F490730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1142 | 555 | 2284 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_17539_c1|nmdc:mga05p37_17539_c1_2631_3725 |
| Length | 364 |
| Sequence | MPMIIVGLCTFSGAAMAFKGQIEQGDFAMADTLGSMAKSICQSATLISSDGKVMAKPRKVIITCAVTGSIHTPSMSPHLPVTAQEIADGAIGAAEAGAAIVHLHARNPQDGRPDQTPEAFAPFLKVIKQRSNVVVNITTGGAPTMTAEERVRPAATFKPEVASLNMGTMNFGLYPMIPRYKGKFKYDWEEPYLENSKKGMFKNTFADIEYILTTCAGNGTRFEIECYDIGHLYTLRHFLDRGLVKPPLFVQSVFGILGGIGPHPEDVTMMKRTADRLLGDNYHWSVLGAGANQMRVAAIAAAMGGNVRVGMEDSLWIGAGKLAESNAQQVTQVRKILEGLGLDIATSDEAREILSLKGGDKVAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 20 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 21 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 22 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 247 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 259 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 260 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 263 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 264 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 265 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 295 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 300 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 301 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 302 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 303 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 306 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 307 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 308 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 309 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 314 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 317 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 393 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 394 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 395 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 396 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 397 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 427 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 440 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 441 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 442 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 443 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 444 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 446 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 447 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 449 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 451 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 452 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 453 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 454 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 455 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 456 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 457 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 458 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 459 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 460 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 461 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 462 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 463 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 464 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 465 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 466 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 467 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 468 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 469 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 470 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 471 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 472 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 473 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 474 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 475 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 476 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 477 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 478 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 479 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 480 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 481 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 482 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 483 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 484 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 485 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 486 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 487 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 488 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 489 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 490 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 491 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 492 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 493 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 494 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 495 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 496 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 497 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 498 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 499 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 500 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 501 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 502 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 503 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 504 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 505 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 506 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 507 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 508 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 509 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 510 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 511 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 512 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 513 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 514 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 515 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 516 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 517 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 518 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 519 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 520 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 521 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 522 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 523 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 524 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 525 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 526 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 527 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 528 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 529 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 530 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 531 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 532 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 533 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 534 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 535 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 536 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 537 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 538 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 539 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 540 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 541 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 542 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 543 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 544 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 545 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 546 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 547 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 548 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 549 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 550 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 551 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 552 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 553 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 554 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 555 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.54 |
| Metatranscriptomes | 0.18 |
| Isolates | 9.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.71 |
| Nodule | 6.57 |
| Rhizoplane | 5.95 |
| Rhizosphere | 82.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga05p37_17539_c1 | 3300050507 | Bacteria | 8643 |
| 2 | 2214761888 | 2209111006 | Bacteria | 2909 |
| 3 | ARSoilYngRDRAFT_c00482 | 3300000042 | Bacteria | 4731 |
| 4 | ARcpr5yngRDRAFT_c000072 | 3300000043 | Bacteria | 16816 |
| 5 | ARSoilOldRDRAFT_c000019 | 3300000044 | Bacteria | 37577 |
| 6 | ARCol0oldRDRAFT_c00632 | 3300000045 | Bacteria | 3095 |
| 7 | ARCol0yngRDRAFT_1000004 | 3300000652 | Bacteria | 52222 |
| 8 | JGI24032J14994_100387 | 3300001430 | Bacteria | 2319 |
| 9 | JGI24752J21851_1008276 | 3300001976 | Bacteria | 1354 |
| 10 | JGI24746J21847_1000147 | 3300001977 | Bacteria | 8859 |
| 11 | JGI24739J22299_10001284 | 3300001989 | Bacteria | 9444 |
| 12 | JGI24739J22299_10006478 | 3300001989 | Bacteria | 4417 |
| 13 | JGI24737J22298_10002058 | 3300001990 | Bacteria | 7196 |
| 14 | JGI24737J22298_10003740 | 3300001990 | Bacteria | 5356 |
| 15 | JGI24750J21931_1002783 | 3300002070 | Bacteria | 2101 |
| 16 | JGI24745J21846_1004824 | 3300002073 | Bacteria | 1455 |
| 17 | JGI24738J21930_10007502 | 3300002075 | Bacteria | 2513 |
| 18 | JGI24744J21845_10015405 | 3300002077 | Bacteria | 1527 |
| 19 | JGI24035J26624_1000276 | 3300002126 | Bacteria | 4800 |
| 20 | JGI24742J22300_10000106 | 3300002244 | Bacteria | 11917 |
| 21 | JGI25162J39368_1000085 | 3300002737 | Bacteria | 107722 |
| 22 | JGI25154J39366_1004383 | 3300002738 | Bacteria | 2553 |
| 23 | JGI25157J39369_1001112 | 3300002741 | Bacteria | 11957 |
| 24 | JGI25159J45721_1005770 | 3300002987 | Bacteria | 3830 |
| 25 | JGI25405J52794_10002175 | 3300003911 | Bacteria | 3340 |
| 26 | Ga0065165_1000381 | 3300005262 | Bacteria | 71865 |
| 27 | Ga0065716_1002577 | 3300005277 | Bacteria | 1660 |
| 28 | Ga0065704_10134743 | 3300005289 | Bacteria | 1585 |
| 29 | Ga0065712_10012403 | 3300005290 | Bacteria | 2271 |
| 30 | Ga0065712_10134279 | 3300005290 | Bacteria | 1514 |
| 31 | Ga0065715_10000492 | 3300005293 | Bacteria | 13012 |
| 32 | Ga0065707_10108638 | 3300005295 | Bacteria | 2502 |
| 33 | Ga0065707_10152149 | 3300005295 | Bacteria | 1646 |
| 34 | Ga0070658_10006079 | 3300005327 | Bacteria | 9790 |
| 35 | Ga0070658_10007539 | 3300005327 | Bacteria | 8780 |
| 36 | Ga0070658_10033078 | 3300005327 | Bacteria | 4159 |
| 37 | Ga0070676_10018740 | 3300005328 | Bacteria | 3840 |
| 38 | Ga0070683_100001872 | 3300005329 | Bacteria | 16425 |
| 39 | Ga0070683_100143088 | 3300005329 | Bacteria | 2265 |
| 40 | Ga0070683_100267073 | 3300005329 | Bacteria | 1627 |
| 41 | Ga0070690_100009881 | 3300005330 | Bacteria | 5536 |
| 42 | Ga0070690_100011634 | 3300005330 | Bacteria | 5152 |
| 43 | Ga0070670_100051478 | 3300005331 | Bacteria | 3537 |
| 44 | Ga0070670_100142780 | 3300005331 | Bacteria | 2071 |
| 45 | Ga0070670_100213692 | 3300005331 | Bacteria | 1677 |
| 46 | Ga0070670_100419587 | 3300005331 | Bacteria | 1183 |
| 47 | Ga0070670_100483759 | 3300005331 | Bacteria | 1099 |
| 48 | Ga0070677_10008296 | 3300005333 | Bacteria | 3490 |
| 49 | Ga0070677_10057974 | 3300005333 | Bacteria | 1589 |
| 50 | Ga0068869_100075238 | 3300005334 | Bacteria | 2508 |
| 51 | Ga0070666_10033282 | 3300005335 | Bacteria | 3410 |
| 52 | Ga0070666_10035602 | 3300005335 | Bacteria | 3302 |
| 53 | Ga0070680_100002868 | 3300005336 | Bacteria | 12797 |
| 54 | Ga0070680_100076261 | 3300005336 | Bacteria | 2759 |
| 55 | Ga0070680_100251639 | 3300005336 | Bacteria | 1494 |
| 56 | Ga0070682_100000695 | 3300005337 | Bacteria | 20200 |
| 57 | Ga0070682_100090544 | 3300005337 | Bacteria | 2000 |
| 58 | Ga0068868_100004036 | 3300005338 | Bacteria | 10230 |
| 59 | Ga0068868_100056301 | 3300005338 | Bacteria | 3105 |
| 60 | Ga0068868_100190261 | 3300005338 | Bacteria | 1706 |
| 61 | Ga0068868_100225707 | 3300005338 | Bacteria | 1569 |
| 62 | Ga0068868_100247739 | 3300005338 | Bacteria | 1499 |
| 63 | Ga0070660_100001014 | 3300005339 | Bacteria | 18890 |
| 64 | Ga0070660_100006040 | 3300005339 | Bacteria | 8372 |
| 65 | Ga0070660_100270239 | 3300005339 | Bacteria | 1390 |
| 66 | Ga0070689_100002731 | 3300005340 | Bacteria | 11575 |
| 67 | Ga0070689_100006121 | 3300005340 | Bacteria | 8293 |
| 68 | Ga0070689_100215246 | 3300005340 | Bacteria | 1574 |
| 69 | Ga0070691_10013966 | 3300005341 | Bacteria | 3684 |
| 70 | Ga0070687_100002464 | 3300005343 | Bacteria | 6952 |
| 71 | Ga0070687_100083047 | 3300005343 | Bacteria | 1753 |
| 72 | Ga0070661_100000081 | 3300005344 | Bacteria | 75382 |
| 73 | Ga0070661_100014181 | 3300005344 | Bacteria | 5613 |
| 74 | Ga0070668_100017049 | 3300005347 | Bacteria | 5434 |
| 75 | Ga0070668_100152766 | 3300005347 | Bacteria | 1868 |
| 76 | Ga0070669_100002322 | 3300005353 | Bacteria | 13763 |
| 77 | Ga0070675_100000240 | 3300005354 | Bacteria | 35499 |
| 78 | Ga0070671_100000154 | 3300005355 | Bacteria | 44924 |
| 79 | Ga0070671_100021816 | 3300005355 | Bacteria | 5230 |
| 80 | Ga0070671_100023570 | 3300005355 | Bacteria | 5039 |
| 81 | Ga0070674_100006119 | 3300005356 | Bacteria | 6993 |
| 82 | Ga0070673_100007045 | 3300005364 | Bacteria | 7375 |
| 83 | Ga0070673_100059784 | 3300005364 | Bacteria | 3017 |
| 84 | Ga0070673_100331342 | 3300005364 | Bacteria | 1347 |
| 85 | Ga0070688_100001905 | 3300005365 | Bacteria | 10468 |
| 86 | Ga0070688_100026190 | 3300005365 | Bacteria | 3462 |
| 87 | Ga0070659_100000267 | 3300005366 | Bacteria | 41199 |
| 88 | Ga0070659_100007610 | 3300005366 | Bacteria | 7873 |
| 89 | Ga0070659_100010913 | 3300005366 | Bacteria | 6703 |
| 90 | Ga0070659_100197060 | 3300005366 | Bacteria | 1657 |
| 91 | Ga0070667_100022893 | 3300005367 | Bacteria | 5180 |
| 92 | Ga0070667_100315931 | 3300005367 | Bacteria | 1409 |
| 93 | Ga0070703_10003896 | 3300005406 | Bacteria | 4226 |
| 94 | Ga0070714_100150374 | 3300005435 | Bacteria | 2098 |
| 95 | Ga0070714_100225914 | 3300005435 | Bacteria | 1723 |
| 96 | Ga0070714_100250124 | 3300005435 | Bacteria | 1639 |
| 97 | Ga0070714_100290711 | 3300005435 | Bacteria | 1521 |
| 98 | Ga0070714_100485269 | 3300005435 | Bacteria | 1177 |
| 99 | Ga0070713_100000381 | 3300005436 | Bacteria | 28351 |
| 100 | Ga0070713_100020065 | 3300005436 | Bacteria | 5116 |
| 101 | Ga0070710_10005621 | 3300005437 | Bacteria | 5967 |
| 102 | Ga0070710_10016551 | 3300005437 | Bacteria | 3755 |
| 103 | Ga0070710_10022539 | 3300005437 | Bacteria | 3295 |
| 104 | Ga0070710_10039215 | 3300005437 | Bacteria | 2606 |
| 105 | Ga0070711_100019336 | 3300005439 | Bacteria | 4368 |
| 106 | Ga0070711_100045069 | 3300005439 | Bacteria | 2997 |
| 107 | Ga0070711_100071213 | 3300005439 | Bacteria | 2449 |
| 108 | Ga0070705_100022183 | 3300005440 | Bacteria | 3389 |
| 109 | Ga0070705_100060393 | 3300005440 | Bacteria | 2248 |
| 110 | Ga0070700_100007981 | 3300005441 | Bacteria | 5747 |
| 111 | Ga0070694_100002780 | 3300005444 | Bacteria | 10387 |
| 112 | Ga0070663_100004180 | 3300005455 | Bacteria | 8442 |
| 113 | Ga0070663_100008652 | 3300005455 | Bacteria | 6273 |
| 114 | Ga0070663_100039989 | 3300005455 | Unclassified | 3280 |
| 115 | Ga0070663_100185458 | 3300005455 | Bacteria | 1616 |
| 116 | Ga0070663_100218735 | 3300005455 | Bacteria | 1494 |
| 117 | Ga0070678_100000466 | 3300005456 | Bacteria | 19307 |
| 118 | Ga0070678_100054156 | 3300005456 | Bacteria | 2921 |
| 119 | Ga0070662_100013331 | 3300005457 | Bacteria | 5469 |
| 120 | Ga0070662_100013532 | 3300005457 | Bacteria | 5430 |
| 121 | Ga0070662_100014065 | 3300005457 | Bacteria | 5336 |
| 122 | Ga0070662_100244223 | 3300005457 | Bacteria | 1441 |
| 123 | Ga0070681_10011001 | 3300005458 | Bacteria | 8944 |
| 124 | Ga0070681_10026535 | 3300005458 | Bacteria | 5822 |
| 125 | Ga0070681_10032324 | 3300005458 | Bacteria | 5251 |
| 126 | Ga0070681_10177839 | 3300005458 | Bacteria | 2049 |
| 127 | Ga0070681_10187431 | 3300005458 | Bacteria | 1989 |
| 128 | Ga0068867_100013497 | 3300005459 | Bacteria | 5786 |
| 129 | Ga0070685_10022962 | 3300005466 | Bacteria | 3408 |
| 130 | Ga0070685_10030759 | 3300005466 | Bacteria | 2994 |
| 131 | Ga0070685_10040191 | 3300005466 | Bacteria | 2661 |
| 132 | Ga0070685_10090239 | 3300005466 | Bacteria | 1853 |
| 133 | Ga0070685_10352483 | 3300005466 | Bacteria | 1006 |
| 134 | Ga0070679_100061423 | 3300005530 | Bacteria | 3745 |
| 135 | Ga0070679_100110736 | 3300005530 | Bacteria | 2732 |
| 136 | Ga0070684_100009261 | 3300005535 | Bacteria | 7750 |
| 137 | Ga0070684_100035555 | 3300005535 | Bacteria | 4264 |
| 138 | Ga0070684_100048346 | 3300005535 | Bacteria | 3690 |
| 139 | Ga0068853_100000018 | 3300005539 | Bacteria | 169680 |
| 140 | Ga0068853_100009694 | 3300005539 | Bacteria | 7766 |
| 141 | Ga0068853_100018128 | 3300005539 | Bacteria | 5822 |
| 142 | Ga0068853_100055702 | 3300005539 | Bacteria | 3408 |
| 143 | Ga0068853_100095001 | 3300005539 | Bacteria | 2628 |
| 144 | Ga0070672_100001847 | 3300005543 | Bacteria | 13222 |
| 145 | Ga0070686_100009029 | 3300005544 | Bacteria | 5590 |
| 146 | Ga0070695_100007070 | 3300005545 | Bacteria | 6651 |
| 147 | Ga0070695_100019487 | 3300005545 | Bacteria | 4131 |
| 148 | Ga0070695_100054062 | 3300005545 | Bacteria | 2583 |
| 149 | Ga0070696_100025756 | 3300005546 | Bacteria | 4000 |
| 150 | Ga0070696_100086725 | 3300005546 | Bacteria | 2223 |
| 151 | Ga0070693_100011440 | 3300005547 | Bacteria | 4469 |
| 152 | Ga0070665_100033061 | 3300005548 | Bacteria | 5204 |
| 153 | Ga0070665_100415575 | 3300005548 | Bacteria | 1354 |
| 154 | Ga0070704_100004531 | 3300005549 | Bacteria | 8025 |
| 155 | Ga0070704_100022446 | 3300005549 | Bacteria | 4107 |
| 156 | Ga0068855_100018700 | 3300005563 | Bacteria | 8331 |
| 157 | Ga0068855_100045702 | 3300005563 | Bacteria | 5178 |
| 158 | Ga0068855_100259486 | 3300005563 | Bacteria | 1936 |
| 159 | Ga0070664_100000139 | 3300005564 | Bacteria | 49134 |
| 160 | Ga0070664_100001002 | 3300005564 | Bacteria | 22163 |
| 161 | Ga0070664_100323895 | 3300005564 | Bacteria | 1397 |
| 162 | Ga0068857_100041010 | 3300005577 | Bacteria | 4104 |
| 163 | Ga0068857_100164926 | 3300005577 | Bacteria | 2012 |
| 164 | Ga0068854_100000042 | 3300005578 | Bacteria | 93095 |
| 165 | Ga0068854_100015350 | 3300005578 | Bacteria | 5071 |
| 166 | Ga0068854_100089811 | 3300005578 | Bacteria | 2284 |
| 167 | Ga0068856_100023460 | 3300005614 | Bacteria | 5998 |
| 168 | Ga0070702_100025374 | 3300005615 | Bacteria | 3175 |
| 169 | Ga0068852_100004985 | 3300005616 | Bacteria | 9446 |
| 170 | Ga0068852_100051947 | 3300005616 | Bacteria | 3521 |
| 171 | Ga0068852_100052341 | 3300005616 | Bacteria | 3509 |
| 172 | Ga0068852_100067068 | 3300005616 | Bacteria | 3136 |
| 173 | Ga0068852_100324084 | 3300005616 | Bacteria | 1497 |
| 174 | Ga0068852_100535761 | 3300005616 | Bacteria | 1170 |
| 175 | Ga0068859_100010808 | 3300005617 | Bacteria | 9190 |
| 176 | Ga0068859_100076391 | 3300005617 | Bacteria | 3390 |
| 177 | Ga0068859_100096718 | 3300005617 | Bacteria | 3005 |
| 178 | Ga0068859_100133270 | 3300005617 | Bacteria | 2557 |
| 179 | Ga0068859_100241281 | 3300005617 | Bacteria | 1896 |
| 180 | Ga0068864_100000139 | 3300005618 | Bacteria | 69907 |
| 181 | Ga0068864_100003922 | 3300005618 | Bacteria | 12254 |
| 182 | Ga0068864_100024286 | 3300005618 | Bacteria | 5098 |
| 183 | Ga0068864_100030575 | 3300005618 | Bacteria | 4565 |
| 184 | Ga0068864_100053453 | 3300005618 | Bacteria | 3484 |
| 185 | Ga0068866_10005476 | 3300005718 | Bacteria | 5240 |
| 186 | Ga0068866_10193249 | 3300005718 | Bacteria | 1211 |
| 187 | Ga0068861_100003710 | 3300005719 | Bacteria | 10192 |
| 188 | Ga0068861_100023937 | 3300005719 | Bacteria | 4410 |
| 189 | Ga0068870_10000157 | 3300005840 | Bacteria | 23872 |
| 190 | Ga0068870_10031956 | 3300005840 | Bacteria | 2671 |
| 191 | Ga0068863_100000674 | 3300005841 | Bacteria | 34508 |
| 192 | Ga0068863_100000769 | 3300005841 | Bacteria | 32199 |
| 193 | Ga0068863_100015953 | 3300005841 | Bacteria | 7204 |
| 194 | Ga0068863_100053128 | 3300005841 | Bacteria | 3839 |
| 195 | Ga0068863_100084214 | 3300005841 | Bacteria | 3014 |
| 196 | Ga0068858_100000107 | 3300005842 | Bacteria | 87216 |
| 197 | Ga0068858_100007301 | 3300005842 | Bacteria | 10703 |
| 198 | Ga0068858_100056802 | 3300005842 | Bacteria | 3617 |
| 199 | Ga0068860_100101946 | 3300005843 | Bacteria | 2738 |
| 200 | Ga0068860_100291285 | 3300005843 | Bacteria | 1597 |
| 201 | Ga0068860_100297307 | 3300005843 | Bacteria | 1581 |
| 202 | Ga0068862_100024990 | 3300005844 | Bacteria | 5014 |
| 203 | Ga0068862_100153278 | 3300005844 | Bacteria | 2052 |
| 204 | Ga0081455_10000059 | 3300005937 | Bacteria | 119148 |
| 205 | Ga0081455_10002427 | 3300005937 | Bacteria | 22238 |
| 206 | Ga0081539_10015684 | 3300005985 | Bacteria | 5485 |
| 207 | Ga0070717_10000161 | 3300006028 | Bacteria | 50633 |
| 208 | Ga0070717_10264242 | 3300006028 | Bacteria | 1523 |
| 209 | Ga0070717_10289620 | 3300006028 | Bacteria | 1454 |
| 210 | Ga0075365_10289910 | 3300006038 | Bacteria | 1151 |
| 211 | Ga0075363_100032141 | 3300006048 | Bacteria | 2724 |
| 212 | Ga0075364_10012857 | 3300006051 | Bacteria | 5134 |
| 213 | Ga0075432_10008600 | 3300006058 | Bacteria | 3484 |
| 214 | Ga0070715_10009422 | 3300006163 | Bacteria | 3441 |
| 215 | Ga0070716_100119805 | 3300006173 | Bacteria | 1645 |
| 216 | Ga0070712_100022489 | 3300006175 | Bacteria | 4154 |
| 217 | Ga0075362_10048252 | 3300006177 | Bacteria | 1899 |
| 218 | Ga0075369_10073687 | 3300006186 | Bacteria | 1506 |
| 219 | Ga0075427_10001329 | 3300006194 | Bacteria | 3172 |
| 220 | Ga0075366_10054571 | 3300006195 | Bacteria | 2373 |
| 221 | Ga0097621_100038788 | 3300006237 | Bacteria | 3823 |
| 222 | Ga0075370_10048661 | 3300006353 | Bacteria | 2402 |
| 223 | Ga0068871_100017953 | 3300006358 | Bacteria | 5367 |
| 224 | Ga0068871_100091354 | 3300006358 | Bacteria | 2537 |
| 225 | Ga0075428_100001505 | 3300006844 | Bacteria | 24947 |
| 226 | Ga0075430_100000070 | 3300006846 | Bacteria | 55805 |
| 227 | Ga0075431_100009121 | 3300006847 | Bacteria | 9948 |
| 228 | Ga0075433_10017583 | 3300006852 | Bacteria | 5928 |
| 229 | Ga0075434_100046801 | 3300006871 | Bacteria | 4292 |
| 230 | Ga0075434_100282465 | 3300006871 | Bacteria | 1679 |
| 231 | Ga0075429_100001029 | 3300006880 | Bacteria | 22286 |
| 232 | Ga0068865_100000131 | 3300006881 | Bacteria | 38862 |
| 233 | Ga0068865_100066350 | 3300006881 | Bacteria | 2545 |
| 234 | Ga0097620_100010810 | 3300006931 | Bacteria | 9190 |
| 235 | Ga0097620_100076390 | 3300006931 | Bacteria | 3390 |
| 236 | Ga0097620_100096709 | 3300006931 | Bacteria | 3005 |
| 237 | Ga0097620_100133268 | 3300006931 | Bacteria | 2557 |
| 238 | Ga0097620_100241280 | 3300006931 | Bacteria | 1896 |
| 239 | Ga0075435_100022284 | 3300007076 | Bacteria | 4886 |
| 240 | Ga0075435_100187428 | 3300007076 | Bacteria | 1750 |
| 241 | Ga0099794_10015192 | 3300007265 | Bacteria | 3393 |
| 242 | Ga0105244_10001072 | 3300009036 | Bacteria | 22803 |
| 243 | Ga0105240_10001685 | 3300009093 | Bacteria | 37448 |
| 244 | Ga0105240_10004942 | 3300009093 | Bacteria | 20044 |
| 245 | Ga0105240_10016520 | 3300009093 | Bacteria | 9991 |
| 246 | Ga0105240_10025053 | 3300009093 | Bacteria | 7852 |
| 247 | Ga0105240_10137083 | 3300009093 | Bacteria | 2930 |
| 248 | Ga0105240_10274444 | 3300009093 | Bacteria | 1940 |
| 249 | Ga0105240_10361389 | 3300009093 | Bacteria | 1644 |
| 250 | Ga0105240_10695389 | 3300009093 | Bacteria | 1110 |
| 251 | Ga0111539_10000138 | 3300009094 | Bacteria | 82968 |
| 252 | Ga0111539_10004385 | 3300009094 | Bacteria | 18464 |
| 253 | Ga0111539_10039247 | 3300009094 | Bacteria | 5708 |
| 254 | Ga0111539_10041584 | 3300009094 | Bacteria | 5525 |
| 255 | Ga0111539_10134101 | 3300009094 | Bacteria | 2900 |
| 256 | Ga0105245_10011704 | 3300009098 | Bacteria | 7635 |
| 257 | Ga0105245_10392756 | 3300009098 | Bacteria | 1384 |
| 258 | Ga0105247_10006310 | 3300009101 | Bacteria | 7348 |
| 259 | Ga0105247_10015808 | 3300009101 | Bacteria | 4517 |
| 260 | Ga0105247_10022803 | 3300009101 | Bacteria | 3771 |
| 261 | Ga0105247_10111510 | 3300009101 | Bacteria | 1761 |
| 262 | Ga0105247_10237907 | 3300009101 | Bacteria | 1239 |
| 263 | Ga0114129_10002312 | 3300009147 | Bacteria | 26434 |
| 264 | Ga0114129_10003950 | 3300009147 | Bacteria | 20934 |
| 265 | Ga0105243_10006299 | 3300009148 | Bacteria | 9170 |
| 266 | Ga0105243_10034798 | 3300009148 | Bacteria | 3903 |
| 267 | Ga0105243_10067549 | 3300009148 | Bacteria | 2878 |
| 268 | Ga0105241_10030880 | 3300009174 | Bacteria | 4007 |
| 269 | Ga0105241_10547417 | 3300009174 | Bacteria | 1038 |
| 270 | Ga0105242_10000964 | 3300009176 | Bacteria | 22474 |
| 271 | Ga0105242_10011160 | 3300009176 | Bacteria | 6903 |
| 272 | Ga0105242_10218094 | 3300009176 | Bacteria | 1703 |
| 273 | Ga0105248_10003045 | 3300009177 | Bacteria | 18601 |
| 274 | Ga0105248_10008262 | 3300009177 | Bacteria | 11437 |
| 275 | Ga0105248_10012777 | 3300009177 | Bacteria | 9265 |
| 276 | Ga0105248_10025646 | 3300009177 | Bacteria | 6555 |
| 277 | Ga0105248_10116434 | 3300009177 | Bacteria | 3014 |
| 278 | Ga0105248_10136825 | 3300009177 | Bacteria | 2763 |
| 279 | Ga0105248_10195579 | 3300009177 | Bacteria | 2278 |
| 280 | Ga0105248_10445223 | 3300009177 | Bacteria | 1459 |
| 281 | Ga0105237_10000640 | 3300009545 | Bacteria | 48895 |
| 282 | Ga0105237_10018866 | 3300009545 | Bacteria | 7132 |
| 283 | Ga0105237_10088192 | 3300009545 | Bacteria | 3092 |
| 284 | Ga0105237_10768790 | 3300009545 | Bacteria | 970 |
| 285 | Ga0105238_10001491 | 3300009551 | Bacteria | 23486 |
| 286 | Ga0105238_10034621 | 3300009551 | Bacteria | 5138 |
| 287 | Ga0105238_10125581 | 3300009551 | Bacteria | 2545 |
| 288 | Ga0105238_10165229 | 3300009551 | Bacteria | 2189 |
| 289 | Ga0105249_10001029 | 3300009553 | Bacteria | 24663 |
| 290 | Ga0105249_10011087 | 3300009553 | Bacteria | 7919 |
| 291 | Ga0105249_10024785 | 3300009553 | Bacteria | 5394 |
| 292 | Ga0105249_10462987 | 3300009553 | Bacteria | 1308 |
| 293 | Ga0105239_10055043 | 3300010375 | Bacteria | 4363 |
| 294 | Ga0105239_10153419 | 3300010375 | Bacteria | 2571 |
| 295 | Ga0105246_10000702 | 3300011119 | Bacteria | 18882 |
| 296 | Ga0105246_10024538 | 3300011119 | Bacteria | 3918 |
| 297 | Ga0157373_10040674 | 3300013100 | Bacteria | 3326 |
| 298 | Ga0157373_10079535 | 3300013100 | Bacteria | 2312 |
| 299 | Ga0157371_10016173 | 3300013102 | Bacteria | 5575 |
| 300 | Ga0157371_10030802 | 3300013102 | Bacteria | 3867 |
| 301 | Ga0157371_10057504 | 3300013102 | Bacteria | 2758 |
| 302 | Ga0157371_10058497 | 3300013102 | Bacteria | 2734 |
| 303 | Ga0157370_10011601 | 3300013104 | Bacteria | 9199 |
| 304 | Ga0157370_10082608 | 3300013104 | Bacteria | 3022 |
| 305 | Ga0157370_10277280 | 3300013104 | Bacteria | 1549 |
| 306 | Ga0157369_10004311 | 3300013105 | Bacteria | 16803 |
| 307 | Ga0157369_10082715 | 3300013105 | Bacteria | 3435 |
| 308 | Ga0157369_10348360 | 3300013105 | Bacteria | 1538 |
| 309 | Ga0157374_10000671 | 3300013296 | Bacteria | 30150 |
| 310 | Ga0157378_10078192 | 3300013297 | Bacteria | 2984 |
| 311 | Ga0157378_10096085 | 3300013297 | Bacteria | 2700 |
| 312 | Ga0163162_10083846 | 3300013306 | Bacteria | 3261 |
| 313 | Ga0163162_10092055 | 3300013306 | Bacteria | 3115 |
| 314 | Ga0163162_10185831 | 3300013306 | Bacteria | 2205 |
| 315 | Ga0157372_10006177 | 3300013307 | Bacteria | 12735 |
| 316 | Ga0157372_10779641 | 3300013307 | Bacteria | 1111 |
| 317 | Ga0157375_10002753 | 3300013308 | Bacteria | 15202 |
| 318 | Ga0157375_10002908 | 3300013308 | Bacteria | 14847 |
| 319 | Ga0157375_10037714 | 3300013308 | Bacteria | 4633 |
| 320 | Ga0157375_10114363 | 3300013308 | Bacteria | 2800 |
| 321 | Ga0157375_10391285 | 3300013308 | Bacteria | 1557 |
| 322 | Ga0163163_10008084 | 3300014325 | Bacteria | 9320 |
| 323 | Ga0163163_10138133 | 3300014325 | Bacteria | 2479 |
| 324 | Ga0163163_10175574 | 3300014325 | Bacteria | 2189 |
| 325 | Ga0157380_10005886 | 3300014326 | Bacteria | 8579 |
| 326 | Ga0157380_10059733 | 3300014326 | Bacteria | 3044 |
| 327 | Ga0157377_10106460 | 3300014745 | Bacteria | 1679 |
| 328 | Ga0157379_10000345 | 3300014968 | Bacteria | 37352 |
| 329 | Ga0157379_10025251 | 3300014968 | Bacteria | 5277 |
| 330 | Ga0157379_10051050 | 3300014968 | Bacteria | 3694 |
| 331 | Ga0157376_10006980 | 3300014969 | Bacteria | 8010 |
| 332 | Ga0157376_10021144 | 3300014969 | Bacteria | 5050 |
| 333 | Ga0163161_10015507 | 3300017792 | Bacteria | 5313 |
| 334 | Ga0163161_10020141 | 3300017792 | Bacteria | 4678 |
| 335 | Ga0163161_10150364 | 3300017792 | Bacteria | 1769 |
| 336 | Ga0197907_10955117 | 3300020069 | Bacteria | 1142 |
| 337 | Ga0206353_11093575 | 3300020082 | Bacteria | 3037 |
| 338 | Ga0213872_10054048 | 3300021361 | Bacteria | 1821 |
| 339 | Ga0209026_1000247 | 3300025250 | Bacteria | 68920 |
| 340 | Ga0209759_1000585 | 3300025256 | Bacteria | 35847 |
| 341 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 342 | Ga0207666_1000069 | 3300025271 | Bacteria | 17953 |
| 343 | Ga0209130_1000127 | 3300025284 | Bacteria | 123652 |
| 344 | Ga0207673_1000178 | 3300025290 | Bacteria | 6339 |
| 345 | Ga0209758_1000257 | 3300025297 | Bacteria | 106321 |
| 346 | Ga0207426_1009253 | 3300025302 | Bacteria | 3914 |
| 347 | Ga0207697_10000390 | 3300025315 | Bacteria | 24639 |
| 348 | Ga0207655_1000250 | 3300025728 | Bacteria | 86806 |
| 349 | Ga0207682_10000048 | 3300025893 | Bacteria | 50998 |
| 350 | Ga0207692_10018051 | 3300025898 | Bacteria | 3159 |
| 351 | Ga0207642_10003255 | 3300025899 | Bacteria | 5106 |
| 352 | Ga0207642_10135069 | 3300025899 | Bacteria | 1293 |
| 353 | Ga0207710_10004679 | 3300025900 | Bacteria | 5938 |
| 354 | Ga0207710_10005833 | 3300025900 | Bacteria | 5281 |
| 355 | Ga0207710_10026924 | 3300025900 | Bacteria | 2487 |
| 356 | Ga0207710_10048485 | 3300025900 | Bacteria | 1901 |
| 357 | Ga0207688_10001496 | 3300025901 | Bacteria | 12264 |
| 358 | Ga0207688_10047650 | 3300025901 | Bacteria | 2393 |
| 359 | Ga0207680_10032418 | 3300025903 | Bacteria | 2970 |
| 360 | Ga0207647_10006274 | 3300025904 | Bacteria | 8656 |
| 361 | Ga0207647_10007330 | 3300025904 | Bacteria | 7977 |
| 362 | Ga0207647_10012466 | 3300025904 | Bacteria | 5917 |
| 363 | Ga0207699_10003447 | 3300025906 | Bacteria | 7538 |
| 364 | Ga0207699_10074109 | 3300025906 | Bacteria | 2090 |
| 365 | Ga0207699_10108599 | 3300025906 | Bacteria | 1774 |
| 366 | Ga0207645_10012526 | 3300025907 | Bacteria | 5751 |
| 367 | Ga0207645_10097383 | 3300025907 | Bacteria | 1896 |
| 368 | Ga0207643_10000581 | 3300025908 | Bacteria | 23180 |
| 369 | Ga0207705_10022458 | 3300025909 | Unclassified | 4498 |
| 370 | Ga0207705_10026050 | 3300025909 | Bacteria | 4173 |
| 371 | Ga0207654_10004716 | 3300025911 | Bacteria | 6899 |
| 372 | Ga0207654_10016465 | 3300025911 | Bacteria | 3850 |
| 373 | Ga0207707_10016616 | 3300025912 | Bacteria | 6416 |
| 374 | Ga0207707_10030130 | 3300025912 | Bacteria | 4745 |
| 375 | Ga0207695_10013062 | 3300025913 | Bacteria | 9915 |
| 376 | Ga0207695_10027399 | 3300025913 | Bacteria | 6345 |
| 377 | Ga0207695_10102424 | 3300025913 | Bacteria | 2856 |
| 378 | Ga0207695_10134010 | 3300025913 | Bacteria | 2432 |
| 379 | Ga0207671_10000566 | 3300025914 | Bacteria | 49574 |
| 380 | Ga0207671_10050362 | 3300025914 | Bacteria | 3084 |
| 381 | Ga0207693_10010010 | 3300025915 | Bacteria | 7706 |
| 382 | Ga0207693_10105498 | 3300025915 | Bacteria | 2210 |
| 383 | Ga0207663_10078086 | 3300025916 | Bacteria | 2157 |
| 384 | Ga0207660_10000192 | 3300025917 | Bacteria | 38947 |
| 385 | Ga0207660_10015932 | 3300025917 | Bacteria | 4970 |
| 386 | Ga0207662_10000647 | 3300025918 | Bacteria | 15732 |
| 387 | Ga0207662_10103926 | 3300025918 | Bacteria | 1763 |
| 388 | Ga0207662_10159669 | 3300025918 | Bacteria | 1439 |
| 389 | Ga0207657_10020011 | 3300025919 | Bacteria | 6339 |
| 390 | Ga0207657_10025383 | 3300025919 | Bacteria | 5466 |
| 391 | Ga0207657_10205632 | 3300025919 | Bacteria | 1582 |
| 392 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 393 | Ga0207649_10000141 | 3300025920 | Bacteria | 60047 |
| 394 | Ga0207652_10004519 | 3300025921 | Bacteria | 11293 |
| 395 | Ga0207652_10109875 | 3300025921 | Bacteria | 2445 |
| 396 | Ga0207652_10137010 | 3300025921 | Bacteria | 2187 |
| 397 | Ga0207646_10294044 | 3300025922 | Bacteria | 1467 |
| 398 | Ga0207681_10000359 | 3300025923 | Bacteria | 32485 |
| 399 | Ga0207694_10104922 | 3300025924 | Bacteria | 2243 |
| 400 | Ga0207694_10113783 | 3300025924 | Bacteria | 2155 |
| 401 | Ga0207694_10203467 | 3300025924 | Bacteria | 1611 |
| 402 | Ga0207650_10004853 | 3300025925 | Bacteria | 9185 |
| 403 | Ga0207650_10084770 | 3300025925 | Bacteria | 2409 |
| 404 | Ga0207650_10145943 | 3300025925 | Bacteria | 1863 |
| 405 | Ga0207659_10000052 | 3300025926 | Bacteria | 79692 |
| 406 | Ga0207659_10128444 | 3300025926 | Bacteria | 1952 |
| 407 | Ga0207687_10000097 | 3300025927 | Bacteria | 64441 |
| 408 | Ga0207687_10069093 | 3300025927 | Bacteria | 2518 |
| 409 | Ga0207664_10235893 | 3300025929 | Bacteria | 1591 |
| 410 | Ga0207664_10253201 | 3300025929 | Bacteria | 1537 |
| 411 | Ga0207664_10278537 | 3300025929 | Bacteria | 1467 |
| 412 | Ga0207664_10367927 | 3300025929 | Bacteria | 1275 |
| 413 | Ga0207644_10000225 | 3300025931 | Bacteria | 38964 |
| 414 | Ga0207690_10000278 | 3300025932 | Bacteria | 36244 |
| 415 | Ga0207690_10000726 | 3300025932 | Bacteria | 21264 |
| 416 | Ga0207690_10023290 | 3300025932 | Bacteria | 3864 |
| 417 | Ga0207690_10222593 | 3300025932 | Bacteria | 1445 |
| 418 | Ga0207706_10010711 | 3300025933 | Bacteria | 8374 |
| 419 | Ga0207706_10017295 | 3300025933 | Bacteria | 6497 |
| 420 | Ga0207706_10022229 | 3300025933 | Bacteria | 5692 |
| 421 | Ga0207706_10356671 | 3300025933 | Bacteria | 1271 |
| 422 | Ga0207686_10000850 | 3300025934 | Bacteria | 18532 |
| 423 | Ga0207686_10003977 | 3300025934 | Bacteria | 7932 |
| 424 | Ga0207686_10005384 | 3300025934 | Bacteria | 6860 |
| 425 | Ga0207686_10025318 | 3300025934 | Bacteria | 3449 |
| 426 | Ga0207686_10064705 | 3300025934 | Bacteria | 2329 |
| 427 | Ga0207709_10000987 | 3300025935 | Bacteria | 21246 |
| 428 | Ga0207709_10014956 | 3300025935 | Bacteria | 4295 |
| 429 | Ga0207709_10037377 | 3300025935 | Bacteria | 2885 |
| 430 | Ga0207709_10151433 | 3300025935 | Bacteria | 1607 |
| 431 | Ga0207709_10325588 | 3300025935 | Bacteria | 1152 |
| 432 | Ga0207670_10000781 | 3300025936 | Bacteria | 16732 |
| 433 | Ga0207670_10018257 | 3300025936 | Bacteria | 4260 |
| 434 | Ga0207669_10000168 | 3300025937 | Bacteria | 30867 |
| 435 | Ga0207669_10179822 | 3300025937 | Bacteria | 1515 |
| 436 | Ga0207669_10287974 | 3300025937 | Bacteria | 1242 |
| 437 | Ga0207704_10000704 | 3300025938 | Bacteria | 14739 |
| 438 | Ga0207704_10029602 | 3300025938 | Bacteria | 3057 |
| 439 | Ga0207665_10000248 | 3300025939 | Bacteria | 37228 |
| 440 | Ga0207665_10024638 | 3300025939 | Bacteria | 3968 |
| 441 | Ga0207665_10117977 | 3300025939 | Bacteria | 1872 |
| 442 | Ga0207691_10003348 | 3300025940 | Bacteria | 15596 |
| 443 | Ga0207691_10127690 | 3300025940 | Bacteria | 2248 |
| 444 | Ga0207691_10228158 | 3300025940 | Bacteria | 1613 |
| 445 | Ga0207691_10294460 | 3300025940 | Bacteria | 1395 |
| 446 | Ga0207711_10006180 | 3300025941 | Bacteria | 10120 |
| 447 | Ga0207711_10036231 | 3300025941 | Bacteria | 4185 |
| 448 | Ga0207711_10050078 | 3300025941 | Bacteria | 3576 |
| 449 | Ga0207711_10092772 | 3300025941 | Bacteria | 2658 |
| 450 | Ga0207711_10112749 | 3300025941 | Bacteria | 2420 |
| 451 | Ga0207711_10115044 | 3300025941 | Bacteria | 2396 |
| 452 | Ga0207711_10182894 | 3300025941 | Bacteria | 1907 |
| 453 | Ga0207689_10012368 | 3300025942 | Bacteria | 7300 |
| 454 | Ga0207689_10066148 | 3300025942 | Bacteria | 2973 |
| 455 | Ga0207661_10000143 | 3300025944 | Bacteria | 45329 |
| 456 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 457 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 458 | Ga0207679_10244154 | 3300025945 | Bacteria | 1523 |
| 459 | Ga0207667_10031667 | 3300025949 | Bacteria | 5707 |
| 460 | Ga0207667_10039655 | 3300025949 | Bacteria | 5019 |
| 461 | Ga0207667_10186756 | 3300025949 | Bacteria | 2127 |
| 462 | Ga0207667_10202498 | 3300025949 | Bacteria | 2036 |
| 463 | Ga0207651_10000080 | 3300025960 | Bacteria | 42826 |
| 464 | Ga0207651_10041829 | 3300025960 | Bacteria | 3045 |
| 465 | Ga0207712_10003380 | 3300025961 | Bacteria | 10087 |
| 466 | Ga0207712_10007061 | 3300025961 | Bacteria | 7084 |
| 467 | Ga0207712_10247442 | 3300025961 | Bacteria | 1439 |
| 468 | Ga0207668_10006479 | 3300025972 | Bacteria | 6923 |
| 469 | Ga0207640_10000002 | 3300025981 | Bacteria | 524211 |
| 470 | Ga0207640_10003188 | 3300025981 | Bacteria | 8828 |
| 471 | Ga0207640_10061809 | 3300025981 | Bacteria | 2482 |
| 472 | Ga0207658_10028523 | 3300025986 | Bacteria | 3931 |
| 473 | Ga0207658_10170407 | 3300025986 | Bacteria | 1793 |
| 474 | Ga0207677_10022723 | 3300026023 | Bacteria | 3860 |
| 475 | Ga0207677_10172015 | 3300026023 | Bacteria | 1695 |
| 476 | Ga0207677_10189598 | 3300026023 | Bacteria | 1625 |
| 477 | Ga0207703_10000146 | 3300026035 | Bacteria | 83180 |
| 478 | Ga0207703_10026475 | 3300026035 | Bacteria | 4565 |
| 479 | Ga0207703_10033869 | 3300026035 | Bacteria | 4051 |
| 480 | Ga0207703_10098826 | 3300026035 | Bacteria | 2469 |
| 481 | Ga0207639_10000011 | 3300026041 | Bacteria | 381897 |
| 482 | Ga0207639_10021647 | 3300026041 | Bacteria | 4621 |
| 483 | Ga0207639_10101334 | 3300026041 | Bacteria | 2328 |
| 484 | Ga0207639_10238818 | 3300026041 | Bacteria | 1579 |
| 485 | Ga0207678_10002636 | 3300026067 | Bacteria | 16329 |
| 486 | Ga0207678_10005116 | 3300026067 | Bacteria | 11764 |
| 487 | Ga0207678_10038030 | 3300026067 | Bacteria | 4184 |
| 488 | Ga0207678_10104213 | 3300026067 | Bacteria | 2421 |
| 489 | Ga0207708_10008117 | 3300026075 | Bacteria | 7775 |
| 490 | Ga0207708_10034651 | 3300026075 | Bacteria | 3840 |
| 491 | Ga0207641_10000019 | 3300026088 | Bacteria | 295899 |
| 492 | Ga0207641_10009143 | 3300026088 | Bacteria | 8183 |
| 493 | Ga0207641_10010979 | 3300026088 | Bacteria | 7424 |
| 494 | Ga0207641_10069889 | 3300026088 | Bacteria | 3016 |
| 495 | Ga0207641_10095692 | 3300026088 | Bacteria | 2607 |
| 496 | Ga0207641_10112240 | 3300026088 | Bacteria | 2418 |
| 497 | Ga0207648_10005438 | 3300026089 | Bacteria | 12836 |
| 498 | Ga0207648_10261904 | 3300026089 | Bacteria | 1543 |
| 499 | Ga0207676_10000689 | 3300026095 | Bacteria | 26702 |
| 500 | Ga0207676_10000924 | 3300026095 | Bacteria | 22721 |
| 501 | Ga0207676_10066670 | 3300026095 | Bacteria | 2872 |
| 502 | Ga0207676_10106263 | 3300026095 | Bacteria | 2338 |
| 503 | Ga0207676_10112535 | 3300026095 | Bacteria | 2280 |
| 504 | Ga0207674_10002206 | 3300026116 | Bacteria | 24670 |
| 505 | Ga0207674_10043375 | 3300026116 | Bacteria | 4638 |
| 506 | Ga0207674_10102983 | 3300026116 | Bacteria | 2834 |
| 507 | Ga0207675_100002223 | 3300026118 | Bacteria | 19286 |
| 508 | Ga0207675_100003721 | 3300026118 | Bacteria | 14854 |
| 509 | Ga0207675_100056999 | 3300026118 | Bacteria | 3645 |
| 510 | Ga0207675_100329711 | 3300026118 | Bacteria | 1492 |
| 511 | Ga0207683_10002096 | 3300026121 | Bacteria | 17563 |
| 512 | Ga0207683_10003030 | 3300026121 | Bacteria | 14680 |
| 513 | Ga0207683_10042030 | 3300026121 | Bacteria | 3992 |
| 514 | Ga0207698_10003387 | 3300026142 | Bacteria | 9597 |
| 515 | Ga0207698_10019224 | 3300026142 | Bacteria | 4673 |
| 516 | Ga0207698_10027888 | 3300026142 | Bacteria | 4017 |
| 517 | Ga0207698_10082895 | 3300026142 | Bacteria | 2594 |
| 518 | Ga0209970_1010035 | 3300027614 | Bacteria | 1547 |
| 519 | Ga0209971_1006717 | 3300027682 | Bacteria | 2723 |
| 520 | Ga0209966_1000361 | 3300027695 | Bacteria | 13894 |
| 521 | Ga0209966_1003787 | 3300027695 | Bacteria | 2552 |
| 522 | Ga0209998_10000497 | 3300027717 | Bacteria | 10801 |
| 523 | Ga0209974_10002220 | 3300027876 | Bacteria | 7062 |
| 524 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 525 | Ga0207428_10000428 | 3300027907 | Bacteria | 51964 |
| 526 | Ga0207428_10001396 | 3300027907 | Bacteria | 25497 |
| 527 | Ga0268266_10054184 | 3300028379 | Bacteria | 3446 |
| 528 | Ga0268266_10111068 | 3300028379 | Bacteria | 2429 |
| 529 | Ga0268265_10011841 | 3300028380 | Bacteria | 5896 |
| 530 | Ga0268265_10414395 | 3300028380 | Bacteria | 1249 |
| 531 | Ga0268264_10001145 | 3300028381 | Bacteria | 25934 |
| 532 | Ga0268264_10034235 | 3300028381 | Bacteria | 4177 |
| 533 | Ga0268264_10045961 | 3300028381 | Bacteria | 3626 |
| 534 | Ga0265337_1000182 | 3300028556 | Bacteria | 33103 |
| 535 | Ga0265338_10124251 | 3300028800 | Bacteria | 2051 |
| 536 | Ga0307511_10000291 | 3300030521 | Bacteria | 52887 |
| 537 | Ga0265325_10000034 | 3300031241 | Bacteria | 99371 |
| 538 | Ga0265325_10001708 | 3300031241 | Bacteria | 15269 |
| 539 | Ga0265325_10004871 | 3300031241 | Bacteria | 8389 |
| 540 | Ga0265325_10012202 | 3300031241 | Bacteria | 4916 |
| 541 | Ga0265325_10096502 | 3300031241 | Bacteria | 1452 |
| 542 | Ga0265316_10006848 | 3300031344 | Bacteria | 10821 |
| 543 | Ga0307408_100001146 | 3300031548 | Bacteria | 20119 |
| 544 | Ga0307408_100281057 | 3300031548 | Bacteria | 1386 |
| 545 | Ga0265313_10000176 | 3300031595 | Bacteria | 68037 |
| 546 | Ga0265313_10004374 | 3300031595 | Bacteria | 10905 |
| 547 | Ga0265313_10007339 | 3300031595 | Bacteria | 7559 |
| 548 | Ga0265313_10023429 | 3300031595 | Bacteria | 3324 |
| 549 | Ga0265313_10046756 | 3300031595 | Bacteria | 2099 |
| 550 | Ga0316575_10092720 | 3300031665 | Bacteria | 1224 |
| 551 | Ga0316579_10003856 | 3300031691 | Bacteria | 5907 |
| 552 | Ga0265314_10030315 | 3300031711 | Bacteria | 4005 |
| 553 | Ga0265314_10110664 | 3300031711 | Bacteria | 1746 |
| 554 | Ga0265314_10130674 | 3300031711 | Bacteria | 1567 |
| 555 | Ga0265342_10000203 | 3300031712 | Bacteria | 66540 |
| 556 | Ga0316576_10011911 | 3300031727 | Bacteria | 5721 |
| 557 | Ga0316578_10115324 | 3300031728 | Bacteria | 1614 |
| 558 | Ga0307405_10001776 | 3300031731 | Bacteria | 9229 |
| 559 | Ga0307413_10005612 | 3300031824 | Bacteria | 5624 |
| 560 | Ga0307410_10004736 | 3300031852 | Bacteria | 7086 |
| 561 | Ga0307406_10001441 | 3300031901 | Bacteria | 13157 |
| 562 | Ga0307406_10053050 | 3300031901 | Bacteria | 2582 |
| 563 | Ga0307407_10141308 | 3300031903 | Bacteria | 1553 |
| 564 | Ga0307412_10021099 | 3300031911 | Bacteria | 3974 |
| 565 | Ga0307409_100004538 | 3300031995 | Bacteria | 7825 |
| 566 | Ga0307409_100472484 | 3300031995 | Bacteria | 1215 |
| 567 | Ga0307416_100019486 | 3300032002 | Bacteria | 4811 |
| 568 | Ga0307414_10012226 | 3300032004 | Bacteria | 5066 |
| 569 | Ga0307411_10005510 | 3300032005 | Bacteria | 6227 |
| 570 | Ga0307415_100014047 | 3300032126 | Bacteria | 4693 |
| 571 | Ga0316583_10006403 | 3300032133 | Bacteria | 4227 |
| 572 | Ga0373948_0000065 | 3300034817 | Bacteria | 11046 |
| 573 | Ga0373948_0014839 | 3300034817 | Bacteria | 1424 |
| 574 | Ga0373950_0001171 | 3300034818 | Bacteria | 3373 |
| 575 | Ga0373950_0005103 | 3300034818 | Bacteria | 1949 |
| 576 | Ga0373950_0011810 | 3300034818 | Bacteria | 1433 |
| 577 | Ga0373958_0000282 | 3300034819 | Bacteria | 6025 |
| 578 | Ga0373958_0032695 | 3300034819 | Bacteria | 1028 |
| 579 | Ga0373938_0000777 | 3300034957 | Bacteria | 5184 |
| 580 | Ga0373938_0001840 | 3300034957 | Bacteria | 3388 |
| 581 | Ga0373938_0006623 | 3300034957 | Bacteria | 2009 |
| 582 | Ga0373926_0002077 | 3300035083 | Bacteria | 6308 |
| 583 | Ga0373926_0013283 | 3300035083 | Bacteria | 2791 |
| 584 | Ga0373926_0047284 | 3300035083 | Bacteria | 1545 |
| 585 | Ga0373928_0004487 | 3300035084 | Bacteria | 2660 |
| 586 | Ga0373929_0005286 | 3300035085 | Bacteria | 2320 |
| 587 | Ga0373944_0000062 | 3300035089 | Bacteria | 17879 |
| 588 | Ga0373949_0004625 | 3300035090 | Bacteria | 3133 |
| 589 | Ga0373949_0006491 | 3300035090 | Bacteria | 2571 |
| 590 | Ga0373949_0009081 | 3300035090 | Bacteria | 2178 |
| 591 | Ga0373951_0003492 | 3300035091 | Bacteria | 3801 |
| 592 | Ga0373951_0007214 | 3300035091 | Bacteria | 2528 |
| 593 | Ga0373951_0012834 | 3300035091 | Bacteria | 1884 |
| 594 | Ga0373923_0000277 | 3300035111 | Bacteria | 11228 |
| 595 | Ga0373923_0051488 | 3300035111 | Bacteria | 1728 |
| 596 | Ga0373932_0003427 | 3300035112 | Bacteria | 3815 |
| 597 | Ga0373936_0000954 | 3300035113 | Bacteria | 10327 |
| 598 | Ga0373936_0033507 | 3300035113 | Bacteria | 2036 |
| 599 | Ga0373939_0004196 | 3300035114 | Bacteria | 3397 |
| 600 | Ga0373939_0006980 | 3300035114 | Bacteria | 2733 |
| 601 | Ga0373939_0027672 | 3300035114 | Bacteria | 1608 |
| 602 | Ga0373941_0000106 | 3300035115 | Bacteria | 14078 |
| 603 | Ga0373941_0000814 | 3300035115 | Bacteria | 6401 |
| 604 | Ga0373941_0005921 | 3300035115 | Bacteria | 2913 |
| 605 | Ga0373945_0000835 | 3300035116 | Bacteria | 9062 |
| 606 | Ga0373945_0012682 | 3300035116 | Bacteria | 2803 |
| 607 | Ga0373953_0000952 | 3300035117 | Bacteria | 8097 |
| 608 | Ga0373953_0076015 | 3300035117 | Bacteria | 1391 |
| 609 | Ga0373954_0009787 | 3300035118 | Bacteria | 4219 |
| 610 | Ga0373954_0022174 | 3300035118 | Bacteria | 2878 |
| 611 | Ga0373956_0004014 | 3300035119 | Bacteria | 5913 |
| 612 | Ga0373956_0043834 | 3300035119 | Bacteria | 1992 |
| 613 | Ga0373956_0053581 | 3300035119 | Bacteria | 1816 |
| 614 | Ga0373957_0002130 | 3300035120 | Bacteria | 5567 |
| 615 | Ga0373957_0024303 | 3300035120 | Bacteria | 2175 |
| 616 | Ga0373957_0025922 | 3300035120 | Bacteria | 2116 |
| 617 | Ga0373960_0001001 | 3300035121 | Bacteria | 6073 |
| 618 | Ga0373960_0013941 | 3300035121 | Bacteria | 2026 |
| 619 | Ga0373960_0053859 | 3300035121 | Bacteria | 1202 |
| 620 | Ga0373943_0006335 | 3300035170 | Bacteria | 5311 |
| 621 | Ga0373943_0098172 | 3300035170 | Bacteria | 1527 |
| 622 | Ga0373946_0006149 | 3300035171 | Bacteria | 4349 |
| 623 | Ga0373946_0134698 | 3300035171 | Bacteria | 1140 |
| 624 | Ga0373955_0000366 | 3300035172 | Bacteria | 19051 |
| 625 | Ga0373955_0007022 | 3300035172 | Bacteria | 5156 |
| 626 | Ga0373955_0007406 | 3300035172 | Bacteria | 5046 |
| 627 | Ga0373955_0089365 | 3300035172 | Bacteria | 1753 |
| 628 | Ga0373942_0001640 | 3300035207 | Bacteria | 5693 |
| 629 | Ga0373961_0002190 | 3300035241 | Bacteria | 5183 |
| 630 | Ga0373961_0002208 | 3300035241 | Bacteria | 5150 |
| 631 | Ga0373961_0020933 | 3300035241 | Bacteria | 1734 |
| 632 | Ga0373962_0003389 | 3300035242 | Bacteria | 3830 |
| 633 | Ga0373962_0004553 | 3300035242 | Bacteria | 3355 |
| 634 | Ga0373962_0033716 | 3300035242 | Bacteria | 1414 |
| 635 | Ga0373924_0009639 | 3300035410 | Bacteria | 3545 |
| 636 | Ga0373924_0053141 | 3300035410 | Bacteria | 1682 |
| 637 | Ga0373931_0005024 | 3300035691 | Bacteria | 6083 |
| 638 | Ga0373931_0009616 | 3300035691 | Bacteria | 4629 |
| 639 | Ga0373931_0010271 | 3300035691 | Bacteria | 4498 |
| 640 | Ga0373931_0028546 | 3300035691 | Bacteria | 2857 |
| 641 | Ga0373931_0034953 | 3300035691 | Bacteria | 2611 |
| 642 | Ga0373935_0005922 | 3300035692 | Bacteria | 7247 |
| 643 | Ga0373935_0029047 | 3300035692 | Bacteria | 3420 |
| 644 | Ga0373935_0122379 | 3300035692 | Bacteria | 1739 |
| 645 | Ga0373927_0005034 | 3300035695 | Bacteria | 9145 |
| 646 | Ga0373927_0024309 | 3300035695 | Bacteria | 3964 |
| 647 | Ga0373933_0002037 | 3300035724 | Bacteria | 11624 |
| 648 | Ga0373933_0039421 | 3300035724 | Bacteria | 2779 |
| 649 | Ga0373933_0256230 | 3300035724 | Bacteria | 1127 |
| 650 | Ga0373947_0008074 | 3300035725 | Bacteria | 6069 |
| 651 | Ga0373947_0033652 | 3300035725 | Bacteria | 3027 |
| 652 | Ga0373937_0011894 | 3300036401 | Bacteria | 7638 |
| 653 | Ga0373937_0101052 | 3300036401 | Bacteria | 2676 |
| 654 | Ga0373937_0319810 | 3300036401 | Bacteria | 1468 |
| 655 | Ga0373937_0337392 | 3300036401 | Bacteria | 1427 |
| 656 | Ga0316582_0202185 | 3300036647 | Bacteria | 1355 |
| 657 | Ga0316584_0012138 | 3300036712 | Bacteria | 6069 |
| 658 | Ga0373925_0011407 | 3300037068 | Bacteria | 6440 |
| 659 | Ga0373925_0025151 | 3300037068 | Bacteria | 4347 |
| 660 | Ga0373925_0027591 | 3300037068 | Bacteria | 4156 |
| 661 | Ga0395900_0166586 | 3300037418 | Bacteria | 2245 |
| 662 | Ga0395898_0018005 | 3300037466 | Bacteria | 7207 |
| 663 | Ga0395898_0394160 | 3300037466 | Bacteria | 1320 |
| 664 | Ga0436364_0691178 | 3300037853 | Bacteria | 1675 |
| 665 | Ga0436364_1036119 | 3300037853 | Bacteria | 968 |
| 666 | Ga0395901_0022846 | 3300038443 | Bacteria | 6412 |
| 667 | Ga0395901_0270169 | 3300038443 | Bacteria | 1769 |
| 668 | Ga0395901_0402455 | 3300038443 | Bacteria | 1406 |
| 669 | Ga0395901_0533749 | 3300038443 | Bacteria | 1191 |
| 670 | Ga0242420_001233 | 3300038996 | Bacteria | 3352 |
| 671 | Ga0436365_0172579 | 3300039437 | Bacteria | 2258 |
| 672 | Ga0436365_1426756 | 3300039437 | Bacteria | 1295 |
| 673 | Ga0436360_0887432 | 3300039438 | Bacteria | 1007 |
| 674 | Ga0436360_1192721 | 3300039438 | Bacteria | 2172 |
| 675 | Ga0436361_0100122 | 3300039447 | Bacteria | 5296 |
| 676 | Ga0439465_0048575 | 3300041413 | Bacteria | 1385 |
| 677 | Ga0439450_030666 | 3300042008 | Bacteria | 1207 |
| 678 | Ga0439464_0005865 | 3300042439 | Bacteria | 3190 |
| 679 | Ga0439460_0017448 | 3300042461 | Bacteria | 1923 |
| 680 | Ga0451577_0002773 | 3300042876 | Bacteria | 20270 |
| 681 | Ga0451577_0148078 | 3300042876 | Bacteria | 2112 |
| 682 | Ga0466972_0058984 | 3300044658 | Bacteria | 1842 |
| 683 | Ga0466966_0051582 | 3300044684 | Bacteria | 2615 |
| 684 | Ga0466963_0096531 | 3300044694 | Bacteria | 2019 |
| 685 | Ga0466963_0179815 | 3300044694 | Bacteria | 1476 |
| 686 | Ga0453684_0096506 | 3300044712 | Bacteria | 3631 |
| 687 | Ga0466971_0036701 | 3300044719 | Bacteria | 2198 |
| 688 | Ga0466957_0071246 | 3300044842 | Bacteria | 2149 |
| 689 | Ga0451576_0033902 | 3300045051 | Bacteria | 5424 |
| 690 | Ga0466958_0020700 | 3300045836 | Bacteria | 3838 |
| 691 | Ga0466958_0168794 | 3300045836 | Bacteria | 1385 |
| 692 | Ga0495592_0004523 | 3300046454 | Bacteria | 10182 |
| 693 | Ga0495592_0007319 | 3300046454 | Bacteria | 8256 |
| 694 | Ga0495592_0040735 | 3300046454 | Bacteria | 3484 |
| 695 | Ga0495592_0085768 | 3300046454 | Bacteria | 2269 |
| 696 | Ga0495603_0023095 | 3300046455 | Bacteria | 3765 |
| 697 | Ga0495629_0002524 | 3300046459 | Bacteria | 14035 |
| 698 | Ga0495629_0110388 | 3300046459 | Bacteria | 1917 |
| 699 | Ga0495629_0257427 | 3300046459 | Bacteria | 1200 |
| 700 | Ga0495641_0031426 | 3300046461 | Bacteria | 2536 |
| 701 | Ga0495651_0001150 | 3300046462 | Bacteria | 20444 |
| 702 | Ga0495651_0006953 | 3300046462 | Bacteria | 8653 |
| 703 | Ga0495651_0022942 | 3300046462 | Bacteria | 4853 |
| 704 | Ga0495651_0097364 | 3300046462 | Bacteria | 2197 |
| 705 | Ga0495651_0170838 | 3300046462 | Bacteria | 1548 |
| 706 | Ga0495651_0174188 | 3300046462 | Bacteria | 1529 |
| 707 | Ga0495653_0001957 | 3300046463 | Bacteria | 16221 |
| 708 | Ga0495653_0005444 | 3300046463 | Bacteria | 10373 |
| 709 | Ga0495653_0154954 | 3300046463 | Bacteria | 1597 |
| 710 | Ga0495653_0180896 | 3300046463 | Bacteria | 1447 |
| 711 | Ga0495580_0001416 | 3300046472 | Bacteria | 21075 |
| 712 | Ga0495580_0111346 | 3300046472 | Bacteria | 1901 |
| 713 | Ga0495582_0010346 | 3300046473 | Bacteria | 5132 |
| 714 | Ga0495582_0100768 | 3300046473 | Bacteria | 1617 |
| 715 | Ga0495582_0115004 | 3300046473 | Bacteria | 1512 |
| 716 | Ga0495639_0037998 | 3300046475 | Bacteria | 2160 |
| 717 | Ga0495639_0039086 | 3300046475 | Bacteria | 2132 |
| 718 | Ga0495662_0002039 | 3300046476 | Bacteria | 10119 |
| 719 | Ga0495662_0097708 | 3300046476 | Bacteria | 1435 |
| 720 | Ga0495664_0000178 | 3300046477 | Bacteria | 31382 |
| 721 | Ga0495585_0015366 | 3300046492 | Bacteria | 4448 |
| 722 | Ga0495594_0039888 | 3300046499 | Bacteria | 2568 |
| 723 | Ga0495607_0020707 | 3300046501 | Bacteria | 4151 |
| 724 | Ga0495608_0028250 | 3300046511 | Bacteria | 3812 |
| 725 | Ga0495608_0033409 | 3300046511 | Bacteria | 3477 |
| 726 | Ga0495608_0186577 | 3300046511 | Bacteria | 1310 |
| 727 | Ga0495618_0003454 | 3300046514 | Bacteria | 9819 |
| 728 | Ga0495618_0003686 | 3300046514 | Bacteria | 9495 |
| 729 | Ga0495628_0001448 | 3300046516 | Bacteria | 21780 |
| 730 | Ga0495628_0015343 | 3300046516 | Bacteria | 6398 |
| 731 | Ga0495630_0115166 | 3300046517 | Bacteria | 2037 |
| 732 | Ga0495644_0001111 | 3300046523 | Bacteria | 11068 |
| 733 | Ga0495663_0008874 | 3300046525 | Bacteria | 2790 |
| 734 | Ga0495666_0000187 | 3300046526 | Bacteria | 26576 |
| 735 | Ga0495652_0002796 | 3300046529 | Bacteria | 17618 |
| 736 | Ga0495652_0247550 | 3300046529 | Bacteria | 1322 |
| 737 | Ga0495665_0006213 | 3300046531 | Bacteria | 6450 |
| 738 | Ga0495665_0090325 | 3300046531 | Bacteria | 1609 |
| 739 | Ga0495586_0002551 | 3300046535 | Bacteria | 9858 |
| 740 | Ga0495587_0002720 | 3300046536 | Bacteria | 11797 |
| 741 | Ga0495587_0015317 | 3300046536 | Bacteria | 4790 |
| 742 | Ga0495587_0095443 | 3300046536 | Bacteria | 1716 |
| 743 | Ga0495621_0011194 | 3300046539 | Bacteria | 2768 |
| 744 | Ga0495645_0000522 | 3300046543 | Bacteria | 26536 |
| 745 | Ga0495645_0001292 | 3300046543 | Bacteria | 17089 |
| 746 | Ga0495645_0007248 | 3300046543 | Bacteria | 7719 |
| 747 | Ga0495622_0001697 | 3300046557 | Bacteria | 10892 |
| 748 | Ga0495633_0001257 | 3300046558 | Bacteria | 20202 |
| 749 | Ga0495667_0002931 | 3300046559 | Bacteria | 11450 |
| 750 | Ga0495667_0005933 | 3300046559 | Bacteria | 8267 |
| 751 | Ga0495667_0006134 | 3300046559 | Bacteria | 8138 |
| 752 | Ga0495656_0015028 | 3300046615 | Bacteria | 2914 |
| 753 | Ga0495634_0012378 | 3300046642 | Bacteria | 6176 |
| 754 | Ga0495634_0101767 | 3300046642 | Bacteria | 1855 |
| 755 | Ga0495634_0189104 | 3300046642 | Bacteria | 1285 |
| 756 | Ga0495611_0006562 | 3300046648 | Bacteria | 4958 |
| 757 | Ga0495635_0001359 | 3300046663 | Bacteria | 16270 |
| 758 | Ga0495635_0011040 | 3300046663 | Bacteria | 6333 |
| 759 | Ga0495635_0035852 | 3300046663 | Bacteria | 3440 |
| 760 | Ga0495635_0044877 | 3300046663 | Bacteria | 3049 |
| 761 | Ga0495635_0326647 | 3300046663 | Bacteria | 1026 |
| 762 | Ga0495588_0001695 | 3300046674 | Bacteria | 9374 |
| 763 | Ga0495588_0024698 | 3300046674 | Bacteria | 2987 |
| 764 | Ga0495657_0002130 | 3300046675 | Bacteria | 16809 |
| 765 | Ga0495657_0013898 | 3300046675 | Bacteria | 5920 |
| 766 | Ga0495657_0085536 | 3300046675 | Bacteria | 2032 |
| 767 | Ga0495599_0000806 | 3300046678 | Bacteria | 17617 |
| 768 | Ga0495599_0004778 | 3300046678 | Bacteria | 8054 |
| 769 | Ga0495599_0033744 | 3300046678 | Bacteria | 3216 |
| 770 | Ga0495623_0002737 | 3300046679 | Bacteria | 11642 |
| 771 | Ga0495623_0008946 | 3300046679 | Bacteria | 6502 |
| 772 | Ga0495646_0006963 | 3300046680 | Bacteria | 7178 |
| 773 | Ga0495646_0050973 | 3300046680 | Bacteria | 2506 |
| 774 | Ga0495646_0071789 | 3300046680 | Bacteria | 2036 |
| 775 | Ga0495646_0100440 | 3300046680 | Bacteria | 1660 |
| 776 | Ga0495647_0000638 | 3300046681 | Bacteria | 10362 |
| 777 | Ga0495658_0004284 | 3300046683 | Bacteria | 7024 |
| 778 | Ga0495669_0063805 | 3300046684 | Bacteria | 1671 |
| 779 | Ga0495613_0012243 | 3300046689 | Bacteria | 6376 |
| 780 | Ga0495613_0018093 | 3300046689 | Bacteria | 5250 |
| 781 | Ga0495624_0015494 | 3300046690 | Bacteria | 5144 |
| 782 | Ga0495670_0005583 | 3300046691 | Bacteria | 6172 |
| 783 | Ga0495589_0010162 | 3300046794 | Bacteria | 4890 |
| 784 | Ga0495600_0001998 | 3300046809 | Bacteria | 11466 |
| 785 | Ga0495600_0008547 | 3300046809 | Bacteria | 6296 |
| 786 | Ga0495600_0020095 | 3300046809 | Bacteria | 4272 |
| 787 | Ga0495600_0053557 | 3300046809 | Bacteria | 2635 |
| 788 | Ga0495600_0067779 | 3300046809 | Bacteria | 2332 |
| 789 | Ga0495581_0014671 | 3300047315 | Bacteria | 4543 |
| 790 | Ga0495581_0067476 | 3300047315 | Bacteria | 2068 |
| 791 | Ga0495604_0001423 | 3300047317 | Bacteria | 19641 |
| 792 | Ga0495604_0005209 | 3300047317 | Bacteria | 10301 |
| 793 | Ga0495604_0016854 | 3300047317 | Bacteria | 5844 |
| 794 | Ga0495604_0023581 | 3300047317 | Bacteria | 4909 |
| 795 | Ga0495674_0015888 | 3300047319 | Bacteria | 7028 |
| 796 | Ga0495674_0258405 | 3300047319 | Bacteria | 1431 |
| 797 | Ga0495676_0055349 | 3300047321 | Bacteria | 3146 |
| 798 | Ga0495680_0001491 | 3300047322 | Bacteria | 25179 |
| 799 | Ga0495680_0003802 | 3300047322 | Bacteria | 14655 |
| 800 | Ga0495680_0007295 | 3300047322 | Bacteria | 10175 |
| 801 | Ga0495680_0050340 | 3300047322 | Bacteria | 3258 |
| 802 | Ga0495680_0074874 | 3300047322 | Bacteria | 2570 |
| 803 | Ga0495680_0097280 | 3300047322 | Bacteria | 2197 |
| 804 | Ga0495687_000406 | 3300047443 | Bacteria | 53268 |
| 805 | Ga0495675_0000657 | 3300047444 | Bacteria | 21846 |
| 806 | Ga0495675_0046956 | 3300047444 | Bacteria | 2748 |
| 807 | Ga0495675_0114346 | 3300047444 | Bacteria | 1683 |
| 808 | Ga0495684_0000711 | 3300047471 | Bacteria | 26762 |
| 809 | Ga0495684_0011970 | 3300047471 | Bacteria | 6691 |
| 810 | Ga0495684_0138923 | 3300047471 | Bacteria | 1822 |
| 811 | Ga0495684_0304263 | 3300047471 | Bacteria | 1144 |
| 812 | Ga0495593_0000309 | 3300047673 | Bacteria | 26737 |
| 813 | Ga0495593_0035254 | 3300047673 | Bacteria | 2718 |
| 814 | Ga0495602_0014126 | 3300048088 | Bacteria | 8119 |
| 815 | Ga0495602_0017283 | 3300048088 | Bacteria | 7233 |
| 816 | Ga0495602_0042861 | 3300048088 | Bacteria | 4119 |
| 817 | Ga0495602_0092565 | 3300048088 | Bacteria | 2504 |
| 818 | Ga0495602_0168195 | 3300048088 | Bacteria | 1704 |
| 819 | Ga0495614_0003292 | 3300048089 | Bacteria | 7220 |
| 820 | Ga0496100_0000203 | 3300048903 | Bacteria | 32744 |
| 821 | Ga0496100_0016419 | 3300048903 | Bacteria | 4348 |
| 822 | Ga0496100_0111390 | 3300048903 | Bacteria | 1902 |
| 823 | Ga0496101_0026542 | 3300048904 | Bacteria | 4027 |
| 824 | Ga0496101_0032429 | 3300048904 | Bacteria | 3677 |
| 825 | Ga0496101_0217067 | 3300048904 | Bacteria | 1483 |
| 826 | Ga0496102_0004838 | 3300048905 | Bacteria | 11387 |
| 827 | Ga0496102_0022976 | 3300048905 | Bacteria | 5533 |
| 828 | Ga0496102_0130067 | 3300048905 | Bacteria | 2355 |
| 829 | Ga0496102_0140143 | 3300048905 | Bacteria | 2267 |
| 830 | Ga0496103_0001529 | 3300048906 | Bacteria | 15450 |
| 831 | Ga0496103_0006837 | 3300048906 | Bacteria | 6808 |
| 832 | Ga0496104_0000317 | 3300048907 | Bacteria | 42918 |
| 833 | Ga0496104_0019322 | 3300048907 | Bacteria | 6230 |
| 834 | Ga0496104_0063751 | 3300048907 | Bacteria | 3496 |
| 835 | Ga0496104_0115458 | 3300048907 | Bacteria | 2576 |
| 836 | Ga0496105_0000485 | 3300048908 | Bacteria | 26121 |
| 837 | Ga0496105_0008071 | 3300048908 | Bacteria | 8183 |
| 838 | Ga0496105_0088533 | 3300048908 | Bacteria | 2557 |
| 839 | Ga0496105_0248480 | 3300048908 | Bacteria | 1441 |
| 840 | Ga0496106_0002909 | 3300048909 | Bacteria | 12739 |
| 841 | Ga0496106_0021657 | 3300048909 | Bacteria | 4772 |
| 842 | Ga0496106_0031693 | 3300048909 | Bacteria | 3939 |
| 843 | Ga0496106_0070128 | 3300048909 | Bacteria | 2676 |
| 844 | Ga0496106_0404301 | 3300048909 | Bacteria | 1097 |
| 845 | Ga0496107_0000268 | 3300048910 | Bacteria | 27611 |
| 846 | Ga0496107_0013083 | 3300048910 | Bacteria | 5797 |
| 847 | Ga0496107_0027599 | 3300048910 | Bacteria | 4031 |
| 848 | Ga0496107_0277471 | 3300048910 | Bacteria | 1248 |
| 849 | Ga0496108_0008793 | 3300048911 | Bacteria | 8187 |
| 850 | Ga0496108_0015269 | 3300048911 | Bacteria | 6268 |
| 851 | Ga0496108_0049947 | 3300048911 | Bacteria | 3499 |
| 852 | Ga0496108_0449648 | 3300048911 | Bacteria | 1125 |
| 853 | Ga0496109_0007775 | 3300048912 | Bacteria | 9077 |
| 854 | Ga0496109_0014079 | 3300048912 | Bacteria | 6953 |
| 855 | Ga0496109_0017745 | 3300048912 | Bacteria | 6243 |
| 856 | Ga0496109_0047388 | 3300048912 | Bacteria | 3908 |
| 857 | Ga0496109_0117220 | 3300048912 | Bacteria | 2478 |
| 858 | Ga0496109_0128158 | 3300048912 | Bacteria | 2367 |
| 859 | Ga0496109_0197694 | 3300048912 | Bacteria | 1890 |
| 860 | Ga0496110_0043830 | 3300048913 | Bacteria | 3906 |
| 861 | Ga0496110_0116904 | 3300048913 | Bacteria | 2401 |
| 862 | Ga0496110_0390684 | 3300048913 | Bacteria | 1268 |
| 863 | Ga0496111_0035908 | 3300048914 | Bacteria | 3544 |
| 864 | Ga0496111_0198822 | 3300048914 | Bacteria | 1490 |
| 865 | Ga0496112_0032191 | 3300048915 | Bacteria | 5090 |
| 866 | Ga0496112_0534899 | 3300048915 | Bacteria | 1106 |
| 867 | Ga0496113_0004401 | 3300048916 | Bacteria | 8645 |
| 868 | Ga0496113_0012044 | 3300048916 | Bacteria | 5800 |
| 869 | Ga0496113_0059732 | 3300048916 | Bacteria | 2873 |
| 870 | Ga0496113_0127484 | 3300048916 | Bacteria | 1994 |
| 871 | Ga0496114_0006070 | 3300048917 | Bacteria | 9508 |
| 872 | Ga0496114_0013910 | 3300048917 | Bacteria | 6451 |
| 873 | Ga0496114_0210165 | 3300048917 | Bacteria | 1706 |
| 874 | Ga0496114_0515009 | 3300048917 | Bacteria | 1058 |
| 875 | Ga0496115_0018077 | 3300048918 | Bacteria | 5403 |
| 876 | Ga0496115_0049636 | 3300048918 | Bacteria | 3360 |
| 877 | Ga0496115_0058081 | 3300048918 | Bacteria | 3112 |
| 878 | Ga0496115_0063544 | 3300048918 | Bacteria | 2978 |
| 879 | Ga0496115_0075050 | 3300048918 | Bacteria | 2746 |
| 880 | Ga0496115_0187624 | 3300048918 | Bacteria | 1708 |
| 881 | Ga0496118_0085656 | 3300048921 | Bacteria | 2193 |
| 882 | Ga0496119_0054970 | 3300048922 | Bacteria | 2421 |
| 883 | Ga0496120_0000909 | 3300048923 | Bacteria | 41346 |
| 884 | Ga0496124_0023662 | 3300048927 | Bacteria | 5603 |
| 885 | Ga0496125_0025536 | 3300048928 | Bacteria | 5407 |
| 886 | Ga0501031_0082494 | 3300049568 | Bacteria | 2096 |
| 887 | Ga0501032_0031388 | 3300049569 | Bacteria | 3643 |
| 888 | Ga0501032_0035059 | 3300049569 | Bacteria | 3431 |
| 889 | Ga0501032_0043106 | 3300049569 | Bacteria | 3058 |
| 890 | Ga0501032_0057988 | 3300049569 | Bacteria | 2600 |
| 891 | Ga0501033_0002073 | 3300049570 | Bacteria | 17410 |
| 892 | Ga0501033_0024802 | 3300049570 | Bacteria | 4523 |
| 893 | Ga0501033_0057242 | 3300049570 | Bacteria | 2882 |
| 894 | Ga0501034_0001131 | 3300049571 | Bacteria | 37119 |
| 895 | Ga0501034_0002653 | 3300049571 | Bacteria | 21171 |
| 896 | Ga0501034_0014877 | 3300049571 | Bacteria | 8003 |
| 897 | Ga0501034_0020143 | 3300049571 | Bacteria | 6810 |
| 898 | Ga0501034_0136041 | 3300049571 | Bacteria | 2438 |
| 899 | Ga0501034_0138981 | 3300049571 | Bacteria | 2409 |
| 900 | Ga0501034_0149334 | 3300049571 | Bacteria | 2313 |
| 901 | Ga0501034_0181219 | 3300049571 | Bacteria | 2071 |
| 902 | Ga0501034_0216343 | 3300049571 | Bacteria | 1870 |
| 903 | Ga0501036_0001536 | 3300049572 | Bacteria | 17831 |
| 904 | Ga0501036_0022944 | 3300049572 | Bacteria | 5254 |
| 905 | Ga0501036_0025987 | 3300049572 | Bacteria | 4940 |
| 906 | Ga0501036_0041082 | 3300049572 | Bacteria | 3914 |
| 907 | Ga0501037_0005604 | 3300049573 | Bacteria | 9150 |
| 908 | Ga0501037_0018589 | 3300049573 | Bacteria | 5121 |
| 909 | Ga0501037_0038014 | 3300049573 | Bacteria | 3548 |
| 910 | Ga0501037_0054611 | 3300049573 | Bacteria | 2921 |
| 911 | Ga0501037_0089624 | 3300049573 | Bacteria | 2225 |
| 912 | Ga0501038_0009911 | 3300049574 | Bacteria | 8723 |
| 913 | Ga0501038_0043871 | 3300049574 | Bacteria | 3887 |
| 914 | Ga0501038_0212128 | 3300049574 | Bacteria | 1548 |
| 915 | Ga0501039_0016262 | 3300049575 | Bacteria | 5698 |
| 916 | Ga0501039_0017229 | 3300049575 | Bacteria | 5541 |
| 917 | Ga0501040_0080822 | 3300049576 | Bacteria | 2252 |
| 918 | Ga0501043_0000736 | 3300049579 | Bacteria | 29004 |
| 919 | Ga0501043_0040782 | 3300049579 | Bacteria | 3648 |
| 920 | Ga0501043_0045564 | 3300049579 | Bacteria | 3449 |
| 921 | Ga0501043_0053270 | 3300049579 | Bacteria | 3177 |
| 922 | Ga0501043_0191143 | 3300049579 | Bacteria | 1592 |
| 923 | Ga0501046_0009584 | 3300049580 | Bacteria | 8355 |
| 924 | Ga0501046_0107601 | 3300049580 | Bacteria | 2133 |
| 925 | Ga0501047_0000124 | 3300049581 | Bacteria | 94721 |
| 926 | Ga0501047_0026327 | 3300049581 | Bacteria | 5596 |
| 927 | Ga0501047_0037811 | 3300049581 | Bacteria | 4667 |
| 928 | Ga0501047_0042592 | 3300049581 | Bacteria | 4387 |
| 929 | Ga0501047_0046378 | 3300049581 | Bacteria | 4200 |
| 930 | Ga0501047_0116109 | 3300049581 | Bacteria | 2558 |
| 931 | Ga0501048_0000566 | 3300049582 | Bacteria | 26246 |
| 932 | Ga0501048_0034416 | 3300049582 | Bacteria | 3654 |
| 933 | Ga0501068_0011085 | 3300049584 | Bacteria | 5074 |
| 934 | Ga0501068_0022673 | 3300049584 | Bacteria | 3673 |
| 935 | Ga0501069_0012763 | 3300049585 | Bacteria | 4472 |
| 936 | Ga0501069_0050995 | 3300049585 | Bacteria | 2302 |
| 937 | Ga0501070_0015997 | 3300049586 | Bacteria | 6304 |
| 938 | Ga0501070_0022848 | 3300049586 | Bacteria | 5235 |
| 939 | Ga0501070_0023849 | 3300049586 | Bacteria | 5127 |
| 940 | Ga0501070_0025834 | 3300049586 | Bacteria | 4927 |
| 941 | Ga0501070_0044982 | 3300049586 | Bacteria | 3672 |
| 942 | Ga0501071_0025639 | 3300049587 | Bacteria | 4132 |
| 943 | Ga0501072_0007804 | 3300049588 | Bacteria | 8127 |
| 944 | Ga0501072_0127733 | 3300049588 | Bacteria | 2026 |
| 945 | Ga0501073_0007018 | 3300049589 | Bacteria | 8392 |
| 946 | Ga0501073_0031043 | 3300049589 | Bacteria | 3813 |
| 947 | Ga0501073_0038432 | 3300049589 | Bacteria | 3394 |
| 948 | Ga0501073_0063109 | 3300049589 | Bacteria | 2584 |
| 949 | Ga0501073_0139682 | 3300049589 | Bacteria | 1679 |
| 950 | Ga0501074_0007534 | 3300049590 | Bacteria | 7874 |
| 951 | Ga0501074_0029328 | 3300049590 | Bacteria | 3985 |
| 952 | Ga0501074_0045167 | 3300049590 | Bacteria | 3187 |
| 953 | Ga0501074_0285716 | 3300049590 | Bacteria | 1172 |
| 954 | Ga0501076_0280793 | 3300049592 | Bacteria | 1364 |
| 955 | Ga0501079_0035277 | 3300049741 | Bacteria | 3850 |
| 956 | Ga0501079_0081212 | 3300049741 | Bacteria | 2506 |
| 957 | Ga0501079_0168315 | 3300049741 | Bacteria | 1709 |
| 958 | Ga0501080_0000130 | 3300049742 | Bacteria | 53465 |
| 959 | Ga0501080_0034272 | 3300049742 | Bacteria | 4738 |
| 960 | Ga0501080_0068873 | 3300049742 | Bacteria | 3291 |
| 961 | Ga0501080_0174238 | 3300049742 | Bacteria | 1983 |
| 962 | Ga0501083_0000480 | 3300049744 | Bacteria | 25565 |
| 963 | Ga0501083_0018924 | 3300049744 | Bacteria | 4793 |
| 964 | Ga0501083_0040857 | 3300049744 | Bacteria | 3147 |
| 965 | Ga0501083_0063766 | 3300049744 | Bacteria | 2457 |
| 966 | Ga0501083_0176596 | 3300049744 | Bacteria | 1395 |
| 967 | Ga0501035_0004040 | 3300049822 | Bacteria | 13976 |
| 968 | Ga0501035_0026081 | 3300049822 | Bacteria | 5352 |
| 969 | Ga0501035_0030901 | 3300049822 | Bacteria | 4879 |
| 970 | Ga0501035_0117695 | 3300049822 | Bacteria | 2325 |
| 971 | Ga0501044_0014077 | 3300049823 | Bacteria | 8637 |
| 972 | Ga0501044_0059472 | 3300049823 | Bacteria | 3914 |
| 973 | Ga0501044_0177933 | 3300049823 | Bacteria | 2095 |
| 974 | Ga0501044_0311501 | 3300049823 | Bacteria | 1500 |
| 975 | Ga0501045_0284825 | 3300049824 | Bacteria | 1230 |
| 976 | nmdc:mga03683_3421_c1 | 3300050489 | Bacteria | 5116 |
| 977 | nmdc:mga00v17_8120_c1 | 3300050491 | Bacteria | 5635 |
| 978 | nmdc:mga0k408_38147_c1 | 3300050493 | Bacteria | 2758 |
| 979 | nmdc:mga0k408_64735_c1 | 3300050493 | Bacteria | 2128 |
| 980 | nmdc:mga0k408_6713_c1 | 3300050493 | Bacteria | 6137 |
| 981 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 982 | nmdc:mga09592_17661_c1 | 3300050508 | Bacteria | 5848 |
| 983 | nmdc:mga0qj67_355_c1 | 3300050509 | Bacteria | 31660 |
| 984 | nmdc:mga06r32_5297_c1 | 3300050510 | Bacteria | 11609 |
| 985 | nmdc:mga08y16_19018_c1 | 3300050511 | Bacteria | 7235 |
| 986 | nmdc:mga08y16_2238_c1 | 3300050511 | Bacteria | 19836 |
| 987 | nmdc:mga08y16_63045_c1 | 3300050511 | Bacteria | 3871 |
| 988 | nmdc:mga0n895_182476_c1 | 3300050512 | Bacteria | 2130 |
| 989 | nmdc:mga0n895_41527_c1 | 3300050512 | Bacteria | 4473 |
| 990 | nmdc:mga0n895_547_c1 | 3300050512 | Bacteria | 25755 |
| 991 | nmdc:mga0n895_79500_c1 | 3300050512 | Bacteria | 3266 |
| 992 | nmdc:mga0rr50_219930_c1 | 3300050513 | Bacteria | 1568 |
| 993 | nmdc:mga0rr50_4724_c1 | 3300050513 | Bacteria | 8031 |
| 994 | nmdc:mga0rr50_93917_c1 | 3300050513 | Bacteria | 1982 |
| 995 | nmdc:mga08x19_326271_c1 | 3300050514 | Bacteria | 1069 |
| 996 | nmdc:mga0a205_26502_c1 | 3300050515 | Bacteria | 5529 |
| 997 | nmdc:mga0a205_6205_c1 | 3300050515 | Bacteria | 10788 |
| 998 | nmdc:mga0a205_629_c1 | 3300050515 | Bacteria | 28029 |
| 999 | Ga0495601_0000521 | 3300053077 | Bacteria | 20312 |
| 1000 | Ga0495601_0011745 | 3300053077 | Bacteria | 5250 |
| 1001 | Ga0495601_0054336 | 3300053077 | Bacteria | 2534 |
| 1002 | Ga0495601_0076766 | 3300053077 | Bacteria | 2139 |
| 1003 | Ga0495601_0098858 | 3300053077 | Bacteria | 1883 |
| 1004 | Ga0495601_0151902 | 3300053077 | Bacteria | 1512 |
| 1005 | Ga0495612_0001070 | 3300053078 | Bacteria | 11208 |
| 1006 | Ga0495612_0003633 | 3300053078 | Bacteria | 6395 |
| 1007 | Ga0495612_0029848 | 3300053078 | Bacteria | 2197 |
| 1008 | Ga0495595_0000186 | 3300053084 | Bacteria | 25013 |
| 1009 | Ga0495595_0001827 | 3300053084 | Bacteria | 8280 |
| 1010 | Ga0495595_0002111 | 3300053084 | Bacteria | 7717 |
| 1011 | Ga0495595_0002555 | 3300053084 | Bacteria | 7144 |
| 1012 | Ga0495595_0009359 | 3300053084 | Bacteria | 4052 |
| 1013 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1014 | Ga0495619_0000670 | 3300053085 | Bacteria | 22463 |
| 1015 | Ga0495619_0002830 | 3300053085 | Bacteria | 11300 |
| 1016 | Ga0495619_0035595 | 3300053085 | Bacteria | 3239 |
| 1017 | Ga0495619_0047542 | 3300053085 | Bacteria | 2825 |
| 1018 | Ga0495619_0047982 | 3300053085 | Bacteria | 2813 |
| 1019 | Ga0495619_0211639 | 3300053085 | Bacteria | 1343 |
| 1020 | Ga0500643_012507 | 3300053087 | Bacteria | 3036 |
| 1021 | Ga0500646_0000594 | 3300053090 | Bacteria | 10416 |
| 1022 | Ga0500641_0026450 | 3300053096 | Bacteria | 2253 |
| 1023 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1024 | Ga0500607_002934 | 3300053121 | Bacteria | 13025 |
| 1025 | Ga0500658_0000447 | 3300053134 | Bacteria | 17605 |
| 1026 | Ga0500604_0006167 | 3300053151 | Bacteria | 3167 |
| 1027 | Ga0500616_0011721 | 3300053153 | Bacteria | 5161 |
| 1028 | Ga0500616_0025161 | 3300053153 | Bacteria | 3302 |
| 1029 | Ga0500616_0128822 | 3300053153 | Bacteria | 1198 |
| 1030 | Ga0500627_0042571 | 3300053158 | Bacteria | 1955 |
| 1031 | Ga0500645_000051 | 3300053730 | Bacteria | 98521 |
| 1032 | Ga0501082_0000510 | 3300060353 | Bacteria | 34491 |
| 1033 | Ga0501082_0052637 | 3300060353 | Bacteria | 3509 |
| 1034 | Ga0501082_0085689 | 3300060353 | Bacteria | 2717 |
| 1035 | Ga0501082_0185725 | 3300060353 | Bacteria | 1809 |
| 1036 | Ga0501082_0391795 | 3300060353 | Bacteria | 1212 |
| 1037 | 2512351568 | 2512047030 | Bacteria | 9031815 |
| 1038 | 2513611987 | 2513237090 | Bacteria | 7096802 |
| 1039 | 2599396658 | 2599185167 | Bacteria | 6353609 |
| 1040 | 2599453282 | 2599185179 | Bacteria | 6611171 |
| 1041 | 2599514614 | 2599185190 | Bacteria | 6285678 |
| 1042 | 2599517455 | 2599185191 | Bacteria | 6297582 |
| 1043 | 2599894121 | 2599185290 | Bacteria | 6289611 |
| 1044 | 2599936082 | 2599185301 | Bacteria | 6161860 |
| 1045 | 2601691313 | 2600255296 | Bacteria | 5784754 |
| 1046 | 2621301125 | 2619619299 | Bacteria | 6649820 |
| 1047 | 2643758836 | 2643221547 | Bacteria | 4740017 |
| 1048 | 2643987926 | 2643221595 | Bacteria | 6565519 |
| 1049 | 2694632419 | 2693429783 | Bacteria | 7019804 |
| 1050 | 2694639169 | 2693429784 | Bacteria | 7241525 |
| 1051 | 2723247612 | 2721755607 | Bacteria | 5841722 |
| 1052 | 2738670250 | 2738541265 | Bacteria | 6594665 |
| 1053 | 2738748643 | 2738541282 | Bacteria | 6593925 |
| 1054 | 2738857685 | 2738541303 | Bacteria | 6591772 |
| 1055 | 2739248710 | 2738543013 | Bacteria | 5618633 |
| 1056 | 2817489521 | 2816332298 | Bacteria | 6852809 |
| 1057 | 2834029435 | 2834028612 | Bacteria | 6354979 |
| 1058 | 2856366229 | 2856364286 | Bacteria | 6939991 |
| 1059 | 2857351397 | 2857349434 | Bacteria | 7926032 |
| 1060 | 2869287264 | 2869285874 | Bacteria | 6901219 |
| 1061 | 2871430563 | 2871429161 | Bacteria | 6547891 |
| 1062 | 2871441607 | 2871435913 | Bacteria | 6880295 |
| 1063 | 2871451559 | 2871444079 | Bacteria | 6423508 |
| 1064 | 2871502649 | 2871495908 | Bacteria | 6935695 |
| 1065 | 2874149158 | 2874146452 | Bacteria | 7533118 |
| 1066 | 2874156055 | 2874155637 | Bacteria | 6724144 |
| 1067 | 2876374112 | 2876369609 | Bacteria | 6807521 |
| 1068 | 2876380206 | 2876377896 | Bacteria | 6565995 |
| 1069 | 2876394076 | 2876392853 | Bacteria | 6660880 |
| 1070 | 2876415418 | 2876413966 | Bacteria | 6831344 |
| 1071 | 2878746996 | 2878745973 | Bacteria | 6867388 |
| 1072 | 2878766541 | 2878760144 | Bacteria | 6823465 |
| 1073 | 2878773737 | 2878767105 | Bacteria | 6898628 |
| 1074 | 2881150937 | 2881147464 | Bacteria | 7779814 |
| 1075 | 2881167198 | 2881161766 | Bacteria | 7127907 |
| 1076 | 2888355522 | 2888350351 | Bacteria | 7372807 |
| 1077 | 2889010490 | 2889010040 | Bacteria | 6749192 |
| 1078 | 2889017843 | 2889016732 | Bacteria | 6700763 |
| 1079 | 2903500487 | 2903492973 | Bacteria | 13473544 |
| 1080 | 2903547690 | 2903540706 | Bacteria | 7062119 |
| 1081 | 2904660407 | 2904659560 | Bacteria | 6685615 |
| 1082 | 2906309809 | 2906308376 | Bacteria | 6841989 |
| 1083 | 2906322444 | 2906321335 | Bacteria | 6579571 |
| 1084 | 2906330303 | 2906328253 | Bacteria | 6585166 |
| 1085 | 2919176305 | 2919171160 | Bacteria | 6499771 |
| 1086 | 2920763953 | 2920760137 | Bacteria | 7427611 |
| 1087 | 2922132989 | 2922130491 | Bacteria | 7173936 |
| 1088 | 2922163136 | 2922158528 | Bacteria | 6573167 |
| 1089 | 2922186412 | 2922185730 | Bacteria | 7113964 |
| 1090 | 2924716200 | 2924710171 | Bacteria | 6752351 |
| 1091 | 2924730722 | 2924726620 | Bacteria | 6271473 |
| 1092 | 2931392444 | 2931390751 | Bacteria | 6273349 |
| 1093 | 2937814892 | 2937813078 | Bacteria | 7783518 |
| 1094 | 2937828882 | 2937822353 | Bacteria | 7290551 |
| 1095 | 2937894225 | 2937891427 | Bacteria | 6357007 |
| 1096 | 2938001565 | 2937994558 | Bacteria | 7036190 |
| 1097 | 2938022159 | 2938014810 | Bacteria | 6700592 |
| 1098 | 2939632999 | 2939631187 | Bacteria | 6118131 |
| 1099 | 2945961761 | 2945961074 | Bacteria | 7342064 |
| 1100 | 2947236257 | 2947233263 | Bacteria | 6439278 |
| 1101 | 2958055542 | 2958041894 | Bacteria | 13082850 |
| 1102 | 2958105406 | 2958100919 | Bacteria | 6800575 |
| 1103 | 2958131764 | 2958130278 | Bacteria | 6897202 |
| 1104 | 2958171719 | 2958165035 | Bacteria | 6906348 |
| 1105 | 2958175081 | 2958172287 | Bacteria | 6716688 |
| 1106 | 2958180824 | 2958179912 | Bacteria | 6874908 |
| 1107 | 2961078662 | 2961077736 | Bacteria | 7079850 |
| 1108 | 2961115732 | 2961114664 | Bacteria | 6680456 |
| 1109 | 2961170160 | 2961163497 | Bacteria | 6901077 |
| 1110 | 2965024911 | 2965018300 | Bacteria | 6883036 |
| 1111 | 2965065461 | 2965062239 | Bacteria | 7412989 |
| 1112 | 2965123298 | 2965119406 | Bacteria | 6956431 |
| 1113 | 2968095151 | 2968091066 | Bacteria | 6052692 |
| 1114 | 2968111465 | 2968110612 | Bacteria | 6814636 |
| 1115 | 2968119736 | 2968117919 | Bacteria | 6536078 |
| 1116 | 2968130707 | 2968128360 | Bacteria | 6270294 |
| 1117 | 2968178552 | 2968171901 | Bacteria | 6894245 |
| 1118 | 2970561397 | 2970554993 | Bacteria | 6814252 |
| 1119 | 2977845647 | 2977843712 | Bacteria | 6753583 |
| 1120 | 2977860972 | 2977858184 | Bacteria | 6215359 |
| 1121 | 2977865430 | 2977864932 | Bacteria | 7534097 |
| 1122 | 2977900968 | 2977898635 | Bacteria | 6675551 |
| 1123 | 2977945219 | 2977942078 | Bacteria | 7570577 |
| 1124 | 2977975917 | 2977971508 | Bacteria | 7472917 |
| 1125 | 2979716479 | 2979710463 | Bacteria | 6785254 |
| 1126 | 2979751294 | 2979742915 | Bacteria | 7301278 |
| 1127 | 2987638581 | 2987636660 | Bacteria | 8088555 |
| 1128 | 2987659444 | 2987652177 | Bacteria | 6969023 |
| 1129 | 2987666401 | 2987659509 | Bacteria | 6966464 |
| 1130 | 2996343578 | 2996341866 | Bacteria | 6643098 |
| 1131 | 2996388609 | 2996386984 | Bacteria | 6978667 |
| 1132 | 3004195407 | 3004188549 | Bacteria | 6952365 |
| 1133 | 3004205176 | 3004203850 | Bacteria | 7307914 |
| 1134 | 8004389101 | 8004387939 | Bacteria | 7049250 |
| 1135 | 8004448848 | 8004445564 | Bacteria | 6322258 |
| 1136 | 8004641009 | 8004640170 | Bacteria | 6723001 |
| 1137 | 8004716164 | 8004714634 | Bacteria | 6776161 |
| 1138 | 8006971469 | 8006964411 | Bacteria | 8966052 |
| 1139 | 8007001213 | 8006994254 | Bacteria | 8309700 |
| 1140 | 8019678097 | 8019668869 | Bacteria | 8791617 |
| 1141 | 8054286807 | 8054285046 | Bacteria | 6919322 |
| 1142 | 8055819475 | 8055817908 | Bacteria | 6609162 |
| 1143 | nmdc:mga05p37_17539_c1 | |||
| 1144 | 2214761888 | |||
| 1145 | ARSoilYngRDRAFT_c00482 | |||
| 1146 | ARcpr5yngRDRAFT_c000072 | |||
| 1147 | ARSoilOldRDRAFT_c000019 | |||
| 1148 | ARCol0oldRDRAFT_c00632 | |||
| 1149 | ARCol0yngRDRAFT_1000004 | |||
| 1150 | JGI24032J14994_100387 | |||
| 1151 | JGI24752J21851_1008276 | |||
| 1152 | JGI24746J21847_1000147 | |||
| 1153 | JGI24739J22299_10001284 | |||
| 1154 | JGI24739J22299_10006478 | |||
| 1155 | JGI24737J22298_10002058 | |||
| 1156 | JGI24737J22298_10003740 | |||
| 1157 | JGI24750J21931_1002783 | |||
| 1158 | JGI24745J21846_1004824 | |||
| 1159 | JGI24738J21930_10007502 | |||
| 1160 | JGI24744J21845_10015405 | |||
| 1161 | JGI24035J26624_1000276 | |||
| 1162 | JGI24742J22300_10000106 | |||
| 1163 | JGI25162J39368_1000085 | |||
| 1164 | JGI25154J39366_1004383 | |||
| 1165 | JGI25157J39369_1001112 | |||
| 1166 | JGI25159J45721_1005770 | |||
| 1167 | JGI25405J52794_10002175 | |||
| 1168 | Ga0065165_1000381 | |||
| 1169 | Ga0065716_1002577 | |||
| 1170 | Ga0065704_10134743 | |||
| 1171 | Ga0065712_10012403 | |||
| 1172 | Ga0065712_10134279 | |||
| 1173 | Ga0065715_10000492 | |||
| 1174 | Ga0065707_10108638 | |||
| 1175 | Ga0065707_10152149 | |||
| 1176 | Ga0070658_10006079 | |||
| 1177 | Ga0070658_10007539 | |||
| 1178 | Ga0070658_10033078 | |||
| 1179 | Ga0070676_10018740 | |||
| 1180 | Ga0070683_100001872 | |||
| 1181 | Ga0070683_100143088 | |||
| 1182 | Ga0070683_100267073 | |||
| 1183 | Ga0070690_100009881 | |||
| 1184 | Ga0070690_100011634 | |||
| 1185 | Ga0070670_100051478 | |||
| 1186 | Ga0070670_100142780 | |||
| 1187 | Ga0070670_100213692 | |||
| 1188 | Ga0070670_100419587 | |||
| 1189 | Ga0070670_100483759 | |||
| 1190 | Ga0070677_10008296 | |||
| 1191 | Ga0070677_10057974 | |||
| 1192 | Ga0068869_100075238 | |||
| 1193 | Ga0070666_10033282 | |||
| 1194 | Ga0070666_10035602 | |||
| 1195 | Ga0070680_100002868 | |||
| 1196 | Ga0070680_100076261 | |||
| 1197 | Ga0070680_100251639 | |||
| 1198 | Ga0070682_100000695 | |||
| 1199 | Ga0070682_100090544 | |||
| 1200 | Ga0068868_100004036 | |||
| 1201 | Ga0068868_100056301 | |||
| 1202 | Ga0068868_100190261 | |||
| 1203 | Ga0068868_100225707 | |||
| 1204 | Ga0068868_100247739 | |||
| 1205 | Ga0070660_100001014 | |||
| 1206 | Ga0070660_100006040 | |||
| 1207 | Ga0070660_100270239 | |||
| 1208 | Ga0070689_100002731 | |||
| 1209 | Ga0070689_100006121 | |||
| 1210 | Ga0070689_100215246 | |||
| 1211 | Ga0070691_10013966 | |||
| 1212 | Ga0070687_100002464 | |||
| 1213 | Ga0070687_100083047 | |||
| 1214 | Ga0070661_100000081 | |||
| 1215 | Ga0070661_100014181 | |||
| 1216 | Ga0070668_100017049 | |||
| 1217 | Ga0070668_100152766 | |||
| 1218 | Ga0070669_100002322 | |||
| 1219 | Ga0070675_100000240 | |||
| 1220 | Ga0070671_100000154 | |||
| 1221 | Ga0070671_100021816 | |||
| 1222 | Ga0070671_100023570 | |||
| 1223 | Ga0070674_100006119 | |||
| 1224 | Ga0070673_100007045 | |||
| 1225 | Ga0070673_100059784 | |||
| 1226 | Ga0070673_100331342 | |||
| 1227 | Ga0070688_100001905 | |||
| 1228 | Ga0070688_100026190 | |||
| 1229 | Ga0070659_100000267 | |||
| 1230 | Ga0070659_100007610 | |||
| 1231 | Ga0070659_100010913 | |||
| 1232 | Ga0070659_100197060 | |||
| 1233 | Ga0070667_100022893 | |||
| 1234 | Ga0070667_100315931 | |||
| 1235 | Ga0070703_10003896 | |||
| 1236 | Ga0070714_100150374 | |||
| 1237 | Ga0070714_100225914 | |||
| 1238 | Ga0070714_100250124 | |||
| 1239 | Ga0070714_100290711 | |||
| 1240 | Ga0070714_100485269 | |||
| 1241 | Ga0070713_100000381 | |||
| 1242 | Ga0070713_100020065 | |||
| 1243 | Ga0070710_10005621 | |||
| 1244 | Ga0070710_10016551 | |||
| 1245 | Ga0070710_10022539 | |||
| 1246 | Ga0070710_10039215 | |||
| 1247 | Ga0070711_100019336 | |||
| 1248 | Ga0070711_100045069 | |||
| 1249 | Ga0070711_100071213 | |||
| 1250 | Ga0070705_100022183 | |||
| 1251 | Ga0070705_100060393 | |||
| 1252 | Ga0070700_100007981 | |||
| 1253 | Ga0070694_100002780 | |||
| 1254 | Ga0070663_100004180 | |||
| 1255 | Ga0070663_100008652 | |||
| 1256 | Ga0070663_100039989 | |||
| 1257 | Ga0070663_100185458 | |||
| 1258 | Ga0070663_100218735 | |||
| 1259 | Ga0070678_100000466 | |||
| 1260 | Ga0070678_100054156 | |||
| 1261 | Ga0070662_100013331 | |||
| 1262 | Ga0070662_100013532 | |||
| 1263 | Ga0070662_100014065 | |||
| 1264 | Ga0070662_100244223 | |||
| 1265 | Ga0070681_10011001 | |||
| 1266 | Ga0070681_10026535 | |||
| 1267 | Ga0070681_10032324 | |||
| 1268 | Ga0070681_10177839 | |||
| 1269 | Ga0070681_10187431 | |||
| 1270 | Ga0068867_100013497 | |||
| 1271 | Ga0070685_10022962 | |||
| 1272 | Ga0070685_10030759 | |||
| 1273 | Ga0070685_10040191 | |||
| 1274 | Ga0070685_10090239 | |||
| 1275 | Ga0070685_10352483 | |||
| 1276 | Ga0070679_100061423 | |||
| 1277 | Ga0070679_100110736 | |||
| 1278 | Ga0070684_100009261 | |||
| 1279 | Ga0070684_100035555 | |||
| 1280 | Ga0070684_100048346 | |||
| 1281 | Ga0068853_100000018 | |||
| 1282 | Ga0068853_100009694 | |||
| 1283 | Ga0068853_100018128 | |||
| 1284 | Ga0068853_100055702 | |||
| 1285 | Ga0068853_100095001 | |||
| 1286 | Ga0070672_100001847 | |||
| 1287 | Ga0070686_100009029 | |||
| 1288 | Ga0070695_100007070 | |||
| 1289 | Ga0070695_100019487 | |||
| 1290 | Ga0070695_100054062 | |||
| 1291 | Ga0070696_100025756 | |||
| 1292 | Ga0070696_100086725 | |||
| 1293 | Ga0070693_100011440 | |||
| 1294 | Ga0070665_100033061 | |||
| 1295 | Ga0070665_100415575 | |||
| 1296 | Ga0070704_100004531 | |||
| 1297 | Ga0070704_100022446 | |||
| 1298 | Ga0068855_100018700 | |||
| 1299 | Ga0068855_100045702 | |||
| 1300 | Ga0068855_100259486 | |||
| 1301 | Ga0070664_100000139 | |||
| 1302 | Ga0070664_100001002 | |||
| 1303 | Ga0070664_100323895 | |||
| 1304 | Ga0068857_100041010 | |||
| 1305 | Ga0068857_100164926 | |||
| 1306 | Ga0068854_100000042 | |||
| 1307 | Ga0068854_100015350 | |||
| 1308 | Ga0068854_100089811 | |||
| 1309 | Ga0068856_100023460 | |||
| 1310 | Ga0070702_100025374 | |||
| 1311 | Ga0068852_100004985 | |||
| 1312 | Ga0068852_100051947 | |||
| 1313 | Ga0068852_100052341 | |||
| 1314 | Ga0068852_100067068 | |||
| 1315 | Ga0068852_100324084 | |||
| 1316 | Ga0068852_100535761 | |||
| 1317 | Ga0068859_100010808 | |||
| 1318 | Ga0068859_100076391 | |||
| 1319 | Ga0068859_100096718 | |||
| 1320 | Ga0068859_100133270 | |||
| 1321 | Ga0068859_100241281 | |||
| 1322 | Ga0068864_100000139 | |||
| 1323 | Ga0068864_100003922 | |||
| 1324 | Ga0068864_100024286 | |||
| 1325 | Ga0068864_100030575 | |||
| 1326 | Ga0068864_100053453 | |||
| 1327 | Ga0068866_10005476 | |||
| 1328 | Ga0068866_10193249 | |||
| 1329 | Ga0068861_100003710 | |||
| 1330 | Ga0068861_100023937 | |||
| 1331 | Ga0068870_10000157 | |||
| 1332 | Ga0068870_10031956 | |||
| 1333 | Ga0068863_100000674 | |||
| 1334 | Ga0068863_100000769 | |||
| 1335 | Ga0068863_100015953 | |||
| 1336 | Ga0068863_100053128 | |||
| 1337 | Ga0068863_100084214 | |||
| 1338 | Ga0068858_100000107 | |||
| 1339 | Ga0068858_100007301 | |||
| 1340 | Ga0068858_100056802 | |||
| 1341 | Ga0068860_100101946 | |||
| 1342 | Ga0068860_100291285 | |||
| 1343 | Ga0068860_100297307 | |||
| 1344 | Ga0068862_100024990 | |||
| 1345 | Ga0068862_100153278 | |||
| 1346 | Ga0081455_10000059 | |||
| 1347 | Ga0081455_10002427 | |||
| 1348 | Ga0081539_10015684 | |||
| 1349 | Ga0070717_10000161 | |||
| 1350 | Ga0070717_10264242 | |||
| 1351 | Ga0070717_10289620 | |||
| 1352 | Ga0075365_10289910 | |||
| 1353 | Ga0075363_100032141 | |||
| 1354 | Ga0075364_10012857 | |||
| 1355 | Ga0075432_10008600 | |||
| 1356 | Ga0070715_10009422 | |||
| 1357 | Ga0070716_100119805 | |||
| 1358 | Ga0070712_100022489 | |||
| 1359 | Ga0075362_10048252 | |||
| 1360 | Ga0075369_10073687 | |||
| 1361 | Ga0075427_10001329 | |||
| 1362 | Ga0075366_10054571 | |||
| 1363 | Ga0097621_100038788 | |||
| 1364 | Ga0075370_10048661 | |||
| 1365 | Ga0068871_100017953 | |||
| 1366 | Ga0068871_100091354 | |||
| 1367 | Ga0075428_100001505 | |||
| 1368 | Ga0075430_100000070 | |||
| 1369 | Ga0075431_100009121 | |||
| 1370 | Ga0075433_10017583 | |||
| 1371 | Ga0075434_100046801 | |||
| 1372 | Ga0075434_100282465 | |||
| 1373 | Ga0075429_100001029 | |||
| 1374 | Ga0068865_100000131 | |||
| 1375 | Ga0068865_100066350 | |||
| 1376 | Ga0097620_100010810 | |||
| 1377 | Ga0097620_100076390 | |||
| 1378 | Ga0097620_100096709 | |||
| 1379 | Ga0097620_100133268 | |||
| 1380 | Ga0097620_100241280 | |||
| 1381 | Ga0075435_100022284 | |||
| 1382 | Ga0075435_100187428 | |||
| 1383 | Ga0099794_10015192 | |||
| 1384 | Ga0105244_10001072 | |||
| 1385 | Ga0105240_10001685 | |||
| 1386 | Ga0105240_10004942 | |||
| 1387 | Ga0105240_10016520 | |||
| 1388 | Ga0105240_10025053 | |||
| 1389 | Ga0105240_10137083 | |||
| 1390 | Ga0105240_10274444 | |||
| 1391 | Ga0105240_10361389 | |||
| 1392 | Ga0105240_10695389 | |||
| 1393 | Ga0111539_10000138 | |||
| 1394 | Ga0111539_10004385 | |||
| 1395 | Ga0111539_10039247 | |||
| 1396 | Ga0111539_10041584 | |||
| 1397 | Ga0111539_10134101 | |||
| 1398 | Ga0105245_10011704 | |||
| 1399 | Ga0105245_10392756 | |||
| 1400 | Ga0105247_10006310 | |||
| 1401 | Ga0105247_10015808 | |||
| 1402 | Ga0105247_10022803 | |||
| 1403 | Ga0105247_10111510 | |||
| 1404 | Ga0105247_10237907 | |||
| 1405 | Ga0114129_10002312 | |||
| 1406 | Ga0114129_10003950 | |||
| 1407 | Ga0105243_10006299 | |||
| 1408 | Ga0105243_10034798 | |||
| 1409 | Ga0105243_10067549 | |||
| 1410 | Ga0105241_10030880 | |||
| 1411 | Ga0105241_10547417 | |||
| 1412 | Ga0105242_10000964 | |||
| 1413 | Ga0105242_10011160 | |||
| 1414 | Ga0105242_10218094 | |||
| 1415 | Ga0105248_10003045 | |||
| 1416 | Ga0105248_10008262 | |||
| 1417 | Ga0105248_10012777 | |||
| 1418 | Ga0105248_10025646 | |||
| 1419 | Ga0105248_10116434 | |||
| 1420 | Ga0105248_10136825 | |||
| 1421 | Ga0105248_10195579 | |||
| 1422 | Ga0105248_10445223 | |||
| 1423 | Ga0105237_10000640 | |||
| 1424 | Ga0105237_10018866 | |||
| 1425 | Ga0105237_10088192 | |||
| 1426 | Ga0105237_10768790 | |||
| 1427 | Ga0105238_10001491 | |||
| 1428 | Ga0105238_10034621 | |||
| 1429 | Ga0105238_10125581 | |||
| 1430 | Ga0105238_10165229 | |||
| 1431 | Ga0105249_10001029 | |||
| 1432 | Ga0105249_10011087 | |||
| 1433 | Ga0105249_10024785 | |||
| 1434 | Ga0105249_10462987 | |||
| 1435 | Ga0105239_10055043 | |||
| 1436 | Ga0105239_10153419 | |||
| 1437 | Ga0105246_10000702 | |||
| 1438 | Ga0105246_10024538 | |||
| 1439 | Ga0157373_10040674 | |||
| 1440 | Ga0157373_10079535 | |||
| 1441 | Ga0157371_10016173 | |||
| 1442 | Ga0157371_10030802 | |||
| 1443 | Ga0157371_10057504 | |||
| 1444 | Ga0157371_10058497 | |||
| 1445 | Ga0157370_10011601 | |||
| 1446 | Ga0157370_10082608 | |||
| 1447 | Ga0157370_10277280 | |||
| 1448 | Ga0157369_10004311 | |||
| 1449 | Ga0157369_10082715 | |||
| 1450 | Ga0157369_10348360 | |||
| 1451 | Ga0157374_10000671 | |||
| 1452 | Ga0157378_10078192 | |||
| 1453 | Ga0157378_10096085 | |||
| 1454 | Ga0163162_10083846 | |||
| 1455 | Ga0163162_10092055 | |||
| 1456 | Ga0163162_10185831 | |||
| 1457 | Ga0157372_10006177 | |||
| 1458 | Ga0157372_10779641 | |||
| 1459 | Ga0157375_10002753 | |||
| 1460 | Ga0157375_10002908 | |||
| 1461 | Ga0157375_10037714 | |||
| 1462 | Ga0157375_10114363 | |||
| 1463 | Ga0157375_10391285 | |||
| 1464 | Ga0163163_10008084 | |||
| 1465 | Ga0163163_10138133 | |||
| 1466 | Ga0163163_10175574 | |||
| 1467 | Ga0157380_10005886 | |||
| 1468 | Ga0157380_10059733 | |||
| 1469 | Ga0157377_10106460 | |||
| 1470 | Ga0157379_10000345 | |||
| 1471 | Ga0157379_10025251 | |||
| 1472 | Ga0157379_10051050 | |||
| 1473 | Ga0157376_10006980 | |||
| 1474 | Ga0157376_10021144 | |||
| 1475 | Ga0163161_10015507 | |||
| 1476 | Ga0163161_10020141 | |||
| 1477 | Ga0163161_10150364 | |||
| 1478 | Ga0197907_10955117 | |||
| 1479 | Ga0206353_11093575 | |||
| 1480 | Ga0213872_10054048 | |||
| 1481 | Ga0209026_1000247 | |||
| 1482 | Ga0209759_1000585 | |||
| 1483 | Ga0209233_1000010 | |||
| 1484 | Ga0207666_1000069 | |||
| 1485 | Ga0209130_1000127 | |||
| 1486 | Ga0207673_1000178 | |||
| 1487 | Ga0209758_1000257 | |||
| 1488 | Ga0207426_1009253 | |||
| 1489 | Ga0207697_10000390 | |||
| 1490 | Ga0207655_1000250 | |||
| 1491 | Ga0207682_10000048 | |||
| 1492 | Ga0207692_10018051 | |||
| 1493 | Ga0207642_10003255 | |||
| 1494 | Ga0207642_10135069 | |||
| 1495 | Ga0207710_10004679 | |||
| 1496 | Ga0207710_10005833 | |||
| 1497 | Ga0207710_10026924 | |||
| 1498 | Ga0207710_10048485 | |||
| 1499 | Ga0207688_10001496 | |||
| 1500 | Ga0207688_10047650 | |||
| 1501 | Ga0207680_10032418 | |||
| 1502 | Ga0207647_10006274 | |||
| 1503 | Ga0207647_10007330 | |||
| 1504 | Ga0207647_10012466 | |||
| 1505 | Ga0207699_10003447 | |||
| 1506 | Ga0207699_10074109 | |||
| 1507 | Ga0207699_10108599 | |||
| 1508 | Ga0207645_10012526 | |||
| 1509 | Ga0207645_10097383 | |||
| 1510 | Ga0207643_10000581 | |||
| 1511 | Ga0207705_10022458 | |||
| 1512 | Ga0207705_10026050 | |||
| 1513 | Ga0207654_10004716 | |||
| 1514 | Ga0207654_10016465 | |||
| 1515 | Ga0207707_10016616 | |||
| 1516 | Ga0207707_10030130 | |||
| 1517 | Ga0207695_10013062 | |||
| 1518 | Ga0207695_10027399 | |||
| 1519 | Ga0207695_10102424 | |||
| 1520 | Ga0207695_10134010 | |||
| 1521 | Ga0207671_10000566 | |||
| 1522 | Ga0207671_10050362 | |||
| 1523 | Ga0207693_10010010 | |||
| 1524 | Ga0207693_10105498 | |||
| 1525 | Ga0207663_10078086 | |||
| 1526 | Ga0207660_10000192 | |||
| 1527 | Ga0207660_10015932 | |||
| 1528 | Ga0207662_10000647 | |||
| 1529 | Ga0207662_10103926 | |||
| 1530 | Ga0207662_10159669 | |||
| 1531 | Ga0207657_10020011 | |||
| 1532 | Ga0207657_10025383 | |||
| 1533 | Ga0207657_10205632 | |||
| 1534 | Ga0207649_10000002 | |||
| 1535 | Ga0207649_10000141 | |||
| 1536 | Ga0207652_10004519 | |||
| 1537 | Ga0207652_10109875 | |||
| 1538 | Ga0207652_10137010 | |||
| 1539 | Ga0207646_10294044 | |||
| 1540 | Ga0207681_10000359 | |||
| 1541 | Ga0207694_10104922 | |||
| 1542 | Ga0207694_10113783 | |||
| 1543 | Ga0207694_10203467 | |||
| 1544 | Ga0207650_10004853 | |||
| 1545 | Ga0207650_10084770 | |||
| 1546 | Ga0207650_10145943 | |||
| 1547 | Ga0207659_10000052 | |||
| 1548 | Ga0207659_10128444 | |||
| 1549 | Ga0207687_10000097 | |||
| 1550 | Ga0207687_10069093 | |||
| 1551 | Ga0207664_10235893 | |||
| 1552 | Ga0207664_10253201 | |||
| 1553 | Ga0207664_10278537 | |||
| 1554 | Ga0207664_10367927 | |||
| 1555 | Ga0207644_10000225 | |||
| 1556 | Ga0207690_10000278 | |||
| 1557 | Ga0207690_10000726 | |||
| 1558 | Ga0207690_10023290 | |||
| 1559 | Ga0207690_10222593 | |||
| 1560 | Ga0207706_10010711 | |||
| 1561 | Ga0207706_10017295 | |||
| 1562 | Ga0207706_10022229 | |||
| 1563 | Ga0207706_10356671 | |||
| 1564 | Ga0207686_10000850 | |||
| 1565 | Ga0207686_10003977 | |||
| 1566 | Ga0207686_10005384 | |||
| 1567 | Ga0207686_10025318 | |||
| 1568 | Ga0207686_10064705 | |||
| 1569 | Ga0207709_10000987 | |||
| 1570 | Ga0207709_10014956 | |||
| 1571 | Ga0207709_10037377 | |||
| 1572 | Ga0207709_10151433 | |||
| 1573 | Ga0207709_10325588 | |||
| 1574 | Ga0207670_10000781 | |||
| 1575 | Ga0207670_10018257 | |||
| 1576 | Ga0207669_10000168 | |||
| 1577 | Ga0207669_10179822 | |||
| 1578 | Ga0207669_10287974 | |||
| 1579 | Ga0207704_10000704 | |||
| 1580 | Ga0207704_10029602 | |||
| 1581 | Ga0207665_10000248 | |||
| 1582 | Ga0207665_10024638 | |||
| 1583 | Ga0207665_10117977 | |||
| 1584 | Ga0207691_10003348 | |||
| 1585 | Ga0207691_10127690 | |||
| 1586 | Ga0207691_10228158 | |||
| 1587 | Ga0207691_10294460 | |||
| 1588 | Ga0207711_10006180 | |||
| 1589 | Ga0207711_10036231 | |||
| 1590 | Ga0207711_10050078 | |||
| 1591 | Ga0207711_10092772 | |||
| 1592 | Ga0207711_10112749 | |||
| 1593 | Ga0207711_10115044 | |||
| 1594 | Ga0207711_10182894 | |||
| 1595 | Ga0207689_10012368 | |||
| 1596 | Ga0207689_10066148 | |||
| 1597 | Ga0207661_10000143 | |||
| 1598 | Ga0207679_10000006 | |||
| 1599 | Ga0207679_10000035 | |||
| 1600 | Ga0207679_10244154 | |||
| 1601 | Ga0207667_10031667 | |||
| 1602 | Ga0207667_10039655 | |||
| 1603 | Ga0207667_10186756 | |||
| 1604 | Ga0207667_10202498 | |||
| 1605 | Ga0207651_10000080 | |||
| 1606 | Ga0207651_10041829 | |||
| 1607 | Ga0207712_10003380 | |||
| 1608 | Ga0207712_10007061 | |||
| 1609 | Ga0207712_10247442 | |||
| 1610 | Ga0207668_10006479 | |||
| 1611 | Ga0207640_10000002 | |||
| 1612 | Ga0207640_10003188 | |||
| 1613 | Ga0207640_10061809 | |||
| 1614 | Ga0207658_10028523 | |||
| 1615 | Ga0207658_10170407 | |||
| 1616 | Ga0207677_10022723 | |||
| 1617 | Ga0207677_10172015 | |||
| 1618 | Ga0207677_10189598 | |||
| 1619 | Ga0207703_10000146 | |||
| 1620 | Ga0207703_10026475 | |||
| 1621 | Ga0207703_10033869 | |||
| 1622 | Ga0207703_10098826 | |||
| 1623 | Ga0207639_10000011 | |||
| 1624 | Ga0207639_10021647 | |||
| 1625 | Ga0207639_10101334 | |||
| 1626 | Ga0207639_10238818 | |||
| 1627 | Ga0207678_10002636 | |||
| 1628 | Ga0207678_10005116 | |||
| 1629 | Ga0207678_10038030 | |||
| 1630 | Ga0207678_10104213 | |||
| 1631 | Ga0207708_10008117 | |||
| 1632 | Ga0207708_10034651 | |||
| 1633 | Ga0207641_10000019 | |||
| 1634 | Ga0207641_10009143 | |||
| 1635 | Ga0207641_10010979 | |||
| 1636 | Ga0207641_10069889 | |||
| 1637 | Ga0207641_10095692 | |||
| 1638 | Ga0207641_10112240 | |||
| 1639 | Ga0207648_10005438 | |||
| 1640 | Ga0207648_10261904 | |||
| 1641 | Ga0207676_10000689 | |||
| 1642 | Ga0207676_10000924 | |||
| 1643 | Ga0207676_10066670 | |||
| 1644 | Ga0207676_10106263 | |||
| 1645 | Ga0207676_10112535 | |||
| 1646 | Ga0207674_10002206 | |||
| 1647 | Ga0207674_10043375 | |||
| 1648 | Ga0207674_10102983 | |||
| 1649 | Ga0207675_100002223 | |||
| 1650 | Ga0207675_100003721 | |||
| 1651 | Ga0207675_100056999 | |||
| 1652 | Ga0207675_100329711 | |||
| 1653 | Ga0207683_10002096 | |||
| 1654 | Ga0207683_10003030 | |||
| 1655 | Ga0207683_10042030 | |||
| 1656 | Ga0207698_10003387 | |||
| 1657 | Ga0207698_10019224 | |||
| 1658 | Ga0207698_10027888 | |||
| 1659 | Ga0207698_10082895 | |||
| 1660 | Ga0209970_1010035 | |||
| 1661 | Ga0209971_1006717 | |||
| 1662 | Ga0209966_1000361 | |||
| 1663 | Ga0209966_1003787 | |||
| 1664 | Ga0209998_10000497 | |||
| 1665 | Ga0209974_10002220 | |||
| 1666 | Ga0207428_10000075 | |||
| 1667 | Ga0207428_10000428 | |||
| 1668 | Ga0207428_10001396 | |||
| 1669 | Ga0268266_10054184 | |||
| 1670 | Ga0268266_10111068 | |||
| 1671 | Ga0268265_10011841 | |||
| 1672 | Ga0268265_10414395 | |||
| 1673 | Ga0268264_10001145 | |||
| 1674 | Ga0268264_10034235 | |||
| 1675 | Ga0268264_10045961 | |||
| 1676 | Ga0265337_1000182 | |||
| 1677 | Ga0265338_10124251 | |||
| 1678 | Ga0307511_10000291 | |||
| 1679 | Ga0265325_10000034 | |||
| 1680 | Ga0265325_10001708 | |||
| 1681 | Ga0265325_10004871 | |||
| 1682 | Ga0265325_10012202 | |||
| 1683 | Ga0265325_10096502 | |||
| 1684 | Ga0265316_10006848 | |||
| 1685 | Ga0307408_100001146 | |||
| 1686 | Ga0307408_100281057 | |||
| 1687 | Ga0265313_10000176 | |||
| 1688 | Ga0265313_10004374 | |||
| 1689 | Ga0265313_10007339 | |||
| 1690 | Ga0265313_10023429 | |||
| 1691 | Ga0265313_10046756 | |||
| 1692 | Ga0316575_10092720 | |||
| 1693 | Ga0316579_10003856 | |||
| 1694 | Ga0265314_10030315 | |||
| 1695 | Ga0265314_10110664 | |||
| 1696 | Ga0265314_10130674 | |||
| 1697 | Ga0265342_10000203 | |||
| 1698 | Ga0316576_10011911 | |||
| 1699 | Ga0316578_10115324 | |||
| 1700 | Ga0307405_10001776 | |||
| 1701 | Ga0307413_10005612 | |||
| 1702 | Ga0307410_10004736 | |||
| 1703 | Ga0307406_10001441 | |||
| 1704 | Ga0307406_10053050 | |||
| 1705 | Ga0307407_10141308 | |||
| 1706 | Ga0307412_10021099 | |||
| 1707 | Ga0307409_100004538 | |||
| 1708 | Ga0307409_100472484 | |||
| 1709 | Ga0307416_100019486 | |||
| 1710 | Ga0307414_10012226 | |||
| 1711 | Ga0307411_10005510 | |||
| 1712 | Ga0307415_100014047 | |||
| 1713 | Ga0316583_10006403 | |||
| 1714 | Ga0373948_0000065 | |||
| 1715 | Ga0373948_0014839 | |||
| 1716 | Ga0373950_0001171 | |||
| 1717 | Ga0373950_0005103 | |||
| 1718 | Ga0373950_0011810 | |||
| 1719 | Ga0373958_0000282 | |||
| 1720 | Ga0373958_0032695 | |||
| 1721 | Ga0373938_0000777 | |||
| 1722 | Ga0373938_0001840 | |||
| 1723 | Ga0373938_0006623 | |||
| 1724 | Ga0373926_0002077 | |||
| 1725 | Ga0373926_0013283 | |||
| 1726 | Ga0373926_0047284 | |||
| 1727 | Ga0373928_0004487 | |||
| 1728 | Ga0373929_0005286 | |||
| 1729 | Ga0373944_0000062 | |||
| 1730 | Ga0373949_0004625 | |||
| 1731 | Ga0373949_0006491 | |||
| 1732 | Ga0373949_0009081 | |||
| 1733 | Ga0373951_0003492 | |||
| 1734 | Ga0373951_0007214 | |||
| 1735 | Ga0373951_0012834 | |||
| 1736 | Ga0373923_0000277 | |||
| 1737 | Ga0373923_0051488 | |||
| 1738 | Ga0373932_0003427 | |||
| 1739 | Ga0373936_0000954 | |||
| 1740 | Ga0373936_0033507 | |||
| 1741 | Ga0373939_0004196 | |||
| 1742 | Ga0373939_0006980 | |||
| 1743 | Ga0373939_0027672 | |||
| 1744 | Ga0373941_0000106 | |||
| 1745 | Ga0373941_0000814 | |||
| 1746 | Ga0373941_0005921 | |||
| 1747 | Ga0373945_0000835 | |||
| 1748 | Ga0373945_0012682 | |||
| 1749 | Ga0373953_0000952 | |||
| 1750 | Ga0373953_0076015 | |||
| 1751 | Ga0373954_0009787 | |||
| 1752 | Ga0373954_0022174 | |||
| 1753 | Ga0373956_0004014 | |||
| 1754 | Ga0373956_0043834 | |||
| 1755 | Ga0373956_0053581 | |||
| 1756 | Ga0373957_0002130 | |||
| 1757 | Ga0373957_0024303 | |||
| 1758 | Ga0373957_0025922 | |||
| 1759 | Ga0373960_0001001 | |||
| 1760 | Ga0373960_0013941 | |||
| 1761 | Ga0373960_0053859 | |||
| 1762 | Ga0373943_0006335 | |||
| 1763 | Ga0373943_0098172 | |||
| 1764 | Ga0373946_0006149 | |||
| 1765 | Ga0373946_0134698 | |||
| 1766 | Ga0373955_0000366 | |||
| 1767 | Ga0373955_0007022 | |||
| 1768 | Ga0373955_0007406 | |||
| 1769 | Ga0373955_0089365 | |||
| 1770 | Ga0373942_0001640 | |||
| 1771 | Ga0373961_0002190 | |||
| 1772 | Ga0373961_0002208 | |||
| 1773 | Ga0373961_0020933 | |||
| 1774 | Ga0373962_0003389 | |||
| 1775 | Ga0373962_0004553 | |||
| 1776 | Ga0373962_0033716 | |||
| 1777 | Ga0373924_0009639 | |||
| 1778 | Ga0373924_0053141 | |||
| 1779 | Ga0373931_0005024 | |||
| 1780 | Ga0373931_0009616 | |||
| 1781 | Ga0373931_0010271 | |||
| 1782 | Ga0373931_0028546 | |||
| 1783 | Ga0373931_0034953 | |||
| 1784 | Ga0373935_0005922 | |||
| 1785 | Ga0373935_0029047 | |||
| 1786 | Ga0373935_0122379 | |||
| 1787 | Ga0373927_0005034 | |||
| 1788 | Ga0373927_0024309 | |||
| 1789 | Ga0373933_0002037 | |||
| 1790 | Ga0373933_0039421 | |||
| 1791 | Ga0373933_0256230 | |||
| 1792 | Ga0373947_0008074 | |||
| 1793 | Ga0373947_0033652 | |||
| 1794 | Ga0373937_0011894 | |||
| 1795 | Ga0373937_0101052 | |||
| 1796 | Ga0373937_0319810 | |||
| 1797 | Ga0373937_0337392 | |||
| 1798 | Ga0316582_0202185 | |||
| 1799 | Ga0316584_0012138 | |||
| 1800 | Ga0373925_0011407 | |||
| 1801 | Ga0373925_0025151 | |||
| 1802 | Ga0373925_0027591 | |||
| 1803 | Ga0395900_0166586 | |||
| 1804 | Ga0395898_0018005 | |||
| 1805 | Ga0395898_0394160 | |||
| 1806 | Ga0436364_0691178 | |||
| 1807 | Ga0436364_1036119 | |||
| 1808 | Ga0395901_0022846 | |||
| 1809 | Ga0395901_0270169 | |||
| 1810 | Ga0395901_0402455 | |||
| 1811 | Ga0395901_0533749 | |||
| 1812 | Ga0242420_001233 | |||
| 1813 | Ga0436365_0172579 | |||
| 1814 | Ga0436365_1426756 | |||
| 1815 | Ga0436360_0887432 | |||
| 1816 | Ga0436360_1192721 | |||
| 1817 | Ga0436361_0100122 | |||
| 1818 | Ga0439465_0048575 | |||
| 1819 | Ga0439450_030666 | |||
| 1820 | Ga0439464_0005865 | |||
| 1821 | Ga0439460_0017448 | |||
| 1822 | Ga0451577_0002773 | |||
| 1823 | Ga0451577_0148078 | |||
| 1824 | Ga0466972_0058984 | |||
| 1825 | Ga0466966_0051582 | |||
| 1826 | Ga0466963_0096531 | |||
| 1827 | Ga0466963_0179815 | |||
| 1828 | Ga0453684_0096506 | |||
| 1829 | Ga0466971_0036701 | |||
| 1830 | Ga0466957_0071246 | |||
| 1831 | Ga0451576_0033902 | |||
| 1832 | Ga0466958_0020700 | |||
| 1833 | Ga0466958_0168794 | |||
| 1834 | Ga0495592_0004523 | |||
| 1835 | Ga0495592_0007319 | |||
| 1836 | Ga0495592_0040735 | |||
| 1837 | Ga0495592_0085768 | |||
| 1838 | Ga0495603_0023095 | |||
| 1839 | Ga0495629_0002524 | |||
| 1840 | Ga0495629_0110388 | |||
| 1841 | Ga0495629_0257427 | |||
| 1842 | Ga0495641_0031426 | |||
| 1843 | Ga0495651_0001150 | |||
| 1844 | Ga0495651_0006953 | |||
| 1845 | Ga0495651_0022942 | |||
| 1846 | Ga0495651_0097364 | |||
| 1847 | Ga0495651_0170838 | |||
| 1848 | Ga0495651_0174188 | |||
| 1849 | Ga0495653_0001957 | |||
| 1850 | Ga0495653_0005444 | |||
| 1851 | Ga0495653_0154954 | |||
| 1852 | Ga0495653_0180896 | |||
| 1853 | Ga0495580_0001416 | |||
| 1854 | Ga0495580_0111346 | |||
| 1855 | Ga0495582_0010346 | |||
| 1856 | Ga0495582_0100768 | |||
| 1857 | Ga0495582_0115004 | |||
| 1858 | Ga0495639_0037998 | |||
| 1859 | Ga0495639_0039086 | |||
| 1860 | Ga0495662_0002039 | |||
| 1861 | Ga0495662_0097708 | |||
| 1862 | Ga0495664_0000178 | |||
| 1863 | Ga0495585_0015366 | |||
| 1864 | Ga0495594_0039888 | |||
| 1865 | Ga0495607_0020707 | |||
| 1866 | Ga0495608_0028250 | |||
| 1867 | Ga0495608_0033409 | |||
| 1868 | Ga0495608_0186577 | |||
| 1869 | Ga0495618_0003454 | |||
| 1870 | Ga0495618_0003686 | |||
| 1871 | Ga0495628_0001448 | |||
| 1872 | Ga0495628_0015343 | |||
| 1873 | Ga0495630_0115166 | |||
| 1874 | Ga0495644_0001111 | |||
| 1875 | Ga0495663_0008874 | |||
| 1876 | Ga0495666_0000187 | |||
| 1877 | Ga0495652_0002796 | |||
| 1878 | Ga0495652_0247550 | |||
| 1879 | Ga0495665_0006213 | |||
| 1880 | Ga0495665_0090325 | |||
| 1881 | Ga0495586_0002551 | |||
| 1882 | Ga0495587_0002720 | |||
| 1883 | Ga0495587_0015317 | |||
| 1884 | Ga0495587_0095443 | |||
| 1885 | Ga0495621_0011194 | |||
| 1886 | Ga0495645_0000522 | |||
| 1887 | Ga0495645_0001292 | |||
| 1888 | Ga0495645_0007248 | |||
| 1889 | Ga0495622_0001697 | |||
| 1890 | Ga0495633_0001257 | |||
| 1891 | Ga0495667_0002931 | |||
| 1892 | Ga0495667_0005933 | |||
| 1893 | Ga0495667_0006134 | |||
| 1894 | Ga0495656_0015028 | |||
| 1895 | Ga0495634_0012378 | |||
| 1896 | Ga0495634_0101767 | |||
| 1897 | Ga0495634_0189104 | |||
| 1898 | Ga0495611_0006562 | |||
| 1899 | Ga0495635_0001359 | |||
| 1900 | Ga0495635_0011040 | |||
| 1901 | Ga0495635_0035852 | |||
| 1902 | Ga0495635_0044877 | |||
| 1903 | Ga0495635_0326647 | |||
| 1904 | Ga0495588_0001695 | |||
| 1905 | Ga0495588_0024698 | |||
| 1906 | Ga0495657_0002130 | |||
| 1907 | Ga0495657_0013898 | |||
| 1908 | Ga0495657_0085536 | |||
| 1909 | Ga0495599_0000806 | |||
| 1910 | Ga0495599_0004778 | |||
| 1911 | Ga0495599_0033744 | |||
| 1912 | Ga0495623_0002737 | |||
| 1913 | Ga0495623_0008946 | |||
| 1914 | Ga0495646_0006963 | |||
| 1915 | Ga0495646_0050973 | |||
| 1916 | Ga0495646_0071789 | |||
| 1917 | Ga0495646_0100440 | |||
| 1918 | Ga0495647_0000638 | |||
| 1919 | Ga0495658_0004284 | |||
| 1920 | Ga0495669_0063805 | |||
| 1921 | Ga0495613_0012243 | |||
| 1922 | Ga0495613_0018093 | |||
| 1923 | Ga0495624_0015494 | |||
| 1924 | Ga0495670_0005583 | |||
| 1925 | Ga0495589_0010162 | |||
| 1926 | Ga0495600_0001998 | |||
| 1927 | Ga0495600_0008547 | |||
| 1928 | Ga0495600_0020095 | |||
| 1929 | Ga0495600_0053557 | |||
| 1930 | Ga0495600_0067779 | |||
| 1931 | Ga0495581_0014671 | |||
| 1932 | Ga0495581_0067476 | |||
| 1933 | Ga0495604_0001423 | |||
| 1934 | Ga0495604_0005209 | |||
| 1935 | Ga0495604_0016854 | |||
| 1936 | Ga0495604_0023581 | |||
| 1937 | Ga0495674_0015888 | |||
| 1938 | Ga0495674_0258405 | |||
| 1939 | Ga0495676_0055349 | |||
| 1940 | Ga0495680_0001491 | |||
| 1941 | Ga0495680_0003802 | |||
| 1942 | Ga0495680_0007295 | |||
| 1943 | Ga0495680_0050340 | |||
| 1944 | Ga0495680_0074874 | |||
| 1945 | Ga0495680_0097280 | |||
| 1946 | Ga0495687_000406 | |||
| 1947 | Ga0495675_0000657 | |||
| 1948 | Ga0495675_0046956 | |||
| 1949 | Ga0495675_0114346 | |||
| 1950 | Ga0495684_0000711 | |||
| 1951 | Ga0495684_0011970 | |||
| 1952 | Ga0495684_0138923 | |||
| 1953 | Ga0495684_0304263 | |||
| 1954 | Ga0495593_0000309 | |||
| 1955 | Ga0495593_0035254 | |||
| 1956 | Ga0495602_0014126 | |||
| 1957 | Ga0495602_0017283 | |||
| 1958 | Ga0495602_0042861 | |||
| 1959 | Ga0495602_0092565 | |||
| 1960 | Ga0495602_0168195 | |||
| 1961 | Ga0495614_0003292 | |||
| 1962 | Ga0496100_0000203 | |||
| 1963 | Ga0496100_0016419 | |||
| 1964 | Ga0496100_0111390 | |||
| 1965 | Ga0496101_0026542 | |||
| 1966 | Ga0496101_0032429 | |||
| 1967 | Ga0496101_0217067 | |||
| 1968 | Ga0496102_0004838 | |||
| 1969 | Ga0496102_0022976 | |||
| 1970 | Ga0496102_0130067 | |||
| 1971 | Ga0496102_0140143 | |||
| 1972 | Ga0496103_0001529 | |||
| 1973 | Ga0496103_0006837 | |||
| 1974 | Ga0496104_0000317 | |||
| 1975 | Ga0496104_0019322 | |||
| 1976 | Ga0496104_0063751 | |||
| 1977 | Ga0496104_0115458 | |||
| 1978 | Ga0496105_0000485 | |||
| 1979 | Ga0496105_0008071 | |||
| 1980 | Ga0496105_0088533 | |||
| 1981 | Ga0496105_0248480 | |||
| 1982 | Ga0496106_0002909 | |||
| 1983 | Ga0496106_0021657 | |||
| 1984 | Ga0496106_0031693 | |||
| 1985 | Ga0496106_0070128 | |||
| 1986 | Ga0496106_0404301 | |||
| 1987 | Ga0496107_0000268 | |||
| 1988 | Ga0496107_0013083 | |||
| 1989 | Ga0496107_0027599 | |||
| 1990 | Ga0496107_0277471 | |||
| 1991 | Ga0496108_0008793 | |||
| 1992 | Ga0496108_0015269 | |||
| 1993 | Ga0496108_0049947 | |||
| 1994 | Ga0496108_0449648 | |||
| 1995 | Ga0496109_0007775 | |||
| 1996 | Ga0496109_0014079 | |||
| 1997 | Ga0496109_0017745 | |||
| 1998 | Ga0496109_0047388 | |||
| 1999 | Ga0496109_0117220 | |||
| 2000 | Ga0496109_0128158 | |||
| 2001 | Ga0496109_0197694 | |||
| 2002 | Ga0496110_0043830 | |||
| 2003 | Ga0496110_0116904 | |||
| 2004 | Ga0496110_0390684 | |||
| 2005 | Ga0496111_0035908 | |||
| 2006 | Ga0496111_0198822 | |||
| 2007 | Ga0496112_0032191 | |||
| 2008 | Ga0496112_0534899 | |||
| 2009 | Ga0496113_0004401 | |||
| 2010 | Ga0496113_0012044 | |||
| 2011 | Ga0496113_0059732 | |||
| 2012 | Ga0496113_0127484 | |||
| 2013 | Ga0496114_0006070 | |||
| 2014 | Ga0496114_0013910 | |||
| 2015 | Ga0496114_0210165 | |||
| 2016 | Ga0496114_0515009 | |||
| 2017 | Ga0496115_0018077 | |||
| 2018 | Ga0496115_0049636 | |||
| 2019 | Ga0496115_0058081 | |||
| 2020 | Ga0496115_0063544 | |||
| 2021 | Ga0496115_0075050 | |||
| 2022 | Ga0496115_0187624 | |||
| 2023 | Ga0496118_0085656 | |||
| 2024 | Ga0496119_0054970 | |||
| 2025 | Ga0496120_0000909 | |||
| 2026 | Ga0496124_0023662 | |||
| 2027 | Ga0496125_0025536 | |||
| 2028 | Ga0501031_0082494 | |||
| 2029 | Ga0501032_0031388 | |||
| 2030 | Ga0501032_0035059 | |||
| 2031 | Ga0501032_0043106 | |||
| 2032 | Ga0501032_0057988 | |||
| 2033 | Ga0501033_0002073 | |||
| 2034 | Ga0501033_0024802 | |||
| 2035 | Ga0501033_0057242 | |||
| 2036 | Ga0501034_0001131 | |||
| 2037 | Ga0501034_0002653 | |||
| 2038 | Ga0501034_0014877 | |||
| 2039 | Ga0501034_0020143 | |||
| 2040 | Ga0501034_0136041 | |||
| 2041 | Ga0501034_0138981 | |||
| 2042 | Ga0501034_0149334 | |||
| 2043 | Ga0501034_0181219 | |||
| 2044 | Ga0501034_0216343 | |||
| 2045 | Ga0501036_0001536 | |||
| 2046 | Ga0501036_0022944 | |||
| 2047 | Ga0501036_0025987 | |||
| 2048 | Ga0501036_0041082 | |||
| 2049 | Ga0501037_0005604 | |||
| 2050 | Ga0501037_0018589 | |||
| 2051 | Ga0501037_0038014 | |||
| 2052 | Ga0501037_0054611 | |||
| 2053 | Ga0501037_0089624 | |||
| 2054 | Ga0501038_0009911 | |||
| 2055 | Ga0501038_0043871 | |||
| 2056 | Ga0501038_0212128 | |||
| 2057 | Ga0501039_0016262 | |||
| 2058 | Ga0501039_0017229 | |||
| 2059 | Ga0501040_0080822 | |||
| 2060 | Ga0501043_0000736 | |||
| 2061 | Ga0501043_0040782 | |||
| 2062 | Ga0501043_0045564 | |||
| 2063 | Ga0501043_0053270 | |||
| 2064 | Ga0501043_0191143 | |||
| 2065 | Ga0501046_0009584 | |||
| 2066 | Ga0501046_0107601 | |||
| 2067 | Ga0501047_0000124 | |||
| 2068 | Ga0501047_0026327 | |||
| 2069 | Ga0501047_0037811 | |||
| 2070 | Ga0501047_0042592 | |||
| 2071 | Ga0501047_0046378 | |||
| 2072 | Ga0501047_0116109 | |||
| 2073 | Ga0501048_0000566 | |||
| 2074 | Ga0501048_0034416 | |||
| 2075 | Ga0501068_0011085 | |||
| 2076 | Ga0501068_0022673 | |||
| 2077 | Ga0501069_0012763 | |||
| 2078 | Ga0501069_0050995 | |||
| 2079 | Ga0501070_0015997 | |||
| 2080 | Ga0501070_0022848 | |||
| 2081 | Ga0501070_0023849 | |||
| 2082 | Ga0501070_0025834 | |||
| 2083 | Ga0501070_0044982 | |||
| 2084 | Ga0501071_0025639 | |||
| 2085 | Ga0501072_0007804 | |||
| 2086 | Ga0501072_0127733 | |||
| 2087 | Ga0501073_0007018 | |||
| 2088 | Ga0501073_0031043 | |||
| 2089 | Ga0501073_0038432 | |||
| 2090 | Ga0501073_0063109 | |||
| 2091 | Ga0501073_0139682 | |||
| 2092 | Ga0501074_0007534 | |||
| 2093 | Ga0501074_0029328 | |||
| 2094 | Ga0501074_0045167 | |||
| 2095 | Ga0501074_0285716 | |||
| 2096 | Ga0501076_0280793 | |||
| 2097 | Ga0501079_0035277 | |||
| 2098 | Ga0501079_0081212 | |||
| 2099 | Ga0501079_0168315 | |||
| 2100 | Ga0501080_0000130 | |||
| 2101 | Ga0501080_0034272 | |||
| 2102 | Ga0501080_0068873 | |||
| 2103 | Ga0501080_0174238 | |||
| 2104 | Ga0501083_0000480 | |||
| 2105 | Ga0501083_0018924 | |||
| 2106 | Ga0501083_0040857 | |||
| 2107 | Ga0501083_0063766 | |||
| 2108 | Ga0501083_0176596 | |||
| 2109 | Ga0501035_0004040 | |||
| 2110 | Ga0501035_0026081 | |||
| 2111 | Ga0501035_0030901 | |||
| 2112 | Ga0501035_0117695 | |||
| 2113 | Ga0501044_0014077 | |||
| 2114 | Ga0501044_0059472 | |||
| 2115 | Ga0501044_0177933 | |||
| 2116 | Ga0501044_0311501 | |||
| 2117 | Ga0501045_0284825 | |||
| 2118 | nmdc:mga03683_3421_c1 | |||
| 2119 | nmdc:mga00v17_8120_c1 | |||
| 2120 | nmdc:mga0k408_38147_c1 | |||
| 2121 | nmdc:mga0k408_64735_c1 | |||
| 2122 | nmdc:mga0k408_6713_c1 | |||
| 2123 | nmdc:mga05p37_32_c1 | |||
| 2124 | nmdc:mga09592_17661_c1 | |||
| 2125 | nmdc:mga0qj67_355_c1 | |||
| 2126 | nmdc:mga06r32_5297_c1 | |||
| 2127 | nmdc:mga08y16_19018_c1 | |||
| 2128 | nmdc:mga08y16_2238_c1 | |||
| 2129 | nmdc:mga08y16_63045_c1 | |||
| 2130 | nmdc:mga0n895_182476_c1 | |||
| 2131 | nmdc:mga0n895_41527_c1 | |||
| 2132 | nmdc:mga0n895_547_c1 | |||
| 2133 | nmdc:mga0n895_79500_c1 | |||
| 2134 | nmdc:mga0rr50_219930_c1 | |||
| 2135 | nmdc:mga0rr50_4724_c1 | |||
| 2136 | nmdc:mga0rr50_93917_c1 | |||
| 2137 | nmdc:mga08x19_326271_c1 | |||
| 2138 | nmdc:mga0a205_26502_c1 | |||
| 2139 | nmdc:mga0a205_6205_c1 | |||
| 2140 | nmdc:mga0a205_629_c1 | |||
| 2141 | Ga0495601_0000521 | |||
| 2142 | Ga0495601_0011745 | |||
| 2143 | Ga0495601_0054336 | |||
| 2144 | Ga0495601_0076766 | |||
| 2145 | Ga0495601_0098858 | |||
| 2146 | Ga0495601_0151902 | |||
| 2147 | Ga0495612_0001070 | |||
| 2148 | Ga0495612_0003633 | |||
| 2149 | Ga0495612_0029848 | |||
| 2150 | Ga0495595_0000186 | |||
| 2151 | Ga0495595_0001827 | |||
| 2152 | Ga0495595_0002111 | |||
| 2153 | Ga0495595_0002555 | |||
| 2154 | Ga0495595_0009359 | |||
| 2155 | Ga0495619_0000016 | |||
| 2156 | Ga0495619_0000670 | |||
| 2157 | Ga0495619_0002830 | |||
| 2158 | Ga0495619_0035595 | |||
| 2159 | Ga0495619_0047542 | |||
| 2160 | Ga0495619_0047982 | |||
| 2161 | Ga0495619_0211639 | |||
| 2162 | Ga0500643_012507 | |||
| 2163 | Ga0500646_0000594 | |||
| 2164 | Ga0500641_0026450 | |||
| 2165 | Ga0500595_000010 | |||
| 2166 | Ga0500607_002934 | |||
| 2167 | Ga0500658_0000447 | |||
| 2168 | Ga0500604_0006167 | |||
| 2169 | Ga0500616_0011721 | |||
| 2170 | Ga0500616_0025161 | |||
| 2171 | Ga0500616_0128822 | |||
| 2172 | Ga0500627_0042571 | |||
| 2173 | Ga0500645_000051 | |||
| 2174 | Ga0501082_0000510 | |||
| 2175 | Ga0501082_0052637 | |||
| 2176 | Ga0501082_0085689 | |||
| 2177 | Ga0501082_0185725 | |||
| 2178 | Ga0501082_0391795 | |||
| 2179 | 2512351568 | |||
| 2180 | 2513611987 | |||
| 2181 | 2599396658 | |||
| 2182 | 2599453282 | |||
| 2183 | 2599514614 | |||
| 2184 | 2599517455 | |||
| 2185 | 2599894121 | |||
| 2186 | 2599936082 | |||
| 2187 | 2601691313 | |||
| 2188 | 2621301125 | |||
| 2189 | 2643758836 | |||
| 2190 | 2643987926 | |||
| 2191 | 2694632419 | |||
| 2192 | 2694639169 | |||
| 2193 | 2723247612 | |||
| 2194 | 2738670250 | |||
| 2195 | 2738748643 | |||
| 2196 | 2738857685 | |||
| 2197 | 2739248710 | |||
| 2198 | 2817489521 | |||
| 2199 | 2834029435 | |||
| 2200 | 2856366229 | |||
| 2201 | 2857351397 | |||
| 2202 | 2869287264 | |||
| 2203 | 2871430563 | |||
| 2204 | 2871441607 | |||
| 2205 | 2871451559 | |||
| 2206 | 2871502649 | |||
| 2207 | 2874149158 | |||
| 2208 | 2874156055 | |||
| 2209 | 2876374112 | |||
| 2210 | 2876380206 | |||
| 2211 | 2876394076 | |||
| 2212 | 2876415418 | |||
| 2213 | 2878746996 | |||
| 2214 | 2878766541 | |||
| 2215 | 2878773737 | |||
| 2216 | 2881150937 | |||
| 2217 | 2881167198 | |||
| 2218 | 2888355522 | |||
| 2219 | 2889010490 | |||
| 2220 | 2889017843 | |||
| 2221 | 2903500487 | |||
| 2222 | 2903547690 | |||
| 2223 | 2904660407 | |||
| 2224 | 2906309809 | |||
| 2225 | 2906322444 | |||
| 2226 | 2906330303 | |||
| 2227 | 2919176305 | |||
| 2228 | 2920763953 | |||
| 2229 | 2922132989 | |||
| 2230 | 2922163136 | |||
| 2231 | 2922186412 | |||
| 2232 | 2924716200 | |||
| 2233 | 2924730722 | |||
| 2234 | 2931392444 | |||
| 2235 | 2937814892 | |||
| 2236 | 2937828882 | |||
| 2237 | 2937894225 | |||
| 2238 | 2938001565 | |||
| 2239 | 2938022159 | |||
| 2240 | 2939632999 | |||
| 2241 | 2945961761 | |||
| 2242 | 2947236257 | |||
| 2243 | 2958055542 | |||
| 2244 | 2958105406 | |||
| 2245 | 2958131764 | |||
| 2246 | 2958171719 | |||
| 2247 | 2958175081 | |||
| 2248 | 2958180824 | |||
| 2249 | 2961078662 | |||
| 2250 | 2961115732 | |||
| 2251 | 2961170160 | |||
| 2252 | 2965024911 | |||
| 2253 | 2965065461 | |||
| 2254 | 2965123298 | |||
| 2255 | 2968095151 | |||
| 2256 | 2968111465 | |||
| 2257 | 2968119736 | |||
| 2258 | 2968130707 | |||
| 2259 | 2968178552 | |||
| 2260 | 2970561397 | |||
| 2261 | 2977845647 | |||
| 2262 | 2977860972 | |||
| 2263 | 2977865430 | |||
| 2264 | 2977900968 | |||
| 2265 | 2977945219 | |||
| 2266 | 2977975917 | |||
| 2267 | 2979716479 | |||
| 2268 | 2979751294 | |||
| 2269 | 2987638581 | |||
| 2270 | 2987659444 | |||
| 2271 | 2987666401 | |||
| 2272 | 2996343578 | |||
| 2273 | 2996388609 | |||
| 2274 | 3004195407 | |||
| 2275 | 3004205176 | |||
| 2276 | 8004389101 | |||
| 2277 | 8004448848 | |||
| 2278 | 8004641009 | |||
| 2279 | 8004716164 | |||
| 2280 | 8006971469 | |||
| 2281 | 8007001213 | |||
| 2282 | 8019678097 | |||
| 2283 | 8054286807 | |||
| 2284 | 8055819475 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e02-assembly1.cif.gz_A | crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution | 0.9888 | 6 | 311 |
| 3e49-assembly1.cif.gz_D | crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution | 0.9871 | 4 | 311 |
| 3e49-assembly1.cif.gz_D | crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution | 0.9839 | 4 | 311 |
| 3lot-assembly1.cif.gz_C | crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution | 0.9795 | 6 | 311 |
| 3e02-assembly1.cif.gz_A | crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution | 0.9698 | 6 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e49C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.984 | 4 | 311 | 3.20.20.70 |
| 3e49C00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9808 | 4 | 311 | 3.20.20.70 |
| af_P71976_1_271_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9711 | 5 | 305 | 3.20.20.70 |
| af_P71976_1_271_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9641 | 5 | 305 | 3.20.20.70 |
| 2y7dC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9541 | 4 | 302 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C9RF70-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 1.001 | 4 | 80 |
GO:0043720
GO:0046872 |
| AF-A0A357CK18-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9974 | 17 | 94 |
GO:0043720
GO:0046872 |
| AF-A0A434EKR6-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9966 | 6 | 114 |
GO:0043720
GO:0046872 |
| AF-A0A1G4UL38-F1-model_v4 | deleted | 0.9959 | 5 | 103 |
|
| AF-A0A529ME14-F1-model_v4 | 3-keto-5-aminohexanoate cleavage protein | 0.9953 | 26 | 101 |
GO:0043720
GO:0046872 |