361 Ga0307412_10347881
1362 Ga0307412_11154384
1363 Ga0307412_12306728
1364 Ga0307416_100013187
1365 Ga0307414_10868918
1366 Ga0307414_11038412
1367 Ga0307411_12027951
1368 Ga0307415_100801850
1369 Ga0395899_0000218
1370 Ga0395899_0002301
1371 Ga0395899_0006313
1372 Ga0395899_0013563
1373 Ga0395899_0036338
1374 Ga0395899_0069707
1375 Ga0395899_0140162
1376 Ga0395899_0234819
1377 Ga0395899_0732024
1378 Ga0395900_0000556
1379 Ga0395900_0032092
1380 Ga0395900_0033288
1381 Ga0395900_0092370
1382 Ga0395900_0313396
1383 Ga0395900_0328641
1384 Ga0395900_0629166
1385 Ga0395900_0734644
1386 Ga0395900_0803915
1387 Ga0395898_0002707
1388 Ga0395898_0189446
1389 Ga0395898_0296605
1390 Ga0395898_0389534
1391 Ga0395898_1063524
1392 Ga0395905_0019147
1393 Ga0395905_0026672
1394 Ga0395905_0069822
1395 Ga0395905_0286641
1396 Ga0395905_0370524
1397 Ga0395905_0426607
1398 Ga0395905_0532113
1399 Ga0395905_0651648
1400 Ga0395905_0956674
1401 Ga0395905_1570587
1402 Ga0395901_0000187
1403 Ga0395901_0004253
1404 Ga0395901_0031790
1405 Ga0395901_0042000
1406 Ga0395901_0084078
1407 Ga0395901_0157570
1408 Ga0395901_0295087
1409 Ga0395901_0299859
1410 Ga0395901_1831590
1411 Ga0439439_0202133
1412 Ga0439453_0021371
1413 Ga0451835_0420587
1414 Ga0439442_042175
1415 Ga0439448_0002308
1416 Ga0439432_033330
1417 Ga0439450_002876
1418 Ga0439450_024308
1419 Ga0439455_0003663
1420 Ga0439455_0208254
1421 Ga0450911_006285
1422 Ga0450906_031340
1423 Ga0439458_0009946
1424 Ga0439458_0075281
1425 Ga0439458_0081481
1426 Ga0450893_0063576
1427 Ga0466969_0003319
1428 Ga0466969_0146066
1429 Ga0466969_0436272
1430 Ga0466969_0549261
1431 Ga0466965_0016066
1432 Ga0466965_0019483
1433 Ga0466965_0024620
1434 Ga0466965_0033961
1435 Ga0466965_0047290
1436 Ga0466966_0041777
1437 Ga0466966_0054553
1438 Ga0466966_0214580
1439 Ga0466966_0489661
1440 Ga0466966_0937321
1441 Ga0466961_0221272
1442 Ga0466961_0246900
1443 Ga0466963_0287666
1444 Ga0466963_0472565
1445 Ga0466964_0000936
1446 Ga0466964_0014020
1447 Ga0466964_0195866
1448 Ga0466971_0048867
1449 Ga0466971_0169432
1450 Ga0466971_0441304
1451 Ga0466968_0003542
1452 Ga0466968_0288341
1453 Ga0466968_0555984
1454 Ga0466957_0019220
1455 Ga0466957_0033031
1456 Ga0466957_0050188
1457 Ga0466957_0069129
1458 Ga0466960_0066746
1459 Ga0466960_0286449
1460 Ga0466959_0008127
1461 Ga0466959_0138774
1462 Ga0466959_0837381
1463 Ga0466958_0222781
1464 Ga0466958_0330913
1465 Ga0466967_0078926
1466 Ga0466967_0293135
1467 Ga0466967_1458691
1468 Ga0466967_1799542
1469 Ga0495617_000027
1470 Ga0495617_000284
1471 Ga0495617_002801
1472 Ga0495617_003312
1473 Ga0495627_000457
1474 Ga0495627_040483
1475 Ga0495627_054056
1476 Ga0495592_0011898
1477 Ga0495603_0000675
1478 Ga0495603_0025946
1479 Ga0495590_0000020
1480 Ga0495590_0000053
1481 Ga0495590_0001165
1482 Ga0495590_0001791
1483 Ga0495590_0009791
1484 Ga0495590_0020073
1485 Ga0495590_0021211
1486 Ga0495590_0038077
1487 Ga0495590_0327625
1488 Ga0495629_0001463
1489 Ga0495629_0003071
1490 Ga0495638_0000235
1491 Ga0495638_0019424
1492 Ga0495638_0030273
1493 Ga0495638_0088307
1494 Ga0495638_0313087
1495 Ga0495638_0374164
1496 Ga0495651_0006186
1497 Ga0495651_0156168
1498 Ga0495653_0000067
1499 Ga0495653_0000728
1500 Ga0495653_0002463
1501 Ga0495653_0015836
1502 Ga0495653_0267906
1503 Ga0495653_0717181
1504 Ga0495650_0000200
1505 Ga0495650_0000436
1506 Ga0495650_0000483
1507 Ga0495650_0000864
1508 Ga0495650_0000903
1509 Ga0495650_0007727
1510 Ga0495650_0008629
1511 Ga0495650_0010320
1512 Ga0495650_0120052
1513 Ga0495580_0169376
1514 Ga0495580_0186502
1515 Ga0495580_0203119
1516 Ga0495582_0012500
1517 Ga0495582_0023988
1518 Ga0495582_0082282
1519 Ga0495582_0086547
1520 Ga0495605_0000061
1521 Ga0495605_0000263
1522 Ga0495605_0000385
1523 Ga0495605_0005596
1524 Ga0495605_0020672
1525 Ga0495605_0033658
1526 Ga0495605_0037213
1527 Ga0495605_0039499
1528 Ga0495605_0070027
1529 Ga0495605_0139064
1530 Ga0495605_0336625
1531 Ga0495639_0037130
1532 Ga0495639_0115536
1533 Ga0495639_0180755
1534 Ga0495664_0351329
1535 Ga0495664_0568847
1536 Ga0495584_0000005
1537 Ga0495584_0000308
1538 Ga0495584_0001309
1539 Ga0495584_0002363
1540 Ga0495584_0012334
1541 Ga0495584_0016560
1542 Ga0495584_0021303
1543 Ga0495584_0061652
1544 Ga0495584_0062216
1545 Ga0495584_0067387
1546 Ga0495584_0120333
1547 Ga0495584_0139018
1548 Ga0495584_0511987
1549 Ga0495585_0000497
1550 Ga0495585_0000599
1551 Ga0495585_0001915
1552 Ga0495585_0001990
1553 Ga0495585_0002632
1554 Ga0495585_0006962
1555 Ga0495585_0010644
1556 Ga0495585_0041466
1557 Ga0495585_0043249
1558 Ga0495585_0060580
1559 Ga0495585_0068399
1560 Ga0495585_0100693
1561 Ga0495585_0125773
1562 Ga0495585_0129000
1563 Ga0495594_0001208
1564 Ga0495594_0005976
1565 Ga0495594_0006113
1566 Ga0495594_0069077
1567 Ga0495594_0136689
1568 Ga0495594_0314011
1569 Ga0495594_0474018
1570 Ga0495596_0002361
1571 Ga0495596_0003205
1572 Ga0495596_0006158
1573 Ga0495596_0009812
1574 Ga0495596_0027017
1575 Ga0495596_0035675
1576 Ga0495596_0037630
1577 Ga0495596_0050269
1578 Ga0495596_0060321
1579 Ga0495596_0076210
1580 Ga0495596_0245244
1581 Ga0495596_0383643
1582 Ga0495607_0000514
1583 Ga0495607_0001557
1584 Ga0495607_0002090
1585 Ga0495607_0003571
1586 Ga0495607_0003749
1587 Ga0495607_0003887
1588 Ga0495607_0004928
1589 Ga0495607_0005825
1590 Ga0495607_0006025
1591 Ga0495607_0050255
1592 Ga0495607_0087578
1593 Ga0495607_0122425
1594 Ga0495607_0278680
1595 Ga0495583_0000158
1596 Ga0495583_0000214
1597 Ga0495583_0000817
1598 Ga0495583_0000834
1599 Ga0495583_0000900
1600 Ga0495583_0007827
1601 Ga0495583_0009870
1602 Ga0495583_0037979
1603 Ga0495583_0060231
1604 Ga0495583_0223738
1605 Ga0495583_0392467
1606 Ga0495583_0397602
1607 Ga0495606_0000120
1608 Ga0495606_0000262
1609 Ga0495606_0000433
1610 Ga0495606_0002393
1611 Ga0495606_0002563
1612 Ga0495606_0003569
1613 Ga0495606_0007053
1614 Ga0495606_0020004
1615 Ga0495606_0020094
1616 Ga0495606_0057905
1617 Ga0495606_0081642
1618 Ga0495606_0119094
1619 Ga0495606_0134058
1620 Ga0495606_0136154
1621 Ga0495606_0201123
1622 Ga0495606_0549350
1623 Ga0495608_0002978
1624 Ga0495608_0012837
1625 Ga0495610_0000017
1626 Ga0495610_0002788
1627 Ga0495610_0003279
1628 Ga0495610_0003795
1629 Ga0495610_0072112
1630 Ga0495610_0154982
1631 Ga0495610_0239694
1632 Ga0495610_0247326
1633 Ga0495610_0289498
1634 Ga0495616_0000234
1635 Ga0495616_0001575
1636 Ga0495616_0003595
1637 Ga0495616_0007658
1638 Ga0495616_0011003
1639 Ga0495616_0011724
1640 Ga0495616_0019228
1641 Ga0495616_0026058
1642 Ga0495616_0031869
1643 Ga0495616_0046973
1644 Ga0495616_0075434
1645 Ga0495616_0075683
1646 Ga0495616_0411044
1647 Ga0495618_0020807
1648 Ga0495620_0001227
1649 Ga0495620_0140543
1650 Ga0495628_0000109
1651 Ga0495628_0002255
1652 Ga0495630_0006488
1653 Ga0495630_0024582
1654 Ga0495631_0000538
1655 Ga0495631_0002275
1656 Ga0495631_0002872
1657 Ga0495631_0003696
1658 Ga0495631_0003905
1659 Ga0495631_0004474
1660 Ga0495631_0005526
1661 Ga0495631_0007002
1662 Ga0495631_0029358
1663 Ga0495631_0041908
1664 Ga0495631_0053698
1665 Ga0495631_0071628
1666 Ga0495631_0075028
1667 Ga0495632_0000069
1668 Ga0495632_0000407
1669 Ga0495632_0000418
1670 Ga0495632_0001896
1671 Ga0495632_0014117
1672 Ga0495632_0014874
1673 Ga0495637_0000053
1674 Ga0495637_0000179
1675 Ga0495637_0007631
1676 Ga0495637_0121111
1677 Ga0495643_0001481
1678 Ga0495643_0001510
1679 Ga0495643_0002282
1680 Ga0495643_0003504
1681 Ga0495643_0003680
1682 Ga0495643_0026429
1683 Ga0495643_0035539
1684 Ga0495643_0041757
1685 Ga0495643_0088606
1686 Ga0495643_0127836
1687 Ga0495643_0276322
1688 Ga0495644_0002891
1689 Ga0495644_0010748
1690 Ga0495644_0012303
1691 Ga0495644_0023965
1692 Ga0495644_0201886
1693 Ga0495644_0446510
1694 Ga0495648_0000350
1695 Ga0495648_0000616
1696 Ga0495648_0002854
1697 Ga0495648_0003263
1698 Ga0495648_0006205
1699 Ga0495648_0009345
1700 Ga0495648_0010195
1701 Ga0495648_0011746
1702 Ga0495648_0020036
1703 Ga0495648_0044241
1704 Ga0495648_0046941
1705 Ga0495648_0047805
1706 Ga0495648_0052456
1707 Ga0495648_0058824
1708 Ga0495648_0097772
1709 Ga0495648_0204263
1710 Ga0495663_0035936
1711 Ga0495663_0306101
1712 Ga0495666_0000722
1713 Ga0495666_0014058
1714 Ga0495666_0218816
1715 Ga0495666_0456490
1716 Ga0495642_0000714
1717 Ga0495642_0008421
1718 Ga0495642_0010442
1719 Ga0495642_0010854
1720 Ga0495642_0012068
1721 Ga0495642_0013362
1722 Ga0495642_0024692
1723 Ga0495642_0055862
1724 Ga0495642_0067617
1725 Ga0495642_0071764
1726 Ga0495642_0095638
1727 Ga0495642_0147674
1728 Ga0495642_0196736
1729 Ga0495642_0387249
1730 Ga0495652_0021087
1731 Ga0495652_0021800
1732 Ga0495652_0033902
1733 Ga0495654_0000060
1734 Ga0495654_0002805
1735 Ga0495654_0007594
1736 Ga0495654_0011270
1737 Ga0495654_0035032
1738 Ga0495654_0163056
1739 Ga0495665_0010947
1740 Ga0495665_0066251
1741 Ga0495640_0009761
1742 Ga0495640_0322914
1743 Ga0495586_0003191
1744 Ga0495586_0005134
1745 Ga0495586_0014799
1746 Ga0495586_0269862
1747 Ga0495587_0007269
1748 Ga0495587_0051685
1749 Ga0495587_0103105
1750 Ga0495609_0000007
1751 Ga0495609_0001337
1752 Ga0495609_0001362
1753 Ga0495609_0001749
1754 Ga0495609_0002344
1755 Ga0495609_0004700
1756 Ga0495609_0013242
1757 Ga0495609_0014546
1758 Ga0495609_0019736
1759 Ga0495609_0025042
1760 Ga0495609_0036229
1761 Ga0495609_0040776
1762 Ga0495609_0101186
1763 Ga0495609_0143878
1764 Ga0495609_0344999
1765 Ga0495621_0165120
1766 Ga0495597_0000556
1767 Ga0495597_0001085
1768 Ga0495597_0001723
1769 Ga0495597_0002020
1770 Ga0495597_0002424
1771 Ga0495597_0025715
1772 Ga0495597_0038641
1773 Ga0495597_0054113
1774 Ga0495597_0075102
1775 Ga0495597_0080134
1776 Ga0495597_0252526
1777 Ga0495597_0300725
1778 Ga0495597_0363122
1779 Ga0495645_0041965
1780 Ga0495645_0074402
1781 Ga0495645_0397478
1782 Ga0495622_0000210
1783 Ga0495622_0000292
1784 Ga0495622_0008494
1785 Ga0495622_0115088
1786 Ga0495622_0139456
1787 Ga0495622_0142119
1788 Ga0495622_0257440
1789 Ga0495633_0000231
1790 Ga0495633_0001200
1791 Ga0495633_0001329
1792 Ga0495633_0002397
1793 Ga0495633_0002578
1794 Ga0495633_0003410
1795 Ga0495633_0009275
1796 Ga0495633_0010586
1797 Ga0495633_0012493
1798 Ga0495633_0014097
1799 Ga0495633_0017868
1800 Ga0495633_0023119
1801 Ga0495633_0038490
1802 Ga0495633_0047267
1803 Ga0495633_0085995
1804 Ga0495633_0102780
1805 Ga0495633_0161883
1806 Ga0495667_0245182
1807 Ga0495656_0024019
1808 Ga0495656_0166678
1809 Ga0495656_0215854
1810 Ga0495656_0521194
1811 Ga0495668_0000162
1812 Ga0495668_0000427
1813 Ga0495668_0000769
1814 Ga0495668_0001457
1815 Ga0495668_0001893
1816 Ga0495668_0002467
1817 Ga0495668_0002786
1818 Ga0495668_0002980
1819 Ga0495668_0008820
1820 Ga0495668_0023037
1821 Ga0495668_0038211
1822 Ga0495668_0038291
1823 Ga0495668_0040840
1824 Ga0495668_0070968
1825 Ga0495668_0073386
1826 Ga0495668_0126068
1827 Ga0495668_0581472
1828 Ga0495634_0006375
1829 Ga0495611_0003342
1830 Ga0495611_0005369
1831 Ga0495611_0006791
1832 Ga0495611_0017338
1833 Ga0495611_0023912
1834 Ga0495611_0025621
1835 Ga0495611_0039492
1836 Ga0495611_0064552
1837 Ga0495611_0312157
1838 Ga0495611_0315851
1839 Ga0495611_0426069
1840 Ga0495625_0001372
1841 Ga0495625_0001954
1842 Ga0495625_0003171
1843 Ga0495625_0003285
1844 Ga0495625_0029379
1845 Ga0495625_0049173
1846 Ga0495625_0058472
1847 Ga0495625_0068571
1848 Ga0495625_0201648
1849 Ga0495625_0216756
1850 Ga0495625_0275893
1851 Ga0495635_0000360
1852 Ga0495635_0109607
1853 Ga0495659_0001470
1854 Ga0495659_0140201
1855 Ga0495659_0260850
1856 Ga0495661_0000343
1857 Ga0495661_0000744
1858 Ga0495661_0000965
1859 Ga0495661_0003744
1860 Ga0495661_0004599
1861 Ga0495661_0004782
1862 Ga0495661_0006054
1863 Ga0495661_0006085
1864 Ga0495661_0008594
1865 Ga0495661_0014032
1866 Ga0495661_0017434
1867 Ga0495661_0017716
1868 Ga0495661_0019247
1869 Ga0495661_0023595
1870 Ga0495661_0037924
1871 Ga0495661_0051835
1872 Ga0495661_0059259
1873 Ga0495661_0141327
1874 Ga0495661_0219171
1875 Ga0495661_0248668
1876 Ga0495661_0318876
1877 Ga0495588_0000199
1878 Ga0495588_0005278
1879 Ga0495588_0007319
1880 Ga0495588_0009039
1881 Ga0495588_0014477
1882 Ga0495588_0019180
1883 Ga0495588_0021436
1884 Ga0495588_0024826
1885 Ga0495588_0057833
1886 Ga0495588_0074914
1887 Ga0495588_0309991
1888 Ga0495588_0642405
1889 Ga0495657_0223054
1890 Ga0495657_0336259
1891 Ga0495599_0009744
1892 Ga0495599_0103526
1893 Ga0495599_0223512
1894 Ga0495623_0007538
1895 Ga0495623_0009364
1896 Ga0495623_0010373
1897 Ga0495623_0038396
1898 Ga0495623_0062178
1899 Ga0495646_0050670
1900 Ga0495646_0110075
1901 Ga0495646_0250243
1902 Ga0495669_0000254
1903 Ga0495669_0006345
1904 Ga0495669_0006869
1905 Ga0495669_0010332
1906 Ga0495669_0020526
1907 Ga0495669_0049217
1908 Ga0495669_0088503
1909 Ga0495669_0594557
1910 Ga0495613_0026427
1911 Ga0495613_0114266
1912 Ga0495624_0056775
1913 Ga0495670_0002551
1914 Ga0495670_0006457
1915 Ga0495670_0008524
1916 Ga0495670_0014034
1917 Ga0495670_0014412
1918 Ga0495670_0021601
1919 Ga0495670_0027579
1920 Ga0495670_0050389
1921 Ga0495670_0070745
1922 Ga0495670_0074931
1923 Ga0495670_0133386
1924 Ga0495670_0173755
1925 Ga0495670_0197640
1926 Ga0495670_0802101
1927 Ga0495671_0000037
1928 Ga0495671_0000587
1929 Ga0495671_0001906
1930 Ga0495671_0012172
1931 Ga0495671_0012455
1932 Ga0495671_0045828
1933 Ga0495671_0132051
1934 Ga0495671_0142658
1935 Ga0495671_0152622
1936 Ga0495649_0004357
1937 Ga0495649_0011442
1938 Ga0495649_0030887
1939 Ga0495649_0037550
1940 Ga0495649_0047011
1941 Ga0495649_0116485
1942 Ga0495649_0197540
1943 Ga0495649_0205003
1944 Ga0495649_0206190
1945 Ga0495589_0000081
1946 Ga0495589_0000497
1947 Ga0495589_0005629
1948 Ga0495589_0011642
1949 Ga0495589_0015128
1950 Ga0495589_0019987
1951 Ga0495589_0051367
1952 Ga0495589_0081717
1953 Ga0495589_0209297
1954 Ga0495600_0004717
1955 Ga0495600_0005559
1956 Ga0495600_0158279
1957 Ga0495600_0272152
1958 Ga0495660_0000409
1959 Ga0495660_0007794
1960 Ga0495660_0011391
1961 Ga0495660_0040087
1962 Ga0495660_0053177
1963 Ga0495660_0118053
1964 Ga0495660_0146349
1965 Ga0495660_0182757
1966 Ga0495660_0202003
1967 Ga0495581_0040884
1968 Ga0495581_0044629
1969 Ga0495604_0004740
1970 Ga0495604_0019402
1971 Ga0495604_0024539
1972 Ga0495604_0026025
1973 Ga0495604_0038733
1974 Ga0495604_0076400
1975 Ga0495604_0506599
1976 Ga0495636_0028117
1977 Ga0495636_0060270
1978 Ga0495636_0099568
1979 Ga0495636_0100201
1980 Ga0495636_0172020
1981 Ga0495636_0214191
1982 Ga0495674_0062290
1983 Ga0495674_0229500
1984 Ga0495672_0000013
1985 Ga0495672_0000135
1986 Ga0495672_0000353
1987 Ga0495672_0000528
1988 Ga0495672_0001258
1989 Ga0495672_0001996
1990 Ga0495672_0095397
1991 Ga0495672_0101004
1992 Ga0495676_0000939
1993 Ga0495676_0055687
1994 Ga0495676_0077678
1995 Ga0495676_0200840
1996 Ga0495676_0449148
1997 Ga0495676_0518134
1998 Ga0495676_0929680
1999 Ga0495680_0005612
2000 Ga0495680_0049238
2001 Ga0495680_0571586
2002 Ga0495680_0740254
2003 Ga0495683_0000589
2004 Ga0495683_0003280
2005 Ga0495683_0016121
2006 Ga0495683_0021467
2007 Ga0495683_0035656
2008 Ga0495683_0046561
2009 Ga0495683_0176315
2010 Ga0495683_0184900
2011 Ga0495687_000030
2012 Ga0495687_000120
2013 Ga0495687_000426
2014 Ga0495687_001506
2015 Ga0495687_002456
2016 Ga0495687_003056
2017 Ga0495687_004675
2018 Ga0495687_013218
2019 Ga0495687_021117
2020 Ga0495687_171105
2021 Ga0495687_250113
2022 Ga0495675_0019028
2023 Ga0495675_0019609
2024 Ga0495675_0029982
2025 Ga0495675_0166557
2026 Ga0495677_0000051
2027 Ga0495677_0000394
2028 Ga0495677_0002953
2029 Ga0495677_0003486
2030 Ga0495677_0003739
2031 Ga0495677_0004721
2032 Ga0495677_0005793
2033 Ga0495677_0006236
2034 Ga0495677_0013074
2035 Ga0495677_0023577
2036 Ga0495677_0027436
2037 Ga0495677_0093816
2038 Ga0495677_0191116
2039 Ga0495679_003087
2040 Ga0495679_004935
2041 Ga0495679_006008
2042 Ga0495679_011743
2043 Ga0495679_012423
2044 Ga0495679_028500
2045 Ga0495685_006733
2046 Ga0495685_008098
2047 Ga0495685_018073
2048 Ga0495685_128545
2049 Ga0495685_263599
2050 Ga0495673_0000179
2051 Ga0495673_0000201
2052 Ga0495673_0000248
2053 Ga0495673_0006288
2054 Ga0495681_0000343
2055 Ga0495681_0001977
2056 Ga0495681_0003190
2057 Ga0495681_0003211
2058 Ga0495681_0005351
2059 Ga0495681_0011950
2060 Ga0495681_0013051
2061 Ga0495681_0019783
2062 Ga0495681_0050805
2063 Ga0495684_0513179
2064 Ga0495686_0000787
2065 Ga0495686_0001233
2066 Ga0495686_0086092
2067 Ga0495686_0156464
2068 Ga0495593_0002400
2069 Ga0495593_0009906
2070 Ga0495593_0089974
2071 Ga0495602_0011139
2072 Ga0495602_0013017
2073 Ga0495602_0293503
2074 Ga0495614_0010941
2075 Ga0495614_0015178
2076 Ga0495614_0033096
2077 Ga0495614_0066516
2078 Ga0495615_0013667
2079 Ga0495615_0028460
2080 Ga0495626_0000105
2081 Ga0495626_0000227
2082 Ga0495626_0001076
2083 Ga0495626_0003064
2084 Ga0495626_0005848
2085 Ga0495626_0013033
2086 Ga0495626_0014324
2087 Ga0495626_0016490
2088 Ga0495626_0020057
2089 Ga0495626_0021325
2090 Ga0495626_0038657
2091 Ga0495626_0049867
2092 Ga0495626_0075488
2093 Ga0495626_0079359
2094 Ga0495626_0114637
2095 Ga0496100_0096448
2096 Ga0496100_0183205
2097 Ga0496100_0352534
2098 Ga0496101_0038244
2099 Ga0496101_0067537
2100 Ga0496101_0118202
2101 Ga0496102_0000262
2102 Ga0496102_0017262
2103 Ga0496102_0090127
2104 Ga0496102_0251827
2105 Ga0496102_0408371
2106 Ga0496102_0504997
2107 Ga0496102_0724369
2108 Ga0496102_0738137
2109 Ga0496102_1044022
2110 Ga0496103_0002217
2111 Ga0496103_0055053
2112 Ga0496103_0092734
2113 Ga0496103_0131357
2114 Ga0496104_0132769
2115 Ga0496104_0153232
2116 Ga0496104_0600089
2117 Ga0496105_0125922
2118 Ga0496105_0203660
2119 Ga0496105_0846445
2120 Ga0496106_0009261
2121 Ga0496106_0680653
2122 Ga0496107_0028042
2123 Ga0496107_0093520
2124 Ga0496107_0242841
2125 Ga0496107_0277264
2126 Ga0496107_0669679
2127 Ga0496108_0866080
2128 Ga0496108_1416043
2129 Ga0496109_0040722
2130 Ga0496110_0000161
2131 Ga0496110_0026821
2132 Ga0496110_0704741
2133 Ga0496110_1606104
2134 Ga0496111_0027384
2135 Ga0496111_0262522
2136 Ga0496112_1031582
2137 Ga0496112_1845907
2138 Ga0496113_0005723
2139 Ga0496113_0181091
2140 Ga0496113_0423500
2141 Ga0496114_0055171
2142 Ga0496114_0067266
2143 Ga0496114_0192441
2144 Ga0496115_0262507
2145 Ga0496115_0414223
2146 Ga0496115_0470410
2147 Ga0496115_0943599
2148 Ga0496115_1266225
2149 Ga0496116_0041525
2150 Ga0496116_0122245
2151 Ga0496117_0000005
2152 Ga0496118_0000031
2153 Ga0496118_0479799
2154 Ga0496120_0277337
2155 Ga0496121_0046355
2156 Ga0496121_0175206
2157 Ga0496121_0314699
2158 Ga0496121_0423659
2159 Ga0496122_0001099
2160 Ga0496122_0001947
2161 Ga0496122_0007607
2162 Ga0496122_0031225
2163 Ga0496122_0089331
2164 Ga0496122_0180567
2165 Ga0496122_0225217
2166 Ga0496122_0287744
2167 Ga0496123_0001733
2168 Ga0496123_0004566
2169 Ga0496123_0007917
2170 Ga0496123_0043679
2171 Ga0496123_0334283
2172 Ga0496123_0511613
2173 Ga0496124_0005414
2174 Ga0496124_0006391
2175 Ga0496124_0060609
2176 Ga0496124_0086762
2177 Ga0496124_0151230
2178 Ga0496124_0171091
2179 Ga0496124_0222250
2180 Ga0496124_0233470
2181 Ga0496124_0292202
2182 Ga0496124_0347070
2183 Ga0496124_0433591
2184 Ga0496124_0991766
2185 Ga0496125_0000455
2186 Ga0496125_0012237
2187 Ga0496125_0097208
2188 Ga0496125_0116285
2189 Ga0496125_0423668
2190 Ga0496126_0006579
2191 Ga0496126_0277926
2192 Ga0496126_0840827
2193 Ga0501308_003575
2194 Ga0495678_000245
2195 Ga0495678_000323
2196 Ga0495678_001298
2197 Ga0495678_001366
2198 Ga0495678_004502
2199 Ga0495678_005660
2200 Ga0495678_006948
2201 Ga0495678_008989
2202 Ga0495682_0001159
2203 Ga0495682_0001815
2204 Ga0495682_0019708
2205 Ga0495682_0194581
2206 Ga0501302_015336
2207 Ga0501315_007394
2208 Ga0501316_061625
2209 Ga0501036_0142862
2210 Ga0501214_022937
2211 Ga0501217_109619
2212 Ga0501222_007068
2213 Ga0501227_001380
2214 Ga0501249_025636
2215 Ga0501269_067515
2216 Ga0501279_000387
2217 Ga0501279_004013
2218 Ga0501035_0003819
2219 Ga0501044_0028495
2220 nmdc:mga07m45_228798_c1
2221 Ga0495601_0016713
2222 Ga0500594_0019294
2223 Ga0500594_0034499
2224 Ga0500595_002580
2225 Ga0500618_000139
2226 Ga0500618_055938
2227 Ga0500559_0322415
2228 Ga0500573_0075029
2229 Ga0500574_002349
2230 Ga0500586_000201
2231 Ga0500619_000403
2232 Ga0587080_164725
2233 Ga0587082_058213
2234 Ga0587083_0193524
2235 Ga0587088_033140
2236 Ga0587091_143099
2237 Ga0587067_076912
2238 Ga0587068_003543
2239 Ga0466962_0091010
2240 Ga0466962_0359396
2241 2511384918
2242 2521560943
2243 2553006172
2244 2601667043
2245 2643792047
2246 2643799458
2247 2644026968
2248 2644216472
2249 2644471548
2250 2738826817
2251 2739150614
2252 2739192533
2253 2739319010
2254 2739337251
2255 2765567372
2256 2808985034
2257 2809132175
2258 2809145860
2259 2809151799
2260 2819543858
2261 2819617328
2262 2821135850
2263 2839095286
2264 2842712312
2265 2852621915
2266 2857549088
2267 2857560827
2268 2857568027
2269 2884838227
2270 2884854519
2271 2885084349
2272 2896159224
2273 2904428834
2274 2904442438
2275 2904533705
2276 2904586662
2277 2904591524
2278 2904602338
2279 2919083337
2280 2923514781
2281 2928133713
2282 2932416138
2283 2932422186
2284 8047676050

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01491

Frataxin_Cyay

Frataxin-like domain

17

121

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jpd-assembly1.cif.gz_A the structure of cyay from burkholderia cenocepacia 0.9427 1 107
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.9407 1 107
4jpd-assembly1.cif.gz_A the structure of cyay from burkholderia cenocepacia 0.9093 1 107
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.9066 1 107
3s5f-assembly1.cif.gz_A crystal structure of human frataxin variant w155f 0.8914 2 108
ID Description Score Start End Superfamily
4jpdA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9427 1 107 3.30.920.10
4jpdA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9093 1 107 3.30.920.10
af_Q54C45_74_193_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.88 2 105 3.30.920.10
af_I1JK59_72_191_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8749 1 107 3.30.920.10
af_Q59PA3_59_177_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8716 1 107 3.30.920.10
ID Description Score Start End GO Terms
AF-A0A2N6J8V1-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9968 1 108 GO:0005737
GO:0008199
GO:0016226
AF-A0A2N6J8V1-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9877 1 108 GO:0005737
GO:0008199
GO:0016226
AF-A0A1J5BCA9-F1-model_v4 Iron donor protein CyaY 0.9874 48 108 GO:0005737
GO:0008199
GO:0016226
AF-A0A6N9HH71-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9872 1 107 GO:0005829
GO:0008198
GO:0008199
GO:0016226
AF-A0A2U2I561-F1-model_v4 Iron-sulfur cluster assembly protein CyaY 0.9855 1 108 GO:0005829
GO:0008198
GO:0008199
GO:0016226

Map