F490736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1143 | 417 | 2256 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10158641|Ga0105237_101586412 |
| Length | 433 |
| Sequence | MADCSMLGPKTPVVPSAHRADDAGRIARRTIPVPRRHQRGFSMPLNSLLTAALAVIGLAVLPAAHAQNTIKVGVIAEFSGPFADYGAQIEAGMKAYMKEHGDTVAGKKVELITRDTKGPAPDVAKRFAQELITRDQVQFLAGFGLTPNAMAVAPVVTEAKVPMIISNAATSSITTKSPYVTRVSMTIPQVSAPMAEWALKNGAKQVYTVVADYGPGIDAETQFTKTFKAGGGEVVGTLRTPLQNPDFSAAIQRVKDAKPQAVFVFLPAGEQGIAFVKGFNERGLAAAGIKLIATGDITDDHVLAAMGDPTLGLITAFHYSTAHESPENAAFLKAYAAANDAKLGGPNFMTAAGYDTMHVIYEVSKKLNGTIDGDKAMAVIKGMRWTSPRGPVSIDADTRDITQTVYIRKVEKKNGKLANVEFDKIADVKDPGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 150 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 242 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 248 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 278 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 281 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 282 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 285 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 286 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 287 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 378 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 380 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 392 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 396 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 397 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 398 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 399 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 400 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 401 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 402 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 403 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 404 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 405 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 406 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 407 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 408 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 409 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 410 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 411 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 412 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 413 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 414 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 415 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 416 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 417 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.5 |
| Metatranscriptomes | 0.44 |
| Isolates | 3.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.65 |
| Nodule | 0.26 |
| Rhizoplane | 3.85 |
| Rhizosphere | 84.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105237_10158641 | 3300009545 | Bacteria | 2260 |
| 2 | JGI24741J21665_1000281 | 3300001915 | Bacteria | 15344 |
| 3 | JGI24752J21851_1002512 | 3300001976 | Bacteria | 2442 |
| 4 | JGI24740J21852_10000382 | 3300001979 | Bacteria | 19010 |
| 5 | JGI24033J26618_1002764 | 3300002155 | Bacteria | 1813 |
| 6 | JGI25155J39150_1000420 | 3300002704 | Bacteria | 11401 |
| 7 | JGI25155J39150_1000466 | 3300002704 | Bacteria | 10170 |
| 8 | JGI25156J39149_1002917 | 3300002705 | Bacteria | 5828 |
| 9 | JGI25156J39149_1010499 | 3300002705 | Bacteria | 2172 |
| 10 | JGI25154J39366_1000291 | 3300002738 | Bacteria | 30050 |
| 11 | JGI25154J39366_1000626 | 3300002738 | Bacteria | 16759 |
| 12 | JGI25154J39366_1001002 | 3300002738 | Bacteria | 11394 |
| 13 | JGI25154J39366_1001202 | 3300002738 | Bacteria | 9805 |
| 14 | JGI25151J46595_10001574 | 3300003187 | Bacteria | 15227 |
| 15 | JGI25151J46595_10002049 | 3300003187 | Bacteria | 12594 |
| 16 | JGI25406J46586_10007907 | 3300003203 | Bacteria | 4837 |
| 17 | rootH1_10022550 | 3300003323 | Bacteria | 5219 |
| 18 | Ga0055538_1000038 | 3300003751 | Bacteria | 186588 |
| 19 | Ga0055539_1000049 | 3300003752 | Bacteria | 186588 |
| 20 | Ga0055539_1000068 | 3300003752 | Bacteria | 134912 |
| 21 | Ga0055533_1000060 | 3300003756 | Bacteria | 186588 |
| 22 | Ga0055532_1000028 | 3300003758 | Bacteria | 234512 |
| 23 | Ga0055525_1000068 | 3300003759 | Bacteria | 186588 |
| 24 | Ga0055525_1000394 | 3300003759 | Bacteria | 27753 |
| 25 | Ga0055535_1000022 | 3300003761 | Bacteria | 234512 |
| 26 | Ga0055542_1001449 | 3300003762 | Bacteria | 11773 |
| 27 | Ga0055529_1000063 | 3300003763 | Bacteria | 181573 |
| 28 | Ga0055529_1000145 | 3300003763 | Bacteria | 101255 |
| 29 | Ga0055526_1003202 | 3300003771 | Bacteria | 10586 |
| 30 | Ga0055526_1008995 | 3300003771 | Bacteria | 4884 |
| 31 | Ga0055537_1000387 | 3300003773 | Bacteria | 29583 |
| 32 | Ga0055524_1000498 | 3300003775 | Bacteria | 30833 |
| 33 | Ga0055536_1005319 | 3300003781 | Bacteria | 6328 |
| 34 | Ga0055534_1000387 | 3300003784 | Bacteria | 27564 |
| 35 | Ga0055541_1000036 | 3300003841 | Bacteria | 186588 |
| 36 | Ga0065715_10007325 | 3300005293 | Bacteria | 3825 |
| 37 | Ga0065715_10122086 | 3300005293 | Bacteria | 2214 |
| 38 | Ga0070658_10051007 | 3300005327 | Bacteria | 3353 |
| 39 | Ga0070658_10198328 | 3300005327 | Bacteria | 1693 |
| 40 | Ga0070676_10001492 | 3300005328 | Bacteria | 11839 |
| 41 | Ga0070676_10010271 | 3300005328 | Bacteria | 5078 |
| 42 | Ga0070676_10010954 | 3300005328 | Bacteria | 4927 |
| 43 | Ga0070676_10017610 | 3300005328 | Bacteria | 3953 |
| 44 | Ga0070676_10143633 | 3300005328 | Bacteria | 1522 |
| 45 | Ga0070683_100005863 | 3300005329 | Bacteria | 10279 |
| 46 | Ga0070683_100024765 | 3300005329 | Bacteria | 5380 |
| 47 | Ga0070683_100060236 | 3300005329 | Bacteria | 3528 |
| 48 | Ga0070683_100130084 | 3300005329 | Bacteria | 2382 |
| 49 | Ga0070683_100311703 | 3300005329 | Bacteria | 1497 |
| 50 | Ga0070690_100002924 | 3300005330 | Bacteria | 9227 |
| 51 | Ga0070670_100001052 | 3300005331 | Bacteria | 21913 |
| 52 | Ga0070670_100004426 | 3300005331 | Bacteria | 11767 |
| 53 | Ga0070670_100006933 | 3300005331 | Bacteria | 9605 |
| 54 | Ga0070670_100007034 | 3300005331 | Bacteria | 9534 |
| 55 | Ga0070670_100025094 | 3300005331 | Bacteria | 5128 |
| 56 | Ga0070670_100030083 | 3300005331 | Bacteria | 4677 |
| 57 | Ga0070670_100105162 | 3300005331 | Bacteria | 2432 |
| 58 | Ga0070677_10001219 | 3300005333 | Bacteria | 8259 |
| 59 | Ga0070677_10005188 | 3300005333 | Bacteria | 4283 |
| 60 | Ga0068869_100005688 | 3300005334 | Bacteria | 7863 |
| 61 | Ga0068869_100021797 | 3300005334 | Bacteria | 4409 |
| 62 | Ga0068869_100026812 | 3300005334 | Unclassified | 4013 |
| 63 | Ga0068869_100113949 | 3300005334 | Bacteria | 2060 |
| 64 | Ga0068869_100129974 | 3300005334 | Bacteria | 1935 |
| 65 | Ga0068869_100139231 | 3300005334 | Bacteria | 1872 |
| 66 | Ga0068869_100200104 | 3300005334 | Bacteria | 1575 |
| 67 | Ga0070666_10009901 | 3300005335 | Bacteria | 5950 |
| 68 | Ga0070666_10012078 | 3300005335 | Bacteria | 5438 |
| 69 | Ga0070680_100016249 | 3300005336 | Bacteria | 5855 |
| 70 | Ga0070680_100141298 | 3300005336 | Bacteria | 2019 |
| 71 | Ga0070680_100169245 | 3300005336 | Bacteria | 1838 |
| 72 | Ga0070682_100039262 | 3300005337 | Bacteria | 2908 |
| 73 | Ga0070682_100075616 | 3300005337 | Bacteria | 2166 |
| 74 | Ga0068868_100003441 | 3300005338 | Bacteria | 11022 |
| 75 | Ga0068868_100035042 | 3300005338 | Bacteria | 3878 |
| 76 | Ga0068868_100068870 | 3300005338 | Bacteria | 2819 |
| 77 | Ga0068868_100076868 | 3300005338 | Bacteria | 2670 |
| 78 | Ga0068868_100128237 | 3300005338 | Bacteria | 2074 |
| 79 | Ga0068868_100171919 | 3300005338 | Bacteria | 1794 |
| 80 | Ga0070660_100000975 | 3300005339 | Bacteria | 19132 |
| 81 | Ga0070660_100013536 | 3300005339 | Bacteria | 5854 |
| 82 | Ga0070660_100013927 | 3300005339 | Bacteria | 5786 |
| 83 | Ga0070660_100025634 | 3300005339 | Bacteria | 4383 |
| 84 | Ga0070660_100031987 | 3300005339 | Bacteria | 3956 |
| 85 | Ga0070660_100039149 | 3300005339 | Bacteria | 3602 |
| 86 | Ga0070689_100004559 | 3300005340 | Bacteria | 9382 |
| 87 | Ga0070689_100012226 | 3300005340 | Bacteria | 6174 |
| 88 | Ga0070689_100074652 | 3300005340 | Bacteria | 2653 |
| 89 | Ga0070689_100159880 | 3300005340 | Bacteria | 1820 |
| 90 | Ga0070691_10026050 | 3300005341 | Bacteria | 2724 |
| 91 | Ga0070661_100000278 | 3300005344 | Bacteria | 41330 |
| 92 | Ga0070661_100034872 | 3300005344 | Bacteria | 3651 |
| 93 | Ga0070661_100045968 | 3300005344 | Bacteria | 3192 |
| 94 | Ga0070661_100057490 | 3300005344 | Bacteria | 2850 |
| 95 | Ga0070661_100059679 | 3300005344 | Bacteria | 2798 |
| 96 | Ga0070661_100065637 | 3300005344 | Bacteria | 2667 |
| 97 | Ga0070661_100065657 | 3300005344 | Bacteria | 2666 |
| 98 | Ga0070692_10025602 | 3300005345 | Bacteria | 2909 |
| 99 | Ga0070692_10040101 | 3300005345 | Bacteria | 2393 |
| 100 | Ga0070668_100003048 | 3300005347 | Bacteria | 12402 |
| 101 | Ga0070668_100011962 | 3300005347 | Bacteria | 6464 |
| 102 | Ga0070668_100028990 | 3300005347 | Bacteria | 4202 |
| 103 | Ga0070668_100105755 | 3300005347 | Bacteria | 2235 |
| 104 | Ga0070669_100093340 | 3300005353 | Bacteria | 2260 |
| 105 | Ga0070675_100005744 | 3300005354 | Bacteria | 9491 |
| 106 | Ga0070675_100007593 | 3300005354 | Bacteria | 8389 |
| 107 | Ga0070675_100013245 | 3300005354 | Bacteria | 6480 |
| 108 | Ga0070671_100009073 | 3300005355 | Bacteria | 7981 |
| 109 | Ga0070671_100039508 | 3300005355 | Bacteria | 3917 |
| 110 | Ga0070671_100121326 | 3300005355 | Bacteria | 2200 |
| 111 | Ga0070671_100237565 | 3300005355 | Bacteria | 1547 |
| 112 | Ga0070674_100000833 | 3300005356 | Bacteria | 15944 |
| 113 | Ga0070674_100009985 | 3300005356 | Bacteria | 5716 |
| 114 | Ga0070674_100022160 | 3300005356 | Bacteria | 4093 |
| 115 | Ga0070674_100042664 | 3300005356 | Bacteria | 3083 |
| 116 | Ga0070673_100000830 | 3300005364 | Bacteria | 17287 |
| 117 | Ga0070673_100000917 | 3300005364 | Bacteria | 16664 |
| 118 | Ga0070673_100002997 | 3300005364 | Bacteria | 10418 |
| 119 | Ga0070673_100005917 | 3300005364 | Bacteria | 7899 |
| 120 | Ga0070673_100026693 | 3300005364 | Bacteria | 4270 |
| 121 | Ga0070673_100039717 | 3300005364 | Bacteria | 3605 |
| 122 | Ga0070673_100044016 | 3300005364 | Bacteria | 3454 |
| 123 | Ga0070673_100121377 | 3300005364 | Bacteria | 2180 |
| 124 | Ga0070688_100001343 | 3300005365 | Bacteria | 12214 |
| 125 | Ga0070688_100003223 | 3300005365 | Bacteria | 8364 |
| 126 | Ga0070688_100005576 | 3300005365 | Bacteria | 6643 |
| 127 | Ga0070688_100007485 | 3300005365 | Bacteria | 5890 |
| 128 | Ga0070659_100000651 | 3300005366 | Bacteria | 25398 |
| 129 | Ga0070659_100012857 | 3300005366 | Bacteria | 6220 |
| 130 | Ga0070659_100015708 | 3300005366 | Bacteria | 5672 |
| 131 | Ga0070659_100023964 | 3300005366 | Bacteria | 4675 |
| 132 | Ga0070659_100050230 | 3300005366 | Bacteria | 3279 |
| 133 | Ga0070659_100065666 | 3300005366 | Bacteria | 2874 |
| 134 | Ga0070659_100078656 | 3300005366 | Bacteria | 2631 |
| 135 | Ga0070659_100091205 | 3300005366 | Bacteria | 2442 |
| 136 | Ga0070667_100013687 | 3300005367 | Bacteria | 6705 |
| 137 | Ga0070667_100021744 | 3300005367 | Bacteria | 5323 |
| 138 | Ga0070667_100026280 | 3300005367 | Bacteria | 4841 |
| 139 | Ga0070667_100073675 | 3300005367 | Bacteria | 2912 |
| 140 | Ga0070667_100082626 | 3300005367 | Bacteria | 2751 |
| 141 | Ga0070667_100132396 | 3300005367 | Bacteria | 2177 |
| 142 | Ga0070667_100164741 | 3300005367 | Bacteria | 1955 |
| 143 | Ga0070667_100174073 | 3300005367 | Unclassified | 1901 |
| 144 | Ga0070709_10007023 | 3300005434 | Bacteria | 6155 |
| 145 | Ga0070709_10008071 | 3300005434 | Bacteria | 5776 |
| 146 | Ga0070709_10019121 | 3300005434 | Bacteria | 3954 |
| 147 | Ga0070709_10024709 | 3300005434 | Bacteria | 3540 |
| 148 | Ga0070709_10036871 | 3300005434 | Bacteria | 2982 |
| 149 | Ga0070714_100073375 | 3300005435 | Bacteria | 2965 |
| 150 | Ga0070714_100185857 | 3300005435 | Bacteria | 1893 |
| 151 | Ga0070714_100286269 | 3300005435 | Bacteria | 1532 |
| 152 | Ga0070713_100000192 | 3300005436 | Bacteria | 40641 |
| 153 | Ga0070713_100001983 | 3300005436 | Bacteria | 13210 |
| 154 | Ga0070713_100004914 | 3300005436 | Bacteria | 9073 |
| 155 | Ga0070713_100005087 | 3300005436 | Bacteria | 8947 |
| 156 | Ga0070713_100011002 | 3300005436 | Bacteria | 6566 |
| 157 | Ga0070713_100059937 | 3300005436 | Bacteria | 3180 |
| 158 | Ga0070713_100096996 | 3300005436 | Bacteria | 2546 |
| 159 | Ga0070710_10003306 | 3300005437 | Bacteria | 7643 |
| 160 | Ga0070710_10018985 | 3300005437 | Bacteria | 3546 |
| 161 | Ga0070710_10025503 | 3300005437 | Bacteria | 3131 |
| 162 | Ga0070711_100020760 | 3300005439 | Bacteria | 4238 |
| 163 | Ga0070711_100165693 | 3300005439 | Bacteria | 1680 |
| 164 | Ga0070711_100196223 | 3300005439 | Bacteria | 1555 |
| 165 | Ga0070705_100008692 | 3300005440 | Bacteria | 5030 |
| 166 | Ga0070700_100005948 | 3300005441 | Bacteria | 6484 |
| 167 | Ga0070700_100103475 | 3300005441 | Bacteria | 1880 |
| 168 | Ga0070708_100080026 | 3300005445 | Bacteria | 2957 |
| 169 | Ga0070708_100131832 | 3300005445 | Bacteria | 2313 |
| 170 | Ga0070663_100000005 | 3300005455 | Bacteria | 251758 |
| 171 | Ga0070663_100052116 | 3300005455 | Bacteria | 2918 |
| 172 | Ga0070663_100218169 | 3300005455 | Bacteria | 1496 |
| 173 | Ga0070678_100000730 | 3300005456 | Bacteria | 16370 |
| 174 | Ga0070678_100030755 | 3300005456 | Bacteria | 3694 |
| 175 | Ga0070678_100061832 | 3300005456 | Bacteria | 2762 |
| 176 | Ga0070678_100071680 | 3300005456 | Bacteria | 2594 |
| 177 | Ga0070662_100000356 | 3300005457 | Bacteria | 27355 |
| 178 | Ga0070662_100042694 | 3300005457 | Bacteria | 3240 |
| 179 | Ga0070662_100079518 | 3300005457 | Bacteria | 2438 |
| 180 | Ga0070662_100196539 | 3300005457 | Bacteria | 1598 |
| 181 | Ga0070681_10002066 | 3300005458 | Bacteria | 18214 |
| 182 | Ga0070681_10013790 | 3300005458 | Bacteria | 8045 |
| 183 | Ga0070681_10167425 | 3300005458 | Bacteria | 2120 |
| 184 | Ga0068867_100003910 | 3300005459 | Bacteria | 10478 |
| 185 | Ga0068867_100034617 | 3300005459 | Bacteria | 3661 |
| 186 | Ga0068867_100056466 | 3300005459 | Bacteria | 2905 |
| 187 | Ga0068867_100184472 | 3300005459 | Bacteria | 1661 |
| 188 | Ga0070685_10000750 | 3300005466 | Bacteria | 17640 |
| 189 | Ga0070685_10001220 | 3300005466 | Bacteria | 13673 |
| 190 | Ga0070685_10004263 | 3300005466 | Bacteria | 7218 |
| 191 | Ga0070685_10030774 | 3300005466 | Bacteria | 2994 |
| 192 | Ga0070706_100021210 | 3300005467 | Bacteria | 5983 |
| 193 | Ga0070706_100042508 | 3300005467 | Bacteria | 4199 |
| 194 | Ga0070706_100049649 | 3300005467 | Bacteria | 3871 |
| 195 | Ga0070707_100010338 | 3300005468 | Bacteria | 8688 |
| 196 | Ga0070698_100081122 | 3300005471 | Bacteria | 3239 |
| 197 | Ga0070699_100069881 | 3300005518 | Bacteria | 3052 |
| 198 | Ga0070699_100202772 | 3300005518 | Bacteria | 1764 |
| 199 | Ga0070699_100230266 | 3300005518 | Bacteria | 1652 |
| 200 | Ga0070679_100020508 | 3300005530 | Bacteria | 6445 |
| 201 | Ga0070679_100031071 | 3300005530 | Bacteria | 5276 |
| 202 | Ga0070679_100042450 | 3300005530 | Bacteria | 4529 |
| 203 | Ga0070679_100094436 | 3300005530 | Bacteria | 2977 |
| 204 | Ga0070684_100001244 | 3300005535 | Bacteria | 18242 |
| 205 | Ga0070684_100029314 | 3300005535 | Bacteria | 4662 |
| 206 | Ga0070684_100096684 | 3300005535 | Bacteria | 2633 |
| 207 | Ga0070684_100112698 | 3300005535 | Bacteria | 2440 |
| 208 | Ga0070684_100200626 | 3300005535 | Bacteria | 1817 |
| 209 | Ga0070697_100025706 | 3300005536 | Bacteria | 4697 |
| 210 | Ga0068853_100010715 | 3300005539 | Bacteria | 7424 |
| 211 | Ga0068853_100088788 | 3300005539 | Bacteria | 2714 |
| 212 | Ga0070672_100001148 | 3300005543 | Bacteria | 16186 |
| 213 | Ga0070672_100003455 | 3300005543 | Bacteria | 10239 |
| 214 | Ga0070672_100008475 | 3300005543 | Bacteria | 7036 |
| 215 | Ga0070672_100037823 | 3300005543 | Bacteria | 3684 |
| 216 | Ga0070672_100039559 | 3300005543 | Bacteria | 3613 |
| 217 | Ga0070672_100100679 | 3300005543 | Bacteria | 2344 |
| 218 | Ga0070672_100238161 | 3300005543 | Bacteria | 1530 |
| 219 | Ga0070686_100026439 | 3300005544 | Bacteria | 3503 |
| 220 | Ga0070686_100034265 | 3300005544 | Bacteria | 3127 |
| 221 | Ga0070695_100082523 | 3300005545 | Bacteria | 2128 |
| 222 | Ga0070695_100105746 | 3300005545 | Bacteria | 1902 |
| 223 | Ga0070696_100006467 | 3300005546 | Bacteria | 7837 |
| 224 | Ga0070696_100016038 | 3300005546 | Bacteria | 5038 |
| 225 | Ga0070693_100050266 | 3300005547 | Bacteria | 2382 |
| 226 | Ga0070665_100001071 | 3300005548 | Bacteria | 34085 |
| 227 | Ga0070665_100012132 | 3300005548 | Bacteria | 8693 |
| 228 | Ga0070665_100016503 | 3300005548 | Bacteria | 7405 |
| 229 | Ga0070665_100168517 | 3300005548 | Bacteria | 2192 |
| 230 | Ga0068855_100000614 | 3300005563 | Bacteria | 43827 |
| 231 | Ga0068855_100001569 | 3300005563 | Bacteria | 28685 |
| 232 | Ga0068855_100024547 | 3300005563 | Bacteria | 7214 |
| 233 | Ga0068855_100034809 | 3300005563 | Bacteria | 6003 |
| 234 | Ga0068855_100037531 | 3300005563 | Bacteria | 5761 |
| 235 | Ga0068855_100138702 | 3300005563 | Bacteria | 2773 |
| 236 | Ga0070664_100000001 | 3300005564 | Bacteria | 551832 |
| 237 | Ga0070664_100000426 | 3300005564 | Bacteria | 31532 |
| 238 | Ga0070664_100135972 | 3300005564 | Bacteria | 2161 |
| 239 | Ga0070664_100179283 | 3300005564 | Bacteria | 1882 |
| 240 | Ga0068857_100005355 | 3300005577 | Bacteria | 10936 |
| 241 | Ga0068857_100356766 | 3300005577 | Bacteria | 1355 |
| 242 | Ga0068854_100000030 | 3300005578 | Bacteria | 111321 |
| 243 | Ga0068854_100007377 | 3300005578 | Bacteria | 7028 |
| 244 | Ga0068854_100015284 | 3300005578 | Bacteria | 5082 |
| 245 | Ga0068854_100020176 | 3300005578 | Bacteria | 4504 |
| 246 | Ga0068856_100000008 | 3300005614 | Bacteria | 190886 |
| 247 | Ga0068856_100000978 | 3300005614 | Bacteria | 30484 |
| 248 | Ga0068856_100002674 | 3300005614 | Bacteria | 18281 |
| 249 | Ga0068856_100064623 | 3300005614 | Bacteria | 3616 |
| 250 | Ga0068856_100134662 | 3300005614 | Bacteria | 2476 |
| 251 | Ga0068856_100185393 | 3300005614 | Bacteria | 2095 |
| 252 | Ga0068856_100300976 | 3300005614 | Bacteria | 1621 |
| 253 | Ga0070702_100003918 | 3300005615 | Bacteria | 6747 |
| 254 | Ga0070702_100009945 | 3300005615 | Bacteria | 4671 |
| 255 | Ga0070702_100074323 | 3300005615 | Bacteria | 2016 |
| 256 | Ga0068852_100006894 | 3300005616 | Bacteria | 8258 |
| 257 | Ga0068852_100006931 | 3300005616 | Bacteria | 8244 |
| 258 | Ga0068852_100008332 | 3300005616 | Bacteria | 7633 |
| 259 | Ga0068852_100021840 | 3300005616 | Bacteria | 5121 |
| 260 | Ga0068852_100046446 | 3300005616 | Bacteria | 3701 |
| 261 | Ga0068859_100000299 | 3300005617 | Bacteria | 49331 |
| 262 | Ga0068859_100001521 | 3300005617 | Bacteria | 23669 |
| 263 | Ga0068864_100000973 | 3300005618 | Bacteria | 24018 |
| 264 | Ga0068864_100001231 | 3300005618 | Bacteria | 21285 |
| 265 | Ga0068864_100001780 | 3300005618 | Bacteria | 17689 |
| 266 | Ga0068864_100003838 | 3300005618 | Bacteria | 12389 |
| 267 | Ga0068864_100011511 | 3300005618 | Bacteria | 7308 |
| 268 | Ga0068864_100039432 | 3300005618 | Bacteria | 4037 |
| 269 | Ga0068864_100140951 | 3300005618 | Bacteria | 2174 |
| 270 | Ga0068864_100285111 | 3300005618 | Bacteria | 1543 |
| 271 | Ga0068866_10002028 | 3300005718 | Bacteria | 8434 |
| 272 | Ga0068866_10007205 | 3300005718 | Bacteria | 4652 |
| 273 | Ga0068861_100026109 | 3300005719 | Bacteria | 4244 |
| 274 | Ga0068861_100146987 | 3300005719 | Bacteria | 1930 |
| 275 | Ga0068861_100186479 | 3300005719 | Bacteria | 1730 |
| 276 | Ga0068851_10003799 | 3300005834 | Bacteria | 6755 |
| 277 | Ga0068851_10003873 | 3300005834 | Bacteria | 6699 |
| 278 | Ga0068851_10006480 | 3300005834 | Bacteria | 5345 |
| 279 | Ga0068870_10011499 | 3300005840 | Bacteria | 4106 |
| 280 | Ga0068870_10012432 | 3300005840 | Bacteria | 3979 |
| 281 | Ga0068870_10057136 | 3300005840 | Unclassified | 2085 |
| 282 | Ga0068863_100002522 | 3300005841 | Bacteria | 18174 |
| 283 | Ga0068863_100008043 | 3300005841 | Bacteria | 10298 |
| 284 | Ga0068863_100011231 | 3300005841 | Bacteria | 8679 |
| 285 | Ga0068863_100030794 | 3300005841 | Bacteria | 5124 |
| 286 | Ga0068863_100101544 | 3300005841 | Bacteria | 2735 |
| 287 | Ga0068863_100131084 | 3300005841 | Bacteria | 2394 |
| 288 | Ga0068863_100383977 | 3300005841 | Bacteria | 1372 |
| 289 | Ga0068858_100000738 | 3300005842 | Bacteria | 34250 |
| 290 | Ga0068858_100002718 | 3300005842 | Bacteria | 17826 |
| 291 | Ga0068858_100022687 | 3300005842 | Bacteria | 5853 |
| 292 | Ga0068858_100124027 | 3300005842 | Bacteria | 2417 |
| 293 | Ga0068860_100003736 | 3300005843 | Bacteria | 15663 |
| 294 | Ga0068860_100005682 | 3300005843 | Bacteria | 12591 |
| 295 | Ga0068860_100049795 | 3300005843 | Bacteria | 3988 |
| 296 | Ga0068860_100065499 | 3300005843 | Bacteria | 3450 |
| 297 | Ga0068860_100067917 | 3300005843 | Bacteria | 3387 |
| 298 | Ga0068860_100078756 | 3300005843 | Bacteria | 3134 |
| 299 | Ga0068860_100203332 | 3300005843 | Bacteria | 1920 |
| 300 | Ga0068862_100054617 | 3300005844 | Bacteria | 3420 |
| 301 | Ga0068862_100136030 | 3300005844 | Bacteria | 2177 |
| 302 | Ga0068862_100186616 | 3300005844 | Bacteria | 1864 |
| 303 | Ga0081455_10121041 | 3300005937 | Bacteria | 2062 |
| 304 | Ga0081539_10000734 | 3300005985 | Bacteria | 65712 |
| 305 | Ga0070717_10043139 | 3300006028 | Bacteria | 3681 |
| 306 | Ga0070715_10012034 | 3300006163 | Bacteria | 3133 |
| 307 | Ga0070716_100009928 | 3300006173 | Bacteria | 4761 |
| 308 | Ga0070716_100072468 | 3300006173 | Bacteria | 2028 |
| 309 | Ga0070712_100002075 | 3300006175 | Bacteria | 12294 |
| 310 | Ga0070712_100014669 | 3300006175 | Bacteria | 5030 |
| 311 | Ga0070712_100048080 | 3300006175 | Bacteria | 2955 |
| 312 | Ga0070712_100063229 | 3300006175 | Bacteria | 2620 |
| 313 | Ga0070712_100111432 | 3300006175 | Bacteria | 2043 |
| 314 | Ga0070712_100114105 | 3300006175 | Bacteria | 2022 |
| 315 | Ga0070712_100152061 | 3300006175 | Bacteria | 1778 |
| 316 | Ga0075369_10014059 | 3300006186 | Bacteria | 3191 |
| 317 | Ga0075366_10071750 | 3300006195 | Bacteria | 2063 |
| 318 | Ga0097621_100002538 | 3300006237 | Bacteria | 12508 |
| 319 | Ga0097621_100023259 | 3300006237 | Bacteria | 4822 |
| 320 | Ga0097621_100026208 | 3300006237 | Bacteria | 4570 |
| 321 | Ga0097621_100033492 | 3300006237 | Bacteria | 4092 |
| 322 | Ga0097621_100147927 | 3300006237 | Bacteria | 2013 |
| 323 | Ga0097621_100176179 | 3300006237 | Bacteria | 1846 |
| 324 | Ga0068871_100001842 | 3300006358 | Bacteria | 14331 |
| 325 | Ga0068871_100009208 | 3300006358 | Bacteria | 7142 |
| 326 | Ga0068871_100029720 | 3300006358 | Bacteria | 4295 |
| 327 | Ga0068871_100032616 | 3300006358 | Bacteria | 4116 |
| 328 | Ga0068871_100036534 | 3300006358 | Bacteria | 3912 |
| 329 | Ga0075428_100031269 | 3300006844 | Bacteria | 5887 |
| 330 | Ga0075428_100052483 | 3300006844 | Bacteria | 4468 |
| 331 | Ga0075428_100145719 | 3300006844 | Bacteria | 2574 |
| 332 | Ga0075433_10072131 | 3300006852 | Bacteria | 3036 |
| 333 | Ga0075434_100087003 | 3300006871 | Bacteria | 3125 |
| 334 | Ga0075434_100104438 | 3300006871 | Bacteria | 2843 |
| 335 | Ga0075434_100119453 | 3300006871 | Bacteria | 2650 |
| 336 | Ga0075434_100132612 | 3300006871 | Bacteria | 2511 |
| 337 | Ga0075434_100171122 | 3300006871 | Bacteria | 2192 |
| 338 | Ga0075434_100219126 | 3300006871 | Bacteria | 1923 |
| 339 | Ga0068865_100120035 | 3300006881 | Unclassified | 1953 |
| 340 | Ga0097620_100000299 | 3300006931 | Bacteria | 49331 |
| 341 | Ga0097620_100001521 | 3300006931 | Bacteria | 23669 |
| 342 | Ga0099826_10000026 | 3300006948 | Bacteria | 146276 |
| 343 | Ga0075435_100009428 | 3300007076 | Bacteria | 7067 |
| 344 | Ga0075435_100026331 | 3300007076 | Bacteria | 4535 |
| 345 | Ga0075435_100098007 | 3300007076 | Bacteria | 2427 |
| 346 | Ga0099795_10007448 | 3300007788 | Bacteria | 3057 |
| 347 | Ga0105244_10038832 | 3300009036 | Bacteria | 2481 |
| 348 | Ga0105240_10002032 | 3300009093 | Bacteria | 33348 |
| 349 | Ga0105240_10008715 | 3300009093 | Bacteria | 14468 |
| 350 | Ga0105240_10008923 | 3300009093 | Bacteria | 14256 |
| 351 | Ga0105240_10024583 | 3300009093 | Bacteria | 7936 |
| 352 | Ga0105240_10053566 | 3300009093 | Bacteria | 5064 |
| 353 | Ga0105240_10055685 | 3300009093 | Bacteria | 4951 |
| 354 | Ga0105240_10073390 | 3300009093 | Bacteria | 4225 |
| 355 | Ga0105240_10187721 | 3300009093 | Bacteria | 2433 |
| 356 | Ga0105240_10296266 | 3300009093 | Bacteria | 1852 |
| 357 | Ga0111539_10012047 | 3300009094 | Bacteria | 10846 |
| 358 | Ga0111539_10031899 | 3300009094 | Bacteria | 6400 |
| 359 | Ga0111539_10049087 | 3300009094 | Bacteria | 5036 |
| 360 | Ga0105245_10008125 | 3300009098 | Bacteria | 9177 |
| 361 | Ga0105245_10008348 | 3300009098 | Bacteria | 9050 |
| 362 | Ga0105245_10022617 | 3300009098 | Bacteria | 5519 |
| 363 | Ga0105245_10075958 | 3300009098 | Bacteria | 3060 |
| 364 | Ga0105245_10149010 | 3300009098 | Bacteria | 2210 |
| 365 | Ga0105247_10018229 | 3300009101 | Bacteria | 4211 |
| 366 | Ga0114129_10003918 | 3300009147 | Bacteria | 21004 |
| 367 | Ga0114129_10062946 | 3300009147 | Bacteria | 5182 |
| 368 | Ga0105243_10110523 | 3300009148 | Bacteria | 2299 |
| 369 | Ga0105243_10137768 | 3300009148 | Bacteria | 2079 |
| 370 | Ga0105241_10089746 | 3300009174 | Bacteria | 2422 |
| 371 | Ga0105241_10300478 | 3300009174 | Bacteria | 1377 |
| 372 | Ga0105242_10022666 | 3300009176 | Bacteria | 4943 |
| 373 | Ga0105242_10034346 | 3300009176 | Bacteria | 4065 |
| 374 | Ga0105242_10074182 | 3300009176 | Bacteria | 2830 |
| 375 | Ga0105248_10003287 | 3300009177 | Bacteria | 17938 |
| 376 | Ga0105248_10010481 | 3300009177 | Bacteria | 10208 |
| 377 | Ga0105248_10022923 | 3300009177 | Bacteria | 6933 |
| 378 | Ga0105248_10038447 | 3300009177 | Bacteria | 5355 |
| 379 | Ga0105248_10057987 | 3300009177 | Bacteria | 4347 |
| 380 | Ga0105248_10111339 | 3300009177 | Bacteria | 3087 |
| 381 | Ga0105248_10234657 | 3300009177 | Bacteria | 2065 |
| 382 | Ga0105237_10025614 | 3300009545 | Bacteria | 6029 |
| 383 | Ga0105237_10048399 | 3300009545 | Bacteria | 4273 |
| 384 | Ga0105237_10070281 | 3300009545 | Bacteria | 3497 |
| 385 | Ga0105237_10165723 | 3300009545 | Bacteria | 2209 |
| 386 | Ga0105237_10281070 | 3300009545 | Bacteria | 1667 |
| 387 | Ga0105238_10000212 | 3300009551 | Bacteria | 64681 |
| 388 | Ga0105238_10031079 | 3300009551 | Bacteria | 5436 |
| 389 | Ga0105238_10058025 | 3300009551 | Bacteria | 3880 |
| 390 | Ga0105249_10010156 | 3300009553 | Bacteria | 8264 |
| 391 | Ga0099796_10003680 | 3300010159 | Bacteria | 3596 |
| 392 | Ga0105239_10004222 | 3300010375 | Bacteria | 17259 |
| 393 | Ga0105239_10007726 | 3300010375 | Bacteria | 12308 |
| 394 | Ga0105239_10038731 | 3300010375 | Bacteria | 5223 |
| 395 | Ga0105239_10086487 | 3300010375 | Bacteria | 3455 |
| 396 | Ga0105239_10214494 | 3300010375 | Bacteria | 2158 |
| 397 | Ga0105239_10345402 | 3300010375 | Bacteria | 1680 |
| 398 | Ga0105246_10037527 | 3300011119 | Bacteria | 3252 |
| 399 | Ga0105246_10080811 | 3300011119 | Bacteria | 2315 |
| 400 | Ga0157373_10001869 | 3300013100 | Bacteria | 15961 |
| 401 | Ga0157373_10030125 | 3300013100 | Bacteria | 3905 |
| 402 | Ga0157373_10031907 | 3300013100 | Bacteria | 3794 |
| 403 | Ga0157373_10051505 | 3300013100 | Bacteria | 2932 |
| 404 | Ga0157371_10000035 | 3300013102 | Bacteria | 223396 |
| 405 | Ga0157371_10000422 | 3300013102 | Bacteria | 52177 |
| 406 | Ga0157370_10000021 | 3300013104 | Bacteria | 166168 |
| 407 | Ga0157370_10007184 | 3300013104 | Bacteria | 12153 |
| 408 | Ga0157370_10013249 | 3300013104 | Bacteria | 8497 |
| 409 | Ga0157370_10015046 | 3300013104 | Bacteria | 7885 |
| 410 | Ga0157370_10023340 | 3300013104 | Bacteria | 6142 |
| 411 | Ga0157370_10044966 | 3300013104 | Bacteria | 4240 |
| 412 | Ga0157370_10090699 | 3300013104 | Bacteria | 2869 |
| 413 | Ga0157370_10157925 | 3300013104 | Bacteria | 2110 |
| 414 | Ga0157370_10191173 | 3300013104 | Bacteria | 1900 |
| 415 | Ga0157369_10001315 | 3300013105 | Bacteria | 30866 |
| 416 | Ga0157369_10002626 | 3300013105 | Bacteria | 21487 |
| 417 | Ga0157369_10026747 | 3300013105 | Bacteria | 6399 |
| 418 | Ga0157369_10105228 | 3300013105 | Bacteria | 3004 |
| 419 | Ga0157369_10117316 | 3300013105 | Bacteria | 2826 |
| 420 | Ga0157374_10006467 | 3300013296 | Bacteria | 9946 |
| 421 | Ga0157374_10070056 | 3300013296 | Bacteria | 3303 |
| 422 | Ga0157374_10090218 | 3300013296 | Bacteria | 2922 |
| 423 | Ga0157374_10196849 | 3300013296 | Bacteria | 1972 |
| 424 | Ga0157374_10254499 | 3300013296 | Bacteria | 1728 |
| 425 | Ga0157378_10032544 | 3300013297 | Bacteria | 4607 |
| 426 | Ga0157378_10037933 | 3300013297 | Bacteria | 4270 |
| 427 | Ga0157378_10119353 | 3300013297 | Unclassified | 2428 |
| 428 | Ga0163162_10000673 | 3300013306 | Bacteria | 31751 |
| 429 | Ga0163162_10015027 | 3300013306 | Bacteria | 7562 |
| 430 | Ga0163162_10055380 | 3300013306 | Bacteria | 3992 |
| 431 | Ga0163162_10185125 | 3300013306 | Bacteria | 2209 |
| 432 | Ga0163162_10369824 | 3300013306 | Bacteria | 1567 |
| 433 | Ga0163162_10402583 | 3300013306 | Bacteria | 1501 |
| 434 | Ga0157372_10000331 | 3300013307 | Bacteria | 51927 |
| 435 | Ga0157372_10000872 | 3300013307 | Bacteria | 32758 |
| 436 | Ga0157372_10013698 | 3300013307 | Bacteria | 8667 |
| 437 | Ga0157372_10076901 | 3300013307 | Bacteria | 3769 |
| 438 | Ga0157372_10089122 | 3300013307 | Bacteria | 3504 |
| 439 | Ga0157372_10356724 | 3300013307 | Bacteria | 1703 |
| 440 | Ga0157375_10002234 | 3300013308 | Bacteria | 16754 |
| 441 | Ga0157375_10012219 | 3300013308 | Bacteria | 7613 |
| 442 | Ga0157375_10021754 | 3300013308 | Bacteria | 5889 |
| 443 | Ga0157375_10033704 | 3300013308 | Unclassified | 4870 |
| 444 | Ga0157375_10266974 | 3300013308 | Bacteria | 1873 |
| 445 | Ga0163163_10001115 | 3300014325 | Bacteria | 22840 |
| 446 | Ga0163163_10001843 | 3300014325 | Bacteria | 17890 |
| 447 | Ga0163163_10013445 | 3300014325 | Bacteria | 7497 |
| 448 | Ga0163163_10019983 | 3300014325 | Bacteria | 6301 |
| 449 | Ga0163163_10029273 | 3300014325 | Bacteria | 5298 |
| 450 | Ga0182008_10013906 | 3300014497 | Bacteria | 4224 |
| 451 | Ga0182008_10064174 | 3300014497 | Bacteria | 1808 |
| 452 | Ga0157377_10004552 | 3300014745 | Bacteria | 6405 |
| 453 | Ga0157379_10004346 | 3300014968 | Bacteria | 12120 |
| 454 | Ga0157379_10005317 | 3300014968 | Bacteria | 11061 |
| 455 | Ga0157379_10056765 | 3300014968 | Bacteria | 3498 |
| 456 | Ga0157376_10000890 | 3300014969 | Bacteria | 19517 |
| 457 | Ga0157376_10020891 | 3300014969 | Bacteria | 5074 |
| 458 | Ga0157376_10048088 | 3300014969 | Bacteria | 3525 |
| 459 | Ga0182006_1000977 | 3300015261 | Bacteria | 18909 |
| 460 | Ga0182006_1024499 | 3300015261 | Bacteria | 2488 |
| 461 | Ga0163161_10025858 | 3300017792 | Bacteria | 4156 |
| 462 | Ga0163161_10029344 | 3300017792 | Bacteria | 3910 |
| 463 | Ga0163161_10042718 | 3300017792 | Bacteria | 3262 |
| 464 | Ga0206356_11359853 | 3300020070 | Bacteria | 3973 |
| 465 | Ga0206351_10716077 | 3300020077 | Bacteria | 2547 |
| 466 | Ga0154015_1042038 | 3300020610 | Bacteria | 50222 |
| 467 | Ga0213872_10003817 | 3300021361 | Bacteria | 8210 |
| 468 | Ga0213872_10037239 | 3300021361 | Bacteria | 2220 |
| 469 | Ga0209435_100067 | 3300025206 | Bacteria | 66388 |
| 470 | Ga0209784_100014 | 3300025224 | Bacteria | 496182 |
| 471 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 472 | Ga0209784_100606 | 3300025224 | Bacteria | 11535 |
| 473 | Ga0209566_100011 | 3300025225 | Bacteria | 496182 |
| 474 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 475 | Ga0209566_100509 | 3300025225 | Bacteria | 26938 |
| 476 | Ga0209566_100684 | 3300025225 | Bacteria | 19795 |
| 477 | Ga0209674_100032 | 3300025226 | Bacteria | 426888 |
| 478 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 479 | Ga0209674_100131 | 3300025226 | Bacteria | 118079 |
| 480 | Ga0209672_100217 | 3300025228 | Bacteria | 44942 |
| 481 | Ga0209672_100428 | 3300025228 | Bacteria | 24381 |
| 482 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 483 | Ga0209563_100029 | 3300025230 | Bacteria | 496182 |
| 484 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 485 | Ga0209563_102531 | 3300025230 | Bacteria | 4103 |
| 486 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 487 | Ga0209646_1000023 | 3300025246 | Bacteria | 441100 |
| 488 | Ga0209646_1000058 | 3300025246 | Bacteria | 259999 |
| 489 | Ga0209646_1000061 | 3300025246 | Bacteria | 255495 |
| 490 | Ga0209026_1000754 | 3300025250 | Bacteria | 18343 |
| 491 | Ga0209026_1002211 | 3300025250 | Bacteria | 7511 |
| 492 | Ga0209026_1002822 | 3300025250 | Bacteria | 6155 |
| 493 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 494 | Ga0209677_100042 | 3300025253 | Bacteria | 225037 |
| 495 | Ga0209677_105351 | 3300025253 | Bacteria | 3375 |
| 496 | Ga0209148_1000043 | 3300025254 | Bacteria | 461531 |
| 497 | Ga0209759_1000209 | 3300025256 | Bacteria | 90642 |
| 498 | Ga0209759_1000537 | 3300025256 | Bacteria | 39856 |
| 499 | Ga0209565_1000232 | 3300025263 | Bacteria | 61159 |
| 500 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 501 | Ga0209130_1008358 | 3300025284 | Bacteria | 3065 |
| 502 | Ga0209675_1000047 | 3300025291 | Bacteria | 221683 |
| 503 | Ga0209675_1000329 | 3300025291 | Bacteria | 41744 |
| 504 | Ga0209675_1002614 | 3300025291 | Bacteria | 9124 |
| 505 | Ga0209676_1000763 | 3300025292 | Bacteria | 43287 |
| 506 | Ga0209025_1000991 | 3300025294 | Bacteria | 42077 |
| 507 | Ga0209025_1001003 | 3300025294 | Bacteria | 41825 |
| 508 | Ga0209025_1002975 | 3300025294 | Bacteria | 16801 |
| 509 | Ga0209564_1000737 | 3300025295 | Bacteria | 46496 |
| 510 | Ga0209564_1003075 | 3300025295 | Bacteria | 11836 |
| 511 | Ga0209564_1003354 | 3300025295 | Bacteria | 11082 |
| 512 | Ga0209256_1003386 | 3300025299 | Bacteria | 11248 |
| 513 | Ga0209256_1004928 | 3300025299 | Bacteria | 8008 |
| 514 | Ga0209051_1003626 | 3300025303 | Bacteria | 10009 |
| 515 | Ga0207697_10004089 | 3300025315 | Bacteria | 7055 |
| 516 | Ga0207697_10004354 | 3300025315 | Bacteria | 6776 |
| 517 | Ga0207656_10006784 | 3300025321 | Bacteria | 4138 |
| 518 | Ga0207656_10059849 | 3300025321 | Bacteria | 1668 |
| 519 | Ga0207656_10061347 | 3300025321 | Bacteria | 1650 |
| 520 | Ga0207682_10000207 | 3300025893 | Bacteria | 26681 |
| 521 | Ga0207682_10001740 | 3300025893 | Bacteria | 9988 |
| 522 | Ga0207682_10040046 | 3300025893 | Bacteria | 1908 |
| 523 | Ga0207682_10073957 | 3300025893 | Bacteria | 1448 |
| 524 | Ga0207692_10011175 | 3300025898 | Bacteria | 3809 |
| 525 | Ga0207692_10038503 | 3300025898 | Bacteria | 2346 |
| 526 | Ga0207642_10067516 | 3300025899 | Bacteria | 1688 |
| 527 | Ga0207688_10000231 | 3300025901 | Bacteria | 25270 |
| 528 | Ga0207680_10002677 | 3300025903 | Bacteria | 8326 |
| 529 | Ga0207680_10003320 | 3300025903 | Bacteria | 7577 |
| 530 | Ga0207680_10167109 | 3300025903 | Bacteria | 1479 |
| 531 | Ga0207647_10085123 | 3300025904 | Bacteria | 1891 |
| 532 | Ga0207647_10085991 | 3300025904 | Bacteria | 1880 |
| 533 | Ga0207685_10010341 | 3300025905 | Bacteria | 2751 |
| 534 | Ga0207685_10017988 | 3300025905 | Bacteria | 2298 |
| 535 | Ga0207699_10007585 | 3300025906 | Bacteria | 5311 |
| 536 | Ga0207699_10020717 | 3300025906 | Bacteria | 3530 |
| 537 | Ga0207699_10022993 | 3300025906 | Bacteria | 3387 |
| 538 | Ga0207699_10039773 | 3300025906 | Bacteria | 2704 |
| 539 | Ga0207699_10131796 | 3300025906 | Bacteria | 1631 |
| 540 | Ga0207645_10003178 | 3300025907 | Bacteria | 12576 |
| 541 | Ga0207645_10003309 | 3300025907 | Bacteria | 12298 |
| 542 | Ga0207645_10010581 | 3300025907 | Bacteria | 6330 |
| 543 | Ga0207645_10019023 | 3300025907 | Bacteria | 4510 |
| 544 | Ga0207645_10036871 | 3300025907 | Bacteria | 3140 |
| 545 | Ga0207645_10100035 | 3300025907 | Bacteria | 1870 |
| 546 | Ga0207643_10000559 | 3300025908 | Bacteria | 23758 |
| 547 | Ga0207643_10024187 | 3300025908 | Bacteria | 3352 |
| 548 | Ga0207643_10062224 | 3300025908 | Unclassified | 2132 |
| 549 | Ga0207684_10040037 | 3300025910 | Bacteria | 3973 |
| 550 | Ga0207684_10062351 | 3300025910 | Bacteria | 3165 |
| 551 | Ga0207684_10063233 | 3300025910 | Bacteria | 3143 |
| 552 | Ga0207684_10110793 | 3300025910 | Bacteria | 2350 |
| 553 | Ga0207684_10299573 | 3300025910 | Bacteria | 1386 |
| 554 | Ga0207654_10153461 | 3300025911 | Bacteria | 1481 |
| 555 | Ga0207707_10013665 | 3300025912 | Bacteria | 7080 |
| 556 | Ga0207707_10047520 | 3300025912 | Bacteria | 3737 |
| 557 | Ga0207707_10065049 | 3300025912 | Bacteria | 3176 |
| 558 | Ga0207707_10067787 | 3300025912 | Bacteria | 3108 |
| 559 | Ga0207707_10078110 | 3300025912 | Bacteria | 2890 |
| 560 | Ga0207707_10253456 | 3300025912 | Bacteria | 1528 |
| 561 | Ga0207707_10260572 | 3300025912 | Bacteria | 1505 |
| 562 | Ga0207695_10002238 | 3300025913 | Bacteria | 29030 |
| 563 | Ga0207695_10006717 | 3300025913 | Bacteria | 14851 |
| 564 | Ga0207695_10020489 | 3300025913 | Bacteria | 7571 |
| 565 | Ga0207695_10022238 | 3300025913 | Bacteria | 7209 |
| 566 | Ga0207695_10036685 | 3300025913 | Bacteria | 5296 |
| 567 | Ga0207695_10053385 | 3300025913 | Bacteria | 4228 |
| 568 | Ga0207695_10057422 | 3300025913 | Bacteria | 4043 |
| 569 | Ga0207695_10144987 | 3300025913 | Bacteria | 2320 |
| 570 | Ga0207695_10198887 | 3300025913 | Bacteria | 1919 |
| 571 | Ga0207671_10007566 | 3300025914 | Bacteria | 9406 |
| 572 | Ga0207671_10011834 | 3300025914 | Bacteria | 7061 |
| 573 | Ga0207671_10091677 | 3300025914 | Bacteria | 2290 |
| 574 | Ga0207671_10123137 | 3300025914 | Bacteria | 1983 |
| 575 | Ga0207693_10000405 | 3300025915 | Bacteria | 39292 |
| 576 | Ga0207693_10001447 | 3300025915 | Bacteria | 21016 |
| 577 | Ga0207693_10042283 | 3300025915 | Bacteria | 3587 |
| 578 | Ga0207693_10064126 | 3300025915 | Bacteria | 2878 |
| 579 | Ga0207693_10089294 | 3300025915 | Bacteria | 2415 |
| 580 | Ga0207693_10092071 | 3300025915 | Bacteria | 2376 |
| 581 | Ga0207693_10148004 | 3300025915 | Bacteria | 1846 |
| 582 | Ga0207663_10006388 | 3300025916 | Bacteria | 6027 |
| 583 | Ga0207663_10060079 | 3300025916 | Bacteria | 2407 |
| 584 | Ga0207663_10128546 | 3300025916 | Bacteria | 1747 |
| 585 | Ga0207660_10020801 | 3300025917 | Bacteria | 4409 |
| 586 | Ga0207660_10055006 | 3300025917 | Bacteria | 2842 |
| 587 | Ga0207660_10076344 | 3300025917 | Bacteria | 2450 |
| 588 | Ga0207660_10217812 | 3300025917 | Bacteria | 1497 |
| 589 | Ga0207662_10021889 | 3300025918 | Bacteria | 3659 |
| 590 | Ga0207662_10056892 | 3300025918 | Bacteria | 2337 |
| 591 | Ga0207662_10157294 | 3300025918 | Bacteria | 1450 |
| 592 | Ga0207657_10000291 | 3300025919 | Bacteria | 53472 |
| 593 | Ga0207657_10003974 | 3300025919 | Bacteria | 15707 |
| 594 | Ga0207657_10011953 | 3300025919 | Bacteria | 8591 |
| 595 | Ga0207657_10028818 | 3300025919 | Bacteria | 5059 |
| 596 | Ga0207657_10040604 | 3300025919 | Bacteria | 4121 |
| 597 | Ga0207657_10076159 | 3300025919 | Bacteria | 2831 |
| 598 | Ga0207649_10000169 | 3300025920 | Bacteria | 53440 |
| 599 | Ga0207649_10063815 | 3300025920 | Bacteria | 2327 |
| 600 | Ga0207649_10123456 | 3300025920 | Bacteria | 1749 |
| 601 | Ga0207649_10201596 | 3300025920 | Bacteria | 1406 |
| 602 | Ga0207652_10031557 | 3300025921 | Bacteria | 4451 |
| 603 | Ga0207652_10087492 | 3300025921 | Bacteria | 2732 |
| 604 | Ga0207652_10105912 | 3300025921 | Bacteria | 2488 |
| 605 | Ga0207652_10123295 | 3300025921 | Bacteria | 2307 |
| 606 | Ga0207646_10013083 | 3300025922 | Bacteria | 7947 |
| 607 | Ga0207646_10016319 | 3300025922 | Bacteria | 6971 |
| 608 | Ga0207646_10026718 | 3300025922 | Bacteria | 5265 |
| 609 | Ga0207646_10122032 | 3300025922 | Bacteria | 2341 |
| 610 | Ga0207681_10007823 | 3300025923 | Bacteria | 6547 |
| 611 | Ga0207681_10015205 | 3300025923 | Bacteria | 4799 |
| 612 | Ga0207694_10000111 | 3300025924 | Bacteria | 85677 |
| 613 | Ga0207694_10000732 | 3300025924 | Bacteria | 29484 |
| 614 | Ga0207694_10067422 | 3300025924 | Bacteria | 2793 |
| 615 | Ga0207650_10009090 | 3300025925 | Bacteria | 6792 |
| 616 | Ga0207650_10018757 | 3300025925 | Bacteria | 4859 |
| 617 | Ga0207650_10035164 | 3300025925 | Bacteria | 3636 |
| 618 | Ga0207650_10043524 | 3300025925 | Bacteria | 3296 |
| 619 | Ga0207650_10079119 | 3300025925 | Bacteria | 2489 |
| 620 | Ga0207650_10157150 | 3300025925 | Bacteria | 1799 |
| 621 | Ga0207650_10173880 | 3300025925 | Unclassified | 1713 |
| 622 | Ga0207650_10242696 | 3300025925 | Bacteria | 1456 |
| 623 | Ga0207659_10006300 | 3300025926 | Bacteria | 7258 |
| 624 | Ga0207659_10008214 | 3300025926 | Bacteria | 6469 |
| 625 | Ga0207659_10022369 | 3300025926 | Unclassified | 4209 |
| 626 | Ga0207659_10042474 | 3300025926 | Bacteria | 3188 |
| 627 | Ga0207659_10043880 | 3300025926 | Bacteria | 3144 |
| 628 | Ga0207659_10119894 | 3300025926 | Bacteria | 2014 |
| 629 | Ga0207659_10130112 | 3300025926 | Bacteria | 1941 |
| 630 | Ga0207687_10000963 | 3300025927 | Bacteria | 19570 |
| 631 | Ga0207687_10002278 | 3300025927 | Bacteria | 13063 |
| 632 | Ga0207687_10018616 | 3300025927 | Bacteria | 4588 |
| 633 | Ga0207687_10039595 | 3300025927 | Bacteria | 3228 |
| 634 | Ga0207700_10000044 | 3300025928 | Bacteria | 89454 |
| 635 | Ga0207700_10000134 | 3300025928 | Bacteria | 44089 |
| 636 | Ga0207700_10001855 | 3300025928 | Bacteria | 11973 |
| 637 | Ga0207700_10004836 | 3300025928 | Bacteria | 7997 |
| 638 | Ga0207700_10008645 | 3300025928 | Bacteria | 6322 |
| 639 | Ga0207700_10026063 | 3300025928 | Bacteria | 4071 |
| 640 | Ga0207664_10000845 | 3300025929 | Bacteria | 20762 |
| 641 | Ga0207664_10034902 | 3300025929 | Bacteria | 3877 |
| 642 | Ga0207664_10060282 | 3300025929 | Bacteria | 3024 |
| 643 | Ga0207664_10061496 | 3300025929 | Bacteria | 2996 |
| 644 | Ga0207664_10135470 | 3300025929 | Bacteria | 2078 |
| 645 | Ga0207644_10001215 | 3300025931 | Bacteria | 16583 |
| 646 | Ga0207644_10003613 | 3300025931 | Bacteria | 10019 |
| 647 | Ga0207644_10006332 | 3300025931 | Bacteria | 7708 |
| 648 | Ga0207644_10008623 | 3300025931 | Bacteria | 6669 |
| 649 | Ga0207644_10022294 | 3300025931 | Bacteria | 4325 |
| 650 | Ga0207644_10043519 | 3300025931 | Bacteria | 3187 |
| 651 | Ga0207644_10070760 | 3300025931 | Bacteria | 2550 |
| 652 | Ga0207690_10001060 | 3300025932 | Bacteria | 17610 |
| 653 | Ga0207690_10008267 | 3300025932 | Bacteria | 6172 |
| 654 | Ga0207690_10012208 | 3300025932 | Bacteria | 5142 |
| 655 | Ga0207690_10015663 | 3300025932 | Bacteria | 4600 |
| 656 | Ga0207690_10121652 | 3300025932 | Bacteria | 1897 |
| 657 | Ga0207690_10169659 | 3300025932 | Bacteria | 1634 |
| 658 | Ga0207706_10000074 | 3300025933 | Bacteria | 103144 |
| 659 | Ga0207706_10001160 | 3300025933 | Bacteria | 26707 |
| 660 | Ga0207706_10052800 | 3300025933 | Bacteria | 3588 |
| 661 | Ga0207706_10064442 | 3300025933 | Bacteria | 3226 |
| 662 | Ga0207706_10095602 | 3300025933 | Bacteria | 2613 |
| 663 | Ga0207706_10095937 | 3300025933 | Bacteria | 2608 |
| 664 | Ga0207706_10162111 | 3300025933 | Bacteria | 1965 |
| 665 | Ga0207706_10255521 | 3300025933 | Bacteria | 1530 |
| 666 | Ga0207686_10000779 | 3300025934 | Bacteria | 19588 |
| 667 | Ga0207686_10013284 | 3300025934 | Bacteria | 4553 |
| 668 | Ga0207686_10020077 | 3300025934 | Bacteria | 3812 |
| 669 | Ga0207686_10057934 | 3300025934 | Bacteria | 2441 |
| 670 | Ga0207670_10003798 | 3300025936 | Bacteria | 8033 |
| 671 | Ga0207670_10046674 | 3300025936 | Bacteria | 2879 |
| 672 | Ga0207670_10138987 | 3300025936 | Bacteria | 1789 |
| 673 | Ga0207670_10281505 | 3300025936 | Bacteria | 1296 |
| 674 | Ga0207704_10060607 | 3300025938 | Bacteria | 2342 |
| 675 | Ga0207704_10079152 | 3300025938 | Bacteria | 2117 |
| 676 | Ga0207704_10094310 | 3300025938 | Unclassified | 1976 |
| 677 | Ga0207691_10000127 | 3300025940 | Bacteria | 69355 |
| 678 | Ga0207691_10002501 | 3300025940 | Bacteria | 17980 |
| 679 | Ga0207691_10004488 | 3300025940 | Bacteria | 13520 |
| 680 | Ga0207691_10006975 | 3300025940 | Bacteria | 10901 |
| 681 | Ga0207691_10011409 | 3300025940 | Bacteria | 8527 |
| 682 | Ga0207691_10021763 | 3300025940 | Bacteria | 6053 |
| 683 | Ga0207691_10160800 | 3300025940 | Bacteria | 1970 |
| 684 | Ga0207711_10000320 | 3300025941 | Bacteria | 51464 |
| 685 | Ga0207711_10001803 | 3300025941 | Bacteria | 19580 |
| 686 | Ga0207711_10002482 | 3300025941 | Bacteria | 16454 |
| 687 | Ga0207711_10050909 | 3300025941 | Bacteria | 3547 |
| 688 | Ga0207689_10006981 | 3300025942 | Bacteria | 9927 |
| 689 | Ga0207689_10010359 | 3300025942 | Bacteria | 8032 |
| 690 | Ga0207689_10017108 | 3300025942 | Bacteria | 6137 |
| 691 | Ga0207689_10021336 | 3300025942 | Bacteria | 5446 |
| 692 | Ga0207689_10023535 | 3300025942 | Bacteria | 5168 |
| 693 | Ga0207689_10023716 | 3300025942 | Bacteria | 5146 |
| 694 | Ga0207661_10000444 | 3300025944 | Bacteria | 26690 |
| 695 | Ga0207661_10045012 | 3300025944 | Bacteria | 3491 |
| 696 | Ga0207661_10109030 | 3300025944 | Bacteria | 2338 |
| 697 | Ga0207661_10339705 | 3300025944 | Bacteria | 1353 |
| 698 | Ga0207679_10000003 | 3300025945 | Bacteria | 597553 |
| 699 | Ga0207679_10002864 | 3300025945 | Bacteria | 10697 |
| 700 | Ga0207679_10027083 | 3300025945 | Bacteria | 3960 |
| 701 | Ga0207679_10037007 | 3300025945 | Bacteria | 3466 |
| 702 | Ga0207679_10064935 | 3300025945 | Bacteria | 2730 |
| 703 | Ga0207679_10084413 | 3300025945 | Bacteria | 2437 |
| 704 | Ga0207679_10089852 | 3300025945 | Bacteria | 2372 |
| 705 | Ga0207679_10146403 | 3300025945 | Bacteria | 1916 |
| 706 | Ga0207667_10000102 | 3300025949 | Bacteria | 137469 |
| 707 | Ga0207667_10009133 | 3300025949 | Bacteria | 11710 |
| 708 | Ga0207667_10020183 | 3300025949 | Bacteria | 7417 |
| 709 | Ga0207667_10071730 | 3300025949 | Bacteria | 3601 |
| 710 | Ga0207667_10078124 | 3300025949 | Bacteria | 3431 |
| 711 | Ga0207667_10113610 | 3300025949 | Bacteria | 2792 |
| 712 | Ga0207667_10189884 | 3300025949 | Bacteria | 2108 |
| 713 | Ga0207651_10010664 | 3300025960 | Bacteria | 5104 |
| 714 | Ga0207651_10011801 | 3300025960 | Bacteria | 4906 |
| 715 | Ga0207651_10025745 | 3300025960 | Bacteria | 3662 |
| 716 | Ga0207651_10029784 | 3300025960 | Bacteria | 3465 |
| 717 | Ga0207651_10030907 | 3300025960 | Bacteria | 3417 |
| 718 | Ga0207651_10040139 | 3300025960 | Bacteria | 3093 |
| 719 | Ga0207651_10111394 | 3300025960 | Bacteria | 2055 |
| 720 | Ga0207712_10025658 | 3300025961 | Bacteria | 3918 |
| 721 | Ga0207668_10005968 | 3300025972 | Bacteria | 7178 |
| 722 | Ga0207668_10046243 | 3300025972 | Bacteria | 2973 |
| 723 | Ga0207668_10116572 | 3300025972 | Bacteria | 2014 |
| 724 | Ga0207640_10000124 | 3300025981 | Bacteria | 58977 |
| 725 | Ga0207640_10007969 | 3300025981 | Bacteria | 5851 |
| 726 | Ga0207640_10054965 | 3300025981 | Bacteria | 2605 |
| 727 | Ga0207658_10004312 | 3300025986 | Bacteria | 9903 |
| 728 | Ga0207658_10028575 | 3300025986 | Plasmid | 3928 |
| 729 | Ga0207658_10042665 | 3300025986 | Bacteria | 3292 |
| 730 | Ga0207658_10066421 | 3300025986 | Bacteria | 2713 |
| 731 | Ga0207658_10081423 | 3300025986 | Bacteria | 2482 |
| 732 | Ga0207658_10091082 | 3300025986 | Bacteria | 2365 |
| 733 | Ga0207658_10118470 | 3300025986 | Bacteria | 2106 |
| 734 | Ga0207658_10160699 | 3300025986 | Bacteria | 1841 |
| 735 | Ga0207658_10257183 | 3300025986 | Bacteria | 1486 |
| 736 | Ga0207677_10001129 | 3300026023 | Bacteria | 14557 |
| 737 | Ga0207677_10001376 | 3300026023 | Bacteria | 12979 |
| 738 | Ga0207677_10019704 | 3300026023 | Bacteria | 4080 |
| 739 | Ga0207677_10059768 | 3300026023 | Bacteria | 2631 |
| 740 | Ga0207703_10000377 | 3300026035 | Bacteria | 47621 |
| 741 | Ga0207703_10011885 | 3300026035 | Bacteria | 6778 |
| 742 | Ga0207703_10158024 | 3300026035 | Bacteria | 1983 |
| 743 | Ga0207639_10065924 | 3300026041 | Bacteria | 2812 |
| 744 | Ga0207639_10119702 | 3300026041 | Bacteria | 2161 |
| 745 | Ga0207639_10232933 | 3300026041 | Bacteria | 1597 |
| 746 | Ga0207678_10000002 | 3300026067 | Bacteria | 371723 |
| 747 | Ga0207678_10001082 | 3300026067 | Bacteria | 24973 |
| 748 | Ga0207678_10010347 | 3300026067 | Bacteria | 8186 |
| 749 | Ga0207678_10019108 | 3300026067 | Bacteria | 6016 |
| 750 | Ga0207678_10030041 | 3300026067 | Bacteria | 4744 |
| 751 | Ga0207708_10000714 | 3300026075 | Bacteria | 25013 |
| 752 | Ga0207708_10015422 | 3300026075 | Bacteria | 5732 |
| 753 | Ga0207708_10034875 | 3300026075 | Bacteria | 3828 |
| 754 | Ga0207708_10112053 | 3300026075 | Bacteria | 2119 |
| 755 | Ga0207702_10000031 | 3300026078 | Bacteria | 175405 |
| 756 | Ga0207702_10001249 | 3300026078 | Bacteria | 25648 |
| 757 | Ga0207702_10002295 | 3300026078 | Bacteria | 18326 |
| 758 | Ga0207702_10011243 | 3300026078 | Bacteria | 7464 |
| 759 | Ga0207702_10045742 | 3300026078 | Bacteria | 3682 |
| 760 | Ga0207702_10228525 | 3300026078 | Bacteria | 1738 |
| 761 | Ga0207641_10001640 | 3300026088 | Bacteria | 21813 |
| 762 | Ga0207641_10004353 | 3300026088 | Bacteria | 12282 |
| 763 | Ga0207641_10007514 | 3300026088 | Bacteria | 9070 |
| 764 | Ga0207641_10016663 | 3300026088 | Bacteria | 6017 |
| 765 | Ga0207641_10041625 | 3300026088 | Bacteria | 3850 |
| 766 | Ga0207641_10201286 | 3300026088 | Bacteria | 1836 |
| 767 | Ga0207648_10005893 | 3300026089 | Bacteria | 12258 |
| 768 | Ga0207648_10006620 | 3300026089 | Bacteria | 11510 |
| 769 | Ga0207648_10031859 | 3300026089 | Bacteria | 4659 |
| 770 | Ga0207648_10042082 | 3300026089 | Bacteria | 4011 |
| 771 | Ga0207648_10071276 | 3300026089 | Bacteria | 3028 |
| 772 | Ga0207648_10081899 | 3300026089 | Bacteria | 2814 |
| 773 | Ga0207648_10103269 | 3300026089 | Bacteria | 2499 |
| 774 | Ga0207648_10201206 | 3300026089 | Bacteria | 1766 |
| 775 | Ga0207676_10000881 | 3300026095 | Bacteria | 23317 |
| 776 | Ga0207676_10002147 | 3300026095 | Bacteria | 14257 |
| 777 | Ga0207676_10015861 | 3300026095 | Bacteria | 5447 |
| 778 | Ga0207676_10025352 | 3300026095 | Bacteria | 4399 |
| 779 | Ga0207676_10041855 | 3300026095 | Bacteria | 3520 |
| 780 | Ga0207676_10081831 | 3300026095 | Bacteria | 2624 |
| 781 | Ga0207674_10006216 | 3300026116 | Bacteria | 14077 |
| 782 | Ga0207674_10009786 | 3300026116 | Bacteria | 10920 |
| 783 | Ga0207674_10011448 | 3300026116 | Bacteria | 9967 |
| 784 | Ga0207674_10017528 | 3300026116 | Bacteria | 7813 |
| 785 | Ga0207674_10081283 | 3300026116 | Bacteria | 3243 |
| 786 | Ga0207674_10100228 | 3300026116 | Bacteria | 2878 |
| 787 | Ga0207674_10365290 | 3300026116 | Bacteria | 1395 |
| 788 | Ga0207675_100001180 | 3300026118 | Bacteria | 25996 |
| 789 | Ga0207675_100043266 | 3300026118 | Bacteria | 4206 |
| 790 | Ga0207675_100064529 | 3300026118 | Bacteria | 3423 |
| 791 | Ga0207683_10000009 | 3300026121 | Bacteria | 150281 |
| 792 | Ga0207683_10003341 | 3300026121 | Bacteria | 13984 |
| 793 | Ga0207683_10006010 | 3300026121 | Bacteria | 10393 |
| 794 | Ga0207683_10038318 | 3300026121 | Bacteria | 4177 |
| 795 | Ga0207683_10222011 | 3300026121 | Bacteria | 1722 |
| 796 | Ga0207698_10004601 | 3300026142 | Bacteria | 8425 |
| 797 | Ga0207698_10006665 | 3300026142 | Bacteria | 7219 |
| 798 | Ga0207698_10027303 | 3300026142 | Bacteria | 4051 |
| 799 | Ga0207698_10040590 | 3300026142 | Bacteria | 3460 |
| 800 | Ga0207698_10070883 | 3300026142 | Bacteria | 2763 |
| 801 | Ga0207698_10071246 | 3300026142 | Bacteria | 2757 |
| 802 | Ga0207698_10082350 | 3300026142 | Bacteria | 2601 |
| 803 | Ga0207698_10317971 | 3300026142 | Bacteria | 1456 |
| 804 | Ga0209282_1000044 | 3300027666 | Bacteria | 119005 |
| 805 | Ga0207428_10014644 | 3300027907 | Bacteria | 6797 |
| 806 | Ga0268266_10011096 | 3300028379 | Bacteria | 7845 |
| 807 | Ga0268266_10011196 | 3300028379 | Bacteria | 7806 |
| 808 | Ga0268266_10017355 | 3300028379 | Bacteria | 6142 |
| 809 | Ga0268266_10024774 | 3300028379 | Bacteria | 5106 |
| 810 | Ga0268266_10027645 | 3300028379 | Bacteria | 4822 |
| 811 | Ga0268266_10169688 | 3300028379 | Bacteria | 1980 |
| 812 | Ga0268266_10222354 | 3300028379 | Bacteria | 1736 |
| 813 | Ga0268265_10080908 | 3300028380 | Bacteria | 2563 |
| 814 | Ga0268265_10106356 | 3300028380 | Bacteria | 2279 |
| 815 | Ga0268265_10188801 | 3300028380 | Bacteria | 1777 |
| 816 | Ga0268265_10255903 | 3300028380 | Bacteria | 1554 |
| 817 | Ga0268264_10003274 | 3300028381 | Bacteria | 14007 |
| 818 | Ga0268264_10016626 | 3300028381 | Bacteria | 6023 |
| 819 | Ga0265338_10086102 | 3300028800 | Bacteria | 2617 |
| 820 | Ga0265332_10000223 | 3300031238 | Bacteria | 45573 |
| 821 | Ga0265328_10000615 | 3300031239 | Bacteria | 16534 |
| 822 | Ga0265328_10037856 | 3300031239 | Bacteria | 1781 |
| 823 | Ga0265320_10003495 | 3300031240 | Bacteria | 10532 |
| 824 | Ga0265325_10013330 | 3300031241 | Bacteria | 4683 |
| 825 | Ga0265339_10008568 | 3300031249 | Bacteria | 6493 |
| 826 | Ga0265339_10018313 | 3300031249 | Bacteria | 4129 |
| 827 | Ga0265331_10003302 | 3300031250 | Bacteria | 10480 |
| 828 | Ga0265327_10006820 | 3300031251 | Bacteria | 9000 |
| 829 | Ga0265316_10028312 | 3300031344 | Bacteria | 4624 |
| 830 | Ga0307508_10025409 | 3300031616 | Bacteria | 5371 |
| 831 | Ga0265314_10001268 | 3300031711 | Bacteria | 28776 |
| 832 | Ga0265314_10003592 | 3300031711 | Bacteria | 14936 |
| 833 | Ga0265342_10001777 | 3300031712 | Bacteria | 19652 |
| 834 | Ga0265342_10002213 | 3300031712 | Bacteria | 17074 |
| 835 | Ga0265342_10011103 | 3300031712 | Bacteria | 6183 |
| 836 | Ga0373934_0016144 | 3300035086 | Bacteria | 2836 |
| 837 | Ga0373949_0027035 | 3300035090 | Bacteria | 1347 |
| 838 | Ga0373923_0005264 | 3300035111 | Bacteria | 4383 |
| 839 | Ga0373923_0033187 | 3300035111 | Bacteria | 2089 |
| 840 | Ga0373923_0037673 | 3300035111 | Bacteria | 1979 |
| 841 | Ga0373936_0022595 | 3300035113 | Bacteria | 2449 |
| 842 | Ga0373945_0002689 | 3300035116 | Bacteria | 5576 |
| 843 | Ga0373953_0000699 | 3300035117 | Bacteria | 9271 |
| 844 | Ga0373953_0003016 | 3300035117 | Bacteria | 5158 |
| 845 | Ga0373953_0014147 | 3300035117 | Bacteria | 2864 |
| 846 | Ga0373953_0082902 | 3300035117 | Bacteria | 1335 |
| 847 | Ga0373954_0005785 | 3300035118 | Bacteria | 5369 |
| 848 | Ga0373954_0012783 | 3300035118 | Bacteria | 3737 |
| 849 | Ga0373954_0014510 | 3300035118 | Bacteria | 3514 |
| 850 | Ga0373954_0027610 | 3300035118 | Bacteria | 2607 |
| 851 | Ga0373956_0011981 | 3300035119 | Bacteria | 3584 |
| 852 | Ga0373956_0035398 | 3300035119 | Bacteria | 2202 |
| 853 | Ga0373957_0002633 | 3300035120 | Bacteria | 5149 |
| 854 | Ga0373957_0125117 | 3300035120 | Bacteria | 1043 |
| 855 | Ga0373957_0130158 | 3300035120 | Bacteria | 1024 |
| 856 | Ga0373943_0005851 | 3300035170 | Bacteria | 5521 |
| 857 | Ga0373946_0033823 | 3300035171 | Bacteria | 2060 |
| 858 | Ga0373955_0021140 | 3300035172 | Bacteria | 3280 |
| 859 | Ga0373955_0037393 | 3300035172 | Bacteria | 2580 |
| 860 | Ga0373955_0134283 | 3300035172 | Bacteria | 1446 |
| 861 | Ga0373924_0000995 | 3300035410 | Bacteria | 8988 |
| 862 | Ga0373924_0028409 | 3300035410 | Bacteria | 2229 |
| 863 | Ga0373935_0013859 | 3300035692 | Bacteria | 4867 |
| 864 | Ga0373927_0029162 | 3300035695 | Bacteria | 3596 |
| 865 | Ga0373927_0066269 | 3300035695 | Bacteria | 2336 |
| 866 | Ga0373947_0006510 | 3300035725 | Bacteria | 6778 |
| 867 | Ga0373947_0007708 | 3300035725 | Bacteria | 6222 |
| 868 | Ga0373947_0057315 | 3300035725 | Bacteria | 2357 |
| 869 | Ga0373947_0135405 | 3300035725 | Bacteria | 1576 |
| 870 | Ga0373937_0000847 | 3300036401 | Bacteria | 26243 |
| 871 | Ga0373937_0014594 | 3300036401 | Bacteria | 6936 |
| 872 | Ga0373937_0018946 | 3300036401 | Bacteria | 6154 |
| 873 | Ga0373937_0058673 | 3300036401 | Bacteria | 3536 |
| 874 | Ga0373937_0061323 | 3300036401 | Bacteria | 3457 |
| 875 | Ga0373937_0080620 | 3300036401 | Bacteria | 3010 |
| 876 | Ga0373937_0139444 | 3300036401 | Bacteria | 2268 |
| 877 | Ga0373937_0185054 | 3300036401 | Bacteria | 1956 |
| 878 | Ga0373937_0214974 | 3300036401 | Bacteria | 1809 |
| 879 | Ga0373937_0241872 | 3300036401 | Bacteria | 1700 |
| 880 | Ga0373925_0025217 | 3300037068 | Bacteria | 4342 |
| 881 | Ga0373925_0099381 | 3300037068 | Bacteria | 2235 |
| 882 | Ga0395900_0010395 | 3300037418 | Bacteria | 9515 |
| 883 | Ga0395900_0086087 | 3300037418 | Bacteria | 3230 |
| 884 | Ga0395900_0217129 | 3300037418 | Bacteria | 1929 |
| 885 | Ga0395905_0013326 | 3300037471 | Bacteria | 7882 |
| 886 | Ga0395905_0188101 | 3300037471 | Bacteria | 1937 |
| 887 | Ga0436364_1083737 | 3300037853 | Bacteria | 1826 |
| 888 | Ga0436364_1133987 | 3300037853 | Bacteria | 19397 |
| 889 | Ga0395901_0003694 | 3300038443 | Bacteria | 15432 |
| 890 | Ga0395901_0099431 | 3300038443 | Bacteria | 3050 |
| 891 | Ga0436360_0414699 | 3300039438 | Bacteria | 1781 |
| 892 | Ga0436361_0298239 | 3300039447 | Bacteria | 16541 |
| 893 | Ga0436361_0580748 | 3300039447 | Bacteria | 3563 |
| 894 | Ga0451841_1180189 | 3300041498 | Bacteria | 1221 |
| 895 | Ga0451853_2213425 | 3300041512 | Bacteria | 1385 |
| 896 | Ga0451853_2661908 | 3300041512 | Bacteria | 1654 |
| 897 | Ga0451577_0018184 | 3300042876 | Bacteria | 6478 |
| 898 | Ga0451577_0021895 | 3300042876 | Bacteria | 5843 |
| 899 | Ga0451577_0263647 | 3300042876 | Unclassified | 1560 |
| 900 | Ga0466986_0105401 | 3300044650 | Bacteria | 1941 |
| 901 | Ga0466969_0004982 | 3300044656 | Bacteria | 7074 |
| 902 | Ga0466972_0015591 | 3300044658 | Bacteria | 3799 |
| 903 | Ga0466981_0065857 | 3300044669 | Bacteria | 2602 |
| 904 | Ga0453683_0079801 | 3300044673 | Bacteria | 2050 |
| 905 | Ga0466966_0003298 | 3300044684 | Bacteria | 10643 |
| 906 | Ga0466961_0000677 | 3300044693 | Bacteria | 21436 |
| 907 | Ga0466961_0058197 | 3300044693 | Bacteria | 2459 |
| 908 | Ga0466968_0010688 | 3300044735 | Bacteria | 3564 |
| 909 | Ga0466970_0105667 | 3300044765 | Bacteria | 1536 |
| 910 | Ga0466957_0057024 | 3300044842 | Bacteria | 2389 |
| 911 | Ga0466959_0003309 | 3300045049 | Bacteria | 10516 |
| 912 | Ga0466959_0029440 | 3300045049 | Bacteria | 4068 |
| 913 | Ga0451576_0006691 | 3300045051 | Bacteria | 14058 |
| 914 | Ga0466967_0012753 | 3300045976 | Bacteria | 6453 |
| 915 | Ga0495592_0053844 | 3300046454 | Bacteria | 2983 |
| 916 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 917 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 918 | Ga0495591_000109 | 3300046458 | Bacteria | 94877 |
| 919 | Ga0495629_0109908 | 3300046459 | Bacteria | 1922 |
| 920 | Ga0495638_0000027 | 3300046460 | Bacteria | 337569 |
| 921 | Ga0495650_0000322 | 3300046471 | Bacteria | 85802 |
| 922 | Ga0495580_0024889 | 3300046472 | Bacteria | 4376 |
| 923 | Ga0495662_0022534 | 3300046476 | Bacteria | 3041 |
| 924 | Ga0495662_0065508 | 3300046476 | Bacteria | 1756 |
| 925 | Ga0495662_0069305 | 3300046476 | Bacteria | 1708 |
| 926 | Ga0495664_0017099 | 3300046477 | Bacteria | 4143 |
| 927 | Ga0495664_0021966 | 3300046477 | Bacteria | 3691 |
| 928 | Ga0495584_0000029 | 3300046491 | Bacteria | 105850 |
| 929 | Ga0495594_0046681 | 3300046499 | Bacteria | 2379 |
| 930 | Ga0495596_0002231 | 3300046500 | Bacteria | 10550 |
| 931 | Ga0495596_0017677 | 3300046500 | Bacteria | 2948 |
| 932 | Ga0495596_0023714 | 3300046500 | Bacteria | 2488 |
| 933 | Ga0495607_0018224 | 3300046501 | Bacteria | 4481 |
| 934 | Ga0495583_0002517 | 3300046506 | Bacteria | 15512 |
| 935 | Ga0495583_0005662 | 3300046506 | Bacteria | 8406 |
| 936 | Ga0495608_0076723 | 3300046511 | Bacteria | 2176 |
| 937 | Ga0495610_0011818 | 3300046512 | Bacteria | 5305 |
| 938 | Ga0495628_0062370 | 3300046516 | Bacteria | 2922 |
| 939 | Ga0495632_0008663 | 3300046519 | Bacteria | 6211 |
| 940 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 941 | Ga0495643_0000167 | 3300046522 | Bacteria | 104447 |
| 942 | Ga0495643_0083867 | 3300046522 | Bacteria | 1654 |
| 943 | Ga0495644_0012382 | 3300046523 | Bacteria | 3280 |
| 944 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 945 | Ga0495648_0018966 | 3300046524 | Bacteria | 4852 |
| 946 | Ga0495642_0008010 | 3300046528 | Bacteria | 4043 |
| 947 | Ga0495587_0010326 | 3300046536 | Bacteria | 5949 |
| 948 | Ga0495587_0024882 | 3300046536 | Bacteria | 3664 |
| 949 | Ga0495609_0031269 | 3300046538 | Bacteria | 2420 |
| 950 | Ga0495621_0001645 | 3300046539 | Bacteria | 5845 |
| 951 | Ga0495621_0003203 | 3300046539 | Bacteria | 4491 |
| 952 | Ga0495621_0010621 | 3300046539 | Bacteria | 2824 |
| 953 | Ga0495621_0010882 | 3300046539 | Bacteria | 2798 |
| 954 | Ga0495597_0000855 | 3300046542 | Bacteria | 23940 |
| 955 | Ga0495645_0002809 | 3300046543 | Bacteria | 11813 |
| 956 | Ga0495622_0000200 | 3300046557 | Bacteria | 47745 |
| 957 | Ga0495633_0000033 | 3300046558 | Bacteria | 186714 |
| 958 | Ga0495633_0009470 | 3300046558 | Bacteria | 5375 |
| 959 | Ga0495633_0060752 | 3300046558 | Bacteria | 1770 |
| 960 | Ga0495667_0033641 | 3300046559 | Bacteria | 3430 |
| 961 | Ga0495667_0202465 | 3300046559 | Bacteria | 1270 |
| 962 | Ga0495668_0000065 | 3300046616 | Bacteria | 178985 |
| 963 | Ga0495668_0005622 | 3300046616 | Bacteria | 8427 |
| 964 | Ga0495634_0066910 | 3300046642 | Bacteria | 2378 |
| 965 | Ga0495611_0000410 | 3300046648 | Bacteria | 26643 |
| 966 | Ga0495635_0003244 | 3300046663 | Bacteria | 11220 |
| 967 | Ga0495635_0005283 | 3300046663 | Bacteria | 8982 |
| 968 | Ga0495635_0030714 | 3300046663 | Bacteria | 3732 |
| 969 | Ga0495635_0040416 | 3300046663 | Bacteria | 3223 |
| 970 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 971 | Ga0495661_0009151 | 3300046665 | Bacteria | 6806 |
| 972 | Ga0495661_0045071 | 3300046665 | Bacteria | 2698 |
| 973 | Ga0495657_0145944 | 3300046675 | Bacteria | 1472 |
| 974 | Ga0495599_0044961 | 3300046678 | Bacteria | 2768 |
| 975 | Ga0495599_0081045 | 3300046678 | Bacteria | 2027 |
| 976 | Ga0495623_0025908 | 3300046679 | Bacteria | 3777 |
| 977 | Ga0495658_0151296 | 3300046683 | Bacteria | 1425 |
| 978 | Ga0495613_0043940 | 3300046689 | Bacteria | 3306 |
| 979 | Ga0495649_0000071 | 3300046694 | Bacteria | 89386 |
| 980 | Ga0495649_0017927 | 3300046694 | Bacteria | 3989 |
| 981 | Ga0495589_0027417 | 3300046794 | Bacteria | 2880 |
| 982 | Ga0495581_0000957 | 3300047315 | Bacteria | 15517 |
| 983 | Ga0495604_0011336 | 3300047317 | Bacteria | 7075 |
| 984 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 985 | Ga0495672_0001752 | 3300047320 | Bacteria | 20938 |
| 986 | Ga0495680_0053537 | 3300047322 | Bacteria | 3140 |
| 987 | Ga0495680_0131082 | 3300047322 | Bacteria | 1842 |
| 988 | Ga0495683_0000168 | 3300047323 | Bacteria | 63828 |
| 989 | Ga0495687_000924 | 3300047443 | Bacteria | 30497 |
| 990 | Ga0495677_0000910 | 3300047445 | Bacteria | 11901 |
| 991 | Ga0495681_0020197 | 3300047470 | Bacteria | 3618 |
| 992 | Ga0495684_0028185 | 3300047471 | Bacteria | 4312 |
| 993 | Ga0495602_0118191 | 3300048088 | Bacteria | 2139 |
| 994 | Ga0495615_0022105 | 3300048090 | Bacteria | 1443 |
| 995 | Ga0496100_0014096 | 3300048903 | Bacteria | 4633 |
| 996 | Ga0496100_0041117 | 3300048903 | Bacteria | 2945 |
| 997 | Ga0496100_0144617 | 3300048903 | Bacteria | 1689 |
| 998 | Ga0496101_0016018 | 3300048904 | Bacteria | 5060 |
| 999 | Ga0496101_0019843 | 3300048904 | Bacteria | 4596 |
| 1000 | Ga0496101_0037367 | 3300048904 | Bacteria | 3445 |
| 1001 | Ga0496102_0005617 | 3300048905 | Bacteria | 10644 |
| 1002 | Ga0496102_0113372 | 3300048905 | Bacteria | 2529 |
| 1003 | Ga0496102_0426964 | 3300048905 | Bacteria | 1245 |
| 1004 | Ga0496103_0041925 | 3300048906 | Bacteria | 2815 |
| 1005 | Ga0496104_0003535 | 3300048907 | Bacteria | 13476 |
| 1006 | Ga0496104_0020707 | 3300048907 | Bacteria | 6031 |
| 1007 | Ga0496105_0005191 | 3300048908 | Bacteria | 9868 |
| 1008 | Ga0496105_0044391 | 3300048908 | Bacteria | 3666 |
| 1009 | Ga0496105_0045465 | 3300048908 | Bacteria | 3623 |
| 1010 | Ga0496106_0003220 | 3300048909 | Bacteria | 12231 |
| 1011 | Ga0496106_0135746 | 3300048909 | Bacteria | 1932 |
| 1012 | Ga0496107_0007215 | 3300048910 | Bacteria | 7658 |
| 1013 | Ga0496107_0018432 | 3300048910 | Bacteria | 4915 |
| 1014 | Ga0496108_0011774 | 3300048911 | Bacteria | 7114 |
| 1015 | Ga0496108_0120248 | 3300048911 | Bacteria | 2252 |
| 1016 | Ga0496109_0008830 | 3300048912 | Bacteria | 8582 |
| 1017 | Ga0496109_0083066 | 3300048912 | Bacteria | 2954 |
| 1018 | Ga0496109_0142649 | 3300048912 | Bacteria | 2240 |
| 1019 | Ga0496109_0353984 | 3300048912 | Bacteria | 1387 |
| 1020 | Ga0496110_0005235 | 3300048913 | Bacteria | 10151 |
| 1021 | Ga0496110_0021730 | 3300048913 | Bacteria | 5438 |
| 1022 | Ga0496110_0099083 | 3300048913 | Bacteria | 2613 |
| 1023 | Ga0496110_0273206 | 3300048913 | Bacteria | 1539 |
| 1024 | Ga0496112_0003897 | 3300048915 | Bacteria | 12482 |
| 1025 | Ga0496112_0017806 | 3300048915 | Bacteria | 6686 |
| 1026 | Ga0496112_0017923 | 3300048915 | Bacteria | 6662 |
| 1027 | Ga0496112_0059883 | 3300048915 | Bacteria | 3752 |
| 1028 | Ga0496112_0167972 | 3300048915 | Bacteria | 2160 |
| 1029 | Ga0496112_0342455 | 3300048915 | Bacteria | 1438 |
| 1030 | Ga0496112_0344078 | 3300048915 | Bacteria | 1434 |
| 1031 | Ga0496113_0030131 | 3300048916 | Bacteria | 3925 |
| 1032 | Ga0496113_0061445 | 3300048916 | Bacteria | 2835 |
| 1033 | Ga0496113_0089546 | 3300048916 | Bacteria | 2369 |
| 1034 | Ga0496113_0259950 | 3300048916 | Bacteria | 1387 |
| 1035 | Ga0496114_0026746 | 3300048917 | Bacteria | 4726 |
| 1036 | Ga0496114_0102479 | 3300048917 | Bacteria | 2445 |
| 1037 | Ga0496114_0303418 | 3300048917 | Bacteria | 1410 |
| 1038 | Ga0496116_0001919 | 3300048919 | Bacteria | 22398 |
| 1039 | Ga0496121_0007703 | 3300048924 | Bacteria | 12927 |
| 1040 | Ga0496121_0008156 | 3300048924 | Bacteria | 12439 |
| 1041 | Ga0496122_0001753 | 3300048925 | Bacteria | 33345 |
| 1042 | Ga0496123_0003783 | 3300048926 | Bacteria | 16574 |
| 1043 | Ga0496125_0006247 | 3300048928 | Bacteria | 12950 |
| 1044 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 1045 | Ga0495678_015197 | 3300049459 | Bacteria | 3552 |
| 1046 | Ga0501032_0139419 | 3300049569 | Bacteria | 1597 |
| 1047 | Ga0501034_0000955 | 3300049571 | Bacteria | 41785 |
| 1048 | Ga0501034_0017193 | 3300049571 | Bacteria | 7420 |
| 1049 | Ga0501047_0051697 | 3300049581 | Bacteria | 3971 |
| 1050 | Ga0501067_0002676 | 3300049583 | Bacteria | 9845 |
| 1051 | Ga0501067_0052680 | 3300049583 | Bacteria | 2255 |
| 1052 | Ga0501068_0000247 | 3300049584 | Bacteria | 26615 |
| 1053 | Ga0501070_0022210 | 3300049586 | Bacteria | 5315 |
| 1054 | Ga0501070_0054523 | 3300049586 | Bacteria | 3315 |
| 1055 | Ga0501072_0007187 | 3300049588 | Bacteria | 8447 |
| 1056 | Ga0501073_0007310 | 3300049589 | Bacteria | 8221 |
| 1057 | Ga0501073_0012613 | 3300049589 | Bacteria | 6165 |
| 1058 | Ga0501073_0033276 | 3300049589 | Bacteria | 3671 |
| 1059 | Ga0501074_0108643 | 3300049590 | Bacteria | 1985 |
| 1060 | Ga0501080_0000516 | 3300049742 | Bacteria | 30472 |
| 1061 | Ga0501080_0009004 | 3300049742 | Bacteria | 9083 |
| 1062 | Ga0501083_0011235 | 3300049744 | Bacteria | 6285 |
| 1063 | Ga0501083_0016722 | 3300049744 | Bacteria | 5126 |
| 1064 | Ga0501083_0168927 | 3300049744 | Bacteria | 1430 |
| 1065 | Ga0501044_0173433 | 3300049823 | Bacteria | 2127 |
| 1066 | nmdc:mga03n38_77731_c1 | 3300050490 | Bacteria | 1552 |
| 1067 | nmdc:mga0yw44_69540_c1 | 3300050492 | Bacteria | 2181 |
| 1068 | nmdc:mga0k408_19087_c1 | 3300050493 | Bacteria | 3829 |
| 1069 | nmdc:mga0k408_22575_c1 | 3300050493 | Bacteria | 3543 |
| 1070 | nmdc:mga05p37_19022_c1 | 3300050507 | Bacteria | 8306 |
| 1071 | nmdc:mga05p37_43164_c1 | 3300050507 | Bacteria | 5545 |
| 1072 | nmdc:mga08y16_16301_c1 | 3300050511 | Bacteria | 7813 |
| 1073 | nmdc:mga08y16_27555_c1 | 3300050511 | Bacteria | 5986 |
| 1074 | nmdc:mga08y16_48522_c1 | 3300050511 | Bacteria | 4444 |
| 1075 | nmdc:mga0n895_101264_c1 | 3300050512 | Bacteria | 2890 |
| 1076 | nmdc:mga0n895_103894_c1 | 3300050512 | Bacteria | 2853 |
| 1077 | nmdc:mga0n895_106025_c1 | 3300050512 | Bacteria | 2823 |
| 1078 | nmdc:mga0n895_106764_c1 | 3300050512 | Bacteria | 2813 |
| 1079 | nmdc:mga0n895_223517_c1 | 3300050512 | Bacteria | 1911 |
| 1080 | nmdc:mga0n895_75866_c1 | 3300050512 | Bacteria | 3342 |
| 1081 | nmdc:mga08x19_24395_c1 | 3300050514 | Bacteria | 3758 |
| 1082 | nmdc:mga08x19_61727_c1 | 3300050514 | Bacteria | 2429 |
| 1083 | nmdc:mga0a205_45716_c1 | 3300050515 | Bacteria | 4222 |
| 1084 | nmdc:mga0sz30_25188_c1 | 3300050516 | Bacteria | 2433 |
| 1085 | Ga0495601_0007094 | 3300053077 | Bacteria | 6565 |
| 1086 | Ga0495612_0041502 | 3300053078 | Bacteria | 1877 |
| 1087 | Ga0495595_0040862 | 3300053084 | Bacteria | 2120 |
| 1088 | Ga0495619_0049770 | 3300053085 | Bacteria | 2764 |
| 1089 | Ga0500593_000057 | 3300053117 | Bacteria | 41215 |
| 1090 | Ga0500634_0032134 | 3300053161 | Bacteria | 2863 |
| 1091 | Ga0587067_004435 | 3300059640 | Bacteria | 1831 |
| 1092 | Ga0587072_004429 | 3300059643 | Bacteria | 2040 |
| 1093 | Ga0466962_0005372 | 3300061719 | Bacteria | 6164 |
| 1094 | 2511251795 | 2511231003 | Bacteria | 5606035 |
| 1095 | 2511251915 | 2511231003 | Bacteria | 5606035 |
| 1096 | 2521559929 | 2521172590 | Bacteria | 5047645 |
| 1097 | 2521559943 | 2521172590 | Bacteria | 5047645 |
| 1098 | 2553006909 | 2551306416 | Bacteria | 6152985 |
| 1099 | 2553006924 | 2551306416 | Bacteria | 6152985 |
| 1100 | 2597029857 | 2596583598 | Bacteria | 5251611 |
| 1101 | 2599443712 | 2599185178 | Bacteria | 5365746 |
| 1102 | 2644030431 | 2643221603 | Bacteria | 6147767 |
| 1103 | 2808982719 | 2808606386 | Bacteria | 4471946 |
| 1104 | 2809130220 | 2808606415 | Bacteria | 4576710 |
| 1105 | 2809150303 | 2808606419 | Bacteria | 4576925 |
| 1106 | 2819618167 | 2818991449 | Bacteria | 5518009 |
| 1107 | 2819618180 | 2818991449 | Bacteria | 5518009 |
| 1108 | 2852621474 | 2852618963 | Bacteria | 4577824 |
| 1109 | 2885267396 | 2885266251 | Bacteria | 4796748 |
| 1110 | 2900582935 | 2900577576 | Bacteria | 5438534 |
| 1111 | 2904444503 | 2904439833 | Bacteria | 5931679 |
| 1112 | 2904444517 | 2904439833 | Bacteria | 5931679 |
| 1113 | 2904535656 | 2904530477 | Bacteria | 5876334 |
| 1114 | 2904535670 | 2904530477 | Bacteria | 5876334 |
| 1115 | 2904588227 | 2904584206 | Bacteria | 6028872 |
| 1116 | 2904588241 | 2904584206 | Bacteria | 6028872 |
| 1117 | 2904594870 | 2904589729 | Bacteria | 6113573 |
| 1118 | 2904594884 | 2904589729 | Bacteria | 6113573 |
| 1119 | 2904606189 | 2904601388 | Bacteria | 5884906 |
| 1120 | 2919049150 | 2919046199 | Bacteria | 5567169 |
| 1121 | 2919049165 | 2919046199 | Bacteria | 5567169 |
| 1122 | 2919084373 | 2919079590 | Bacteria | 5946433 |
| 1123 | 2919084387 | 2919079590 | Bacteria | 5946433 |
| 1124 | 2923513715 | 2923510766 | Bacteria | 5926163 |
| 1125 | 2923513732 | 2923510766 | Bacteria | 5926163 |
| 1126 | 2928061974 | 2928058823 | Bacteria | 5520022 |
| 1127 | 2928134408 | 2928130867 | Bacteria | 5467269 |
| 1128 | 2928134423 | 2928130867 | Bacteria | 5467269 |
| 1129 | Ga0105237_10158641 | |||
| 1130 | JGI24741J21665_1000281 | |||
| 1131 | JGI24752J21851_1002512 | |||
| 1132 | JGI24740J21852_10000382 | |||
| 1133 | JGI24033J26618_1002764 | |||
| 1134 | JGI25155J39150_1000420 | |||
| 1135 | JGI25155J39150_1000466 | |||
| 1136 | JGI25156J39149_1002917 | |||
| 1137 | JGI25156J39149_1010499 | |||
| 1138 | JGI25154J39366_1000291 | |||
| 1139 | JGI25154J39366_1000626 | |||
| 1140 | JGI25154J39366_1001002 | |||
| 1141 | JGI25154J39366_1001202 | |||
| 1142 | JGI25151J46595_10001574 | |||
| 1143 | JGI25151J46595_10002049 | |||
| 1144 | JGI25406J46586_10007907 | |||
| 1145 | rootH1_10022550 | |||
| 1146 | Ga0055538_1000038 | |||
| 1147 | Ga0055539_1000049 | |||
| 1148 | Ga0055539_1000068 | |||
| 1149 | Ga0055533_1000060 | |||
| 1150 | Ga0055532_1000028 | |||
| 1151 | Ga0055525_1000068 | |||
| 1152 | Ga0055525_1000394 | |||
| 1153 | Ga0055535_1000022 | |||
| 1154 | Ga0055542_1001449 | |||
| 1155 | Ga0055529_1000063 | |||
| 1156 | Ga0055529_1000145 | |||
| 1157 | Ga0055526_1003202 | |||
| 1158 | Ga0055526_1008995 | |||
| 1159 | Ga0055537_1000387 | |||
| 1160 | Ga0055524_1000498 | |||
| 1161 | Ga0055536_1005319 | |||
| 1162 | Ga0055534_1000387 | |||
| 1163 | Ga0055541_1000036 | |||
| 1164 | Ga0065715_10007325 | |||
| 1165 | Ga0065715_10122086 | |||
| 1166 | Ga0070658_10051007 | |||
| 1167 | Ga0070658_10198328 | |||
| 1168 | Ga0070676_10001492 | |||
| 1169 | Ga0070676_10010271 | |||
| 1170 | Ga0070676_10010954 | |||
| 1171 | Ga0070676_10017610 | |||
| 1172 | Ga0070676_10143633 | |||
| 1173 | Ga0070683_100005863 | |||
| 1174 | Ga0070683_100024765 | |||
| 1175 | Ga0070683_100060236 | |||
| 1176 | Ga0070683_100130084 | |||
| 1177 | Ga0070683_100311703 | |||
| 1178 | Ga0070690_100002924 | |||
| 1179 | Ga0070670_100001052 | |||
| 1180 | Ga0070670_100004426 | |||
| 1181 | Ga0070670_100006933 | |||
| 1182 | Ga0070670_100007034 | |||
| 1183 | Ga0070670_100025094 | |||
| 1184 | Ga0070670_100030083 | |||
| 1185 | Ga0070670_100105162 | |||
| 1186 | Ga0070677_10001219 | |||
| 1187 | Ga0070677_10005188 | |||
| 1188 | Ga0068869_100005688 | |||
| 1189 | Ga0068869_100021797 | |||
| 1190 | Ga0068869_100026812 | |||
| 1191 | Ga0068869_100113949 | |||
| 1192 | Ga0068869_100129974 | |||
| 1193 | Ga0068869_100139231 | |||
| 1194 | Ga0068869_100200104 | |||
| 1195 | Ga0070666_10009901 | |||
| 1196 | Ga0070666_10012078 | |||
| 1197 | Ga0070680_100016249 | |||
| 1198 | Ga0070680_100141298 | |||
| 1199 | Ga0070680_100169245 | |||
| 1200 | Ga0070682_100039262 | |||
| 1201 | Ga0070682_100075616 | |||
| 1202 | Ga0068868_100003441 | |||
| 1203 | Ga0068868_100035042 | |||
| 1204 | Ga0068868_100068870 | |||
| 1205 | Ga0068868_100076868 | |||
| 1206 | Ga0068868_100128237 | |||
| 1207 | Ga0068868_100171919 | |||
| 1208 | Ga0070660_100000975 | |||
| 1209 | Ga0070660_100013536 | |||
| 1210 | Ga0070660_100013927 | |||
| 1211 | Ga0070660_100025634 | |||
| 1212 | Ga0070660_100031987 | |||
| 1213 | Ga0070660_100039149 | |||
| 1214 | Ga0070689_100004559 | |||
| 1215 | Ga0070689_100012226 | |||
| 1216 | Ga0070689_100074652 | |||
| 1217 | Ga0070689_100159880 | |||
| 1218 | Ga0070691_10026050 | |||
| 1219 | Ga0070661_100000278 | |||
| 1220 | Ga0070661_100034872 | |||
| 1221 | Ga0070661_100045968 | |||
| 1222 | Ga0070661_100057490 | |||
| 1223 | Ga0070661_100059679 | |||
| 1224 | Ga0070661_100065637 | |||
| 1225 | Ga0070661_100065657 | |||
| 1226 | Ga0070692_10025602 | |||
| 1227 | Ga0070692_10040101 | |||
| 1228 | Ga0070668_100003048 | |||
| 1229 | Ga0070668_100011962 | |||
| 1230 | Ga0070668_100028990 | |||
| 1231 | Ga0070668_100105755 | |||
| 1232 | Ga0070669_100093340 | |||
| 1233 | Ga0070675_100005744 | |||
| 1234 | Ga0070675_100007593 | |||
| 1235 | Ga0070675_100013245 | |||
| 1236 | Ga0070671_100009073 | |||
| 1237 | Ga0070671_100039508 | |||
| 1238 | Ga0070671_100121326 | |||
| 1239 | Ga0070671_100237565 | |||
| 1240 | Ga0070674_100000833 | |||
| 1241 | Ga0070674_100009985 | |||
| 1242 | Ga0070674_100022160 | |||
| 1243 | Ga0070674_100042664 | |||
| 1244 | Ga0070673_100000830 | |||
| 1245 | Ga0070673_100000917 | |||
| 1246 | Ga0070673_100002997 | |||
| 1247 | Ga0070673_100005917 | |||
| 1248 | Ga0070673_100026693 | |||
| 1249 | Ga0070673_100039717 | |||
| 1250 | Ga0070673_100044016 | |||
| 1251 | Ga0070673_100121377 | |||
| 1252 | Ga0070688_100001343 | |||
| 1253 | Ga0070688_100003223 | |||
| 1254 | Ga0070688_100005576 | |||
| 1255 | Ga0070688_100007485 | |||
| 1256 | Ga0070659_100000651 | |||
| 1257 | Ga0070659_100012857 | |||
| 1258 | Ga0070659_100015708 | |||
| 1259 | Ga0070659_100023964 | |||
| 1260 | Ga0070659_100050230 | |||
| 1261 | Ga0070659_100065666 | |||
| 1262 | Ga0070659_100078656 | |||
| 1263 | Ga0070659_100091205 | |||
| 1264 | Ga0070667_100013687 | |||
| 1265 | Ga0070667_100021744 | |||
| 1266 | Ga0070667_100026280 | |||
| 1267 | Ga0070667_100073675 | |||
| 1268 | Ga0070667_100082626 | |||
| 1269 | Ga0070667_100132396 | |||
| 1270 | Ga0070667_100164741 | |||
| 1271 | Ga0070667_100174073 | |||
| 1272 | Ga0070709_10007023 | |||
| 1273 | Ga0070709_10008071 | |||
| 1274 | Ga0070709_10019121 | |||
| 1275 | Ga0070709_10024709 | |||
| 1276 | Ga0070709_10036871 | |||
| 1277 | Ga0070714_100073375 | |||
| 1278 | Ga0070714_100185857 | |||
| 1279 | Ga0070714_100286269 | |||
| 1280 | Ga0070713_100000192 | |||
| 1281 | Ga0070713_100001983 | |||
| 1282 | Ga0070713_100004914 | |||
| 1283 | Ga0070713_100005087 | |||
| 1284 | Ga0070713_100011002 | |||
| 1285 | Ga0070713_100059937 | |||
| 1286 | Ga0070713_100096996 | |||
| 1287 | Ga0070710_10003306 | |||
| 1288 | Ga0070710_10018985 | |||
| 1289 | Ga0070710_10025503 | |||
| 1290 | Ga0070711_100020760 | |||
| 1291 | Ga0070711_100165693 | |||
| 1292 | Ga0070711_100196223 | |||
| 1293 | Ga0070705_100008692 | |||
| 1294 | Ga0070700_100005948 | |||
| 1295 | Ga0070700_100103475 | |||
| 1296 | Ga0070708_100080026 | |||
| 1297 | Ga0070708_100131832 | |||
| 1298 | Ga0070663_100000005 | |||
| 1299 | Ga0070663_100052116 | |||
| 1300 | Ga0070663_100218169 | |||
| 1301 | Ga0070678_100000730 | |||
| 1302 | Ga0070678_100030755 | |||
| 1303 | Ga0070678_100061832 | |||
| 1304 | Ga0070678_100071680 | |||
| 1305 | Ga0070662_100000356 | |||
| 1306 | Ga0070662_100042694 | |||
| 1307 | Ga0070662_100079518 | |||
| 1308 | Ga0070662_100196539 | |||
| 1309 | Ga0070681_10002066 | |||
| 1310 | Ga0070681_10013790 | |||
| 1311 | Ga0070681_10167425 | |||
| 1312 | Ga0068867_100003910 | |||
| 1313 | Ga0068867_100034617 | |||
| 1314 | Ga0068867_100056466 | |||
| 1315 | Ga0068867_100184472 | |||
| 1316 | Ga0070685_10000750 | |||
| 1317 | Ga0070685_10001220 | |||
| 1318 | Ga0070685_10004263 | |||
| 1319 | Ga0070685_10030774 | |||
| 1320 | Ga0070706_100021210 | |||
| 1321 | Ga0070706_100042508 | |||
| 1322 | Ga0070706_100049649 | |||
| 1323 | Ga0070707_100010338 | |||
| 1324 | Ga0070698_100081122 | |||
| 1325 | Ga0070699_100069881 | |||
| 1326 | Ga0070699_100202772 | |||
| 1327 | Ga0070699_100230266 | |||
| 1328 | Ga0070679_100020508 | |||
| 1329 | Ga0070679_100031071 | |||
| 1330 | Ga0070679_100042450 | |||
| 1331 | Ga0070679_100094436 | |||
| 1332 | Ga0070684_100001244 | |||
| 1333 | Ga0070684_100029314 | |||
| 1334 | Ga0070684_100096684 | |||
| 1335 | Ga0070684_100112698 | |||
| 1336 | Ga0070684_100200626 | |||
| 1337 | Ga0070697_100025706 | |||
| 1338 | Ga0068853_100010715 | |||
| 1339 | Ga0068853_100088788 | |||
| 1340 | Ga0070672_100001148 | |||
| 1341 | Ga0070672_100003455 | |||
| 1342 | Ga0070672_100008475 | |||
| 1343 | Ga0070672_100037823 | |||
| 1344 | Ga0070672_100039559 | |||
| 1345 | Ga0070672_100100679 | |||
| 1346 | Ga0070672_100238161 | |||
| 1347 | Ga0070686_100026439 | |||
| 1348 | Ga0070686_100034265 | |||
| 1349 | Ga0070695_100082523 | |||
| 1350 | Ga0070695_100105746 | |||
| 1351 | Ga0070696_100006467 | |||
| 1352 | Ga0070696_100016038 | |||
| 1353 | Ga0070693_100050266 | |||
| 1354 | Ga0070665_100001071 | |||
| 1355 | Ga0070665_100012132 | |||
| 1356 | Ga0070665_100016503 | |||
| 1357 | Ga0070665_100168517 | |||
| 1358 | Ga0068855_100000614 | |||
| 1359 | Ga0068855_100001569 | |||
| 1360 | Ga0068855_100024547 | |||
| 1361 | Ga0068855_100034809 | |||
| 1362 | Ga0068855_100037531 | |||
| 1363 | Ga0068855_100138702 | |||
| 1364 | Ga0070664_100000001 | |||
| 1365 | Ga0070664_100000426 | |||
| 1366 | Ga0070664_100135972 | |||
| 1367 | Ga0070664_100179283 | |||
| 1368 | Ga0068857_100005355 | |||
| 1369 | Ga0068857_100356766 | |||
| 1370 | Ga0068854_100000030 | |||
| 1371 | Ga0068854_100007377 | |||
| 1372 | Ga0068854_100015284 | |||
| 1373 | Ga0068854_100020176 | |||
| 1374 | Ga0068856_100000008 | |||
| 1375 | Ga0068856_100000978 | |||
| 1376 | Ga0068856_100002674 | |||
| 1377 | Ga0068856_100064623 | |||
| 1378 | Ga0068856_100134662 | |||
| 1379 | Ga0068856_100185393 | |||
| 1380 | Ga0068856_100300976 | |||
| 1381 | Ga0070702_100003918 | |||
| 1382 | Ga0070702_100009945 | |||
| 1383 | Ga0070702_100074323 | |||
| 1384 | Ga0068852_100006894 | |||
| 1385 | Ga0068852_100006931 | |||
| 1386 | Ga0068852_100008332 | |||
| 1387 | Ga0068852_100021840 | |||
| 1388 | Ga0068852_100046446 | |||
| 1389 | Ga0068859_100000299 | |||
| 1390 | Ga0068859_100001521 | |||
| 1391 | Ga0068864_100000973 | |||
| 1392 | Ga0068864_100001231 | |||
| 1393 | Ga0068864_100001780 | |||
| 1394 | Ga0068864_100003838 | |||
| 1395 | Ga0068864_100011511 | |||
| 1396 | Ga0068864_100039432 | |||
| 1397 | Ga0068864_100140951 | |||
| 1398 | Ga0068864_100285111 | |||
| 1399 | Ga0068866_10002028 | |||
| 1400 | Ga0068866_10007205 | |||
| 1401 | Ga0068861_100026109 | |||
| 1402 | Ga0068861_100146987 | |||
| 1403 | Ga0068861_100186479 | |||
| 1404 | Ga0068851_10003799 | |||
| 1405 | Ga0068851_10003873 | |||
| 1406 | Ga0068851_10006480 | |||
| 1407 | Ga0068870_10011499 | |||
| 1408 | Ga0068870_10012432 | |||
| 1409 | Ga0068870_10057136 | |||
| 1410 | Ga0068863_100002522 | |||
| 1411 | Ga0068863_100008043 | |||
| 1412 | Ga0068863_100011231 | |||
| 1413 | Ga0068863_100030794 | |||
| 1414 | Ga0068863_100101544 | |||
| 1415 | Ga0068863_100131084 | |||
| 1416 | Ga0068863_100383977 | |||
| 1417 | Ga0068858_100000738 | |||
| 1418 | Ga0068858_100002718 | |||
| 1419 | Ga0068858_100022687 | |||
| 1420 | Ga0068858_100124027 | |||
| 1421 | Ga0068860_100003736 | |||
| 1422 | Ga0068860_100005682 | |||
| 1423 | Ga0068860_100049795 | |||
| 1424 | Ga0068860_100065499 | |||
| 1425 | Ga0068860_100067917 | |||
| 1426 | Ga0068860_100078756 | |||
| 1427 | Ga0068860_100203332 | |||
| 1428 | Ga0068862_100054617 | |||
| 1429 | Ga0068862_100136030 | |||
| 1430 | Ga0068862_100186616 | |||
| 1431 | Ga0081455_10121041 | |||
| 1432 | Ga0081539_10000734 | |||
| 1433 | Ga0070717_10043139 | |||
| 1434 | Ga0070715_10012034 | |||
| 1435 | Ga0070716_100009928 | |||
| 1436 | Ga0070716_100072468 | |||
| 1437 | Ga0070712_100002075 | |||
| 1438 | Ga0070712_100014669 | |||
| 1439 | Ga0070712_100048080 | |||
| 1440 | Ga0070712_100063229 | |||
| 1441 | Ga0070712_100111432 | |||
| 1442 | Ga0070712_100114105 | |||
| 1443 | Ga0070712_100152061 | |||
| 1444 | Ga0075369_10014059 | |||
| 1445 | Ga0075366_10071750 | |||
| 1446 | Ga0097621_100002538 | |||
| 1447 | Ga0097621_100023259 | |||
| 1448 | Ga0097621_100026208 | |||
| 1449 | Ga0097621_100033492 | |||
| 1450 | Ga0097621_100147927 | |||
| 1451 | Ga0097621_100176179 | |||
| 1452 | Ga0068871_100001842 | |||
| 1453 | Ga0068871_100009208 | |||
| 1454 | Ga0068871_100029720 | |||
| 1455 | Ga0068871_100032616 | |||
| 1456 | Ga0068871_100036534 | |||
| 1457 | Ga0075428_100031269 | |||
| 1458 | Ga0075428_100052483 | |||
| 1459 | Ga0075428_100145719 | |||
| 1460 | Ga0075433_10072131 | |||
| 1461 | Ga0075434_100087003 | |||
| 1462 | Ga0075434_100104438 | |||
| 1463 | Ga0075434_100119453 | |||
| 1464 | Ga0075434_100132612 | |||
| 1465 | Ga0075434_100171122 | |||
| 1466 | Ga0075434_100219126 | |||
| 1467 | Ga0068865_100120035 | |||
| 1468 | Ga0097620_100000299 | |||
| 1469 | Ga0097620_100001521 | |||
| 1470 | Ga0099826_10000026 | |||
| 1471 | Ga0075435_100009428 | |||
| 1472 | Ga0075435_100026331 | |||
| 1473 | Ga0075435_100098007 | |||
| 1474 | Ga0099795_10007448 | |||
| 1475 | Ga0105244_10038832 | |||
| 1476 | Ga0105240_10002032 | |||
| 1477 | Ga0105240_10008715 | |||
| 1478 | Ga0105240_10008923 | |||
| 1479 | Ga0105240_10024583 | |||
| 1480 | Ga0105240_10053566 | |||
| 1481 | Ga0105240_10055685 | |||
| 1482 | Ga0105240_10073390 | |||
| 1483 | Ga0105240_10187721 | |||
| 1484 | Ga0105240_10296266 | |||
| 1485 | Ga0111539_10012047 | |||
| 1486 | Ga0111539_10031899 | |||
| 1487 | Ga0111539_10049087 | |||
| 1488 | Ga0105245_10008125 | |||
| 1489 | Ga0105245_10008348 | |||
| 1490 | Ga0105245_10022617 | |||
| 1491 | Ga0105245_10075958 | |||
| 1492 | Ga0105245_10149010 | |||
| 1493 | Ga0105247_10018229 | |||
| 1494 | Ga0114129_10003918 | |||
| 1495 | Ga0114129_10062946 | |||
| 1496 | Ga0105243_10110523 | |||
| 1497 | Ga0105243_10137768 | |||
| 1498 | Ga0105241_10089746 | |||
| 1499 | Ga0105241_10300478 | |||
| 1500 | Ga0105242_10022666 | |||
| 1501 | Ga0105242_10034346 | |||
| 1502 | Ga0105242_10074182 | |||
| 1503 | Ga0105248_10003287 | |||
| 1504 | Ga0105248_10010481 | |||
| 1505 | Ga0105248_10022923 | |||
| 1506 | Ga0105248_10038447 | |||
| 1507 | Ga0105248_10057987 | |||
| 1508 | Ga0105248_10111339 | |||
| 1509 | Ga0105248_10234657 | |||
| 1510 | Ga0105237_10025614 | |||
| 1511 | Ga0105237_10048399 | |||
| 1512 | Ga0105237_10070281 | |||
| 1513 | Ga0105237_10165723 | |||
| 1514 | Ga0105237_10281070 | |||
| 1515 | Ga0105238_10000212 | |||
| 1516 | Ga0105238_10031079 | |||
| 1517 | Ga0105238_10058025 | |||
| 1518 | Ga0105249_10010156 | |||
| 1519 | Ga0099796_10003680 | |||
| 1520 | Ga0105239_10004222 | |||
| 1521 | Ga0105239_10007726 | |||
| 1522 | Ga0105239_10038731 | |||
| 1523 | Ga0105239_10086487 | |||
| 1524 | Ga0105239_10214494 | |||
| 1525 | Ga0105239_10345402 | |||
| 1526 | Ga0105246_10037527 | |||
| 1527 | Ga0105246_10080811 | |||
| 1528 | Ga0157373_10001869 | |||
| 1529 | Ga0157373_10030125 | |||
| 1530 | Ga0157373_10031907 | |||
| 1531 | Ga0157373_10051505 | |||
| 1532 | Ga0157371_10000035 | |||
| 1533 | Ga0157371_10000422 | |||
| 1534 | Ga0157370_10000021 | |||
| 1535 | Ga0157370_10007184 | |||
| 1536 | Ga0157370_10013249 | |||
| 1537 | Ga0157370_10015046 | |||
| 1538 | Ga0157370_10023340 | |||
| 1539 | Ga0157370_10044966 | |||
| 1540 | Ga0157370_10090699 | |||
| 1541 | Ga0157370_10157925 | |||
| 1542 | Ga0157370_10191173 | |||
| 1543 | Ga0157369_10001315 | |||
| 1544 | Ga0157369_10002626 | |||
| 1545 | Ga0157369_10026747 | |||
| 1546 | Ga0157369_10105228 | |||
| 1547 | Ga0157369_10117316 | |||
| 1548 | Ga0157374_10006467 | |||
| 1549 | Ga0157374_10070056 | |||
| 1550 | Ga0157374_10090218 | |||
| 1551 | Ga0157374_10196849 | |||
| 1552 | Ga0157374_10254499 | |||
| 1553 | Ga0157378_10032544 | |||
| 1554 | Ga0157378_10037933 | |||
| 1555 | Ga0157378_10119353 | |||
| 1556 | Ga0163162_10000673 | |||
| 1557 | Ga0163162_10015027 | |||
| 1558 | Ga0163162_10055380 | |||
| 1559 | Ga0163162_10185125 | |||
| 1560 | Ga0163162_10369824 | |||
| 1561 | Ga0163162_10402583 | |||
| 1562 | Ga0157372_10000331 | |||
| 1563 | Ga0157372_10000872 | |||
| 1564 | Ga0157372_10013698 | |||
| 1565 | Ga0157372_10076901 | |||
| 1566 | Ga0157372_10089122 | |||
| 1567 | Ga0157372_10356724 | |||
| 1568 | Ga0157375_10002234 | |||
| 1569 | Ga0157375_10012219 | |||
| 1570 | Ga0157375_10021754 | |||
| 1571 | Ga0157375_10033704 | |||
| 1572 | Ga0157375_10266974 | |||
| 1573 | Ga0163163_10001115 | |||
| 1574 | Ga0163163_10001843 | |||
| 1575 | Ga0163163_10013445 | |||
| 1576 | Ga0163163_10019983 | |||
| 1577 | Ga0163163_10029273 | |||
| 1578 | Ga0182008_10013906 | |||
| 1579 | Ga0182008_10064174 | |||
| 1580 | Ga0157377_10004552 | |||
| 1581 | Ga0157379_10004346 | |||
| 1582 | Ga0157379_10005317 | |||
| 1583 | Ga0157379_10056765 | |||
| 1584 | Ga0157376_10000890 | |||
| 1585 | Ga0157376_10020891 | |||
| 1586 | Ga0157376_10048088 | |||
| 1587 | Ga0182006_1000977 | |||
| 1588 | Ga0182006_1024499 | |||
| 1589 | Ga0163161_10025858 | |||
| 1590 | Ga0163161_10029344 | |||
| 1591 | Ga0163161_10042718 | |||
| 1592 | Ga0206356_11359853 | |||
| 1593 | Ga0206351_10716077 | |||
| 1594 | Ga0154015_1042038 | |||
| 1595 | Ga0213872_10003817 | |||
| 1596 | Ga0213872_10037239 | |||
| 1597 | Ga0209435_100067 | |||
| 1598 | Ga0209784_100014 | |||
| 1599 | Ga0209784_100021 | |||
| 1600 | Ga0209784_100606 | |||
| 1601 | Ga0209566_100011 | |||
| 1602 | Ga0209566_100039 | |||
| 1603 | Ga0209566_100509 | |||
| 1604 | Ga0209566_100684 | |||
| 1605 | Ga0209674_100032 | |||
| 1606 | Ga0209674_100036 | |||
| 1607 | Ga0209674_100131 | |||
| 1608 | Ga0209672_100217 | |||
| 1609 | Ga0209672_100428 | |||
| 1610 | Ga0209147_100002 | |||
| 1611 | Ga0209563_100029 | |||
| 1612 | Ga0209563_100040 | |||
| 1613 | Ga0209563_102531 | |||
| 1614 | Ga0209258_100002 | |||
| 1615 | Ga0209646_1000023 | |||
| 1616 | Ga0209646_1000058 | |||
| 1617 | Ga0209646_1000061 | |||
| 1618 | Ga0209026_1000754 | |||
| 1619 | Ga0209026_1002211 | |||
| 1620 | Ga0209026_1002822 | |||
| 1621 | Ga0209677_100023 | |||
| 1622 | Ga0209677_100042 | |||
| 1623 | Ga0209677_105351 | |||
| 1624 | Ga0209148_1000043 | |||
| 1625 | Ga0209759_1000209 | |||
| 1626 | Ga0209759_1000537 | |||
| 1627 | Ga0209565_1000232 | |||
| 1628 | Ga0209455_1000009 | |||
| 1629 | Ga0209130_1008358 | |||
| 1630 | Ga0209675_1000047 | |||
| 1631 | Ga0209675_1000329 | |||
| 1632 | Ga0209675_1002614 | |||
| 1633 | Ga0209676_1000763 | |||
| 1634 | Ga0209025_1000991 | |||
| 1635 | Ga0209025_1001003 | |||
| 1636 | Ga0209025_1002975 | |||
| 1637 | Ga0209564_1000737 | |||
| 1638 | Ga0209564_1003075 | |||
| 1639 | Ga0209564_1003354 | |||
| 1640 | Ga0209256_1003386 | |||
| 1641 | Ga0209256_1004928 | |||
| 1642 | Ga0209051_1003626 | |||
| 1643 | Ga0207697_10004089 | |||
| 1644 | Ga0207697_10004354 | |||
| 1645 | Ga0207656_10006784 | |||
| 1646 | Ga0207656_10059849 | |||
| 1647 | Ga0207656_10061347 | |||
| 1648 | Ga0207682_10000207 | |||
| 1649 | Ga0207682_10001740 | |||
| 1650 | Ga0207682_10040046 | |||
| 1651 | Ga0207682_10073957 | |||
| 1652 | Ga0207692_10011175 | |||
| 1653 | Ga0207692_10038503 | |||
| 1654 | Ga0207642_10067516 | |||
| 1655 | Ga0207688_10000231 | |||
| 1656 | Ga0207680_10002677 | |||
| 1657 | Ga0207680_10003320 | |||
| 1658 | Ga0207680_10167109 | |||
| 1659 | Ga0207647_10085123 | |||
| 1660 | Ga0207647_10085991 | |||
| 1661 | Ga0207685_10010341 | |||
| 1662 | Ga0207685_10017988 | |||
| 1663 | Ga0207699_10007585 | |||
| 1664 | Ga0207699_10020717 | |||
| 1665 | Ga0207699_10022993 | |||
| 1666 | Ga0207699_10039773 | |||
| 1667 | Ga0207699_10131796 | |||
| 1668 | Ga0207645_10003178 | |||
| 1669 | Ga0207645_10003309 | |||
| 1670 | Ga0207645_10010581 | |||
| 1671 | Ga0207645_10019023 | |||
| 1672 | Ga0207645_10036871 | |||
| 1673 | Ga0207645_10100035 | |||
| 1674 | Ga0207643_10000559 | |||
| 1675 | Ga0207643_10024187 | |||
| 1676 | Ga0207643_10062224 | |||
| 1677 | Ga0207684_10040037 | |||
| 1678 | Ga0207684_10062351 | |||
| 1679 | Ga0207684_10063233 | |||
| 1680 | Ga0207684_10110793 | |||
| 1681 | Ga0207684_10299573 | |||
| 1682 | Ga0207654_10153461 | |||
| 1683 | Ga0207707_10013665 | |||
| 1684 | Ga0207707_10047520 | |||
| 1685 | Ga0207707_10065049 | |||
| 1686 | Ga0207707_10067787 | |||
| 1687 | Ga0207707_10078110 | |||
| 1688 | Ga0207707_10253456 | |||
| 1689 | Ga0207707_10260572 | |||
| 1690 | Ga0207695_10002238 | |||
| 1691 | Ga0207695_10006717 | |||
| 1692 | Ga0207695_10020489 | |||
| 1693 | Ga0207695_10022238 | |||
| 1694 | Ga0207695_10036685 | |||
| 1695 | Ga0207695_10053385 | |||
| 1696 | Ga0207695_10057422 | |||
| 1697 | Ga0207695_10144987 | |||
| 1698 | Ga0207695_10198887 | |||
| 1699 | Ga0207671_10007566 | |||
| 1700 | Ga0207671_10011834 | |||
| 1701 | Ga0207671_10091677 | |||
| 1702 | Ga0207671_10123137 | |||
| 1703 | Ga0207693_10000405 | |||
| 1704 | Ga0207693_10001447 | |||
| 1705 | Ga0207693_10042283 | |||
| 1706 | Ga0207693_10064126 | |||
| 1707 | Ga0207693_10089294 | |||
| 1708 | Ga0207693_10092071 | |||
| 1709 | Ga0207693_10148004 | |||
| 1710 | Ga0207663_10006388 | |||
| 1711 | Ga0207663_10060079 | |||
| 1712 | Ga0207663_10128546 | |||
| 1713 | Ga0207660_10020801 | |||
| 1714 | Ga0207660_10055006 | |||
| 1715 | Ga0207660_10076344 | |||
| 1716 | Ga0207660_10217812 | |||
| 1717 | Ga0207662_10021889 | |||
| 1718 | Ga0207662_10056892 | |||
| 1719 | Ga0207662_10157294 | |||
| 1720 | Ga0207657_10000291 | |||
| 1721 | Ga0207657_10003974 | |||
| 1722 | Ga0207657_10011953 | |||
| 1723 | Ga0207657_10028818 | |||
| 1724 | Ga0207657_10040604 | |||
| 1725 | Ga0207657_10076159 | |||
| 1726 | Ga0207649_10000169 | |||
| 1727 | Ga0207649_10063815 | |||
| 1728 | Ga0207649_10123456 | |||
| 1729 | Ga0207649_10201596 | |||
| 1730 | Ga0207652_10031557 | |||
| 1731 | Ga0207652_10087492 | |||
| 1732 | Ga0207652_10105912 | |||
| 1733 | Ga0207652_10123295 | |||
| 1734 | Ga0207646_10013083 | |||
| 1735 | Ga0207646_10016319 | |||
| 1736 | Ga0207646_10026718 | |||
| 1737 | Ga0207646_10122032 | |||
| 1738 | Ga0207681_10007823 | |||
| 1739 | Ga0207681_10015205 | |||
| 1740 | Ga0207694_10000111 | |||
| 1741 | Ga0207694_10000732 | |||
| 1742 | Ga0207694_10067422 | |||
| 1743 | Ga0207650_10009090 | |||
| 1744 | Ga0207650_10018757 | |||
| 1745 | Ga0207650_10035164 | |||
| 1746 | Ga0207650_10043524 | |||
| 1747 | Ga0207650_10079119 | |||
| 1748 | Ga0207650_10157150 | |||
| 1749 | Ga0207650_10173880 | |||
| 1750 | Ga0207650_10242696 | |||
| 1751 | Ga0207659_10006300 | |||
| 1752 | Ga0207659_10008214 | |||
| 1753 | Ga0207659_10022369 | |||
| 1754 | Ga0207659_10042474 | |||
| 1755 | Ga0207659_10043880 | |||
| 1756 | Ga0207659_10119894 | |||
| 1757 | Ga0207659_10130112 | |||
| 1758 | Ga0207687_10000963 | |||
| 1759 | Ga0207687_10002278 | |||
| 1760 | Ga0207687_10018616 | |||
| 1761 | Ga0207687_10039595 | |||
| 1762 | Ga0207700_10000044 | |||
| 1763 | Ga0207700_10000134 | |||
| 1764 | Ga0207700_10001855 | |||
| 1765 | Ga0207700_10004836 | |||
| 1766 | Ga0207700_10008645 | |||
| 1767 | Ga0207700_10026063 | |||
| 1768 | Ga0207664_10000845 | |||
| 1769 | Ga0207664_10034902 | |||
| 1770 | Ga0207664_10060282 | |||
| 1771 | Ga0207664_10061496 | |||
| 1772 | Ga0207664_10135470 | |||
| 1773 | Ga0207644_10001215 | |||
| 1774 | Ga0207644_10003613 | |||
| 1775 | Ga0207644_10006332 | |||
| 1776 | Ga0207644_10008623 | |||
| 1777 | Ga0207644_10022294 | |||
| 1778 | Ga0207644_10043519 | |||
| 1779 | Ga0207644_10070760 | |||
| 1780 | Ga0207690_10001060 | |||
| 1781 | Ga0207690_10008267 | |||
| 1782 | Ga0207690_10012208 | |||
| 1783 | Ga0207690_10015663 | |||
| 1784 | Ga0207690_10121652 | |||
| 1785 | Ga0207690_10169659 | |||
| 1786 | Ga0207706_10000074 | |||
| 1787 | Ga0207706_10001160 | |||
| 1788 | Ga0207706_10052800 | |||
| 1789 | Ga0207706_10064442 | |||
| 1790 | Ga0207706_10095602 | |||
| 1791 | Ga0207706_10095937 | |||
| 1792 | Ga0207706_10162111 | |||
| 1793 | Ga0207706_10255521 | |||
| 1794 | Ga0207686_10000779 | |||
| 1795 | Ga0207686_10013284 | |||
| 1796 | Ga0207686_10020077 | |||
| 1797 | Ga0207686_10057934 | |||
| 1798 | Ga0207670_10003798 | |||
| 1799 | Ga0207670_10046674 | |||
| 1800 | Ga0207670_10138987 | |||
| 1801 | Ga0207670_10281505 | |||
| 1802 | Ga0207704_10060607 | |||
| 1803 | Ga0207704_10079152 | |||
| 1804 | Ga0207704_10094310 | |||
| 1805 | Ga0207691_10000127 | |||
| 1806 | Ga0207691_10002501 | |||
| 1807 | Ga0207691_10004488 | |||
| 1808 | Ga0207691_10006975 | |||
| 1809 | Ga0207691_10011409 | |||
| 1810 | Ga0207691_10021763 | |||
| 1811 | Ga0207691_10160800 | |||
| 1812 | Ga0207711_10000320 | |||
| 1813 | Ga0207711_10001803 | |||
| 1814 | Ga0207711_10002482 | |||
| 1815 | Ga0207711_10050909 | |||
| 1816 | Ga0207689_10006981 | |||
| 1817 | Ga0207689_10010359 | |||
| 1818 | Ga0207689_10017108 | |||
| 1819 | Ga0207689_10021336 | |||
| 1820 | Ga0207689_10023535 | |||
| 1821 | Ga0207689_10023716 | |||
| 1822 | Ga0207661_10000444 | |||
| 1823 | Ga0207661_10045012 | |||
| 1824 | Ga0207661_10109030 | |||
| 1825 | Ga0207661_10339705 | |||
| 1826 | Ga0207679_10000003 | |||
| 1827 | Ga0207679_10002864 | |||
| 1828 | Ga0207679_10027083 | |||
| 1829 | Ga0207679_10037007 | |||
| 1830 | Ga0207679_10064935 | |||
| 1831 | Ga0207679_10084413 | |||
| 1832 | Ga0207679_10089852 | |||
| 1833 | Ga0207679_10146403 | |||
| 1834 | Ga0207667_10000102 | |||
| 1835 | Ga0207667_10009133 | |||
| 1836 | Ga0207667_10020183 | |||
| 1837 | Ga0207667_10071730 | |||
| 1838 | Ga0207667_10078124 | |||
| 1839 | Ga0207667_10113610 | |||
| 1840 | Ga0207667_10189884 | |||
| 1841 | Ga0207651_10010664 | |||
| 1842 | Ga0207651_10011801 | |||
| 1843 | Ga0207651_10025745 | |||
| 1844 | Ga0207651_10029784 | |||
| 1845 | Ga0207651_10030907 | |||
| 1846 | Ga0207651_10040139 | |||
| 1847 | Ga0207651_10111394 | |||
| 1848 | Ga0207712_10025658 | |||
| 1849 | Ga0207668_10005968 | |||
| 1850 | Ga0207668_10046243 | |||
| 1851 | Ga0207668_10116572 | |||
| 1852 | Ga0207640_10000124 | |||
| 1853 | Ga0207640_10007969 | |||
| 1854 | Ga0207640_10054965 | |||
| 1855 | Ga0207658_10004312 | |||
| 1856 | Ga0207658_10028575 | |||
| 1857 | Ga0207658_10042665 | |||
| 1858 | Ga0207658_10066421 | |||
| 1859 | Ga0207658_10081423 | |||
| 1860 | Ga0207658_10091082 | |||
| 1861 | Ga0207658_10118470 | |||
| 1862 | Ga0207658_10160699 | |||
| 1863 | Ga0207658_10257183 | |||
| 1864 | Ga0207677_10001129 | |||
| 1865 | Ga0207677_10001376 | |||
| 1866 | Ga0207677_10019704 | |||
| 1867 | Ga0207677_10059768 | |||
| 1868 | Ga0207703_10000377 | |||
| 1869 | Ga0207703_10011885 | |||
| 1870 | Ga0207703_10158024 | |||
| 1871 | Ga0207639_10065924 | |||
| 1872 | Ga0207639_10119702 | |||
| 1873 | Ga0207639_10232933 | |||
| 1874 | Ga0207678_10000002 | |||
| 1875 | Ga0207678_10001082 | |||
| 1876 | Ga0207678_10010347 | |||
| 1877 | Ga0207678_10019108 | |||
| 1878 | Ga0207678_10030041 | |||
| 1879 | Ga0207708_10000714 | |||
| 1880 | Ga0207708_10015422 | |||
| 1881 | Ga0207708_10034875 | |||
| 1882 | Ga0207708_10112053 | |||
| 1883 | Ga0207702_10000031 | |||
| 1884 | Ga0207702_10001249 | |||
| 1885 | Ga0207702_10002295 | |||
| 1886 | Ga0207702_10011243 | |||
| 1887 | Ga0207702_10045742 | |||
| 1888 | Ga0207702_10228525 | |||
| 1889 | Ga0207641_10001640 | |||
| 1890 | Ga0207641_10004353 | |||
| 1891 | Ga0207641_10007514 | |||
| 1892 | Ga0207641_10016663 | |||
| 1893 | Ga0207641_10041625 | |||
| 1894 | Ga0207641_10201286 | |||
| 1895 | Ga0207648_10005893 | |||
| 1896 | Ga0207648_10006620 | |||
| 1897 | Ga0207648_10031859 | |||
| 1898 | Ga0207648_10042082 | |||
| 1899 | Ga0207648_10071276 | |||
| 1900 | Ga0207648_10081899 | |||
| 1901 | Ga0207648_10103269 | |||
| 1902 | Ga0207648_10201206 | |||
| 1903 | Ga0207676_10000881 | |||
| 1904 | Ga0207676_10002147 | |||
| 1905 | Ga0207676_10015861 | |||
| 1906 | Ga0207676_10025352 | |||
| 1907 | Ga0207676_10041855 | |||
| 1908 | Ga0207676_10081831 | |||
| 1909 | Ga0207674_10006216 | |||
| 1910 | Ga0207674_10009786 | |||
| 1911 | Ga0207674_10011448 | |||
| 1912 | Ga0207674_10017528 | |||
| 1913 | Ga0207674_10081283 | |||
| 1914 | Ga0207674_10100228 | |||
| 1915 | Ga0207674_10365290 | |||
| 1916 | Ga0207675_100001180 | |||
| 1917 | Ga0207675_100043266 | |||
| 1918 | Ga0207675_100064529 | |||
| 1919 | Ga0207683_10000009 | |||
| 1920 | Ga0207683_10003341 | |||
| 1921 | Ga0207683_10006010 | |||
| 1922 | Ga0207683_10038318 | |||
| 1923 | Ga0207683_10222011 | |||
| 1924 | Ga0207698_10004601 | |||
| 1925 | Ga0207698_10006665 | |||
| 1926 | Ga0207698_10027303 | |||
| 1927 | Ga0207698_10040590 | |||
| 1928 | Ga0207698_10070883 | |||
| 1929 | Ga0207698_10071246 | |||
| 1930 | Ga0207698_10082350 | |||
| 1931 | Ga0207698_10317971 | |||
| 1932 | Ga0209282_1000044 | |||
| 1933 | Ga0207428_10014644 | |||
| 1934 | Ga0268266_10011096 | |||
| 1935 | Ga0268266_10011196 | |||
| 1936 | Ga0268266_10017355 | |||
| 1937 | Ga0268266_10024774 | |||
| 1938 | Ga0268266_10027645 | |||
| 1939 | Ga0268266_10169688 | |||
| 1940 | Ga0268266_10222354 | |||
| 1941 | Ga0268265_10080908 | |||
| 1942 | Ga0268265_10106356 | |||
| 1943 | Ga0268265_10188801 | |||
| 1944 | Ga0268265_10255903 | |||
| 1945 | Ga0268264_10003274 | |||
| 1946 | Ga0268264_10016626 | |||
| 1947 | Ga0265338_10086102 | |||
| 1948 | Ga0265332_10000223 | |||
| 1949 | Ga0265328_10000615 | |||
| 1950 | Ga0265328_10037856 | |||
| 1951 | Ga0265320_10003495 | |||
| 1952 | Ga0265325_10013330 | |||
| 1953 | Ga0265339_10008568 | |||
| 1954 | Ga0265339_10018313 | |||
| 1955 | Ga0265331_10003302 | |||
| 1956 | Ga0265327_10006820 | |||
| 1957 | Ga0265316_10028312 | |||
| 1958 | Ga0307508_10025409 | |||
| 1959 | Ga0265314_10001268 | |||
| 1960 | Ga0265314_10003592 | |||
| 1961 | Ga0265342_10001777 | |||
| 1962 | Ga0265342_10002213 | |||
| 1963 | Ga0265342_10011103 | |||
| 1964 | Ga0373934_0016144 | |||
| 1965 | Ga0373949_0027035 | |||
| 1966 | Ga0373923_0005264 | |||
| 1967 | Ga0373923_0033187 | |||
| 1968 | Ga0373923_0037673 | |||
| 1969 | Ga0373936_0022595 | |||
| 1970 | Ga0373945_0002689 | |||
| 1971 | Ga0373953_0000699 | |||
| 1972 | Ga0373953_0003016 | |||
| 1973 | Ga0373953_0014147 | |||
| 1974 | Ga0373953_0082902 | |||
| 1975 | Ga0373954_0005785 | |||
| 1976 | Ga0373954_0012783 | |||
| 1977 | Ga0373954_0014510 | |||
| 1978 | Ga0373954_0027610 | |||
| 1979 | Ga0373956_0011981 | |||
| 1980 | Ga0373956_0035398 | |||
| 1981 | Ga0373957_0002633 | |||
| 1982 | Ga0373957_0125117 | |||
| 1983 | Ga0373957_0130158 | |||
| 1984 | Ga0373943_0005851 | |||
| 1985 | Ga0373946_0033823 | |||
| 1986 | Ga0373955_0021140 | |||
| 1987 | Ga0373955_0037393 | |||
| 1988 | Ga0373955_0134283 | |||
| 1989 | Ga0373924_0000995 | |||
| 1990 | Ga0373924_0028409 | |||
| 1991 | Ga0373935_0013859 | |||
| 1992 | Ga0373927_0029162 | |||
| 1993 | Ga0373927_0066269 | |||
| 1994 | Ga0373947_0006510 | |||
| 1995 | Ga0373947_0007708 | |||
| 1996 | Ga0373947_0057315 | |||
| 1997 | Ga0373947_0135405 | |||
| 1998 | Ga0373937_0000847 | |||
| 1999 | Ga0373937_0014594 | |||
| 2000 | Ga0373937_0018946 | |||
| 2001 | Ga0373937_0058673 | |||
| 2002 | Ga0373937_0061323 | |||
| 2003 | Ga0373937_0080620 | |||
| 2004 | Ga0373937_0139444 | |||
| 2005 | Ga0373937_0185054 | |||
| 2006 | Ga0373937_0214974 | |||
| 2007 | Ga0373937_0241872 | |||
| 2008 | Ga0373925_0025217 | |||
| 2009 | Ga0373925_0099381 | |||
| 2010 | Ga0395900_0010395 | |||
| 2011 | Ga0395900_0086087 | |||
| 2012 | Ga0395900_0217129 | |||
| 2013 | Ga0395905_0013326 | |||
| 2014 | Ga0395905_0188101 | |||
| 2015 | Ga0436364_1083737 | |||
| 2016 | Ga0436364_1133987 | |||
| 2017 | Ga0395901_0003694 | |||
| 2018 | Ga0395901_0099431 | |||
| 2019 | Ga0436360_0414699 | |||
| 2020 | Ga0436361_0298239 | |||
| 2021 | Ga0436361_0580748 | |||
| 2022 | Ga0451841_1180189 | |||
| 2023 | Ga0451853_2213425 | |||
| 2024 | Ga0451853_2661908 | |||
| 2025 | Ga0451577_0018184 | |||
| 2026 | Ga0451577_0021895 | |||
| 2027 | Ga0451577_0263647 | |||
| 2028 | Ga0466986_0105401 | |||
| 2029 | Ga0466969_0004982 | |||
| 2030 | Ga0466972_0015591 | |||
| 2031 | Ga0466981_0065857 | |||
| 2032 | Ga0453683_0079801 | |||
| 2033 | Ga0466966_0003298 | |||
| 2034 | Ga0466961_0000677 | |||
| 2035 | Ga0466961_0058197 | |||
| 2036 | Ga0466968_0010688 | |||
| 2037 | Ga0466970_0105667 | |||
| 2038 | Ga0466957_0057024 | |||
| 2039 | Ga0466959_0003309 | |||
| 2040 | Ga0466959_0029440 | |||
| 2041 | Ga0451576_0006691 | |||
| 2042 | Ga0466967_0012753 | |||
| 2043 | Ga0495592_0053844 | |||
| 2044 | Ga0495590_0000005 | |||
| 2045 | Ga0495590_0000013 | |||
| 2046 | Ga0495591_000109 | |||
| 2047 | Ga0495629_0109908 | |||
| 2048 | Ga0495638_0000027 | |||
| 2049 | Ga0495650_0000322 | |||
| 2050 | Ga0495580_0024889 | |||
| 2051 | Ga0495662_0022534 | |||
| 2052 | Ga0495662_0065508 | |||
| 2053 | Ga0495662_0069305 | |||
| 2054 | Ga0495664_0017099 | |||
| 2055 | Ga0495664_0021966 | |||
| 2056 | Ga0495584_0000029 | |||
| 2057 | Ga0495594_0046681 | |||
| 2058 | Ga0495596_0002231 | |||
| 2059 | Ga0495596_0017677 | |||
| 2060 | Ga0495596_0023714 | |||
| 2061 | Ga0495607_0018224 | |||
| 2062 | Ga0495583_0002517 | |||
| 2063 | Ga0495583_0005662 | |||
| 2064 | Ga0495608_0076723 | |||
| 2065 | Ga0495610_0011818 | |||
| 2066 | Ga0495628_0062370 | |||
| 2067 | Ga0495632_0008663 | |||
| 2068 | Ga0495637_0000008 | |||
| 2069 | Ga0495643_0000167 | |||
| 2070 | Ga0495643_0083867 | |||
| 2071 | Ga0495644_0012382 | |||
| 2072 | Ga0495648_0000002 | |||
| 2073 | Ga0495648_0018966 | |||
| 2074 | Ga0495642_0008010 | |||
| 2075 | Ga0495587_0010326 | |||
| 2076 | Ga0495587_0024882 | |||
| 2077 | Ga0495609_0031269 | |||
| 2078 | Ga0495621_0001645 | |||
| 2079 | Ga0495621_0003203 | |||
| 2080 | Ga0495621_0010621 | |||
| 2081 | Ga0495621_0010882 | |||
| 2082 | Ga0495597_0000855 | |||
| 2083 | Ga0495645_0002809 | |||
| 2084 | Ga0495622_0000200 | |||
| 2085 | Ga0495633_0000033 | |||
| 2086 | Ga0495633_0009470 | |||
| 2087 | Ga0495633_0060752 | |||
| 2088 | Ga0495667_0033641 | |||
| 2089 | Ga0495667_0202465 | |||
| 2090 | Ga0495668_0000065 | |||
| 2091 | Ga0495668_0005622 | |||
| 2092 | Ga0495634_0066910 | |||
| 2093 | Ga0495611_0000410 | |||
| 2094 | Ga0495635_0003244 | |||
| 2095 | Ga0495635_0005283 | |||
| 2096 | Ga0495635_0030714 | |||
| 2097 | Ga0495635_0040416 | |||
| 2098 | Ga0495661_0000049 | |||
| 2099 | Ga0495661_0009151 | |||
| 2100 | Ga0495661_0045071 | |||
| 2101 | Ga0495657_0145944 | |||
| 2102 | Ga0495599_0044961 | |||
| 2103 | Ga0495599_0081045 | |||
| 2104 | Ga0495623_0025908 | |||
| 2105 | Ga0495658_0151296 | |||
| 2106 | Ga0495613_0043940 | |||
| 2107 | Ga0495649_0000071 | |||
| 2108 | Ga0495649_0017927 | |||
| 2109 | Ga0495589_0027417 | |||
| 2110 | Ga0495581_0000957 | |||
| 2111 | Ga0495604_0011336 | |||
| 2112 | Ga0495672_0000033 | |||
| 2113 | Ga0495672_0001752 | |||
| 2114 | Ga0495680_0053537 | |||
| 2115 | Ga0495680_0131082 | |||
| 2116 | Ga0495683_0000168 | |||
| 2117 | Ga0495687_000924 | |||
| 2118 | Ga0495677_0000910 | |||
| 2119 | Ga0495681_0020197 | |||
| 2120 | Ga0495684_0028185 | |||
| 2121 | Ga0495602_0118191 | |||
| 2122 | Ga0495615_0022105 | |||
| 2123 | Ga0496100_0014096 | |||
| 2124 | Ga0496100_0041117 | |||
| 2125 | Ga0496100_0144617 | |||
| 2126 | Ga0496101_0016018 | |||
| 2127 | Ga0496101_0019843 | |||
| 2128 | Ga0496101_0037367 | |||
| 2129 | Ga0496102_0005617 | |||
| 2130 | Ga0496102_0113372 | |||
| 2131 | Ga0496102_0426964 | |||
| 2132 | Ga0496103_0041925 | |||
| 2133 | Ga0496104_0003535 | |||
| 2134 | Ga0496104_0020707 | |||
| 2135 | Ga0496105_0005191 | |||
| 2136 | Ga0496105_0044391 | |||
| 2137 | Ga0496105_0045465 | |||
| 2138 | Ga0496106_0003220 | |||
| 2139 | Ga0496106_0135746 | |||
| 2140 | Ga0496107_0007215 | |||
| 2141 | Ga0496107_0018432 | |||
| 2142 | Ga0496108_0011774 | |||
| 2143 | Ga0496108_0120248 | |||
| 2144 | Ga0496109_0008830 | |||
| 2145 | Ga0496109_0083066 | |||
| 2146 | Ga0496109_0142649 | |||
| 2147 | Ga0496109_0353984 | |||
| 2148 | Ga0496110_0005235 | |||
| 2149 | Ga0496110_0021730 | |||
| 2150 | Ga0496110_0099083 | |||
| 2151 | Ga0496110_0273206 | |||
| 2152 | Ga0496112_0003897 | |||
| 2153 | Ga0496112_0017806 | |||
| 2154 | Ga0496112_0017923 | |||
| 2155 | Ga0496112_0059883 | |||
| 2156 | Ga0496112_0167972 | |||
| 2157 | Ga0496112_0342455 | |||
| 2158 | Ga0496112_0344078 | |||
| 2159 | Ga0496113_0030131 | |||
| 2160 | Ga0496113_0061445 | |||
| 2161 | Ga0496113_0089546 | |||
| 2162 | Ga0496113_0259950 | |||
| 2163 | Ga0496114_0026746 | |||
| 2164 | Ga0496114_0102479 | |||
| 2165 | Ga0496114_0303418 | |||
| 2166 | Ga0496116_0001919 | |||
| 2167 | Ga0496121_0007703 | |||
| 2168 | Ga0496121_0008156 | |||
| 2169 | Ga0496122_0001753 | |||
| 2170 | Ga0496123_0003783 | |||
| 2171 | Ga0496125_0006247 | |||
| 2172 | Ga0495678_000024 | |||
| 2173 | Ga0495678_015197 | |||
| 2174 | Ga0501032_0139419 | |||
| 2175 | Ga0501034_0000955 | |||
| 2176 | Ga0501034_0017193 | |||
| 2177 | Ga0501047_0051697 | |||
| 2178 | Ga0501067_0002676 | |||
| 2179 | Ga0501067_0052680 | |||
| 2180 | Ga0501068_0000247 | |||
| 2181 | Ga0501070_0022210 | |||
| 2182 | Ga0501070_0054523 | |||
| 2183 | Ga0501072_0007187 | |||
| 2184 | Ga0501073_0007310 | |||
| 2185 | Ga0501073_0012613 | |||
| 2186 | Ga0501073_0033276 | |||
| 2187 | Ga0501074_0108643 | |||
| 2188 | Ga0501080_0000516 | |||
| 2189 | Ga0501080_0009004 | |||
| 2190 | Ga0501083_0011235 | |||
| 2191 | Ga0501083_0016722 | |||
| 2192 | Ga0501083_0168927 | |||
| 2193 | Ga0501044_0173433 | |||
| 2194 | nmdc:mga03n38_77731_c1 | |||
| 2195 | nmdc:mga0yw44_69540_c1 | |||
| 2196 | nmdc:mga0k408_19087_c1 | |||
| 2197 | nmdc:mga0k408_22575_c1 | |||
| 2198 | nmdc:mga05p37_19022_c1 | |||
| 2199 | nmdc:mga05p37_43164_c1 | |||
| 2200 | nmdc:mga08y16_16301_c1 | |||
| 2201 | nmdc:mga08y16_27555_c1 | |||
| 2202 | nmdc:mga08y16_48522_c1 | |||
| 2203 | nmdc:mga0n895_101264_c1 | |||
| 2204 | nmdc:mga0n895_103894_c1 | |||
| 2205 | nmdc:mga0n895_106025_c1 | |||
| 2206 | nmdc:mga0n895_106764_c1 | |||
| 2207 | nmdc:mga0n895_223517_c1 | |||
| 2208 | nmdc:mga0n895_75866_c1 | |||
| 2209 | nmdc:mga08x19_24395_c1 | |||
| 2210 | nmdc:mga08x19_61727_c1 | |||
| 2211 | nmdc:mga0a205_45716_c1 | |||
| 2212 | nmdc:mga0sz30_25188_c1 | |||
| 2213 | Ga0495601_0007094 | |||
| 2214 | Ga0495612_0041502 | |||
| 2215 | Ga0495595_0040862 | |||
| 2216 | Ga0495619_0049770 | |||
| 2217 | Ga0500593_000057 | |||
| 2218 | Ga0500634_0032134 | |||
| 2219 | Ga0587067_004435 | |||
| 2220 | Ga0587072_004429 | |||
| 2221 | Ga0466962_0005372 | |||
| 2222 | 2511251795 | |||
| 2223 | 2511251915 | |||
| 2224 | 2521559929 | |||
| 2225 | 2521559943 | |||
| 2226 | 2553006909 | |||
| 2227 | 2553006924 | |||
| 2228 | 2597029857 | |||
| 2229 | 2599443712 | |||
| 2230 | 2644030431 | |||
| 2231 | 2808982719 | |||
| 2232 | 2809130220 | |||
| 2233 | 2809150303 | |||
| 2234 | 2819618167 | |||
| 2235 | 2819618180 | |||
| 2236 | 2852621474 | |||
| 2237 | 2885267396 | |||
| 2238 | 2900582935 | |||
| 2239 | 2904444503 | |||
| 2240 | 2904444517 | |||
| 2241 | 2904535656 | |||
| 2242 | 2904535670 | |||
| 2243 | 2904588227 | |||
| 2244 | 2904588241 | |||
| 2245 | 2904594870 | |||
| 2246 | 2904594884 | |||
| 2247 | 2904606189 | |||
| 2248 | 2919049150 | |||
| 2249 | 2919049165 | |||
| 2250 | 2919084373 | |||
| 2251 | 2919084387 | |||
| 2252 | 2923513715 | |||
| 2253 | 2923513732 | |||
| 2254 | 2928061974 | |||
| 2255 | 2928134408 | |||
| 2256 | 2928134423 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f06-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid | 0.9831 | 25 | 388 |
| 4evs-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate | 0.9821 | 25 | 388 |
| 4eyk-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid | 0.9818 | 26 | 388 |
| 4f06-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid | 0.9699 | 25 | 388 |
| 4evs-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate | 0.9689 | 25 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f06A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9687 | 145 | 388 | 3.40.50.2300 |
| 4ey3A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9641 | 143 | 388 | 3.40.50.2300 |
| 4f06A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9487 | 25 | 359 | 3.40.50.2300 |
| 4ey3A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9468 | 143 | 388 | 3.40.50.2300 |
| 4f06A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9438 | 25 | 359 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537X4X2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9838 | 23 | 389 |
GO:0006865
|
| AF-A0A5C9CTM2-F1-model_v4 | Branched-chain amino acid transport system substrate-binding protein | 0.9799 | 234 | 389 |
|
| AF-A0A537X4X2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9732 | 23 | 389 |
GO:0006865
|
| AF-A0A3C0K8Z4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9618 | 134 | 386 |
|
| AF-A0A5C9CTM2-F1-model_v4 | Branched-chain amino acid transport system substrate-binding protein | 0.9556 | 234 | 389 |
|