F490738
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1143 | 569 | 1049 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10161144|Ga0105238_101611443 |
| Length | 357 |
| Sequence | VARAERRGPGSTITTYHEEIVMNRRTLARSLAGLAAVALTALAPAYAWEPSKTVEFVVPAGTGGGADQMARLIQSIIAKHNLMKQPMVVVNKSGGAGAEGFLDVKGSKGDGHKIVITLSNLFTTPLATGVPFNWKDLTPVEMMALDEFVLWVNADTPYKTAKEYLDAVKAAGSGSDRKKMGGTGSKQEDQIITVNLEKQTGAKFIYVPFKGGGEVATQLVGKHIDSTVNNPIEAVAQWRAGSLRPLCVFDSKRMPYKDKVTKDMAWGDIPTCKESGVDVEYLMLRGIFMPGGVTPDVVKYYTDVLAKVRATDEWKKFMNDGAFNTTSMSGKEYADWVAKNEQLHMSLMKDAGFLAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 2 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 3 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 6 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 7 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 8 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 9 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 10 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 11 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 12 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 13 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 14 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 15 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 16 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 17 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 18 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 19 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 20 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 21 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 22 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 23 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 24 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 25 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 26 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 27 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 28 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 29 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 30 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 31 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 32 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 33 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 34 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 37 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 41 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 42 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 43 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 44 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 45 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 46 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 47 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 48 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 49 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 50 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 51 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 52 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 56 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 57 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 58 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 59 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 60 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 61 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 62 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 63 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 64 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 65 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 66 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 67 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 68 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 69 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 70 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 71 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 72 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 73 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 74 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 75 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 76 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 77 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 78 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 79 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 80 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 81 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 82 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 83 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 84 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 85 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 86 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 87 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 88 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 89 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 90 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 91 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 92 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 93 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 94 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 95 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 96 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 97 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 98 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 99 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 100 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 101 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 102 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 103 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 104 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 105 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 106 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 107 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 108 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 109 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 110 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 111 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 112 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 113 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 116 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 117 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 118 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 123 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 127 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 129 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 139 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 150 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 151 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 152 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 156 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 159 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 167 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 168 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 169 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 171 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 172 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 173 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 174 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 175 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 176 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 177 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 178 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 179 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 180 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 181 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 182 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 183 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 184 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 185 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 186 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 187 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 189 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 190 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 191 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 192 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 193 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 195 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 196 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 197 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 198 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 199 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 200 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 201 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 202 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 203 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 204 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 206 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 207 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 208 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 209 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 238 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 239 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 240 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 241 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 242 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 243 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 244 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 245 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 246 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 250 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 253 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 256 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 259 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 329 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 330 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 333 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 341 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 345 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 349 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 350 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 351 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 352 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 353 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 354 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 355 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 356 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 357 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 358 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 359 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 360 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 361 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 362 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 363 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 364 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 365 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 366 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 367 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 368 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 369 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 370 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 371 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 372 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 373 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 374 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 375 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 376 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 377 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 378 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 379 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 380 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 381 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 382 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 383 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 384 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 385 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 386 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 387 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 388 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 389 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 390 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 391 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 392 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 393 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 394 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 395 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 396 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 397 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 398 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 399 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 400 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 401 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 402 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 403 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 404 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 405 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 406 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 407 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 408 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 409 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 410 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 411 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 412 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 413 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 414 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 415 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 416 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 417 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 418 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 465 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 466 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 467 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 468 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 469 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 471 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 472 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 473 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 474 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 475 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 476 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 477 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 478 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 479 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 480 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 481 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 505 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 510 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 511 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 515 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 516 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 517 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 518 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 519 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 520 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 521 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 522 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 531 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 534 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 535 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 536 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 537 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 538 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 539 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 540 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 541 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 542 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 543 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 544 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 545 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 546 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 547 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 548 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 549 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 550 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 551 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 552 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 553 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 555 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 568 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 569 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.94 |
| Metatranscriptomes | 1.84 |
| Isolates | 8.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.97 |
| Nodule | 2.97 |
| Rhizoplane | 2.27 |
| Rhizosphere | 69.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014800 | 3300001979 | Bacteria | 2866 |
| 2 | JGI24739J22299_10053786 | 3300001989 | Bacteria | 1291 |
| 3 | JGI25152J39213_1003264 | 3300002773 | Bacteria | 5620 |
| 4 | JGI25152J39213_1014338 | 3300002773 | Bacteria | 1611 |
| 5 | JGI25150J39212_1001250 | 3300002774 | Bacteria | 7348 |
| 6 | JGI25159J45721_1000172 | 3300002987 | Bacteria | 30295 |
| 7 | JGI25159J45721_1018208 | 3300002987 | Bacteria | 1425 |
| 8 | JGI25151J46595_10000484 | 3300003187 | Bacteria | 37639 |
| 9 | JGI25151J46595_10000795 | 3300003187 | Bacteria | 25423 |
| 10 | JGI25153J46596_10002000 | 3300003215 | Bacteria | 12047 |
| 11 | JGI25153J46596_10002578 | 3300003215 | Bacteria | 10387 |
| 12 | JGI25153J46596_10003655 | 3300003215 | Bacteria | 8519 |
| 13 | JGI25153J46596_10011009 | 3300003215 | Bacteria | 4033 |
| 14 | JGI25153J46596_10013460 | 3300003215 | Bacteria | 3453 |
| 15 | JGI25160J50197_1000348 | 3300003354 | Bacteria | 30762 |
| 16 | JGI25160J50197_1003589 | 3300003354 | Bacteria | 6887 |
| 17 | JGI25160J50197_1014690 | 3300003354 | Bacteria | 2606 |
| 18 | JGI25161J50226_1000337 | 3300003374 | Bacteria | 25212 |
| 19 | Ga0055535_1000378 | 3300003761 | Bacteria | 42270 |
| 20 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 21 | Ga0055526_1001374 | 3300003771 | Bacteria | 17418 |
| 22 | Ga0055526_1004796 | 3300003771 | Bacteria | 8003 |
| 23 | Ga0055526_1009724 | 3300003771 | Bacteria | 4581 |
| 24 | Ga0055537_1000208 | 3300003773 | Bacteria | 44120 |
| 25 | Ga0055537_1001748 | 3300003773 | Bacteria | 8003 |
| 26 | Ga0055537_1002770 | 3300003773 | Bacteria | 5655 |
| 27 | Ga0055524_1000425 | 3300003775 | Bacteria | 35448 |
| 28 | Ga0055524_1001707 | 3300003775 | Bacteria | 12218 |
| 29 | Ga0055524_1017096 | 3300003775 | Bacteria | 2570 |
| 30 | Ga0055534_1000198 | 3300003784 | Bacteria | 44120 |
| 31 | Ga0055534_1000958 | 3300003784 | Bacteria | 12813 |
| 32 | Ga0055534_1002072 | 3300003784 | Bacteria | 7237 |
| 33 | Ga0055534_1003776 | 3300003784 | Bacteria | 4658 |
| 34 | Ga0055528_1000306 | 3300003790 | Bacteria | 41629 |
| 35 | Ga0055528_1009322 | 3300003790 | Bacteria | 4109 |
| 36 | Ga0055528_1016769 | 3300003790 | Bacteria | 2570 |
| 37 | Ga0055530_10001827 | 3300003791 | Bacteria | 14691 |
| 38 | Ga0055530_10002550 | 3300003791 | Bacteria | 11591 |
| 39 | Ga0055530_10003783 | 3300003791 | Bacteria | 8342 |
| 40 | Ga0055530_10005532 | 3300003791 | Bacteria | 5964 |
| 41 | Ga0055540_1000028 | 3300003792 | Bacteria | 184864 |
| 42 | Ga0055540_1012589 | 3300003792 | Bacteria | 2644 |
| 43 | Ga0055531_10001429 | 3300003794 | Bacteria | 17634 |
| 44 | Ga0055531_10002132 | 3300003794 | Bacteria | 13551 |
| 45 | Ga0055543_1000503 | 3300004625 | Bacteria | 22459 |
| 46 | Ga0058863_10003707 | 3300004799 | Bacteria | 1117 |
| 47 | Ga0058862_12772269 | 3300004803 | Bacteria | 1620 |
| 48 | Ga0065165_1001031 | 3300005262 | Bacteria | 33766 |
| 49 | Ga0065165_1001283 | 3300005262 | Bacteria | 28362 |
| 50 | Ga0065165_1008884 | 3300005262 | Bacteria | 4609 |
| 51 | Ga0065714_10015959 | 3300005288 | Bacteria | 1916 |
| 52 | Ga0065707_10096561 | 3300005295 | Bacteria | 3256 |
| 53 | Ga0065707_10234388 | 3300005295 | Bacteria | 1177 |
| 54 | Ga0070658_10002654 | 3300005327 | Bacteria | 14881 |
| 55 | Ga0070658_10046848 | 3300005327 | Bacteria | 3499 |
| 56 | Ga0070658_10075930 | 3300005327 | Bacteria | 2757 |
| 57 | Ga0070683_100014191 | 3300005329 | Bacteria | 6960 |
| 58 | Ga0070683_100072206 | 3300005329 | Bacteria | 3221 |
| 59 | Ga0070683_100139159 | 3300005329 | Bacteria | 2299 |
| 60 | Ga0070670_100006352 | 3300005331 | Bacteria | 10003 |
| 61 | Ga0070670_100098038 | 3300005331 | Bacteria | 2522 |
| 62 | Ga0070670_100206049 | 3300005331 | Bacteria | 1709 |
| 63 | Ga0070670_100216340 | 3300005331 | Bacteria | 1667 |
| 64 | Ga0070670_100274809 | 3300005331 | Bacteria | 1471 |
| 65 | Ga0070677_10066634 | 3300005333 | Bacteria | 1502 |
| 66 | Ga0068869_100013906 | 3300005334 | Bacteria | 5366 |
| 67 | Ga0068869_100116849 | 3300005334 | Bacteria | 2035 |
| 68 | Ga0068869_100254894 | 3300005334 | Bacteria | 1403 |
| 69 | Ga0070666_10004388 | 3300005335 | Bacteria | 8592 |
| 70 | Ga0070666_10128550 | 3300005335 | Bacteria | 1759 |
| 71 | Ga0070680_100003680 | 3300005336 | Bacteria | 11448 |
| 72 | Ga0070680_100018826 | 3300005336 | Bacteria | 5462 |
| 73 | Ga0070682_100016453 | 3300005337 | Bacteria | 4299 |
| 74 | Ga0068868_100003486 | 3300005338 | Bacteria | 10947 |
| 75 | Ga0068868_100045739 | 3300005338 | Bacteria | 3425 |
| 76 | Ga0068868_100061582 | 3300005338 | Bacteria | 2973 |
| 77 | Ga0068868_100114395 | 3300005338 | Bacteria | 2195 |
| 78 | Ga0068868_100286429 | 3300005338 | Bacteria | 1396 |
| 79 | Ga0070660_100186027 | 3300005339 | Bacteria | 1682 |
| 80 | Ga0070689_100023973 | 3300005340 | Bacteria | 4573 |
| 81 | Ga0070689_100039280 | 3300005340 | Bacteria | 3623 |
| 82 | Ga0070691_10036068 | 3300005341 | Bacteria | 2330 |
| 83 | Ga0070691_10060585 | 3300005341 | Bacteria | 1819 |
| 84 | Ga0070687_100000018 | 3300005343 | Bacteria | 53672 |
| 85 | Ga0070687_100249588 | 3300005343 | Bacteria | 1102 |
| 86 | Ga0070661_100000474 | 3300005344 | Bacteria | 30640 |
| 87 | Ga0070661_100005709 | 3300005344 | Bacteria | 8578 |
| 88 | Ga0070661_100006617 | 3300005344 | Bacteria | 7993 |
| 89 | Ga0070661_100011155 | 3300005344 | Bacteria | 6259 |
| 90 | Ga0070661_100068111 | 3300005344 | Bacteria | 2616 |
| 91 | Ga0070661_100091204 | 3300005344 | Bacteria | 2257 |
| 92 | Ga0070661_100096885 | 3300005344 | Bacteria | 2189 |
| 93 | Ga0070692_10001631 | 3300005345 | Bacteria | 8269 |
| 94 | Ga0070692_10082902 | 3300005345 | Bacteria | 1730 |
| 95 | Ga0070668_100081328 | 3300005347 | Bacteria | 2540 |
| 96 | Ga0070669_100014865 | 3300005353 | Bacteria | 5546 |
| 97 | Ga0070669_100019200 | 3300005353 | Bacteria | 4884 |
| 98 | Ga0070669_100030223 | 3300005353 | Bacteria | 3908 |
| 99 | Ga0070675_100012109 | 3300005354 | Bacteria | 6762 |
| 100 | Ga0070671_100003012 | 3300005355 | Bacteria | 13118 |
| 101 | Ga0070671_100011803 | 3300005355 | Bacteria | 7027 |
| 102 | Ga0070671_100071629 | 3300005355 | Bacteria | 2893 |
| 103 | Ga0070671_100213492 | 3300005355 | Bacteria | 1637 |
| 104 | Ga0070674_100061792 | 3300005356 | Bacteria | 2615 |
| 105 | Ga0070674_100139106 | 3300005356 | Bacteria | 1820 |
| 106 | Ga0070688_100017944 | 3300005365 | Bacteria | 4071 |
| 107 | Ga0070688_100020460 | 3300005365 | Bacteria | 3849 |
| 108 | Ga0070688_100096298 | 3300005365 | Bacteria | 1944 |
| 109 | Ga0070659_100001233 | 3300005366 | Bacteria | 18559 |
| 110 | Ga0070659_100056895 | 3300005366 | Bacteria | 3083 |
| 111 | Ga0070659_100099151 | 3300005366 | Bacteria | 2343 |
| 112 | Ga0070659_100099881 | 3300005366 | Bacteria | 2335 |
| 113 | Ga0070667_100029475 | 3300005367 | Bacteria | 4572 |
| 114 | Ga0070667_100143144 | 3300005367 | Bacteria | 2095 |
| 115 | Ga0070714_100000785 | 3300005435 | Bacteria | 22548 |
| 116 | Ga0070714_100005767 | 3300005435 | Bacteria | 9495 |
| 117 | Ga0070714_100292630 | 3300005435 | Bacteria | 1516 |
| 118 | Ga0070713_100006452 | 3300005436 | Bacteria | 8134 |
| 119 | Ga0070713_100085335 | 3300005436 | Bacteria | 2704 |
| 120 | Ga0070701_10023640 | 3300005438 | Bacteria | 2964 |
| 121 | Ga0070711_100030852 | 3300005439 | Bacteria | 3553 |
| 122 | Ga0070705_100014462 | 3300005440 | Bacteria | 4060 |
| 123 | Ga0070694_100059812 | 3300005444 | Bacteria | 2596 |
| 124 | Ga0070678_100000773 | 3300005456 | Bacteria | 16046 |
| 125 | Ga0070678_100038668 | 3300005456 | Bacteria | 3361 |
| 126 | Ga0070678_100074121 | 3300005456 | Bacteria | 2557 |
| 127 | Ga0070678_100265012 | 3300005456 | Bacteria | 1447 |
| 128 | Ga0070678_100331502 | 3300005456 | Bacteria | 1302 |
| 129 | Ga0070662_100030745 | 3300005457 | Bacteria | 3762 |
| 130 | Ga0070662_100034510 | 3300005457 | Bacteria | 3567 |
| 131 | Ga0070681_10002448 | 3300005458 | Bacteria | 17001 |
| 132 | Ga0070681_10040960 | 3300005458 | Bacteria | 4641 |
| 133 | Ga0070681_10105197 | 3300005458 | Bacteria | 2764 |
| 134 | Ga0070681_10351450 | 3300005458 | Bacteria | 1384 |
| 135 | Ga0070681_10405605 | 3300005458 | Bacteria | 1275 |
| 136 | Ga0068867_100002021 | 3300005459 | Bacteria | 14179 |
| 137 | Ga0068867_100040009 | 3300005459 | Bacteria | 3419 |
| 138 | Ga0068867_100216929 | 3300005459 | Bacteria | 1540 |
| 139 | Ga0070706_100165397 | 3300005467 | Bacteria | 2066 |
| 140 | Ga0070707_100373997 | 3300005468 | Bacteria | 1384 |
| 141 | Ga0070698_100069969 | 3300005471 | Bacteria | 3522 |
| 142 | Ga0070698_100200629 | 3300005471 | Bacteria | 1931 |
| 143 | Ga0070699_100037853 | 3300005518 | Bacteria | 4175 |
| 144 | Ga0070699_100054610 | 3300005518 | Bacteria | 3458 |
| 145 | Ga0070679_100007265 | 3300005530 | Bacteria | 10343 |
| 146 | Ga0070679_100035432 | 3300005530 | Bacteria | 4952 |
| 147 | Ga0070679_100072190 | 3300005530 | Bacteria | 3443 |
| 148 | Ga0070679_100262736 | 3300005530 | Bacteria | 1681 |
| 149 | Ga0070679_100283853 | 3300005530 | Bacteria | 1608 |
| 150 | Ga0070684_100035493 | 3300005535 | Bacteria | 4267 |
| 151 | Ga0070684_100098119 | 3300005535 | Bacteria | 2613 |
| 152 | Ga0070697_100019630 | 3300005536 | Bacteria | 5339 |
| 153 | Ga0068853_100012954 | 3300005539 | Bacteria | 6797 |
| 154 | Ga0068853_100030460 | 3300005539 | Bacteria | 4557 |
| 155 | Ga0068853_100035086 | 3300005539 | Bacteria | 4259 |
| 156 | Ga0068853_100100885 | 3300005539 | Bacteria | 2552 |
| 157 | Ga0070672_100015306 | 3300005543 | Bacteria | 5458 |
| 158 | Ga0070672_100030272 | 3300005543 | Bacteria | 4065 |
| 159 | Ga0070672_100041943 | 3300005543 | Bacteria | 3521 |
| 160 | Ga0070672_100056572 | 3300005543 | Bacteria | 3077 |
| 161 | Ga0070672_100091843 | 3300005543 | Bacteria | 2450 |
| 162 | Ga0070695_100041991 | 3300005545 | Bacteria | 2901 |
| 163 | Ga0070695_100044766 | 3300005545 | Bacteria | 2819 |
| 164 | Ga0070695_100247102 | 3300005545 | Bacteria | 1297 |
| 165 | Ga0070696_100009153 | 3300005546 | Bacteria | 6630 |
| 166 | Ga0070696_100146532 | 3300005546 | Bacteria | 1730 |
| 167 | Ga0070696_100166611 | 3300005546 | Bacteria | 1626 |
| 168 | Ga0070696_100209143 | 3300005546 | Bacteria | 1460 |
| 169 | Ga0070696_100284287 | 3300005546 | Bacteria | 1262 |
| 170 | Ga0070693_100000931 | 3300005547 | Bacteria | 12987 |
| 171 | Ga0070693_100004820 | 3300005547 | Bacteria | 6428 |
| 172 | Ga0070693_100013718 | 3300005547 | Bacteria | 4135 |
| 173 | Ga0070693_100070585 | 3300005547 | Bacteria | 2055 |
| 174 | Ga0070693_100111821 | 3300005547 | Bacteria | 1681 |
| 175 | Ga0070665_100033484 | 3300005548 | Bacteria | 5169 |
| 176 | Ga0070665_100099169 | 3300005548 | Bacteria | 2917 |
| 177 | Ga0070665_100129062 | 3300005548 | Bacteria | 2530 |
| 178 | Ga0070665_100254627 | 3300005548 | Bacteria | 1756 |
| 179 | Ga0070665_100263201 | 3300005548 | Bacteria | 1726 |
| 180 | Ga0070665_100320584 | 3300005548 | Bacteria | 1554 |
| 181 | Ga0070704_100019424 | 3300005549 | Bacteria | 4366 |
| 182 | Ga0070704_100128992 | 3300005549 | Bacteria | 1956 |
| 183 | Ga0070664_100001851 | 3300005564 | Bacteria | 16936 |
| 184 | Ga0070664_100010293 | 3300005564 | Bacteria | 7589 |
| 185 | Ga0070664_100111652 | 3300005564 | Bacteria | 2386 |
| 186 | Ga0070664_100117886 | 3300005564 | Bacteria | 2322 |
| 187 | Ga0070664_100189630 | 3300005564 | Bacteria | 1831 |
| 188 | Ga0068857_100205610 | 3300005577 | Bacteria | 1796 |
| 189 | Ga0068854_100005240 | 3300005578 | Bacteria | 8179 |
| 190 | Ga0068854_100012314 | 3300005578 | Bacteria | 5597 |
| 191 | Ga0068854_100012425 | 3300005578 | Bacteria | 5575 |
| 192 | Ga0068854_100316253 | 3300005578 | Bacteria | 1267 |
| 193 | Ga0068856_100008513 | 3300005614 | Bacteria | 9974 |
| 194 | Ga0068856_100012538 | 3300005614 | Bacteria | 8205 |
| 195 | Ga0068856_100076780 | 3300005614 | Bacteria | 3309 |
| 196 | Ga0068856_100131262 | 3300005614 | Bacteria | 2510 |
| 197 | Ga0068856_100169533 | 3300005614 | Bacteria | 2195 |
| 198 | Ga0068856_100287330 | 3300005614 | Bacteria | 1661 |
| 199 | Ga0068856_100314913 | 3300005614 | Bacteria | 1582 |
| 200 | Ga0070702_100009464 | 3300005615 | Bacteria | 4771 |
| 201 | Ga0070702_100096100 | 3300005615 | Bacteria | 1807 |
| 202 | Ga0068852_100000325 | 3300005616 | Bacteria | 32471 |
| 203 | Ga0068852_100036441 | 3300005616 | Bacteria | 4116 |
| 204 | Ga0068852_100043473 | 3300005616 | Bacteria | 3811 |
| 205 | Ga0068852_100044094 | 3300005616 | Bacteria | 3785 |
| 206 | Ga0068859_100014988 | 3300005617 | Bacteria | 7781 |
| 207 | Ga0068859_100036816 | 3300005617 | Bacteria | 4913 |
| 208 | Ga0068859_100046715 | 3300005617 | Bacteria | 4348 |
| 209 | Ga0068859_100056936 | 3300005617 | Bacteria | 3937 |
| 210 | Ga0068859_100106483 | 3300005617 | Bacteria | 2863 |
| 211 | Ga0068859_100259256 | 3300005617 | Bacteria | 1829 |
| 212 | Ga0068859_100556906 | 3300005617 | Bacteria | 1241 |
| 213 | Ga0068864_100002651 | 3300005618 | Bacteria | 14774 |
| 214 | Ga0068864_100079737 | 3300005618 | Bacteria | 2867 |
| 215 | Ga0068864_100466499 | 3300005618 | Bacteria | 1210 |
| 216 | Ga0068866_10019847 | 3300005718 | Bacteria | 3068 |
| 217 | Ga0068866_10061450 | 3300005718 | Bacteria | 1951 |
| 218 | Ga0068861_100003649 | 3300005719 | Bacteria | 10260 |
| 219 | Ga0068851_10001493 | 3300005834 | Bacteria | 10265 |
| 220 | Ga0068851_10009796 | 3300005834 | Bacteria | 4463 |
| 221 | Ga0068851_10056841 | 3300005834 | Bacteria | 1997 |
| 222 | Ga0068863_100039786 | 3300005841 | Bacteria | 4472 |
| 223 | Ga0068863_100055486 | 3300005841 | Bacteria | 3752 |
| 224 | Ga0068863_100060886 | 3300005841 | Bacteria | 3569 |
| 225 | Ga0068863_100061216 | 3300005841 | Bacteria | 3559 |
| 226 | Ga0068863_100256068 | 3300005841 | Bacteria | 1691 |
| 227 | Ga0068858_100000730 | 3300005842 | Bacteria | 34410 |
| 228 | Ga0068858_100067139 | 3300005842 | Bacteria | 3321 |
| 229 | Ga0068858_100103586 | 3300005842 | Bacteria | 2655 |
| 230 | Ga0068860_100003477 | 3300005843 | Bacteria | 16211 |
| 231 | Ga0068860_100016555 | 3300005843 | Bacteria | 7191 |
| 232 | Ga0068860_100037729 | 3300005843 | Bacteria | 4624 |
| 233 | Ga0068860_100083962 | 3300005843 | Bacteria | 3029 |
| 234 | Ga0068860_100156219 | 3300005843 | Bacteria | 2198 |
| 235 | Ga0068860_100436818 | 3300005843 | Bacteria | 1300 |
| 236 | Ga0068862_100001654 | 3300005844 | Bacteria | 20281 |
| 237 | Ga0068862_100010795 | 3300005844 | Bacteria | 7542 |
| 238 | Ga0081455_10003517 | 3300005937 | Bacteria | 18002 |
| 239 | Ga0081455_10007375 | 3300005937 | Bacteria | 11595 |
| 240 | Ga0081455_10063531 | 3300005937 | Bacteria | 3098 |
| 241 | Ga0081455_10102570 | 3300005937 | Bacteria | 2293 |
| 242 | Ga0081538_10030556 | 3300005981 | Bacteria | 3654 |
| 243 | Ga0081538_10065423 | 3300005981 | Bacteria | 2047 |
| 244 | Ga0081540_1002531 | 3300005983 | Bacteria | 14829 |
| 245 | Ga0081540_1016498 | 3300005983 | Bacteria | 4618 |
| 246 | Ga0081540_1029880 | 3300005983 | Bacteria | 3028 |
| 247 | Ga0081539_10004441 | 3300005985 | Bacteria | 15485 |
| 248 | Ga0081539_10008485 | 3300005985 | Bacteria | 8928 |
| 249 | Ga0075365_10014914 | 3300006038 | Bacteria | 4686 |
| 250 | Ga0075365_10172845 | 3300006038 | Bacteria | 1508 |
| 251 | Ga0075363_100197194 | 3300006048 | Bacteria | 1150 |
| 252 | Ga0075363_100197851 | 3300006048 | Bacteria | 1148 |
| 253 | Ga0075364_10019233 | 3300006051 | Bacteria | 4285 |
| 254 | Ga0070716_100048821 | 3300006173 | Bacteria | 2395 |
| 255 | Ga0070716_100096160 | 3300006173 | Bacteria | 1804 |
| 256 | Ga0070712_100315159 | 3300006175 | Bacteria | 1270 |
| 257 | Ga0075362_10006880 | 3300006177 | Bacteria | 4261 |
| 258 | Ga0075362_10013195 | 3300006177 | Bacteria | 3301 |
| 259 | Ga0075362_10078021 | 3300006177 | Bacteria | 1523 |
| 260 | Ga0075362_10081810 | 3300006177 | Bacteria | 1489 |
| 261 | Ga0075367_10228200 | 3300006178 | Bacteria | 1166 |
| 262 | Ga0075369_10000082 | 3300006186 | Bacteria | 24871 |
| 263 | Ga0075369_10021909 | 3300006186 | Bacteria | 2631 |
| 264 | Ga0075366_10006869 | 3300006195 | Bacteria | 6262 |
| 265 | Ga0075366_10008494 | 3300006195 | Bacteria | 5713 |
| 266 | Ga0075366_10010447 | 3300006195 | Bacteria | 5213 |
| 267 | Ga0075366_10012018 | 3300006195 | Bacteria | 4904 |
| 268 | Ga0075366_10021262 | 3300006195 | Bacteria | 3771 |
| 269 | Ga0075366_10052699 | 3300006195 | Bacteria | 2417 |
| 270 | Ga0075366_10053401 | 3300006195 | Bacteria | 2400 |
| 271 | Ga0075366_10065710 | 3300006195 | Bacteria | 2158 |
| 272 | Ga0097621_100005770 | 3300006237 | Bacteria | 8740 |
| 273 | Ga0097621_100019855 | 3300006237 | Bacteria | 5169 |
| 274 | Ga0097621_100024461 | 3300006237 | Bacteria | 4717 |
| 275 | Ga0097621_100063969 | 3300006237 | Bacteria | 3024 |
| 276 | Ga0097621_100105151 | 3300006237 | Bacteria | 2379 |
| 277 | Ga0097621_100136364 | 3300006237 | Bacteria | 2093 |
| 278 | Ga0075370_10006736 | 3300006353 | Bacteria | 5798 |
| 279 | Ga0075370_10023998 | 3300006353 | Bacteria | 3364 |
| 280 | Ga0075370_10026465 | 3300006353 | Bacteria | 3214 |
| 281 | Ga0075370_10043341 | 3300006353 | Bacteria | 2543 |
| 282 | Ga0075370_10116077 | 3300006353 | Bacteria | 1556 |
| 283 | Ga0075370_10182096 | 3300006353 | Bacteria | 1237 |
| 284 | Ga0068871_100000344 | 3300006358 | Bacteria | 32279 |
| 285 | Ga0068871_100001629 | 3300006358 | Bacteria | 15121 |
| 286 | Ga0068871_100020265 | 3300006358 | Bacteria | 5092 |
| 287 | Ga0068871_100063332 | 3300006358 | Bacteria | 3024 |
| 288 | Ga0068871_100154529 | 3300006358 | Bacteria | 1958 |
| 289 | Ga0068871_100191606 | 3300006358 | Bacteria | 1761 |
| 290 | Ga0068871_100214566 | 3300006358 | Bacteria | 1665 |
| 291 | Ga0075428_100000505 | 3300006844 | Bacteria | 39638 |
| 292 | Ga0075428_100011999 | 3300006844 | Bacteria | 9640 |
| 293 | Ga0075428_100077317 | 3300006844 | Bacteria | 3633 |
| 294 | Ga0075428_100160813 | 3300006844 | Bacteria | 2438 |
| 295 | Ga0075430_100022713 | 3300006846 | Bacteria | 5336 |
| 296 | Ga0075430_100059137 | 3300006846 | Bacteria | 3222 |
| 297 | Ga0075431_100000584 | 3300006847 | Bacteria | 30912 |
| 298 | Ga0075431_100018872 | 3300006847 | Bacteria | 7025 |
| 299 | Ga0075431_100019249 | 3300006847 | Bacteria | 6959 |
| 300 | Ga0075431_100528896 | 3300006847 | Bacteria | 1168 |
| 301 | Ga0075433_10251505 | 3300006852 | Bacteria | 1568 |
| 302 | Ga0075434_100055910 | 3300006871 | Bacteria | 3922 |
| 303 | Ga0075429_100000783 | 3300006880 | Bacteria | 25072 |
| 304 | Ga0075429_100011050 | 3300006880 | Bacteria | 7815 |
| 305 | Ga0075429_100014877 | 3300006880 | Bacteria | 6747 |
| 306 | Ga0075429_100047247 | 3300006880 | Bacteria | 3745 |
| 307 | Ga0068865_100007125 | 3300006881 | Bacteria | 6866 |
| 308 | Ga0068865_100020089 | 3300006881 | Bacteria | 4331 |
| 309 | Ga0068865_100066334 | 3300006881 | Bacteria | 2546 |
| 310 | Ga0075436_100001608 | 3300006914 | Bacteria | 15441 |
| 311 | Ga0075436_100053251 | 3300006914 | Bacteria | 2794 |
| 312 | Ga0097620_100014989 | 3300006931 | Bacteria | 7781 |
| 313 | Ga0097620_100036817 | 3300006931 | Bacteria | 4913 |
| 314 | Ga0097620_100046715 | 3300006931 | Bacteria | 4348 |
| 315 | Ga0097620_100056933 | 3300006931 | Bacteria | 3937 |
| 316 | Ga0097620_100106485 | 3300006931 | Bacteria | 2863 |
| 317 | Ga0097620_100259270 | 3300006931 | Bacteria | 1829 |
| 318 | Ga0097620_100556997 | 3300006931 | Bacteria | 1241 |
| 319 | Ga0099823_1033761 | 3300006944 | Bacteria | 4091 |
| 320 | Ga0079104_1000194 | 3300006946 | Bacteria | 85426 |
| 321 | Ga0099826_10073580 | 3300006948 | Bacteria | 2158 |
| 322 | Ga0075435_100028705 | 3300007076 | Bacteria | 4364 |
| 323 | Ga0075435_100168902 | 3300007076 | Bacteria | 1845 |
| 324 | Ga0111539_10000490 | 3300009094 | Bacteria | 50162 |
| 325 | Ga0111539_10000705 | 3300009094 | Bacteria | 43338 |
| 326 | Ga0111539_10014358 | 3300009094 | Bacteria | 9888 |
| 327 | Ga0111539_10030018 | 3300009094 | Bacteria | 6614 |
| 328 | Ga0111539_10137142 | 3300009094 | Bacteria | 2865 |
| 329 | Ga0111539_10186342 | 3300009094 | Bacteria | 2423 |
| 330 | Ga0111539_10217210 | 3300009094 | Bacteria | 2227 |
| 331 | Ga0105245_10041845 | 3300009098 | Bacteria | 4085 |
| 332 | Ga0105245_10047188 | 3300009098 | Bacteria | 3850 |
| 333 | Ga0105245_10090345 | 3300009098 | Bacteria | 2817 |
| 334 | Ga0105245_10103159 | 3300009098 | Bacteria | 2642 |
| 335 | Ga0105245_10148242 | 3300009098 | Bacteria | 2216 |
| 336 | Ga0105247_10065504 | 3300009101 | Bacteria | 2260 |
| 337 | Ga0114129_10000057 | 3300009147 | Bacteria | 99258 |
| 338 | Ga0114129_10000341 | 3300009147 | Bacteria | 54331 |
| 339 | Ga0114129_10140657 | 3300009147 | Bacteria | 3309 |
| 340 | Ga0105243_10000346 | 3300009148 | Bacteria | 49790 |
| 341 | Ga0105243_10008545 | 3300009148 | Bacteria | 7856 |
| 342 | Ga0105243_10075395 | 3300009148 | Bacteria | 2738 |
| 343 | Ga0105241_10099992 | 3300009174 | Bacteria | 2304 |
| 344 | Ga0105241_10184458 | 3300009174 | Bacteria | 1733 |
| 345 | Ga0105241_10212348 | 3300009174 | Bacteria | 1622 |
| 346 | Ga0105242_10004136 | 3300009176 | Bacteria | 11293 |
| 347 | Ga0105242_10159730 | 3300009176 | Bacteria | 1972 |
| 348 | Ga0105248_10035140 | 3300009177 | Bacteria | 5607 |
| 349 | Ga0105248_10076968 | 3300009177 | Bacteria | 3750 |
| 350 | Ga0105248_10205294 | 3300009177 | Bacteria | 2220 |
| 351 | Ga0105248_10238394 | 3300009177 | Bacteria | 2048 |
| 352 | Ga0105248_10249923 | 3300009177 | Bacteria | 1996 |
| 353 | Ga0105237_10021401 | 3300009545 | Bacteria | 6648 |
| 354 | Ga0105237_10150584 | 3300009545 | Bacteria | 2323 |
| 355 | Ga0105238_10014576 | 3300009551 | Bacteria | 7947 |
| 356 | Ga0105238_10026008 | 3300009551 | Bacteria | 5965 |
| 357 | Ga0105238_10034965 | 3300009551 | Bacteria | 5111 |
| 358 | Ga0105238_10161144 | 3300009551 | Bacteria | 2219 |
| 359 | Ga0105249_10010104 | 3300009553 | Bacteria | 8285 |
| 360 | Ga0105249_10176132 | 3300009553 | Bacteria | 2078 |
| 361 | Ga0105249_10380603 | 3300009553 | Bacteria | 1437 |
| 362 | Ga0105249_10409923 | 3300009553 | Bacteria | 1387 |
| 363 | Ga0105239_10019990 | 3300010375 | Bacteria | 7390 |
| 364 | Ga0105239_10215152 | 3300010375 | Bacteria | 2154 |
| 365 | Ga0105239_10272694 | 3300010375 | Bacteria | 1903 |
| 366 | Ga0105246_10037203 | 3300011119 | Bacteria | 3265 |
| 367 | Ga0157373_10007866 | 3300013100 | Bacteria | 7930 |
| 368 | Ga0157373_10027114 | 3300013100 | Bacteria | 4134 |
| 369 | Ga0157373_10041685 | 3300013100 | Bacteria | 3283 |
| 370 | Ga0157373_10052531 | 3300013100 | Bacteria | 2900 |
| 371 | Ga0157371_10051690 | 3300013102 | Bacteria | 2920 |
| 372 | Ga0157371_10078904 | 3300013102 | Bacteria | 2332 |
| 373 | Ga0157370_10001435 | 3300013104 | Bacteria | 29541 |
| 374 | Ga0157370_10009451 | 3300013104 | Bacteria | 10414 |
| 375 | Ga0157370_10081869 | 3300013104 | Bacteria | 3037 |
| 376 | Ga0157370_10139287 | 3300013104 | Bacteria | 2261 |
| 377 | Ga0157370_10163736 | 3300013104 | Bacteria | 2069 |
| 378 | Ga0157369_10017534 | 3300013105 | Bacteria | 8045 |
| 379 | Ga0157369_10148696 | 3300013105 | Bacteria | 2476 |
| 380 | Ga0157369_10253549 | 3300013105 | Bacteria | 1836 |
| 381 | Ga0157374_10001734 | 3300013296 | Bacteria | 18285 |
| 382 | Ga0157374_10028606 | 3300013296 | Bacteria | 5036 |
| 383 | Ga0157374_10153335 | 3300013296 | Bacteria | 2241 |
| 384 | Ga0157374_10155005 | 3300013296 | Bacteria | 2229 |
| 385 | Ga0157374_10182192 | 3300013296 | Bacteria | 2052 |
| 386 | Ga0157378_10061851 | 3300013297 | Bacteria | 3343 |
| 387 | Ga0157378_10082324 | 3300013297 | Bacteria | 2910 |
| 388 | Ga0157378_10212139 | 3300013297 | Bacteria | 1836 |
| 389 | Ga0157378_10301550 | 3300013297 | Bacteria | 1551 |
| 390 | Ga0163162_10003566 | 3300013306 | Bacteria | 14886 |
| 391 | Ga0163162_10042978 | 3300013306 | Bacteria | 4523 |
| 392 | Ga0163162_10085275 | 3300013306 | Bacteria | 3235 |
| 393 | Ga0163162_10127176 | 3300013306 | Bacteria | 2655 |
| 394 | Ga0163162_10127640 | 3300013306 | Bacteria | 2651 |
| 395 | Ga0157372_10045037 | 3300013307 | Bacteria | 4892 |
| 396 | Ga0157372_10076502 | 3300013307 | Bacteria | 3779 |
| 397 | Ga0157375_10007052 | 3300013308 | Bacteria | 9816 |
| 398 | Ga0157375_10024702 | 3300013308 | Bacteria | 5567 |
| 399 | Ga0163163_10047946 | 3300014325 | Bacteria | 4199 |
| 400 | Ga0163163_10070822 | 3300014325 | Bacteria | 3473 |
| 401 | Ga0157380_10151850 | 3300014326 | Bacteria | 2003 |
| 402 | Ga0157377_10008943 | 3300014745 | Bacteria | 4900 |
| 403 | Ga0157377_10027628 | 3300014745 | Bacteria | 3048 |
| 404 | Ga0157379_10031503 | 3300014968 | Bacteria | 4724 |
| 405 | Ga0157379_10072610 | 3300014968 | Bacteria | 3079 |
| 406 | Ga0157379_10122996 | 3300014968 | Bacteria | 2335 |
| 407 | Ga0157376_10024018 | 3300014969 | Bacteria | 4780 |
| 408 | Ga0157376_10068402 | 3300014969 | Bacteria | 3007 |
| 409 | Ga0157376_10168937 | 3300014969 | Bacteria | 1990 |
| 410 | Ga0163161_10014997 | 3300017792 | Bacteria | 5399 |
| 411 | Ga0197907_10590190 | 3300020069 | Bacteria | 1248 |
| 412 | Ga0206356_10165203 | 3300020070 | Bacteria | 1149 |
| 413 | Ga0206352_11255281 | 3300020078 | Bacteria | 1296 |
| 414 | Ga0206352_11269377 | 3300020078 | Bacteria | 1239 |
| 415 | Ga0206353_11895588 | 3300020082 | Bacteria | 2032 |
| 416 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 417 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 418 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 419 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 420 | Ga0224712_10094181 | 3300022467 | Bacteria | 1260 |
| 421 | Ga0209672_101176 | 3300025228 | Bacteria | 10682 |
| 422 | Ga0209147_100472 | 3300025229 | Bacteria | 24613 |
| 423 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 424 | Ga0207425_1000190 | 3300025245 | Bacteria | 49963 |
| 425 | Ga0207425_1000598 | 3300025245 | Bacteria | 20958 |
| 426 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 427 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 428 | Ga0209129_1000091 | 3300025258 | Bacteria | 175716 |
| 429 | Ga0209129_1001758 | 3300025258 | Bacteria | 11609 |
| 430 | Ga0209129_1018735 | 3300025258 | Bacteria | 1324 |
| 431 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 432 | Ga0209565_1000335 | 3300025263 | Bacteria | 41834 |
| 433 | Ga0209565_1002488 | 3300025263 | Bacteria | 6592 |
| 434 | Ga0209565_1006285 | 3300025263 | Bacteria | 3351 |
| 435 | Ga0209673_1000072 | 3300025273 | Bacteria | 236935 |
| 436 | Ga0209673_1000154 | 3300025273 | Bacteria | 146394 |
| 437 | Ga0209673_1002551 | 3300025273 | Bacteria | 12441 |
| 438 | Ga0209673_1004238 | 3300025273 | Bacteria | 7806 |
| 439 | Ga0209673_1013792 | 3300025273 | Bacteria | 3170 |
| 440 | Ga0209130_1000140 | 3300025284 | Bacteria | 115434 |
| 441 | Ga0209130_1000782 | 3300025284 | Bacteria | 27407 |
| 442 | Ga0209130_1001163 | 3300025284 | Bacteria | 19005 |
| 443 | Ga0209130_1001760 | 3300025284 | Bacteria | 12841 |
| 444 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 445 | Ga0209675_1001002 | 3300025291 | Bacteria | 17764 |
| 446 | Ga0209675_1001248 | 3300025291 | Bacteria | 15267 |
| 447 | Ga0209675_1004489 | 3300025291 | Bacteria | 6183 |
| 448 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 449 | Ga0209676_1007117 | 3300025292 | Bacteria | 5346 |
| 450 | Ga0209676_1018341 | 3300025292 | Bacteria | 2444 |
| 451 | Ga0209025_1000207 | 3300025294 | Bacteria | 140774 |
| 452 | Ga0209025_1000286 | 3300025294 | Bacteria | 114096 |
| 453 | Ga0209025_1000328 | 3300025294 | Bacteria | 105594 |
| 454 | Ga0209025_1000356 | 3300025294 | Bacteria | 98547 |
| 455 | Ga0209025_1003562 | 3300025294 | Bacteria | 14591 |
| 456 | Ga0209564_1000103 | 3300025295 | Bacteria | 221166 |
| 457 | Ga0209564_1000129 | 3300025295 | Bacteria | 195163 |
| 458 | Ga0209564_1000597 | 3300025295 | Bacteria | 56580 |
| 459 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 460 | Ga0209758_1000197 | 3300025297 | Bacteria | 133706 |
| 461 | Ga0209758_1000209 | 3300025297 | Bacteria | 128038 |
| 462 | Ga0209758_1000213 | 3300025297 | Bacteria | 126745 |
| 463 | Ga0209758_1000613 | 3300025297 | Bacteria | 55154 |
| 464 | Ga0209758_1001871 | 3300025297 | Bacteria | 23059 |
| 465 | Ga0209758_1004235 | 3300025297 | Bacteria | 12142 |
| 466 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 467 | Ga0209050_1000178 | 3300025298 | Bacteria | 145314 |
| 468 | Ga0209050_1000282 | 3300025298 | Bacteria | 108629 |
| 469 | Ga0209050_1022724 | 3300025298 | Bacteria | 2236 |
| 470 | Ga0209050_1040650 | 3300025298 | Bacteria | 1291 |
| 471 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 472 | Ga0209256_1000065 | 3300025299 | Bacteria | 248104 |
| 473 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 474 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 475 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 476 | Ga0207426_1000235 | 3300025302 | Bacteria | 126601 |
| 477 | Ga0207426_1001703 | 3300025302 | Bacteria | 16900 |
| 478 | Ga0207426_1004495 | 3300025302 | Bacteria | 6762 |
| 479 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 480 | Ga0209051_1000273 | 3300025303 | Bacteria | 84847 |
| 481 | Ga0209051_1000461 | 3300025303 | Bacteria | 53478 |
| 482 | Ga0209051_1004272 | 3300025303 | Bacteria | 8893 |
| 483 | Ga0209051_1009904 | 3300025303 | Bacteria | 4865 |
| 484 | Ga0209051_1018102 | 3300025303 | Bacteria | 3127 |
| 485 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 486 | Ga0209257_1001999 | 3300025304 | Bacteria | 21868 |
| 487 | Ga0209257_1007808 | 3300025304 | Bacteria | 6340 |
| 488 | Ga0207656_10000707 | 3300025321 | Bacteria | 10917 |
| 489 | Ga0207656_10035021 | 3300025321 | Bacteria | 2099 |
| 490 | Ga0207692_10056904 | 3300025898 | Bacteria | 2008 |
| 491 | Ga0207642_10001781 | 3300025899 | Bacteria | 6660 |
| 492 | Ga0207688_10026991 | 3300025901 | Bacteria | 3158 |
| 493 | Ga0207688_10040362 | 3300025901 | Bacteria | 2593 |
| 494 | Ga0207680_10011039 | 3300025903 | Bacteria | 4548 |
| 495 | Ga0207647_10063202 | 3300025904 | Bacteria | 2252 |
| 496 | Ga0207699_10074132 | 3300025906 | Bacteria | 2090 |
| 497 | Ga0207645_10056399 | 3300025907 | Bacteria | 2508 |
| 498 | Ga0207643_10039006 | 3300025908 | Bacteria | 2671 |
| 499 | Ga0207705_10010757 | 3300025909 | Bacteria | 6643 |
| 500 | Ga0207684_10060695 | 3300025910 | Bacteria | 3211 |
| 501 | Ga0207654_10001352 | 3300025911 | Bacteria | 13006 |
| 502 | Ga0207707_10005308 | 3300025912 | Bacteria | 11258 |
| 503 | Ga0207707_10041797 | 3300025912 | Bacteria | 4003 |
| 504 | Ga0207707_10053222 | 3300025912 | Bacteria | 3524 |
| 505 | Ga0207707_10133476 | 3300025912 | Bacteria | 2171 |
| 506 | Ga0207707_10158081 | 3300025912 | Bacteria | 1982 |
| 507 | Ga0207707_10244778 | 3300025912 | Bacteria | 1558 |
| 508 | Ga0207695_10043723 | 3300025913 | Bacteria | 4772 |
| 509 | Ga0207671_10040140 | 3300025914 | Bacteria | 3465 |
| 510 | Ga0207671_10053972 | 3300025914 | Bacteria | 2978 |
| 511 | Ga0207671_10107413 | 3300025914 | Bacteria | 2120 |
| 512 | Ga0207693_10000070 | 3300025915 | Bacteria | 90057 |
| 513 | Ga0207663_10034707 | 3300025916 | Bacteria | 3020 |
| 514 | Ga0207663_10101271 | 3300025916 | Bacteria | 1935 |
| 515 | Ga0207660_10018761 | 3300025917 | Bacteria | 4617 |
| 516 | Ga0207660_10025680 | 3300025917 | Bacteria | 4002 |
| 517 | Ga0207660_10190659 | 3300025917 | Bacteria | 1596 |
| 518 | Ga0207662_10000347 | 3300025918 | Bacteria | 20979 |
| 519 | Ga0207657_10006160 | 3300025919 | Bacteria | 12468 |
| 520 | Ga0207657_10105256 | 3300025919 | Bacteria | 2336 |
| 521 | Ga0207657_10233343 | 3300025919 | Bacteria | 1471 |
| 522 | Ga0207657_10243076 | 3300025919 | Bacteria | 1437 |
| 523 | Ga0207649_10006855 | 3300025920 | Bacteria | 6189 |
| 524 | Ga0207649_10017049 | 3300025920 | Bacteria | 4111 |
| 525 | Ga0207649_10021160 | 3300025920 | Bacteria | 3739 |
| 526 | Ga0207649_10024036 | 3300025920 | Bacteria | 3537 |
| 527 | Ga0207649_10074248 | 3300025920 | Bacteria | 2181 |
| 528 | Ga0207649_10171427 | 3300025920 | Bacteria | 1512 |
| 529 | Ga0207652_10029293 | 3300025921 | Bacteria | 4602 |
| 530 | Ga0207652_10221164 | 3300025921 | Bacteria | 1706 |
| 531 | Ga0207646_10080148 | 3300025922 | Bacteria | 2919 |
| 532 | Ga0207681_10022061 | 3300025923 | Bacteria | 4056 |
| 533 | Ga0207694_10119003 | 3300025924 | Bacteria | 2107 |
| 534 | Ga0207694_10142647 | 3300025924 | Bacteria | 1927 |
| 535 | Ga0207650_10003752 | 3300025925 | Bacteria | 10390 |
| 536 | Ga0207650_10022051 | 3300025925 | Bacteria | 4507 |
| 537 | Ga0207650_10030088 | 3300025925 | Bacteria | 3909 |
| 538 | Ga0207650_10048329 | 3300025925 | Bacteria | 3138 |
| 539 | Ga0207650_10064049 | 3300025925 | Bacteria | 2751 |
| 540 | Ga0207650_10227277 | 3300025925 | Bacteria | 1504 |
| 541 | Ga0207650_10359410 | 3300025925 | Bacteria | 1199 |
| 542 | Ga0207659_10044153 | 3300025926 | Bacteria | 3135 |
| 543 | Ga0207659_10102613 | 3300025926 | Bacteria | 2159 |
| 544 | Ga0207659_10203351 | 3300025926 | Bacteria | 1583 |
| 545 | Ga0207687_10004204 | 3300025927 | Bacteria | 9630 |
| 546 | Ga0207687_10037559 | 3300025927 | Bacteria | 3305 |
| 547 | Ga0207687_10053692 | 3300025927 | Bacteria | 2817 |
| 548 | Ga0207700_10009237 | 3300025928 | Bacteria | 6151 |
| 549 | Ga0207700_10056892 | 3300025928 | Bacteria | 2946 |
| 550 | Ga0207664_10001186 | 3300025929 | Bacteria | 17334 |
| 551 | Ga0207644_10011121 | 3300025931 | Bacteria | 5945 |
| 552 | Ga0207644_10011640 | 3300025931 | Bacteria | 5824 |
| 553 | Ga0207644_10075156 | 3300025931 | Bacteria | 2482 |
| 554 | Ga0207644_10120624 | 3300025931 | Bacteria | 1996 |
| 555 | Ga0207644_10132129 | 3300025931 | Bacteria | 1912 |
| 556 | Ga0207690_10000538 | 3300025932 | Bacteria | 24715 |
| 557 | Ga0207690_10023590 | 3300025932 | Bacteria | 3841 |
| 558 | Ga0207690_10097341 | 3300025932 | Bacteria | 2094 |
| 559 | Ga0207690_10133755 | 3300025932 | Bacteria | 1818 |
| 560 | Ga0207706_10073512 | 3300025933 | Bacteria | 3006 |
| 561 | Ga0207686_10000520 | 3300025934 | Bacteria | 24908 |
| 562 | Ga0207686_10085595 | 3300025934 | Bacteria | 2068 |
| 563 | Ga0207686_10146353 | 3300025934 | Bacteria | 1639 |
| 564 | Ga0207709_10000485 | 3300025935 | Bacteria | 36221 |
| 565 | Ga0207709_10004462 | 3300025935 | Bacteria | 8082 |
| 566 | Ga0207709_10370959 | 3300025935 | Bacteria | 1086 |
| 567 | Ga0207670_10007266 | 3300025936 | Bacteria | 6172 |
| 568 | Ga0207670_10039008 | 3300025936 | Bacteria | 3107 |
| 569 | Ga0207669_10010756 | 3300025937 | Bacteria | 4419 |
| 570 | Ga0207669_10034065 | 3300025937 | Bacteria | 2882 |
| 571 | Ga0207669_10051238 | 3300025937 | Bacteria | 2472 |
| 572 | Ga0207669_10073212 | 3300025937 | Bacteria | 2161 |
| 573 | Ga0207669_10154485 | 3300025937 | Bacteria | 1612 |
| 574 | Ga0207704_10007350 | 3300025938 | Bacteria | 5198 |
| 575 | Ga0207704_10188533 | 3300025938 | Bacteria | 1498 |
| 576 | Ga0207704_10222934 | 3300025938 | Bacteria | 1396 |
| 577 | Ga0207665_10021996 | 3300025939 | Bacteria | 4192 |
| 578 | Ga0207665_10082049 | 3300025939 | Bacteria | 2221 |
| 579 | Ga0207691_10027404 | 3300025940 | Bacteria | 5341 |
| 580 | Ga0207691_10049988 | 3300025940 | Bacteria | 3829 |
| 581 | Ga0207691_10057620 | 3300025940 | Bacteria | 3535 |
| 582 | Ga0207691_10218849 | 3300025940 | Bacteria | 1652 |
| 583 | Ga0207691_10233158 | 3300025940 | Bacteria | 1593 |
| 584 | Ga0207711_10192784 | 3300025941 | Bacteria | 1858 |
| 585 | Ga0207711_10261434 | 3300025941 | Bacteria | 1591 |
| 586 | Ga0207711_10305393 | 3300025941 | Bacteria | 1468 |
| 587 | Ga0207689_10000488 | 3300025942 | Bacteria | 37483 |
| 588 | Ga0207689_10018916 | 3300025942 | Bacteria | 5809 |
| 589 | Ga0207689_10023643 | 3300025942 | Bacteria | 5153 |
| 590 | Ga0207689_10072374 | 3300025942 | Bacteria | 2832 |
| 591 | Ga0207689_10154799 | 3300025942 | Bacteria | 1890 |
| 592 | Ga0207661_10039572 | 3300025944 | Bacteria | 3701 |
| 593 | Ga0207679_10000542 | 3300025945 | Bacteria | 25399 |
| 594 | Ga0207679_10021173 | 3300025945 | Bacteria | 4401 |
| 595 | Ga0207679_10134289 | 3300025945 | Bacteria | 1990 |
| 596 | Ga0207667_10077947 | 3300025949 | Bacteria | 3435 |
| 597 | Ga0207667_10241526 | 3300025949 | Bacteria | 1848 |
| 598 | Ga0207651_10016651 | 3300025960 | Bacteria | 4315 |
| 599 | Ga0207651_10027002 | 3300025960 | Bacteria | 3598 |
| 600 | Ga0207651_10027540 | 3300025960 | Bacteria | 3571 |
| 601 | Ga0207651_10137482 | 3300025960 | Bacteria | 1882 |
| 602 | Ga0207712_10023406 | 3300025961 | Bacteria | 4075 |
| 603 | Ga0207668_10053142 | 3300025972 | Bacteria | 2806 |
| 604 | Ga0207668_10074026 | 3300025972 | Bacteria | 2443 |
| 605 | Ga0207668_10228414 | 3300025972 | Bacteria | 1499 |
| 606 | Ga0207640_10133268 | 3300025981 | Bacteria | 1799 |
| 607 | Ga0207658_10022101 | 3300025986 | Bacteria | 4425 |
| 608 | Ga0207658_10149123 | 3300025986 | Bacteria | 1903 |
| 609 | Ga0207677_10016950 | 3300026023 | Bacteria | 4329 |
| 610 | Ga0207677_10029061 | 3300026023 | Bacteria | 3507 |
| 611 | Ga0207677_10084777 | 3300026023 | Bacteria | 2285 |
| 612 | Ga0207703_10022993 | 3300026035 | Bacteria | 4894 |
| 613 | Ga0207703_10097347 | 3300026035 | Bacteria | 2486 |
| 614 | Ga0207703_10205804 | 3300026035 | Bacteria | 1751 |
| 615 | Ga0207639_10015836 | 3300026041 | Bacteria | 5324 |
| 616 | Ga0207639_10107397 | 3300026041 | Bacteria | 2267 |
| 617 | Ga0207639_10146596 | 3300026041 | Bacteria | 1972 |
| 618 | Ga0207678_10053759 | 3300026067 | Bacteria | 3469 |
| 619 | Ga0207708_10141554 | 3300026075 | Bacteria | 1887 |
| 620 | Ga0207702_10004295 | 3300026078 | Bacteria | 12708 |
| 621 | Ga0207702_10033733 | 3300026078 | Bacteria | 4277 |
| 622 | Ga0207702_10123155 | 3300026078 | Bacteria | 2323 |
| 623 | Ga0207702_10195819 | 3300026078 | Bacteria | 1870 |
| 624 | Ga0207702_10298361 | 3300026078 | Bacteria | 1529 |
| 625 | Ga0207641_10007815 | 3300026088 | Bacteria | 8880 |
| 626 | Ga0207641_10055353 | 3300026088 | Bacteria | 3368 |
| 627 | Ga0207648_10001364 | 3300026089 | Bacteria | 26988 |
| 628 | Ga0207648_10021207 | 3300026089 | Bacteria | 5841 |
| 629 | Ga0207648_10100675 | 3300026089 | Bacteria | 2532 |
| 630 | Ga0207676_10002757 | 3300026095 | Bacteria | 12496 |
| 631 | Ga0207676_10044753 | 3300026095 | Bacteria | 3416 |
| 632 | Ga0207676_10045404 | 3300026095 | Bacteria | 3394 |
| 633 | Ga0207674_10008147 | 3300026116 | Bacteria | 12150 |
| 634 | Ga0207674_10015377 | 3300026116 | Bacteria | 8407 |
| 635 | Ga0207674_10110494 | 3300026116 | Bacteria | 2724 |
| 636 | Ga0207675_100000316 | 3300026118 | Bacteria | 46037 |
| 637 | Ga0207675_100002430 | 3300026118 | Bacteria | 18452 |
| 638 | Ga0207675_100015324 | 3300026118 | Bacteria | 7153 |
| 639 | Ga0207675_100252636 | 3300026118 | Bacteria | 1707 |
| 640 | Ga0207683_10000503 | 3300026121 | Bacteria | 36106 |
| 641 | Ga0207683_10014682 | 3300026121 | Bacteria | 6669 |
| 642 | Ga0207683_10015036 | 3300026121 | Bacteria | 6587 |
| 643 | Ga0207683_10018772 | 3300026121 | Bacteria | 5899 |
| 644 | Ga0207683_10047847 | 3300026121 | Bacteria | 3745 |
| 645 | Ga0207683_10056247 | 3300026121 | Bacteria | 3450 |
| 646 | Ga0207683_10520179 | 3300026121 | Bacteria | 1099 |
| 647 | Ga0207698_10007138 | 3300026142 | Bacteria | 6996 |
| 648 | Ga0207698_10010409 | 3300026142 | Bacteria | 5974 |
| 649 | Ga0207698_10208279 | 3300026142 | Bacteria | 1757 |
| 650 | Ga0207698_10321436 | 3300026142 | Bacteria | 1449 |
| 651 | Ga0209281_1000083 | 3300027111 | Bacteria | 255034 |
| 652 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 653 | Ga0209969_1005346 | 3300027360 | Bacteria | 1799 |
| 654 | Ga0209489_105217 | 3300027361 | Bacteria | 22905 |
| 655 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 656 | Ga0209967_1000971 | 3300027364 | Bacteria | 3650 |
| 657 | Ga0209996_1008152 | 3300027395 | Bacteria | 1371 |
| 658 | Ga0209984_1004908 | 3300027424 | Bacteria | 1590 |
| 659 | Ga0210000_1004391 | 3300027462 | Bacteria | 2037 |
| 660 | Ga0209995_1010466 | 3300027471 | Bacteria | 1505 |
| 661 | Ga0209968_1000171 | 3300027526 | Bacteria | 11334 |
| 662 | Ga0209970_1008103 | 3300027614 | Bacteria | 1726 |
| 663 | Ga0209282_1004201 | 3300027666 | Bacteria | 8656 |
| 664 | Ga0209966_1000118 | 3300027695 | Bacteria | 35137 |
| 665 | Ga0209813_10040887 | 3300027866 | Bacteria | 1411 |
| 666 | Ga0209974_10001716 | 3300027876 | Bacteria | 7955 |
| 667 | Ga0207428_10001513 | 3300027907 | Bacteria | 24320 |
| 668 | Ga0207428_10001574 | 3300027907 | Bacteria | 23762 |
| 669 | Ga0207428_10003990 | 3300027907 | Bacteria | 14165 |
| 670 | Ga0268266_10002299 | 3300028379 | Bacteria | 20728 |
| 671 | Ga0268266_10005672 | 3300028379 | Bacteria | 11578 |
| 672 | Ga0268266_10024830 | 3300028379 | Bacteria | 5100 |
| 673 | Ga0268266_10032022 | 3300028379 | Bacteria | 4467 |
| 674 | Ga0268266_10120010 | 3300028379 | Bacteria | 2339 |
| 675 | Ga0268266_10272887 | 3300028379 | Bacteria | 1570 |
| 676 | Ga0268266_10476300 | 3300028379 | Bacteria | 1189 |
| 677 | Ga0268265_10002823 | 3300028380 | Bacteria | 12777 |
| 678 | Ga0268265_10003395 | 3300028380 | Bacteria | 11458 |
| 679 | Ga0268265_10024517 | 3300028380 | Bacteria | 4269 |
| 680 | Ga0268265_10055399 | 3300028380 | Bacteria | 3012 |
| 681 | Ga0268265_10084165 | 3300028380 | Bacteria | 2521 |
| 682 | Ga0268264_10007460 | 3300028381 | Bacteria | 9127 |
| 683 | Ga0268264_10029236 | 3300028381 | Bacteria | 4512 |
| 684 | Ga0268264_10061138 | 3300028381 | Bacteria | 3159 |
| 685 | Ga0268264_10079331 | 3300028381 | Bacteria | 2800 |
| 686 | Ga0268264_10363002 | 3300028381 | Bacteria | 1382 |
| 687 | Ga0307517_10000579 | 3300028786 | Bacteria | 62428 |
| 688 | Ga0307517_10236544 | 3300028786 | Bacteria | 1089 |
| 689 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 690 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 691 | Ga0307515_10000150 | 3300028794 | Bacteria | 169644 |
| 692 | Ga0307515_10000367 | 3300028794 | Bacteria | 111166 |
| 693 | Ga0307515_10005608 | 3300028794 | Bacteria | 25370 |
| 694 | Ga0307515_10020668 | 3300028794 | Bacteria | 11727 |
| 695 | Ga0307515_10051395 | 3300028794 | Bacteria | 6146 |
| 696 | Ga0307515_10054271 | 3300028794 | Bacteria | 5888 |
| 697 | Ga0307515_10063415 | 3300028794 | Bacteria | 5191 |
| 698 | Ga0307515_10087565 | 3300028794 | Bacteria | 3950 |
| 699 | Ga0316177_1084583 | 3300030731 | Bacteria | 7782 |
| 700 | Ga0316176_1043862 | 3300030732 | Bacteria | 3343 |
| 701 | Ga0314311_1136633 | 3300030733 | Bacteria | 2731 |
| 702 | Ga0316178_1001707 | 3300030735 | Bacteria | 6637 |
| 703 | Ga0316183_1034028 | 3300030742 | Bacteria | 5300 |
| 704 | Ga0316182_1352626 | 3300030745 | Bacteria | 3143 |
| 705 | Ga0307513_10000514 | 3300031456 | Bacteria | 55608 |
| 706 | Ga0307513_10000924 | 3300031456 | Bacteria | 42435 |
| 707 | Ga0307513_10000991 | 3300031456 | Bacteria | 41018 |
| 708 | Ga0307513_10008489 | 3300031456 | Bacteria | 13127 |
| 709 | Ga0307513_10179781 | 3300031456 | Bacteria | 1980 |
| 710 | Ga0307513_10183595 | 3300031456 | Bacteria | 1951 |
| 711 | Ga0307509_10020754 | 3300031507 | Bacteria | 7452 |
| 712 | Ga0307408_100049104 | 3300031548 | Bacteria | 3029 |
| 713 | Ga0307508_10016499 | 3300031616 | Bacteria | 6724 |
| 714 | Ga0307514_10100671 | 3300031649 | Bacteria | 2076 |
| 715 | Ga0265314_10043562 | 3300031711 | Bacteria | 3190 |
| 716 | Ga0307516_10000839 | 3300031730 | Bacteria | 42125 |
| 717 | Ga0307516_10001570 | 3300031730 | Bacteria | 31465 |
| 718 | Ga0307516_10003308 | 3300031730 | Bacteria | 20859 |
| 719 | Ga0307516_10060979 | 3300031730 | Bacteria | 3662 |
| 720 | Ga0307516_10099941 | 3300031730 | Bacteria | 2717 |
| 721 | Ga0307405_10071431 | 3300031731 | Bacteria | 2233 |
| 722 | Ga0307413_10170881 | 3300031824 | Bacteria | 1538 |
| 723 | Ga0307413_10248844 | 3300031824 | Bacteria | 1317 |
| 724 | Ga0307410_10047191 | 3300031852 | Bacteria | 2877 |
| 725 | Ga0307410_10055265 | 3300031852 | Bacteria | 2695 |
| 726 | Ga0307406_10168255 | 3300031901 | Bacteria | 1583 |
| 727 | Ga0307412_10043577 | 3300031911 | Bacteria | 2922 |
| 728 | Ga0307412_10150097 | 3300031911 | Bacteria | 1718 |
| 729 | Ga0307412_10156718 | 3300031911 | Bacteria | 1686 |
| 730 | Ga0307412_10294608 | 3300031911 | Bacteria | 1280 |
| 731 | Ga0307409_100050443 | 3300031995 | Bacteria | 3178 |
| 732 | Ga0307416_100102783 | 3300032002 | Bacteria | 2493 |
| 733 | Ga0307416_100117706 | 3300032002 | Bacteria | 2359 |
| 734 | Ga0307416_100132824 | 3300032002 | Bacteria | 2245 |
| 735 | Ga0307414_10042351 | 3300032004 | Bacteria | 3093 |
| 736 | Ga0307414_10049656 | 3300032004 | Bacteria | 2902 |
| 737 | Ga0307414_10346151 | 3300032004 | Bacteria | 1274 |
| 738 | Ga0307411_10031544 | 3300032005 | Bacteria | 3262 |
| 739 | Ga0307415_100051380 | 3300032126 | Bacteria | 2797 |
| 740 | Ga0307510_10002141 | 3300033180 | Bacteria | 22301 |
| 741 | Ga0307510_10040933 | 3300033180 | Bacteria | 5076 |
| 742 | Ga0373926_0001218 | 3300035083 | Bacteria | 7730 |
| 743 | Ga0373926_0038908 | 3300035083 | Bacteria | 1695 |
| 744 | Ga0373934_0023345 | 3300035086 | Bacteria | 2389 |
| 745 | Ga0373934_0065656 | 3300035086 | Bacteria | 1449 |
| 746 | Ga0373944_0014577 | 3300035089 | Bacteria | 2196 |
| 747 | Ga0373936_0008312 | 3300035113 | Bacteria | 3904 |
| 748 | Ga0373936_0071331 | 3300035113 | Bacteria | 1432 |
| 749 | Ga0373939_0053786 | 3300035114 | Bacteria | 1259 |
| 750 | Ga0373945_0001462 | 3300035116 | Bacteria | 7207 |
| 751 | Ga0373945_0014320 | 3300035116 | Bacteria | 2655 |
| 752 | Ga0373945_0022309 | 3300035116 | Bacteria | 2179 |
| 753 | Ga0373954_0010094 | 3300035118 | Bacteria | 4160 |
| 754 | Ga0373956_0022239 | 3300035119 | Bacteria | 2712 |
| 755 | Ga0373957_0010902 | 3300035120 | Bacteria | 3019 |
| 756 | Ga0373943_0004090 | 3300035170 | Bacteria | 6623 |
| 757 | Ga0373943_0004457 | 3300035170 | Bacteria | 6339 |
| 758 | Ga0373946_0019189 | 3300035171 | Bacteria | 2633 |
| 759 | Ga0373931_0130953 | 3300035691 | Bacteria | 1444 |
| 760 | Ga0373935_0017872 | 3300035692 | Bacteria | 4308 |
| 761 | Ga0373935_0048671 | 3300035692 | Bacteria | 2684 |
| 762 | Ga0373935_0069199 | 3300035692 | Bacteria | 2273 |
| 763 | Ga0373935_0073556 | 3300035692 | Bacteria | 2208 |
| 764 | Ga0373927_0009262 | 3300035695 | Bacteria | 6604 |
| 765 | Ga0373927_0010401 | 3300035695 | Bacteria | 6207 |
| 766 | Ga0373927_0067048 | 3300035695 | Bacteria | 2322 |
| 767 | Ga0373933_0052787 | 3300035724 | Bacteria | 2433 |
| 768 | Ga0373947_0018280 | 3300035725 | Bacteria | 4034 |
| 769 | Ga0373947_0115911 | 3300035725 | Bacteria | 1698 |
| 770 | Ga0373937_0073389 | 3300036401 | Bacteria | 3157 |
| 771 | Ga0373937_0096628 | 3300036401 | Bacteria | 2740 |
| 772 | Ga0373925_0021067 | 3300037068 | Bacteria | 4749 |
| 773 | Ga0373925_0030730 | 3300037068 | Bacteria | 3943 |
| 774 | Ga0373925_0032915 | 3300037068 | Bacteria | 3818 |
| 775 | Ga0373925_0155395 | 3300037068 | Bacteria | 1799 |
| 776 | Ga0395899_0002908 | 3300037312 | Bacteria | 13761 |
| 777 | Ga0395900_0044462 | 3300037418 | Bacteria | 4576 |
| 778 | Ga0395905_0041886 | 3300037471 | Bacteria | 4297 |
| 779 | Ga0395905_0080961 | 3300037471 | Bacteria | 3043 |
| 780 | Ga0395905_0116788 | 3300037471 | Bacteria | 2508 |
| 781 | Ga0395901_0044397 | 3300038443 | Bacteria | 4610 |
| 782 | Ga0436365_1320810 | 3300039437 | Bacteria | 2106 |
| 783 | Ga0439466_0003499 | 3300041411 | Bacteria | 6080 |
| 784 | Ga0439465_0000906 | 3300041413 | Bacteria | 9383 |
| 785 | Ga0451804_0459646 | 3300041463 | Bacteria | 2168 |
| 786 | Ga0439431_0017028 | 3300041997 | Bacteria | 1705 |
| 787 | Ga0439433_0002551 | 3300041999 | Bacteria | 3866 |
| 788 | Ga0439441_003356 | 3300042001 | Bacteria | 2355 |
| 789 | Ga0439432_001993 | 3300042006 | Bacteria | 7725 |
| 790 | Ga0439432_028886 | 3300042006 | Bacteria | 1805 |
| 791 | Ga0439449_0009165 | 3300042007 | Bacteria | 3750 |
| 792 | Ga0439452_006599 | 3300042010 | Bacteria | 3623 |
| 793 | Ga0439457_001803 | 3300042014 | Bacteria | 6323 |
| 794 | Ga0439462_0003738 | 3300042015 | Bacteria | 3671 |
| 795 | Ga0450919_001126 | 3300042121 | Bacteria | 3466 |
| 796 | Ga0450919_005256 | 3300042121 | Bacteria | 1561 |
| 797 | Ga0450898_017655 | 3300042134 | Bacteria | 1229 |
| 798 | Ga0439464_0002509 | 3300042439 | Bacteria | 4526 |
| 799 | Ga0450918_000031 | 3300042531 | Bacteria | 28580 |
| 800 | Ga0451577_0004664 | 3300042876 | Bacteria | 14392 |
| 801 | Ga0451577_0005819 | 3300042876 | Bacteria | 12483 |
| 802 | Ga0451577_0009097 | 3300042876 | Bacteria | 9586 |
| 803 | Ga0451577_0017515 | 3300042876 | Bacteria | 6618 |
| 804 | Ga0451577_0053684 | 3300042876 | Bacteria | 3597 |
| 805 | Ga0451577_0105405 | 3300042876 | Bacteria | 2520 |
| 806 | Ga0451577_0167861 | 3300042876 | Bacteria | 1977 |
| 807 | Ga0466965_0020374 | 3300044683 | Bacteria | 3187 |
| 808 | Ga0466961_0089476 | 3300044693 | Bacteria | 1944 |
| 809 | Ga0453684_0189876 | 3300044712 | Bacteria | 2404 |
| 810 | Ga0466957_0015102 | 3300044842 | Bacteria | 4507 |
| 811 | Ga0466957_0017998 | 3300044842 | Bacteria | 4144 |
| 812 | Ga0466957_0224568 | 3300044842 | Bacteria | 1241 |
| 813 | Ga0451576_0000140 | 3300045051 | Bacteria | 183279 |
| 814 | Ga0451576_0018448 | 3300045051 | Bacteria | 7648 |
| 815 | Ga0451576_0033233 | 3300045051 | Bacteria | 5483 |
| 816 | Ga0451576_0270087 | 3300045051 | Bacteria | 1778 |
| 817 | Ga0495627_004268 | 3300046453 | Bacteria | 6029 |
| 818 | Ga0495592_0000727 | 3300046454 | Bacteria | 23029 |
| 819 | Ga0495592_0061687 | 3300046454 | Bacteria | 2755 |
| 820 | Ga0495603_0015743 | 3300046455 | Bacteria | 4573 |
| 821 | Ga0495629_0031121 | 3300046459 | Bacteria | 3779 |
| 822 | Ga0495629_0241769 | 3300046459 | Bacteria | 1243 |
| 823 | Ga0495638_0086632 | 3300046460 | Bacteria | 1893 |
| 824 | Ga0495641_0045333 | 3300046461 | Bacteria | 2025 |
| 825 | Ga0495651_0050662 | 3300046462 | Bacteria | 3203 |
| 826 | Ga0495651_0175100 | 3300046462 | Bacteria | 1524 |
| 827 | Ga0495653_0056762 | 3300046463 | Bacteria | 2983 |
| 828 | Ga0495650_0072544 | 3300046471 | Bacteria | 1347 |
| 829 | Ga0495639_0016075 | 3300046475 | Bacteria | 3246 |
| 830 | Ga0495584_0059497 | 3300046491 | Bacteria | 1921 |
| 831 | Ga0495585_0077745 | 3300046492 | Bacteria | 1801 |
| 832 | Ga0495585_0098914 | 3300046492 | Bacteria | 1562 |
| 833 | Ga0495606_0002171 | 3300046507 | Bacteria | 23603 |
| 834 | Ga0495610_0056390 | 3300046512 | Bacteria | 1889 |
| 835 | Ga0495620_0017826 | 3300046515 | Bacteria | 3530 |
| 836 | Ga0495620_0053935 | 3300046515 | Bacteria | 1701 |
| 837 | Ga0495630_0030549 | 3300046517 | Bacteria | 4009 |
| 838 | Ga0495630_0056112 | 3300046517 | Bacteria | 2952 |
| 839 | Ga0495632_0001754 | 3300046519 | Bacteria | 17540 |
| 840 | Ga0495637_0049391 | 3300046520 | Bacteria | 1768 |
| 841 | Ga0495652_0157146 | 3300046529 | Bacteria | 1769 |
| 842 | Ga0495665_0009292 | 3300046531 | Bacteria | 5324 |
| 843 | Ga0495665_0065868 | 3300046531 | Bacteria | 1912 |
| 844 | Ga0495586_0004128 | 3300046535 | Bacteria | 7782 |
| 845 | Ga0495587_0003976 | 3300046536 | Bacteria | 9802 |
| 846 | Ga0495587_0143699 | 3300046536 | Bacteria | 1361 |
| 847 | Ga0495598_0006159 | 3300046537 | Bacteria | 2697 |
| 848 | Ga0495621_0063185 | 3300046539 | Bacteria | 1348 |
| 849 | Ga0495621_0110149 | 3300046539 | Bacteria | 1055 |
| 850 | Ga0495645_0000502 | 3300046543 | Bacteria | 27029 |
| 851 | Ga0495667_0051856 | 3300046559 | Bacteria | 2705 |
| 852 | Ga0495625_0002019 | 3300046660 | Bacteria | 22847 |
| 853 | Ga0495625_0058844 | 3300046660 | Bacteria | 2728 |
| 854 | Ga0495635_0048111 | 3300046663 | Bacteria | 2940 |
| 855 | Ga0495588_0005471 | 3300046674 | Bacteria | 5654 |
| 856 | Ga0495588_0021515 | 3300046674 | Bacteria | 3178 |
| 857 | Ga0495588_0108957 | 3300046674 | Bacteria | 1458 |
| 858 | Ga0495599_0003122 | 3300046678 | Bacteria | 9655 |
| 859 | Ga0495647_0010668 | 3300046681 | Bacteria | 3132 |
| 860 | Ga0495658_0001264 | 3300046683 | Bacteria | 13289 |
| 861 | Ga0495658_0034976 | 3300046683 | Bacteria | 2760 |
| 862 | Ga0495658_0082219 | 3300046683 | Bacteria | 1892 |
| 863 | Ga0495613_0026742 | 3300046689 | Bacteria | 4297 |
| 864 | Ga0495671_0009477 | 3300046692 | Bacteria | 5439 |
| 865 | Ga0495581_0000535 | 3300047315 | Bacteria | 19542 |
| 866 | Ga0495581_0025443 | 3300047315 | Bacteria | 3432 |
| 867 | Ga0495604_0169307 | 3300047317 | Bacteria | 1538 |
| 868 | Ga0495672_0040687 | 3300047320 | Bacteria | 2816 |
| 869 | Ga0495676_0058042 | 3300047321 | Bacteria | 3048 |
| 870 | Ga0495676_0104765 | 3300047321 | Bacteria | 2086 |
| 871 | Ga0495680_0053268 | 3300047322 | Bacteria | 3150 |
| 872 | Ga0495683_0082180 | 3300047323 | Bacteria | 1570 |
| 873 | Ga0495687_031562 | 3300047443 | Bacteria | 2429 |
| 874 | Ga0495684_0006061 | 3300047471 | Bacteria | 9398 |
| 875 | Ga0495686_0005215 | 3300047472 | Bacteria | 10332 |
| 876 | Ga0495686_0100679 | 3300047472 | Bacteria | 1743 |
| 877 | Ga0495593_0042464 | 3300047673 | Bacteria | 2440 |
| 878 | Ga0495602_0077123 | 3300048088 | Bacteria | 2821 |
| 879 | Ga0496100_0020338 | 3300048903 | Bacteria | 3978 |
| 880 | Ga0496100_0150311 | 3300048903 | Bacteria | 1660 |
| 881 | Ga0496102_0007689 | 3300048905 | Bacteria | 9207 |
| 882 | Ga0496102_0009712 | 3300048905 | Bacteria | 8273 |
| 883 | Ga0496104_0004440 | 3300048907 | Bacteria | 12216 |
| 884 | Ga0496104_0534702 | 3300048907 | Bacteria | 1083 |
| 885 | Ga0496105_0152338 | 3300048908 | Bacteria | 1900 |
| 886 | Ga0496106_0064186 | 3300048909 | Bacteria | 2793 |
| 887 | Ga0496106_0141271 | 3300048909 | Bacteria | 1894 |
| 888 | Ga0496107_0091925 | 3300048910 | Bacteria | 2218 |
| 889 | Ga0496107_0260501 | 3300048910 | Bacteria | 1290 |
| 890 | Ga0496108_0119966 | 3300048911 | Bacteria | 2255 |
| 891 | Ga0496108_0417478 | 3300048911 | Bacteria | 1172 |
| 892 | Ga0496109_0103560 | 3300048912 | Bacteria | 2642 |
| 893 | Ga0496109_0104568 | 3300048912 | Bacteria | 2629 |
| 894 | Ga0496111_0211874 | 3300048914 | Bacteria | 1439 |
| 895 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 896 | Ga0496112_0004395 | 3300048915 | Bacteria | 11926 |
| 897 | Ga0496112_0133017 | 3300048915 | Bacteria | 2458 |
| 898 | Ga0496113_0299682 | 3300048916 | Bacteria | 1287 |
| 899 | Ga0496114_0033642 | 3300048917 | Bacteria | 4225 |
| 900 | Ga0496114_0209093 | 3300048917 | Bacteria | 1711 |
| 901 | Ga0496118_0005318 | 3300048921 | Bacteria | 14673 |
| 902 | Ga0496119_0131216 | 3300048922 | Bacteria | 1365 |
| 903 | Ga0496121_0027380 | 3300048924 | Bacteria | 5335 |
| 904 | Ga0496121_0085596 | 3300048924 | Bacteria | 2481 |
| 905 | Ga0496123_0067475 | 3300048926 | Bacteria | 2259 |
| 906 | Ga0496124_0075596 | 3300048927 | Bacteria | 2782 |
| 907 | Ga0496125_0027763 | 3300048928 | Bacteria | 5123 |
| 908 | Ga0496125_0100358 | 3300048928 | Bacteria | 2134 |
| 909 | Ga0501310_004251 | 3300049130 | Bacteria | 1432 |
| 910 | Ga0501317_001111 | 3300049533 | Bacteria | 2223 |
| 911 | Ga0501031_0015585 | 3300049568 | Bacteria | 4935 |
| 912 | Ga0501034_0005172 | 3300049571 | Bacteria | 14310 |
| 913 | Ga0501034_0018257 | 3300049571 | Bacteria | 7195 |
| 914 | Ga0501036_0014495 | 3300049572 | Bacteria | 6565 |
| 915 | Ga0501038_0102733 | 3300049574 | Bacteria | 2378 |
| 916 | Ga0501039_0022016 | 3300049575 | Bacteria | 4891 |
| 917 | Ga0501040_0039666 | 3300049576 | Bacteria | 3203 |
| 918 | Ga0501041_0032509 | 3300049577 | Bacteria | 3153 |
| 919 | Ga0501042_0102626 | 3300049578 | Bacteria | 2057 |
| 920 | Ga0501043_0034397 | 3300049579 | Bacteria | 3986 |
| 921 | Ga0501046_0068872 | 3300049580 | Bacteria | 2754 |
| 922 | Ga0501046_0093936 | 3300049580 | Bacteria | 2305 |
| 923 | Ga0501047_0044468 | 3300049581 | Bacteria | 4291 |
| 924 | Ga0501048_0005866 | 3300049582 | Bacteria | 9345 |
| 925 | Ga0501067_0003121 | 3300049583 | Bacteria | 9152 |
| 926 | Ga0501067_0098000 | 3300049583 | Bacteria | 1629 |
| 927 | Ga0501068_0317204 | 3300049584 | Bacteria | 999 |
| 928 | Ga0501069_0099739 | 3300049585 | Bacteria | 1648 |
| 929 | Ga0501069_0266890 | 3300049585 | Bacteria | 1000 |
| 930 | Ga0501070_0001451 | 3300049586 | Bacteria | 21195 |
| 931 | Ga0501072_0029027 | 3300049588 | Bacteria | 4317 |
| 932 | Ga0501072_0030219 | 3300049588 | Bacteria | 4236 |
| 933 | Ga0501072_0049620 | 3300049588 | Bacteria | 3304 |
| 934 | Ga0501072_0097100 | 3300049588 | Bacteria | 2342 |
| 935 | Ga0501073_0008058 | 3300049589 | Bacteria | 7817 |
| 936 | Ga0501074_0062953 | 3300049590 | Bacteria | 2672 |
| 937 | Ga0501076_0221425 | 3300049592 | Bacteria | 1546 |
| 938 | Ga0501077_0009547 | 3300049593 | Bacteria | 6033 |
| 939 | Ga0501249_005845 | 3300049679 | Bacteria | 2516 |
| 940 | Ga0501079_0113768 | 3300049741 | Bacteria | 2104 |
| 941 | Ga0501080_0015826 | 3300049742 | Bacteria | 6959 |
| 942 | Ga0501080_0068473 | 3300049742 | Bacteria | 3302 |
| 943 | Ga0501080_0072595 | 3300049742 | Bacteria | 3202 |
| 944 | Ga0501080_0089937 | 3300049742 | Bacteria | 2852 |
| 945 | Ga0501080_0228827 | 3300049742 | Bacteria | 1700 |
| 946 | Ga0501081_0104384 | 3300049743 | Bacteria | 2006 |
| 947 | Ga0501083_0004010 | 3300049744 | Bacteria | 10347 |
| 948 | Ga0501241_019332 | 3300049758 | Bacteria | 1250 |
| 949 | Ga0501262_000180 | 3300049759 | Bacteria | 7858 |
| 950 | Ga0501035_0108325 | 3300049822 | Bacteria | 2436 |
| 951 | Ga0501044_0374879 | 3300049823 | Bacteria | 1339 |
| 952 | Ga0501045_0007316 | 3300049824 | Bacteria | 7671 |
| 953 | nmdc:mga03683_10404_c1 | 3300050489 | Bacteria | 3336 |
| 954 | nmdc:mga03683_32556_c1 | 3300050489 | Bacteria | 2098 |
| 955 | nmdc:mga03683_662_c1 | 3300050489 | Bacteria | 9889 |
| 956 | nmdc:mga03n38_21320_c1 | 3300050490 | Bacteria | 2606 |
| 957 | nmdc:mga03n38_66667_c1 | 3300050490 | Bacteria | 1654 |
| 958 | nmdc:mga00v17_86221_c1 | 3300050491 | Bacteria | 1967 |
| 959 | nmdc:mga0yw44_22504_c1 | 3300050492 | Bacteria | 3536 |
| 960 | nmdc:mga0yw44_73945_c1 | 3300050492 | Bacteria | 2122 |
| 961 | nmdc:mga0k408_188809_c1 | 3300050493 | Bacteria | 1229 |
| 962 | nmdc:mga0k408_19883_c1 | 3300050493 | Bacteria | 3759 |
| 963 | nmdc:mga0k408_20741_c1 | 3300050493 | Bacteria | 3686 |
| 964 | nmdc:mga0k408_28504_c1 | 3300050493 | Bacteria | 3175 |
| 965 | nmdc:mga0k408_30386_c1 | 3300050493 | Bacteria | 3080 |
| 966 | nmdc:mga0k408_5223_c1 | 3300050493 | Bacteria | 6891 |
| 967 | nmdc:mga0k408_6810_c1 | 3300050493 | Bacteria | 6093 |
| 968 | nmdc:mga0k408_8004_c1 | 3300050493 | Bacteria | 5667 |
| 969 | nmdc:mga0k408_8592_c1 | 3300050493 | Bacteria | 5487 |
| 970 | nmdc:mga0k408_9014_c1 | 3300050493 | Bacteria | 5370 |
| 971 | nmdc:mga06z11_192751_c1 | 3300050494 | Bacteria | 1180 |
| 972 | nmdc:mga06z11_42153_c1 | 3300050494 | Bacteria | 2288 |
| 973 | nmdc:mga06z11_91772_c1 | 3300050494 | Bacteria | 1650 |
| 974 | nmdc:mga04h51_16886_c1 | 3300050495 | Bacteria | 2125 |
| 975 | nmdc:mga07m45_22715_c1 | 3300050496 | Bacteria | 3427 |
| 976 | nmdc:mga07m45_5517_c1 | 3300050496 | Bacteria | 6304 |
| 977 | nmdc:mga07m45_63905_c1 | 3300050496 | Bacteria | 2088 |
| 978 | nmdc:mga07m45_71156_c1 | 3300050496 | Bacteria | 1979 |
| 979 | nmdc:mga07m45_80719_c1 | 3300050496 | Bacteria | 1364 |
| 980 | nmdc:mga05p37_165287_c1 | 3300050507 | Bacteria | 2701 |
| 981 | nmdc:mga05p37_302592_c1 | 3300050507 | Bacteria | 1899 |
| 982 | nmdc:mga05p37_368_c1 | 3300050507 | Bacteria | 48338 |
| 983 | nmdc:mga05p37_5315_c1 | 3300050507 | Bacteria | 15118 |
| 984 | nmdc:mga09592_1120_c1 | 3300050508 | Bacteria | 21354 |
| 985 | nmdc:mga09592_1504_c1 | 3300050508 | Bacteria | 18770 |
| 986 | nmdc:mga09592_301_c1 | 3300050508 | Bacteria | 35907 |
| 987 | nmdc:mga09592_8084_c1 | 3300050508 | Bacteria | 8556 |
| 988 | nmdc:mga0qj67_158070_c1 | 3300050509 | Bacteria | 1840 |
| 989 | nmdc:mga0qj67_288881_c1 | 3300050509 | Bacteria | 1329 |
| 990 | nmdc:mga0qj67_34644_c1 | 3300050509 | Bacteria | 3945 |
| 991 | nmdc:mga0qj67_41135_c1 | 3300050509 | Bacteria | 3634 |
| 992 | nmdc:mga06r32_1761_c1 | 3300050510 | Bacteria | 19420 |
| 993 | nmdc:mga06r32_31271_c1 | 3300050510 | Bacteria | 4998 |
| 994 | nmdc:mga08y16_107_c1 | 3300050511 | Bacteria | 69847 |
| 995 | nmdc:mga08y16_217587_c1 | 3300050511 | Bacteria | 1978 |
| 996 | nmdc:mga08y16_3339_c1 | 3300050511 | Bacteria | 16624 |
| 997 | nmdc:mga08y16_354984_c1 | 3300050511 | Bacteria | 1505 |
| 998 | nmdc:mga08y16_9580_c1 | 3300050511 | Bacteria | 10168 |
| 999 | nmdc:mga0n895_105446_c1 | 3300050512 | Bacteria | 2831 |
| 1000 | nmdc:mga0n895_45054_c1 | 3300050512 | Bacteria | 4303 |
| 1001 | nmdc:mga0rr50_223902_c1 | 3300050513 | Bacteria | 1554 |
| 1002 | nmdc:mga08x19_2660_c1 | 3300050514 | Bacteria | 10809 |
| 1003 | nmdc:mga08x19_87726_c1 | 3300050514 | Bacteria | 2050 |
| 1004 | nmdc:mga0sz30_15_c1 | 3300050516 | Bacteria | 83405 |
| 1005 | Ga0495601_0006136 | 3300053077 | Bacteria | 7009 |
| 1006 | Ga0495619_0007995 | 3300053085 | Bacteria | 6693 |
| 1007 | Ga0495619_0044597 | 3300053085 | Bacteria | 2911 |
| 1008 | Ga0500578_0000393 | 3300053086 | Bacteria | 53719 |
| 1009 | Ga0500644_0008964 | 3300053088 | Bacteria | 2659 |
| 1010 | Ga0500581_076119 | 3300053089 | Bacteria | 1683 |
| 1011 | Ga0500583_0041918 | 3300053092 | Bacteria | 2083 |
| 1012 | Ga0500583_0075229 | 3300053092 | Bacteria | 1622 |
| 1013 | Ga0500651_0012079 | 3300053093 | Bacteria | 5223 |
| 1014 | Ga0500641_0038517 | 3300053096 | Bacteria | 1921 |
| 1015 | Ga0500562_028862 | 3300053108 | Bacteria | 1459 |
| 1016 | Ga0500593_000388 | 3300053117 | Bacteria | 17529 |
| 1017 | Ga0500595_009117 | 3300053119 | Bacteria | 4023 |
| 1018 | Ga0500617_075941 | 3300053124 | Bacteria | 1464 |
| 1019 | Ga0500628_001546 | 3300053129 | Bacteria | 3916 |
| 1020 | Ga0500652_001779 | 3300053131 | Bacteria | 6527 |
| 1021 | Ga0500655_006375 | 3300053133 | Bacteria | 2124 |
| 1022 | Ga0500568_0013120 | 3300053139 | Bacteria | 3786 |
| 1023 | Ga0500568_0014416 | 3300053139 | Bacteria | 3570 |
| 1024 | Ga0500568_0018255 | 3300053139 | Bacteria | 3074 |
| 1025 | Ga0500568_0019136 | 3300053139 | Bacteria | 2982 |
| 1026 | Ga0500589_070532 | 3300053147 | Bacteria | 1581 |
| 1027 | Ga0500604_0015432 | 3300053151 | Bacteria | 2092 |
| 1028 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1029 | Ga0500622_0000232 | 3300053156 | Bacteria | 57941 |
| 1030 | Ga0500627_0000792 | 3300053158 | Bacteria | 8417 |
| 1031 | Ga0500645_000228 | 3300053730 | Bacteria | 42875 |
| 1032 | Ga0500645_011086 | 3300053730 | Bacteria | 2955 |
| 1033 | Ga0501084_0060052 | 3300054114 | Bacteria | 3183 |
| 1034 | Ga0501084_0145259 | 3300054114 | Bacteria | 1998 |
| 1035 | Ga0501084_0231389 | 3300054114 | Bacteria | 1560 |
| 1036 | Ga0590071_021107 | 3300059421 | Bacteria | 1535 |
| 1037 | Ga0587077_015577 | 3300059493 | Bacteria | 1268 |
| 1038 | Ga0587083_0007514 | 3300059505 | Bacteria | 1672 |
| 1039 | Ga0587085_003754 | 3300059506 | Bacteria | 1680 |
| 1040 | Ga0587086_007587 | 3300059507 | Bacteria | 1246 |
| 1041 | Ga0587088_017683 | 3300059508 | Bacteria | 1151 |
| 1042 | Ga0587109_011735 | 3300059624 | Bacteria | 1422 |
| 1043 | Ga0587067_019455 | 3300059640 | Bacteria | 1151 |
| 1044 | Ga0587072_021118 | 3300059643 | Bacteria | 1153 |
| 1045 | Ga0587078_004027 | 3300059646 | Bacteria | 1523 |
| 1046 | Ga0587079_013693 | 3300059647 | Bacteria | 1348 |
| 1047 | Ga0587102_003400 | 3300059649 | Bacteria | 1293 |
| 1048 | Ga0501082_0077066 | 3300060353 | Bacteria | 2874 |
| 1049 | Ga0530510_0041648 | 3300061734 | Bacteria | 3316 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046539 | Ga0495621_0110149 | Ga0495621_0110149_14_829 | 271 |
| 2 | 3300041463 | Ga0451804_0459646 | Ga0451804_0459646_21_881 | 286 |
| 3 | 3300049579 | Ga0501043_0034397 | Ga0501043_0034397_3111_3974 | 287 |
| 4 | 3300049584 | Ga0501068_0317204 | Ga0501068_0317204_116_979 | 287 |
| 5 | 3300053133 | Ga0500655_006375 | Ga0500655_006375_1177_2082 | 301 |
| 6 | 3300053085 | Ga0495619_0044597 | Ga0495619_0044597_1987_2895 | 302 |
| 7 | 3300004803 | Ga0058862_12772269 | Ga0058862_127722692 | 305 |
| 8 | 3300005458 | Ga0070681_10105197 | Ga0070681_101051971 | 305 |
| 9 | 3300005530 | Ga0070679_100035432 | Ga0070679_1000354323 | 305 |
| 10 | 3300013104 | Ga0157370_10081869 | Ga0157370_100818692 | 305 |
| 11 | 3300020069 | Ga0197907_10590190 | Ga0197907_105901901 | 305 |
| 12 | 3300020078 | Ga0206352_11255281 | Ga0206352_112552811 | 305 |
| 13 | 3300025917 | Ga0207660_10190659 | Ga0207660_101906592 | 305 |
| 14 | 3300025921 | Ga0207652_10221164 | Ga0207652_102211642 | 305 |
| 15 | 3300049588 | Ga0501072_0097100 | Ga0501072_0097100_727_1701 | 305 |
| 16 | 3300006195 | Ga0075366_10053401 | Ga0075366_100534011 | 308 |
| 17 | 3300042134 | Ga0450898_017655 | Ga0450898_017655_87_1097 | 309 |
| 18 | 3300005347 | Ga0070668_100081328 | Ga0070668_1000813281 | 310 |
| 19 | 3300005353 | Ga0070669_100030223 | Ga0070669_1000302234 | 310 |
| 20 | 3300005459 | Ga0068867_100002021 | Ga0068867_1000020215 | 310 |
| 21 | 3300005543 | Ga0070672_100091843 | Ga0070672_1000918433 | 310 |
| 22 | 3300005617 | Ga0068859_100046715 | Ga0068859_1000467153 | 310 |
| 23 | 3300005718 | Ga0068866_10061450 | Ga0068866_100614502 | 310 |
| 24 | 3300005843 | Ga0068860_100003477 | Ga0068860_1000034775 | 310 |
| 25 | 3300006881 | Ga0068865_100007125 | Ga0068865_1000071255 | 310 |
| 26 | 3300006931 | Ga0097620_100046715 | Ga0097620_1000467153 | 310 |
| 27 | 3300013296 | Ga0157374_10028606 | Ga0157374_100286064 | 310 |
| 28 | 3300013297 | Ga0157378_10061851 | Ga0157378_100618513 | 310 |
| 29 | 3300025919 | Ga0207657_10233343 | Ga0207657_102333431 | 310 |
| 30 | 3300025923 | Ga0207681_10022061 | Ga0207681_100220614 | 310 |
| 31 | 3300025931 | Ga0207644_10120624 | Ga0207644_101206241 | 310 |
| 32 | 3300025937 | Ga0207669_10010756 | Ga0207669_100107563 | 310 |
| 33 | 3300025938 | Ga0207704_10188533 | Ga0207704_101885331 | 310 |
| 34 | 3300025940 | Ga0207691_10049988 | Ga0207691_100499883 | 310 |
| 35 | 3300025972 | Ga0207668_10053142 | Ga0207668_100531421 | 310 |
| 36 | 3300026089 | Ga0207648_10001364 | Ga0207648_1000136419 | 310 |
| 37 | 3300026118 | Ga0207675_100002430 | Ga0207675_10000243016 | 310 |
| 38 | 3300028380 | Ga0268265_10003395 | Ga0268265_100033957 | 310 |
| 39 | 3300028381 | Ga0268264_10079331 | Ga0268264_100793311 | 310 |
| 40 | 3300037312 | Ga0395899_0002908 | Ga0395899_0002908_2203_3180 | 310 |
| 41 | 3300042876 | Ga0451577_0009097 | Ga0451577_0009097_1346_2401 | 310 |
| 42 | 3300045051 | Ga0451576_0000140 | Ga0451576_0000140_142256_143251 | 310 |
| 43 | 3300045051 | Ga0451576_0018448 | Ga0451576_0018448_557_1612 | 310 |
| 44 | 3300045051 | Ga0451576_0033233 | Ga0451576_0033233_3055_4044 | 310 |
| 45 | 3300048905 | Ga0496102_0009712 | Ga0496102_0009712_6089_7048 | 310 |
| 46 | 3300050507 | nmdc:mga05p37_5315_c1 | nmdc:mga05p37_5315_c1_4645_5622 | 310 |
| 47 | 3300050508 | nmdc:mga09592_301_c1 | nmdc:mga09592_301_c1_33145_34122 | 310 |
| 48 | 3300050510 | nmdc:mga06r32_31271_c1 | nmdc:mga06r32_31271_c1_2261_3238 | 310 |
| 49 | iso_pu_bacteria | 2643221644 | 2644247463 | 310 |
| 50 | iso_pu_bacteria | 2844533157 | 2844539191 | 310 |
| 51 | 3300005295 | Ga0065707_10096561 | Ga0065707_100965611 | 311 |
| 52 | 3300005344 | Ga0070661_100000474 | Ga0070661_10000047429 | 311 |
| 53 | 3300005344 | Ga0070661_100006617 | Ga0070661_1000066173 | 311 |
| 54 | 3300005366 | Ga0070659_100001233 | Ga0070659_10000123311 | 311 |
| 55 | 3300005458 | Ga0070681_10002448 | Ga0070681_1000244813 | 311 |
| 56 | 3300005458 | Ga0070681_10040960 | Ga0070681_100409604 | 311 |
| 57 | 3300005530 | Ga0070679_100007265 | Ga0070679_1000072656 | 311 |
| 58 | 3300005539 | Ga0068853_100012954 | Ga0068853_1000129543 | 311 |
| 59 | 3300005564 | Ga0070664_100001851 | Ga0070664_1000018512 | 311 |
| 60 | 3300005577 | Ga0068857_100205610 | Ga0068857_1002056102 | 311 |
| 61 | 3300009094 | Ga0111539_10217210 | Ga0111539_102172102 | 311 |
| 62 | 3300013104 | Ga0157370_10163736 | Ga0157370_101637362 | 311 |
| 63 | 3300025912 | Ga0207707_10158081 | Ga0207707_101580812 | 311 |
| 64 | 3300025920 | Ga0207649_10006855 | Ga0207649_100068552 | 311 |
| 65 | 3300025920 | Ga0207649_10021160 | Ga0207649_100211601 | 311 |
| 66 | 3300025921 | Ga0207652_10029293 | Ga0207652_100292932 | 311 |
| 67 | 3300025932 | Ga0207690_10000538 | Ga0207690_100005387 | 311 |
| 68 | 3300025945 | Ga0207679_10000542 | Ga0207679_1000054219 | 311 |
| 69 | 3300028794 | Ga0307515_10087565 | Ga0307515_100875653 | 311 |
| 70 | 3300042006 | Ga0439432_028886 | Ga0439432_028886_820_1791 | 311 |
| 71 | 3300048909 | Ga0496106_0064186 | Ga0496106_0064186_1088_2077 | 311 |
| 72 | 3300050491 | nmdc:mga00v17_86221_c1 | nmdc:mga00v17_86221_c1_930_1892 | 311 |
| 73 | 3300050492 | nmdc:mga0yw44_73945_c1 | nmdc:mga0yw44_73945_c1_159_1130 | 311 |
| 74 | 3300050493 | nmdc:mga0k408_20741_c1 | nmdc:mga0k408_20741_c1_1742_2713 | 311 |
| 75 | 3300050493 | nmdc:mga0k408_30386_c1 | nmdc:mga0k408_30386_c1_926_1897 | 311 |
| 76 | 3300050495 | nmdc:mga04h51_16886_c1 | nmdc:mga04h51_16886_c1_328_1299 | 311 |
| 77 | 3300050516 | nmdc:mga0sz30_15_c1 | nmdc:mga0sz30_15_c1_60406_61377 | 311 |
| 78 | iso_pu_bacteria | 2513237092 | 2513622852 | 311 |
| 79 | iso_pu_bacteria | 2513237161 | 2514009646 | 311 |
| 80 | iso_pu_bacteria | 2585428057 | 2587729065 | 311 |
| 81 | iso_pu_bacteria | 2585428058 | 2587733636 | 311 |
| 82 | iso_pu_bacteria | 2588253510 | 2588294028 | 311 |
| 83 | iso_pu_bacteria | 2617270741 | 2617372497 | 311 |
| 84 | iso_pu_bacteria | 2643221592 | 2643967131 | 311 |
| 85 | iso_pu_bacteria | 2643221625 | 2644139961 | 311 |
| 86 | iso_pu_bacteria | 2643221648 | 2644271201 | 311 |
| 87 | iso_pu_bacteria | 2643221660 | 2644337365 | 311 |
| 88 | iso_pu_bacteria | 2824671348 | 2824675020 | 311 |
| 89 | iso_pu_bacteria | 2824687955 | 2824693357 | 311 |
| 90 | iso_pu_bacteria | 2824746037 | 2824747067 | 311 |
| 91 | iso_pu_bacteria | 2838122688 | 2838122876 | 311 |
| 92 | iso_pu_bacteria | 2841941048 | 2841944836 | 311 |
| 93 | iso_pu_bacteria | 2841966195 | 2841973687 | 311 |
| 94 | iso_pu_bacteria | 2841974524 | 2841978581 | 311 |
| 95 | iso_pu_bacteria | 2841983080 | 2841988943 | 311 |
| 96 | iso_pu_bacteria | 2885366525 | 2885369687 | 311 |
| 97 | iso_pu_bacteria | 2908775508 | 2908780949 | 311 |
| 98 | iso_pu_bacteria | 3005483717 | 3005484991 | 311 |
| 99 | iso_pu_bacteria | 3005587118 | 3005587267 | 311 |
| 100 | 3300002773 | JGI25152J39213_1003264 | JGI25152J39213_10032645 | 312 |
| 101 | 3300003215 | JGI25153J46596_10002000 | JGI25153J46596_100020007 | 312 |
| 102 | 3300003771 | Ga0055526_1001374 | Ga0055526_100137416 | 312 |
| 103 | 3300004799 | Ga0058863_10003707 | Ga0058863_100037071 | 312 |
| 104 | 3300005355 | Ga0070671_100003012 | Ga0070671_10000301210 | 312 |
| 105 | 3300005356 | Ga0070674_100139106 | Ga0070674_1001391062 | 312 |
| 106 | 3300005456 | Ga0070678_100331502 | Ga0070678_1003315021 | 312 |
| 107 | 3300005458 | Ga0070681_10405605 | Ga0070681_104056051 | 312 |
| 108 | 3300005543 | Ga0070672_100056572 | Ga0070672_1000565722 | 312 |
| 109 | 3300005937 | Ga0081455_10007375 | Ga0081455_1000737510 | 312 |
| 110 | 3300006237 | Ga0097621_100105151 | Ga0097621_1001051513 | 312 |
| 111 | 3300006844 | Ga0075428_100077317 | Ga0075428_1000773172 | 312 |
| 112 | 3300006844 | Ga0075428_100160813 | Ga0075428_1001608133 | 312 |
| 113 | 3300006846 | Ga0075430_100022713 | Ga0075430_1000227134 | 312 |
| 114 | 3300006847 | Ga0075431_100018872 | Ga0075431_1000188725 | 312 |
| 115 | 3300009177 | Ga0105248_10035140 | Ga0105248_100351403 | 312 |
| 116 | 3300009177 | Ga0105248_10076968 | Ga0105248_100769684 | 312 |
| 117 | 3300013296 | Ga0157374_10155005 | Ga0157374_101550052 | 312 |
| 118 | 3300020070 | Ga0206356_10165203 | Ga0206356_101652031 | 312 |
| 119 | 3300020078 | Ga0206352_11269377 | Ga0206352_112693772 | 312 |
| 120 | 3300020082 | Ga0206353_11895588 | Ga0206353_118955882 | 312 |
| 121 | 3300025245 | Ga0207425_1000598 | Ga0207425_100059820 | 312 |
| 122 | 3300025258 | Ga0209129_1000038 | Ga0209129_1000038180 | 312 |
| 123 | 3300025263 | Ga0209565_1006285 | Ga0209565_10062852 | 312 |
| 124 | 3300025273 | Ga0209673_1013792 | Ga0209673_10137923 | 312 |
| 125 | 3300025295 | Ga0209564_1000129 | Ga0209564_10001297 | 312 |
| 126 | 3300025297 | Ga0209758_1000197 | Ga0209758_10001977 | 312 |
| 127 | 3300025912 | Ga0207707_10053222 | Ga0207707_100532222 | 312 |
| 128 | 3300025925 | Ga0207650_10030088 | Ga0207650_100300882 | 312 |
| 129 | 3300025925 | Ga0207650_10359410 | Ga0207650_103594102 | 312 |
| 130 | 3300025931 | Ga0207644_10011121 | Ga0207644_100111214 | 312 |
| 131 | 3300025937 | Ga0207669_10051238 | Ga0207669_100512383 | 312 |
| 132 | 3300025940 | Ga0207691_10057620 | Ga0207691_100576203 | 312 |
| 133 | 3300026095 | Ga0207676_10044753 | Ga0207676_100447533 | 312 |
| 134 | 3300026121 | Ga0207683_10014682 | Ga0207683_100146824 | 312 |
| 135 | 3300026121 | Ga0207683_10520179 | Ga0207683_105201791 | 312 |
| 136 | 3300026142 | Ga0207698_10208279 | Ga0207698_102082792 | 312 |
| 137 | 3300031911 | Ga0307412_10294608 | Ga0307412_102946082 | 312 |
| 138 | 3300035692 | Ga0373935_0069199 | Ga0373935_0069199_505_1503 | 312 |
| 139 | 3300042121 | Ga0450919_001126 | Ga0450919_001126_141_1142 | 312 |
| 140 | 3300042121 | Ga0450919_005256 | Ga0450919_005256_274_1242 | 312 |
| 141 | 3300042531 | Ga0450918_000031 | Ga0450918_000031_24114_25115 | 312 |
| 142 | 3300042876 | Ga0451577_0005819 | Ga0451577_0005819_4711_5718 | 312 |
| 143 | 3300046683 | Ga0495658_0034976 | Ga0495658_0034976_852_1850 | 312 |
| 144 | 3300048912 | Ga0496109_0103560 | Ga0496109_0103560_227_1225 | 312 |
| 145 | 3300049583 | Ga0501067_0098000 | Ga0501067_0098000_40_1053 | 312 |
| 146 | 3300050507 | nmdc:mga05p37_368_c1 | nmdc:mga05p37_368_c1_24292_25296 | 312 |
| 147 | 3300050510 | nmdc:mga06r32_1761_c1 | nmdc:mga06r32_1761_c1_8602_9606 | 312 |
| 148 | 3300050511 | nmdc:mga08y16_107_c1 | nmdc:mga08y16_107_c1_32871_33875 | 312 |
| 149 | 3300059493 | Ga0587077_015577 | Ga0587077_015577_112_1125 | 312 |
| 150 | 3300059505 | Ga0587083_0007514 | Ga0587083_0007514_492_1505 | 312 |
| 151 | 3300059506 | Ga0587085_003754 | Ga0587085_003754_180_1193 | 312 |
| 152 | 3300059507 | Ga0587086_007587 | Ga0587086_007587_127_1140 | 312 |
| 153 | 3300059508 | Ga0587088_017683 | Ga0587088_017683_27_1040 | 312 |
| 154 | 3300059640 | Ga0587067_019455 | Ga0587067_019455_115_1128 | 312 |
| 155 | 3300059643 | Ga0587072_021118 | Ga0587072_021118_29_1042 | 312 |
| 156 | 3300059646 | Ga0587078_004027 | Ga0587078_004027_180_1193 | 312 |
| 157 | 3300059647 | Ga0587079_013693 | Ga0587079_013693_108_1121 | 312 |
| 158 | iso_pu_bacteria | 2513237139 | 2513878265 | 312 |
| 159 | iso_pu_bacteria | 2517093001 | 2517103927 | 312 |
| 160 | iso_pu_bacteria | 2528768022 | 2528854541 | 312 |
| 161 | iso_pu_bacteria | 2617270735 | 2617346587 | 312 |
| 162 | iso_pu_bacteria | 2802429603 | 2805918487 | 312 |
| 163 | iso_pu_bacteria | 2824600985 | 2824607074 | 312 |
| 164 | iso_pu_bacteria | 2824609381 | 2824613511 | 312 |
| 165 | iso_pu_bacteria | 2824617872 | 2824622866 | 312 |
| 166 | iso_pu_bacteria | 2824626560 | 2824631983 | 312 |
| 167 | iso_pu_bacteria | 2824635225 | 2824638562 | 312 |
| 168 | iso_pu_bacteria | 2824644064 | 2824647732 | 312 |
| 169 | iso_pu_bacteria | 2824653114 | 2824658268 | 312 |
| 170 | iso_pu_bacteria | 2824661429 | 2824665322 | 312 |
| 171 | iso_pu_bacteria | 2824679649 | 2824681489 | 312 |
| 172 | iso_pu_bacteria | 2824696289 | 2824699664 | 312 |
| 173 | iso_pu_bacteria | 2824714736 | 2824716216 | 312 |
| 174 | iso_pu_bacteria | 2824723954 | 2824726816 | 312 |
| 175 | iso_pu_bacteria | 2824773399 | 2824777332 | 312 |
| 176 | iso_pu_bacteria | 2847930680 | 2847937142 | 312 |
| 177 | iso_pu_bacteria | 2847939898 | 2847947523 | 312 |
| 178 | iso_pu_bacteria | 2849076700 | 2849078600 | 312 |
| 179 | iso_pu_bacteria | 2857509624 | 2857512989 | 312 |
| 180 | iso_pu_bacteria | 2874612657 | 2874614795 | 312 |
| 181 | iso_pu_bacteria | 2879083081 | 2879089194 | 312 |
| 182 | iso_pu_bacteria | 2881364244 | 2881364731 | 312 |
| 183 | iso_pu_bacteria | 2888419890 | 2888425389 | 312 |
| 184 | iso_pu_bacteria | 2906643746 | 2906650391 | 312 |
| 185 | iso_pu_bacteria | 2919450847 | 2919452556 | 312 |
| 186 | iso_pu_bacteria | 2922393267 | 2922397285 | 312 |
| 187 | iso_pu_bacteria | 2929615660 | 2929620464 | 312 |
| 188 | iso_pu_bacteria | 2929624759 | 2929626357 | 312 |
| 189 | iso_pu_bacteria | 2933577622 | 2933582382 | 312 |
| 190 | iso_pu_bacteria | 3005506211 | 3005507289 | 312 |
| 191 | iso_pu_bacteria | 8001845381 | 8001847094 | 312 |
| 192 | iso_pu_bacteria | 8055742211 | 8055745326 | 312 |
| 193 | 3300003775 | Ga0055524_1000425 | Ga0055524_100042515 | 313 |
| 194 | 3300003791 | Ga0055530_10001827 | Ga0055530_1000182713 | 313 |
| 195 | 3300003791 | Ga0055530_10002550 | Ga0055530_100025506 | 313 |
| 196 | 3300003792 | Ga0055540_1000028 | Ga0055540_100002844 | 313 |
| 197 | 3300003794 | Ga0055531_10002132 | Ga0055531_100021324 | 313 |
| 198 | 3300005333 | Ga0070677_10066634 | Ga0070677_100666342 | 313 |
| 199 | 3300005341 | Ga0070691_10060585 | Ga0070691_100605851 | 313 |
| 200 | 3300005617 | Ga0068859_100259256 | Ga0068859_1002592561 | 313 |
| 201 | 3300005841 | Ga0068863_100061216 | Ga0068863_1000612163 | 313 |
| 202 | 3300005844 | Ga0068862_100010795 | Ga0068862_1000107957 | 313 |
| 203 | 3300005937 | Ga0081455_10003517 | Ga0081455_100035175 | 313 |
| 204 | 3300005937 | Ga0081455_10102570 | Ga0081455_101025703 | 313 |
| 205 | 3300005983 | Ga0081540_1002531 | Ga0081540_100253111 | 313 |
| 206 | 3300006178 | Ga0075367_10228200 | Ga0075367_102282001 | 313 |
| 207 | 3300006195 | Ga0075366_10065710 | Ga0075366_100657103 | 313 |
| 208 | 3300006847 | Ga0075431_100528896 | Ga0075431_1005288961 | 313 |
| 209 | 3300006931 | Ga0097620_100259270 | Ga0097620_1002592701 | 313 |
| 210 | 3300006946 | Ga0079104_1000194 | Ga0079104_100019480 | 313 |
| 211 | 3300009094 | Ga0111539_10186342 | Ga0111539_101863421 | 313 |
| 212 | 3300009101 | Ga0105247_10065504 | Ga0105247_100655043 | 313 |
| 213 | 3300009148 | Ga0105243_10075395 | Ga0105243_100753952 | 313 |
| 214 | 3300009553 | Ga0105249_10176132 | Ga0105249_101761322 | 313 |
| 215 | 3300013306 | Ga0163162_10003566 | Ga0163162_100035663 | 313 |
| 216 | 3300013308 | Ga0157375_10007052 | Ga0157375_100070526 | 313 |
| 217 | 3300014968 | Ga0157379_10072610 | Ga0157379_100726102 | 313 |
| 218 | 3300025298 | Ga0209050_1000282 | Ga0209050_100028256 | 313 |
| 219 | 3300025298 | Ga0209050_1022724 | Ga0209050_10227242 | 313 |
| 220 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015142 | 313 |
| 221 | 3300025303 | Ga0209051_1000022 | Ga0209051_1000022309 | 313 |
| 222 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030507 | 313 |
| 223 | 3300025901 | Ga0207688_10040362 | Ga0207688_100403622 | 313 |
| 224 | 3300025912 | Ga0207707_10244778 | Ga0207707_102447782 | 313 |
| 225 | 3300025960 | Ga0207651_10027540 | Ga0207651_100275403 | 313 |
| 226 | 3300026089 | Ga0207648_10100675 | Ga0207648_101006753 | 313 |
| 227 | 3300027111 | Ga0209281_1000083 | Ga0209281_1000083145 | 313 |
| 228 | 3300028380 | Ga0268265_10024517 | Ga0268265_100245171 | 313 |
| 229 | 3300031730 | Ga0307516_10003308 | Ga0307516_1000330816 | 313 |
| 230 | 3300031852 | Ga0307410_10055265 | Ga0307410_100552652 | 313 |
| 231 | 3300031995 | Ga0307409_100050443 | Ga0307409_1000504433 | 313 |
| 232 | 3300032002 | Ga0307416_100132824 | Ga0307416_1001328242 | 313 |
| 233 | 3300032126 | Ga0307415_100051380 | Ga0307415_1000513803 | 313 |
| 234 | 3300035695 | Ga0373927_0010401 | Ga0373927_0010401_1950_2978 | 313 |
| 235 | 3300037068 | Ga0373925_0032915 | Ga0373925_0032915_888_1916 | 313 |
| 236 | 3300046683 | Ga0495658_0082219 | Ga0495658_0082219_136_1164 | 313 |
| 237 | 3300049568 | Ga0501031_0015585 | Ga0501031_0015585_3226_4239 | 313 |
| 238 | 3300049572 | Ga0501036_0014495 | Ga0501036_0014495_672_1685 | 313 |
| 239 | 3300049574 | Ga0501038_0102733 | Ga0501038_0102733_682_1695 | 313 |
| 240 | 3300049575 | Ga0501039_0022016 | Ga0501039_0022016_1527_2540 | 313 |
| 241 | 3300049577 | Ga0501041_0032509 | Ga0501041_0032509_1379_2392 | 313 |
| 242 | 3300049578 | Ga0501042_0102626 | Ga0501042_0102626_782_1795 | 313 |
| 243 | 3300049580 | Ga0501046_0093936 | Ga0501046_0093936_1214_2227 | 313 |
| 244 | 3300049582 | Ga0501048_0005866 | Ga0501048_0005866_6424_7437 | 313 |
| 245 | 3300049585 | Ga0501069_0266890 | Ga0501069_0266890_10_987 | 313 |
| 246 | 3300049588 | Ga0501072_0029027 | Ga0501072_0029027_2409_3422 | 313 |
| 247 | 3300049592 | Ga0501076_0221425 | Ga0501076_0221425_136_1149 | 313 |
| 248 | 3300049593 | Ga0501077_0009547 | Ga0501077_0009547_4247_5260 | 313 |
| 249 | 3300049742 | Ga0501080_0089937 | Ga0501080_0089937_69_1082 | 313 |
| 250 | 3300049743 | Ga0501081_0104384 | Ga0501081_0104384_638_1651 | 313 |
| 251 | 3300049822 | Ga0501035_0108325 | Ga0501035_0108325_180_1193 | 313 |
| 252 | 3300049823 | Ga0501044_0374879 | Ga0501044_0374879_126_1139 | 313 |
| 253 | 3300049824 | Ga0501045_0007316 | Ga0501045_0007316_750_1763 | 313 |
| 254 | 3300050493 | nmdc:mga0k408_9014_c1 | nmdc:mga0k408_9014_c1_2237_3262 | 313 |
| 255 | 3300050494 | nmdc:mga06z11_192751_c1 | nmdc:mga06z11_192751_c1_114_1139 | 313 |
| 256 | 3300050507 | nmdc:mga05p37_165287_c1 | nmdc:mga05p37_165287_c1_835_1845 | 313 |
| 257 | 3300050511 | nmdc:mga08y16_354984_c1 | nmdc:mga08y16_354984_c1_202_1227 | 313 |
| 258 | 3300054114 | Ga0501084_0060052 | Ga0501084_0060052_761_1774 | 313 |
| 259 | 3300060353 | Ga0501082_0077066 | Ga0501082_0077066_566_1579 | 313 |
| 260 | 3300061734 | Ga0530510_0041648 | Ga0530510_0041648_975_1988 | 313 |
| 261 | 3300003215 | JGI25153J46596_10002578 | JGI25153J46596_100025784 | 314 |
| 262 | 3300003215 | JGI25153J46596_10003655 | JGI25153J46596_100036552 | 314 |
| 263 | 3300003791 | Ga0055530_10005532 | Ga0055530_100055323 | 314 |
| 264 | 3300005262 | Ga0065165_1008884 | Ga0065165_10088842 | 314 |
| 265 | 3300005295 | Ga0065707_10234388 | Ga0065707_102343881 | 314 |
| 266 | 3300005327 | Ga0070658_10046848 | Ga0070658_100468483 | 314 |
| 267 | 3300005329 | Ga0070683_100014191 | Ga0070683_1000141916 | 314 |
| 268 | 3300005331 | Ga0070670_100206049 | Ga0070670_1002060492 | 314 |
| 269 | 3300005331 | Ga0070670_100216340 | Ga0070670_1002163402 | 314 |
| 270 | 3300005344 | Ga0070661_100005709 | Ga0070661_1000057092 | 314 |
| 271 | 3300005366 | Ga0070659_100056895 | Ga0070659_1000568952 | 314 |
| 272 | 3300005366 | Ga0070659_100099881 | Ga0070659_1000998813 | 314 |
| 273 | 3300005435 | Ga0070714_100292630 | Ga0070714_1002926302 | 314 |
| 274 | 3300005471 | Ga0070698_100069969 | Ga0070698_1000699692 | 314 |
| 275 | 3300005535 | Ga0070684_100098119 | Ga0070684_1000981192 | 314 |
| 276 | 3300005539 | Ga0068853_100035086 | Ga0068853_1000350864 | 314 |
| 277 | 3300005545 | Ga0070695_100247102 | Ga0070695_1002471022 | 314 |
| 278 | 3300005548 | Ga0070665_100033484 | Ga0070665_1000334847 | 314 |
| 279 | 3300005548 | Ga0070665_100099169 | Ga0070665_1000991693 | 314 |
| 280 | 3300005564 | Ga0070664_100117886 | Ga0070664_1001178862 | 314 |
| 281 | 3300005578 | Ga0068854_100012425 | Ga0068854_1000124252 | 314 |
| 282 | 3300005614 | Ga0068856_100008513 | Ga0068856_1000085138 | 314 |
| 283 | 3300005616 | Ga0068852_100043473 | Ga0068852_1000434733 | 314 |
| 284 | 3300005617 | Ga0068859_100014988 | Ga0068859_1000149885 | 314 |
| 285 | 3300005617 | Ga0068859_100556906 | Ga0068859_1005569062 | 314 |
| 286 | 3300005719 | Ga0068861_100003649 | Ga0068861_1000036498 | 314 |
| 287 | 3300005843 | Ga0068860_100436818 | Ga0068860_1004368181 | 314 |
| 288 | 3300005981 | Ga0081538_10065423 | Ga0081538_100654232 | 314 |
| 289 | 3300005985 | Ga0081539_10004441 | Ga0081539_100044417 | 314 |
| 290 | 3300005985 | Ga0081539_10008485 | Ga0081539_100084855 | 314 |
| 291 | 3300006038 | Ga0075365_10014914 | Ga0075365_100149144 | 314 |
| 292 | 3300006048 | Ga0075363_100197851 | Ga0075363_1001978511 | 314 |
| 293 | 3300006177 | Ga0075362_10006880 | Ga0075362_100068804 | 314 |
| 294 | 3300006177 | Ga0075362_10013195 | Ga0075362_100131953 | 314 |
| 295 | 3300006177 | Ga0075362_10078021 | Ga0075362_100780212 | 314 |
| 296 | 3300006177 | Ga0075362_10081810 | Ga0075362_100818102 | 314 |
| 297 | 3300006186 | Ga0075369_10000082 | Ga0075369_1000008212 | 314 |
| 298 | 3300006353 | Ga0075370_10043341 | Ga0075370_100433412 | 314 |
| 299 | 3300006353 | Ga0075370_10182096 | Ga0075370_101820961 | 314 |
| 300 | 3300006358 | Ga0068871_100214566 | Ga0068871_1002145662 | 314 |
| 301 | 3300006847 | Ga0075431_100019249 | Ga0075431_1000192493 | 314 |
| 302 | 3300006852 | Ga0075433_10251505 | Ga0075433_102515052 | 314 |
| 303 | 3300006880 | Ga0075429_100000783 | Ga0075429_1000007833 | 314 |
| 304 | 3300006931 | Ga0097620_100014989 | Ga0097620_1000149893 | 314 |
| 305 | 3300006931 | Ga0097620_100556997 | Ga0097620_1005569972 | 314 |
| 306 | 3300007076 | Ga0075435_100168902 | Ga0075435_1001689022 | 314 |
| 307 | 3300009147 | Ga0114129_10000341 | Ga0114129_100003414 | 314 |
| 308 | 3300009551 | Ga0105238_10014576 | Ga0105238_100145766 | 314 |
| 309 | 3300009553 | Ga0105249_10010104 | Ga0105249_100101042 | 314 |
| 310 | 3300013100 | Ga0157373_10007866 | Ga0157373_100078668 | 314 |
| 311 | 3300013104 | Ga0157370_10139287 | Ga0157370_101392872 | 314 |
| 312 | 3300013105 | Ga0157369_10017534 | Ga0157369_100175342 | 314 |
| 313 | 3300014968 | Ga0157379_10122996 | Ga0157379_101229962 | 314 |
| 314 | 3300025258 | Ga0209129_1018735 | Ga0209129_10187352 | 314 |
| 315 | 3300025273 | Ga0209673_1004238 | Ga0209673_100423810 | 314 |
| 316 | 3300025297 | Ga0209758_1000209 | Ga0209758_100020910 | 314 |
| 317 | 3300025297 | Ga0209758_1000213 | Ga0209758_100021341 | 314 |
| 318 | 3300025297 | Ga0209758_1000613 | Ga0209758_100061345 | 314 |
| 319 | 3300025298 | Ga0209050_1000178 | Ga0209050_100017826 | 314 |
| 320 | 3300025303 | Ga0209051_1004272 | Ga0209051_10042722 | 314 |
| 321 | 3300025920 | Ga0207649_10024036 | Ga0207649_100240363 | 314 |
| 322 | 3300025925 | Ga0207650_10227277 | Ga0207650_102272772 | 314 |
| 323 | 3300025932 | Ga0207690_10023590 | Ga0207690_100235902 | 314 |
| 324 | 3300025945 | Ga0207679_10021173 | Ga0207679_100211733 | 314 |
| 325 | 3300025961 | Ga0207712_10023406 | Ga0207712_100234064 | 314 |
| 326 | 3300026041 | Ga0207639_10146596 | Ga0207639_101465962 | 314 |
| 327 | 3300026078 | Ga0207702_10004295 | Ga0207702_100042952 | 314 |
| 328 | 3300026116 | Ga0207674_10015377 | Ga0207674_100153774 | 314 |
| 329 | 3300026118 | Ga0207675_100015324 | Ga0207675_1000153241 | 314 |
| 330 | 3300026142 | Ga0207698_10007138 | Ga0207698_100071383 | 314 |
| 331 | 3300027526 | Ga0209968_1000171 | Ga0209968_10001713 | 314 |
| 332 | 3300027695 | Ga0209966_1000118 | Ga0209966_100011816 | 314 |
| 333 | 3300027866 | Ga0209813_10040887 | Ga0209813_100408871 | 314 |
| 334 | 3300028379 | Ga0268266_10002299 | Ga0268266_100022993 | 314 |
| 335 | 3300028379 | Ga0268266_10032022 | Ga0268266_100320222 | 314 |
| 336 | 3300028380 | Ga0268265_10084165 | Ga0268265_100841653 | 314 |
| 337 | 3300028794 | Ga0307515_10000150 | Ga0307515_10000150145 | 314 |
| 338 | 3300028794 | Ga0307515_10000367 | Ga0307515_1000036778 | 314 |
| 339 | 3300028794 | Ga0307515_10005608 | Ga0307515_1000560814 | 314 |
| 340 | 3300028794 | Ga0307515_10054271 | Ga0307515_100542714 | 314 |
| 341 | 3300028794 | Ga0307515_10063415 | Ga0307515_100634154 | 314 |
| 342 | 3300031456 | Ga0307513_10000514 | Ga0307513_100005141 | 314 |
| 343 | 3300031456 | Ga0307513_10000991 | Ga0307513_1000099123 | 314 |
| 344 | 3300031507 | Ga0307509_10020754 | Ga0307509_100207542 | 314 |
| 345 | 3300031548 | Ga0307408_100049104 | Ga0307408_1000491042 | 314 |
| 346 | 3300031730 | Ga0307516_10060979 | Ga0307516_100609792 | 314 |
| 347 | 3300031730 | Ga0307516_10099941 | Ga0307516_100999412 | 314 |
| 348 | 3300032002 | Ga0307416_100117706 | Ga0307416_1001177063 | 314 |
| 349 | 3300037471 | Ga0395905_0080961 | Ga0395905_0080961_1371_2378 | 314 |
| 350 | 3300042876 | Ga0451577_0105405 | Ga0451577_0105405_418_1425 | 314 |
| 351 | 3300044712 | Ga0453684_0189876 | Ga0453684_0189876_888_1898 | 314 |
| 352 | 3300046515 | Ga0495620_0053935 | Ga0495620_0053935_442_1446 | 314 |
| 353 | 3300046519 | Ga0495632_0001754 | Ga0495632_0001754_7547_8551 | 314 |
| 354 | 3300046537 | Ga0495598_0006159 | Ga0495598_0006159_1526_2545 | 314 |
| 355 | 3300047320 | Ga0495672_0040687 | Ga0495672_0040687_297_1301 | 314 |
| 356 | 3300048924 | Ga0496121_0085596 | Ga0496121_0085596_1009_2013 | 314 |
| 357 | 3300050489 | nmdc:mga03683_10404_c1 | nmdc:mga03683_10404_c1_935_1948 | 314 |
| 358 | 3300050493 | nmdc:mga0k408_28504_c1 | nmdc:mga0k408_28504_c1_1803_2807 | 314 |
| 359 | 3300053086 | Ga0500578_0000393 | Ga0500578_0000393_13342_14346 | 314 |
| 360 | 3300053088 | Ga0500644_0008964 | Ga0500644_0008964_680_1693 | 314 |
| 361 | 3300053092 | Ga0500583_0041918 | Ga0500583_0041918_229_1233 | 314 |
| 362 | 3300053093 | Ga0500651_0012079 | Ga0500651_0012079_1445_2449 | 314 |
| 363 | 3300053096 | Ga0500641_0038517 | Ga0500641_0038517_304_1314 | 314 |
| 364 | 3300053108 | Ga0500562_028862 | Ga0500562_028862_373_1377 | 314 |
| 365 | 3300053129 | Ga0500628_001546 | Ga0500628_001546_18_1022 | 314 |
| 366 | 3300053131 | Ga0500652_001779 | Ga0500652_001779_3514_4518 | 314 |
| 367 | 3300053139 | Ga0500568_0013120 | Ga0500568_0013120_1883_2890 | 314 |
| 368 | 3300053139 | Ga0500568_0014416 | Ga0500568_0014416_2016_3020 | 314 |
| 369 | 3300053156 | Ga0500622_0000232 | Ga0500622_0000232_22909_23913 | 314 |
| 370 | 3300053730 | Ga0500645_000228 | Ga0500645_000228_2684_3706 | 314 |
| 371 | iso_pu_bacteria | 2522572158 | 2523107081 | 314 |
| 372 | iso_pu_bacteria | 2842333319 | 2842336811 | 314 |
| 373 | 3300003215 | JGI25153J46596_10013460 | JGI25153J46596_100134604 | 315 |
| 374 | 3300003354 | JGI25160J50197_1014690 | JGI25160J50197_10146901 | 315 |
| 375 | 3300005262 | Ga0065165_1001283 | Ga0065165_100128313 | 315 |
| 376 | 3300005459 | Ga0068867_100216929 | Ga0068867_1002169291 | 315 |
| 377 | 3300005530 | Ga0070679_100072190 | Ga0070679_1000721903 | 315 |
| 378 | 3300005545 | Ga0070695_100041991 | Ga0070695_1000419913 | 315 |
| 379 | 3300005546 | Ga0070696_100284287 | Ga0070696_1002842871 | 315 |
| 380 | 3300005548 | Ga0070665_100254627 | Ga0070665_1002546272 | 315 |
| 381 | 3300005614 | Ga0068856_100131262 | Ga0068856_1001312622 | 315 |
| 382 | 3300005615 | Ga0070702_100096100 | Ga0070702_1000961001 | 315 |
| 383 | 3300005617 | Ga0068859_100106483 | Ga0068859_1001064832 | 315 |
| 384 | 3300005841 | Ga0068863_100256068 | Ga0068863_1002560682 | 315 |
| 385 | 3300005843 | Ga0068860_100016555 | Ga0068860_1000165553 | 315 |
| 386 | 3300005843 | Ga0068860_100156219 | Ga0068860_1001562192 | 315 |
| 387 | 3300005937 | Ga0081455_10063531 | Ga0081455_100635313 | 315 |
| 388 | 3300005983 | Ga0081540_1016498 | Ga0081540_10164984 | 315 |
| 389 | 3300005983 | Ga0081540_1029880 | Ga0081540_10298803 | 315 |
| 390 | 3300006038 | Ga0075365_10172845 | Ga0075365_101728451 | 315 |
| 391 | 3300006048 | Ga0075363_100197194 | Ga0075363_1001971941 | 315 |
| 392 | 3300006186 | Ga0075369_10021909 | Ga0075369_100219092 | 315 |
| 393 | 3300006353 | Ga0075370_10026465 | Ga0075370_100264652 | 315 |
| 394 | 3300006353 | Ga0075370_10116077 | Ga0075370_101160771 | 315 |
| 395 | 3300006931 | Ga0097620_100106485 | Ga0097620_1001064852 | 315 |
| 396 | 3300006944 | Ga0099823_1033761 | Ga0099823_10337612 | 315 |
| 397 | 3300009098 | Ga0105245_10047188 | Ga0105245_100471883 | 315 |
| 398 | 3300009177 | Ga0105248_10249923 | Ga0105248_102499232 | 315 |
| 399 | 3300009553 | Ga0105249_10380603 | Ga0105249_103806031 | 315 |
| 400 | 3300009553 | Ga0105249_10409923 | Ga0105249_104099231 | 315 |
| 401 | 3300010375 | Ga0105239_10019990 | Ga0105239_100199906 | 315 |
| 402 | 3300021320 | Ga0214544_1000004 | Ga0214544_1000004330 | 315 |
| 403 | 3300021321 | Ga0214542_1000001 | Ga0214542_100000123 | 315 |
| 404 | 3300021324 | Ga0214545_1000001 | Ga0214545_100000190 | 315 |
| 405 | 3300021327 | Ga0214543_1000006 | Ga0214543_100000687 | 315 |
| 406 | 3300022467 | Ga0224712_10094181 | Ga0224712_100941811 | 315 |
| 407 | 3300025297 | Ga0209758_1004235 | Ga0209758_10042352 | 315 |
| 408 | 3300025302 | Ga0207426_1001703 | Ga0207426_10017034 | 315 |
| 409 | 3300025302 | Ga0207426_1004495 | Ga0207426_10044956 | 315 |
| 410 | 3300025912 | Ga0207707_10133476 | Ga0207707_101334762 | 315 |
| 411 | 3300025914 | Ga0207671_10040140 | Ga0207671_100401403 | 315 |
| 412 | 3300025917 | Ga0207660_10025680 | Ga0207660_100256804 | 315 |
| 413 | 3300025919 | Ga0207657_10243076 | Ga0207657_102430762 | 315 |
| 414 | 3300025932 | Ga0207690_10097341 | Ga0207690_100973411 | 315 |
| 415 | 3300025940 | Ga0207691_10218849 | Ga0207691_102188491 | 315 |
| 416 | 3300025941 | Ga0207711_10305393 | Ga0207711_103053932 | 315 |
| 417 | 3300025949 | Ga0207667_10241526 | Ga0207667_102415262 | 315 |
| 418 | 3300025960 | Ga0207651_10137482 | Ga0207651_101374821 | 315 |
| 419 | 3300025972 | Ga0207668_10228414 | Ga0207668_102284142 | 315 |
| 420 | 3300025986 | Ga0207658_10149123 | Ga0207658_101491232 | 315 |
| 421 | 3300026023 | Ga0207677_10084777 | Ga0207677_100847772 | 315 |
| 422 | 3300026067 | Ga0207678_10053759 | Ga0207678_100537592 | 315 |
| 423 | 3300026078 | Ga0207702_10123155 | Ga0207702_101231551 | 315 |
| 424 | 3300026142 | Ga0207698_10321436 | Ga0207698_103214361 | 315 |
| 425 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001328 | 315 |
| 426 | 3300027360 | Ga0209969_1005346 | Ga0209969_10053462 | 315 |
| 427 | 3300027361 | Ga0209489_105217 | Ga0209489_10521716 | 315 |
| 428 | 3300027363 | Ga0209700_100007 | Ga0209700_10000799 | 315 |
| 429 | 3300027364 | Ga0209967_1000971 | Ga0209967_10009712 | 315 |
| 430 | 3300027395 | Ga0209996_1008152 | Ga0209996_10081522 | 315 |
| 431 | 3300027424 | Ga0209984_1004908 | Ga0209984_10049082 | 315 |
| 432 | 3300027462 | Ga0210000_1004391 | Ga0210000_10043912 | 315 |
| 433 | 3300027471 | Ga0209995_1010466 | Ga0209995_10104661 | 315 |
| 434 | 3300027614 | Ga0209970_1008103 | Ga0209970_10081032 | 315 |
| 435 | 3300028379 | Ga0268266_10476300 | Ga0268266_104763001 | 315 |
| 436 | 3300028380 | Ga0268265_10055399 | Ga0268265_100553993 | 315 |
| 437 | 3300028381 | Ga0268264_10363002 | Ga0268264_103630021 | 315 |
| 438 | 3300028786 | Ga0307517_10000579 | Ga0307517_1000057935 | 315 |
| 439 | 3300028794 | Ga0307515_10020668 | Ga0307515_100206688 | 315 |
| 440 | 3300031456 | Ga0307513_10008489 | Ga0307513_1000848911 | 315 |
| 441 | 3300032004 | Ga0307414_10346151 | Ga0307414_103461511 | 315 |
| 442 | 3300033180 | Ga0307510_10040933 | Ga0307510_100409332 | 315 |
| 443 | 3300035114 | Ga0373939_0053786 | Ga0373939_0053786_75_1088 | 315 |
| 444 | 3300035691 | Ga0373931_0130953 | Ga0373931_0130953_292_1305 | 315 |
| 445 | 3300044842 | Ga0466957_0224568 | Ga0466957_0224568_35_1042 | 315 |
| 446 | 3300045051 | Ga0451576_0270087 | Ga0451576_0270087_460_1464 | 315 |
| 447 | 3300046459 | Ga0495629_0241769 | Ga0495629_0241769_220_1233 | 315 |
| 448 | 3300046461 | Ga0495641_0045333 | Ga0495641_0045333_687_1700 | 315 |
| 449 | 3300046471 | Ga0495650_0072544 | Ga0495650_0072544_240_1253 | 315 |
| 450 | 3300046491 | Ga0495584_0059497 | Ga0495584_0059497_444_1457 | 315 |
| 451 | 3300046492 | Ga0495585_0077745 | Ga0495585_0077745_143_1156 | 315 |
| 452 | 3300046492 | Ga0495585_0098914 | Ga0495585_0098914_301_1314 | 315 |
| 453 | 3300046507 | Ga0495606_0002171 | Ga0495606_0002171_17680_18693 | 315 |
| 454 | 3300046520 | Ga0495637_0049391 | Ga0495637_0049391_291_1304 | 315 |
| 455 | 3300046539 | Ga0495621_0063185 | Ga0495621_0063185_250_1263 | 315 |
| 456 | 3300047317 | Ga0495604_0169307 | Ga0495604_0169307_496_1500 | 315 |
| 457 | 3300047321 | Ga0495676_0058042 | Ga0495676_0058042_1053_2066 | 315 |
| 458 | 3300047323 | Ga0495683_0082180 | Ga0495683_0082180_460_1473 | 315 |
| 459 | 3300047472 | Ga0495686_0100679 | Ga0495686_0100679_411_1418 | 315 |
| 460 | 3300048903 | Ga0496100_0020338 | Ga0496100_0020338_893_1909 | 315 |
| 461 | 3300048907 | Ga0496104_0534702 | Ga0496104_0534702_28_1035 | 315 |
| 462 | 3300048910 | Ga0496107_0260501 | Ga0496107_0260501_76_1083 | 315 |
| 463 | 3300048911 | Ga0496108_0417478 | Ga0496108_0417478_67_1083 | 315 |
| 464 | 3300048914 | Ga0496111_0211874 | Ga0496111_0211874_26_1039 | 315 |
| 465 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_445397_446410 | 315 |
| 466 | 3300048915 | Ga0496112_0133017 | Ga0496112_0133017_986_1999 | 315 |
| 467 | 3300048917 | Ga0496114_0033642 | Ga0496114_0033642_719_1735 | 315 |
| 468 | 3300048922 | Ga0496119_0131216 | Ga0496119_0131216_235_1248 | 315 |
| 469 | 3300048927 | Ga0496124_0075596 | Ga0496124_0075596_361_1374 | 315 |
| 470 | 3300048928 | Ga0496125_0100358 | Ga0496125_0100358_348_1361 | 315 |
| 471 | 3300049571 | Ga0501034_0005172 | Ga0501034_0005172_3924_4937 | 315 |
| 472 | 3300049742 | Ga0501080_0068473 | Ga0501080_0068473_442_1434 | 315 |
| 473 | 3300050490 | nmdc:mga03n38_66667_c1 | nmdc:mga03n38_66667_c1_475_1488 | 315 |
| 474 | 3300050494 | nmdc:mga06z11_42153_c1 | nmdc:mga06z11_42153_c1_837_1850 | 315 |
| 475 | 3300050494 | nmdc:mga06z11_91772_c1 | nmdc:mga06z11_91772_c1_150_1163 | 315 |
| 476 | 3300050496 | nmdc:mga07m45_22715_c1 | nmdc:mga07m45_22715_c1_591_1604 | 315 |
| 477 | 3300050509 | nmdc:mga0qj67_288881_c1 | nmdc:mga0qj67_288881_c1_13_1044 | 315 |
| 478 | 3300050512 | nmdc:mga0n895_105446_c1 | nmdc:mga0n895_105446_c1_1568_2575 | 315 |
| 479 | 3300050513 | nmdc:mga0rr50_223902_c1 | nmdc:mga0rr50_223902_c1_536_1543 | 315 |
| 480 | 3300053089 | Ga0500581_076119 | Ga0500581_076119_48_1061 | 315 |
| 481 | 3300053119 | Ga0500595_009117 | Ga0500595_009117_1956_2963 | 315 |
| 482 | 3300053124 | Ga0500617_075941 | Ga0500617_075941_56_1069 | 315 |
| 483 | 3300053139 | Ga0500568_0018255 | Ga0500568_0018255_835_1842 | 315 |
| 484 | 3300053147 | Ga0500589_070532 | Ga0500589_070532_63_1076 | 315 |
| 485 | 3300053151 | Ga0500604_0015432 | Ga0500604_0015432_610_1623 | 315 |
| 486 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_273405_274415 | 315 |
| 487 | 3300053730 | Ga0500645_011086 | Ga0500645_011086_812_1825 | 315 |
| 488 | 3300005329 | Ga0070683_100072206 | Ga0070683_1000722062 | 316 |
| 489 | 3300005336 | Ga0070680_100003680 | Ga0070680_1000036806 | 316 |
| 490 | 3300005338 | Ga0068868_100003486 | Ga0068868_1000034865 | 316 |
| 491 | 3300005343 | Ga0070687_100000018 | Ga0070687_10000001813 | 316 |
| 492 | 3300005344 | Ga0070661_100091204 | Ga0070661_1000912041 | 316 |
| 493 | 3300005345 | Ga0070692_10082902 | Ga0070692_100829022 | 316 |
| 494 | 3300005564 | Ga0070664_100010293 | Ga0070664_1000102933 | 316 |
| 495 | 3300005614 | Ga0068856_100012538 | Ga0068856_1000125386 | 316 |
| 496 | 3300005616 | Ga0068852_100044094 | Ga0068852_1000440943 | 316 |
| 497 | 3300005841 | Ga0068863_100055486 | Ga0068863_1000554863 | 316 |
| 498 | 3300005844 | Ga0068862_100001654 | Ga0068862_1000016547 | 316 |
| 499 | 3300006195 | Ga0075366_10021262 | Ga0075366_100212622 | 316 |
| 500 | 3300006358 | Ga0068871_100000344 | Ga0068871_1000003443 | 316 |
| 501 | 3300006844 | Ga0075428_100000505 | Ga0075428_10000050522 | 316 |
| 502 | 3300006880 | Ga0075429_100047247 | Ga0075429_1000472474 | 316 |
| 503 | 3300009094 | Ga0111539_10000490 | Ga0111539_100004905 | 316 |
| 504 | 3300009094 | Ga0111539_10030018 | Ga0111539_100300184 | 316 |
| 505 | 3300009148 | Ga0105243_10000346 | Ga0105243_1000034625 | 316 |
| 506 | 3300009545 | Ga0105237_10150584 | Ga0105237_101505843 | 316 |
| 507 | 3300009551 | Ga0105238_10026008 | Ga0105238_100260083 | 316 |
| 508 | 3300013102 | Ga0157371_10078904 | Ga0157371_100789043 | 316 |
| 509 | 3300013105 | Ga0157369_10148696 | Ga0157369_101486961 | 316 |
| 510 | 3300013307 | Ga0157372_10045037 | Ga0157372_100450372 | 316 |
| 511 | 3300025904 | Ga0207647_10063202 | Ga0207647_100632023 | 316 |
| 512 | 3300025914 | Ga0207671_10053972 | Ga0207671_100539723 | 316 |
| 513 | 3300025918 | Ga0207662_10000347 | Ga0207662_1000034713 | 316 |
| 514 | 3300025920 | Ga0207649_10017049 | Ga0207649_100170494 | 316 |
| 515 | 3300025924 | Ga0207694_10142647 | Ga0207694_101426472 | 316 |
| 516 | 3300025927 | Ga0207687_10004204 | Ga0207687_100042045 | 316 |
| 517 | 3300025935 | Ga0207709_10000485 | Ga0207709_1000048521 | 316 |
| 518 | 3300025942 | Ga0207689_10000488 | Ga0207689_100004885 | 316 |
| 519 | 3300026088 | Ga0207641_10055353 | Ga0207641_100553533 | 316 |
| 520 | 3300026118 | Ga0207675_100000316 | Ga0207675_10000031626 | 316 |
| 521 | 3300027907 | Ga0207428_10001574 | Ga0207428_100015743 | 316 |
| 522 | 3300028380 | Ga0268265_10002823 | Ga0268265_100028235 | 316 |
| 523 | 3300028381 | Ga0268264_10007460 | Ga0268264_100074607 | 316 |
| 524 | 3300032002 | Ga0307416_100102783 | Ga0307416_1001027832 | 316 |
| 525 | 3300035083 | Ga0373926_0001218 | Ga0373926_0001218_2150_3157 | 316 |
| 526 | 3300035089 | Ga0373944_0014577 | Ga0373944_0014577_876_1877 | 316 |
| 527 | 3300035113 | Ga0373936_0008312 | Ga0373936_0008312_2083_3084 | 316 |
| 528 | 3300035116 | Ga0373945_0001462 | Ga0373945_0001462_457_1464 | 316 |
| 529 | 3300035170 | Ga0373943_0004457 | Ga0373943_0004457_3479_4486 | 316 |
| 530 | 3300035692 | Ga0373935_0048671 | Ga0373935_0048671_39_1046 | 316 |
| 531 | 3300037068 | Ga0373925_0155395 | Ga0373925_0155395_502_1500 | 316 |
| 532 | 3300046455 | Ga0495603_0015743 | Ga0495603_0015743_1473_2474 | 316 |
| 533 | 3300046475 | Ga0495639_0016075 | Ga0495639_0016075_1413_2420 | 316 |
| 534 | 3300046531 | Ga0495665_0065868 | Ga0495665_0065868_258_1259 | 316 |
| 535 | 3300046535 | Ga0495586_0004128 | Ga0495586_0004128_5986_6993 | 316 |
| 536 | 3300046674 | Ga0495588_0005471 | Ga0495588_0005471_3480_4487 | 316 |
| 537 | 3300046683 | Ga0495658_0001264 | Ga0495658_0001264_7602_8609 | 316 |
| 538 | 3300047315 | Ga0495581_0025443 | Ga0495581_0025443_2329_3336 | 316 |
| 539 | 3300047321 | Ga0495676_0104765 | Ga0495676_0104765_685_1686 | 316 |
| 540 | 3300049742 | Ga0501080_0228827 | Ga0501080_0228827_433_1440 | 316 |
| 541 | 3300050493 | nmdc:mga0k408_19883_c1 | nmdc:mga0k408_19883_c1_1582_2583 | 316 |
| 542 | 3300050493 | nmdc:mga0k408_5223_c1 | nmdc:mga0k408_5223_c1_3384_4388 | 316 |
| 543 | 3300050496 | nmdc:mga07m45_63905_c1 | nmdc:mga07m45_63905_c1_638_1639 | 316 |
| 544 | 3300050508 | nmdc:mga09592_1504_c1 | nmdc:mga09592_1504_c1_913_1929 | 316 |
| 545 | 3300050511 | nmdc:mga08y16_217587_c1 | nmdc:mga08y16_217587_c1_407_1411 | 316 |
| 546 | 3300050511 | nmdc:mga08y16_3339_c1 | nmdc:mga08y16_3339_c1_5642_6658 | 316 |
| 547 | 3300054114 | Ga0501084_0145259 | Ga0501084_0145259_374_1381 | 316 |
| 548 | 3300002987 | JGI25159J45721_1018208 | JGI25159J45721_10182081 | 317 |
| 549 | 3300003187 | JGI25151J46595_10000795 | JGI25151J46595_100007955 | 317 |
| 550 | 3300005329 | Ga0070683_100139159 | Ga0070683_1001391592 | 317 |
| 551 | 3300005334 | Ga0068869_100013906 | Ga0068869_1000139064 | 317 |
| 552 | 3300005334 | Ga0068869_100254894 | Ga0068869_1002548941 | 317 |
| 553 | 3300005335 | Ga0070666_10004388 | Ga0070666_100043888 | 317 |
| 554 | 3300005335 | Ga0070666_10128550 | Ga0070666_101285501 | 317 |
| 555 | 3300005336 | Ga0070680_100018826 | Ga0070680_1000188265 | 317 |
| 556 | 3300005337 | Ga0070682_100016453 | Ga0070682_1000164533 | 317 |
| 557 | 3300005338 | Ga0068868_100045739 | Ga0068868_1000457394 | 317 |
| 558 | 3300005338 | Ga0068868_100061582 | Ga0068868_1000615823 | 317 |
| 559 | 3300005338 | Ga0068868_100114395 | Ga0068868_1001143953 | 317 |
| 560 | 3300005340 | Ga0070689_100039280 | Ga0070689_1000392803 | 317 |
| 561 | 3300005341 | Ga0070691_10036068 | Ga0070691_100360683 | 317 |
| 562 | 3300005343 | Ga0070687_100249588 | Ga0070687_1002495881 | 317 |
| 563 | 3300005344 | Ga0070661_100011155 | Ga0070661_1000111552 | 317 |
| 564 | 3300005345 | Ga0070692_10001631 | Ga0070692_100016316 | 317 |
| 565 | 3300005353 | Ga0070669_100014865 | Ga0070669_1000148651 | 317 |
| 566 | 3300005355 | Ga0070671_100011803 | Ga0070671_1000118036 | 317 |
| 567 | 3300005355 | Ga0070671_100213492 | Ga0070671_1002134922 | 317 |
| 568 | 3300005356 | Ga0070674_100061792 | Ga0070674_1000617922 | 317 |
| 569 | 3300005365 | Ga0070688_100020460 | Ga0070688_1000204603 | 317 |
| 570 | 3300005365 | Ga0070688_100096298 | Ga0070688_1000962982 | 317 |
| 571 | 3300005366 | Ga0070659_100099151 | Ga0070659_1000991513 | 317 |
| 572 | 3300005367 | Ga0070667_100029475 | Ga0070667_1000294752 | 317 |
| 573 | 3300005367 | Ga0070667_100143144 | Ga0070667_1001431442 | 317 |
| 574 | 3300005435 | Ga0070714_100000785 | Ga0070714_10000078513 | 317 |
| 575 | 3300005436 | Ga0070713_100006452 | Ga0070713_1000064525 | 317 |
| 576 | 3300005436 | Ga0070713_100085335 | Ga0070713_1000853353 | 317 |
| 577 | 3300005438 | Ga0070701_10023640 | Ga0070701_100236403 | 317 |
| 578 | 3300005439 | Ga0070711_100030852 | Ga0070711_1000308523 | 317 |
| 579 | 3300005440 | Ga0070705_100014462 | Ga0070705_1000144622 | 317 |
| 580 | 3300005444 | Ga0070694_100059812 | Ga0070694_1000598123 | 317 |
| 581 | 3300005456 | Ga0070678_100000773 | Ga0070678_1000007733 | 317 |
| 582 | 3300005457 | Ga0070662_100030745 | Ga0070662_1000307454 | 317 |
| 583 | 3300005457 | Ga0070662_100034510 | Ga0070662_1000345103 | 317 |
| 584 | 3300005458 | Ga0070681_10351450 | Ga0070681_103514501 | 317 |
| 585 | 3300005459 | Ga0068867_100040009 | Ga0068867_1000400093 | 317 |
| 586 | 3300005467 | Ga0070706_100165397 | Ga0070706_1001653972 | 317 |
| 587 | 3300005468 | Ga0070707_100373997 | Ga0070707_1003739971 | 317 |
| 588 | 3300005471 | Ga0070698_100200629 | Ga0070698_1002006292 | 317 |
| 589 | 3300005518 | Ga0070699_100037853 | Ga0070699_1000378534 | 317 |
| 590 | 3300005530 | Ga0070679_100262736 | Ga0070679_1002627362 | 317 |
| 591 | 3300005535 | Ga0070684_100035493 | Ga0070684_1000354932 | 317 |
| 592 | 3300005536 | Ga0070697_100019630 | Ga0070697_1000196303 | 317 |
| 593 | 3300005539 | Ga0068853_100100885 | Ga0068853_1001008853 | 317 |
| 594 | 3300005545 | Ga0070695_100044766 | Ga0070695_1000447663 | 317 |
| 595 | 3300005546 | Ga0070696_100166611 | Ga0070696_1001666112 | 317 |
| 596 | 3300005547 | Ga0070693_100000931 | Ga0070693_1000009316 | 317 |
| 597 | 3300005547 | Ga0070693_100070585 | Ga0070693_1000705852 | 317 |
| 598 | 3300005547 | Ga0070693_100111821 | Ga0070693_1001118212 | 317 |
| 599 | 3300005548 | Ga0070665_100129062 | Ga0070665_1001290622 | 317 |
| 600 | 3300005549 | Ga0070704_100128992 | Ga0070704_1001289922 | 317 |
| 601 | 3300005564 | Ga0070664_100189630 | Ga0070664_1001896302 | 317 |
| 602 | 3300005578 | Ga0068854_100005240 | Ga0068854_1000052404 | 317 |
| 603 | 3300005578 | Ga0068854_100012314 | Ga0068854_1000123145 | 317 |
| 604 | 3300005614 | Ga0068856_100076780 | Ga0068856_1000767802 | 317 |
| 605 | 3300005614 | Ga0068856_100169533 | Ga0068856_1001695333 | 317 |
| 606 | 3300005614 | Ga0068856_100314913 | Ga0068856_1003149132 | 317 |
| 607 | 3300005615 | Ga0070702_100009464 | Ga0070702_1000094643 | 317 |
| 608 | 3300005616 | Ga0068852_100036441 | Ga0068852_1000364414 | 317 |
| 609 | 3300005617 | Ga0068859_100056936 | Ga0068859_1000569363 | 317 |
| 610 | 3300005618 | Ga0068864_100002651 | Ga0068864_10000265112 | 317 |
| 611 | 3300005718 | Ga0068866_10019847 | Ga0068866_100198473 | 317 |
| 612 | 3300005834 | Ga0068851_10009796 | Ga0068851_100097963 | 317 |
| 613 | 3300005841 | Ga0068863_100060886 | Ga0068863_1000608862 | 317 |
| 614 | 3300005842 | Ga0068858_100067139 | Ga0068858_1000671391 | 317 |
| 615 | 3300005843 | Ga0068860_100037729 | Ga0068860_1000377294 | 317 |
| 616 | 3300005843 | Ga0068860_100083962 | Ga0068860_1000839623 | 317 |
| 617 | 3300005981 | Ga0081538_10030556 | Ga0081538_100305564 | 317 |
| 618 | 3300006173 | Ga0070716_100048821 | Ga0070716_1000488213 | 317 |
| 619 | 3300006173 | Ga0070716_100096160 | Ga0070716_1000961602 | 317 |
| 620 | 3300006175 | Ga0070712_100315159 | Ga0070712_1003151592 | 317 |
| 621 | 3300006195 | Ga0075366_10012018 | Ga0075366_100120183 | 317 |
| 622 | 3300006237 | Ga0097621_100063969 | Ga0097621_1000639693 | 317 |
| 623 | 3300006237 | Ga0097621_100136364 | Ga0097621_1001363642 | 317 |
| 624 | 3300006358 | Ga0068871_100063332 | Ga0068871_1000633323 | 317 |
| 625 | 3300006358 | Ga0068871_100191606 | Ga0068871_1001916062 | 317 |
| 626 | 3300006846 | Ga0075430_100059137 | Ga0075430_1000591372 | 317 |
| 627 | 3300006847 | Ga0075431_100000584 | Ga0075431_10000058420 | 317 |
| 628 | 3300006880 | Ga0075429_100011050 | Ga0075429_1000110504 | 317 |
| 629 | 3300006881 | Ga0068865_100066334 | Ga0068865_1000663343 | 317 |
| 630 | 3300006914 | Ga0075436_100053251 | Ga0075436_1000532513 | 317 |
| 631 | 3300006931 | Ga0097620_100056933 | Ga0097620_1000569333 | 317 |
| 632 | 3300009094 | Ga0111539_10000705 | Ga0111539_100007053 | 317 |
| 633 | 3300009098 | Ga0105245_10090345 | Ga0105245_100903453 | 317 |
| 634 | 3300009098 | Ga0105245_10103159 | Ga0105245_101031592 | 317 |
| 635 | 3300009098 | Ga0105245_10148242 | Ga0105245_101482423 | 317 |
| 636 | 3300009147 | Ga0114129_10000057 | Ga0114129_1000005742 | 317 |
| 637 | 3300009174 | Ga0105241_10099992 | Ga0105241_100999922 | 317 |
| 638 | 3300009174 | Ga0105241_10184458 | Ga0105241_101844582 | 317 |
| 639 | 3300009174 | Ga0105241_10212348 | Ga0105241_102123481 | 317 |
| 640 | 3300009176 | Ga0105242_10004136 | Ga0105242_100041369 | 317 |
| 641 | 3300009176 | Ga0105242_10159730 | Ga0105242_101597301 | 317 |
| 642 | 3300009177 | Ga0105248_10205294 | Ga0105248_102052942 | 317 |
| 643 | 3300009545 | Ga0105237_10021401 | Ga0105237_100214014 | 317 |
| 644 | 3300009551 | Ga0105238_10034965 | Ga0105238_100349654 | 317 |
| 645 | 3300010375 | Ga0105239_10215152 | Ga0105239_102151522 | 317 |
| 646 | 3300011119 | Ga0105246_10037203 | Ga0105246_100372032 | 317 |
| 647 | 3300013100 | Ga0157373_10041685 | Ga0157373_100416853 | 317 |
| 648 | 3300013102 | Ga0157371_10051690 | Ga0157371_100516903 | 317 |
| 649 | 3300013104 | Ga0157370_10009451 | Ga0157370_100094518 | 317 |
| 650 | 3300013105 | Ga0157369_10253549 | Ga0157369_102535492 | 317 |
| 651 | 3300013296 | Ga0157374_10001734 | Ga0157374_100017344 | 317 |
| 652 | 3300013297 | Ga0157378_10082324 | Ga0157378_100823243 | 317 |
| 653 | 3300013306 | Ga0163162_10127176 | Ga0163162_101271762 | 317 |
| 654 | 3300013306 | Ga0163162_10127640 | Ga0163162_101276402 | 317 |
| 655 | 3300014325 | Ga0163163_10070822 | Ga0163163_100708222 | 317 |
| 656 | 3300014745 | Ga0157377_10027628 | Ga0157377_100276282 | 317 |
| 657 | 3300014968 | Ga0157379_10031503 | Ga0157379_100315033 | 317 |
| 658 | 3300014969 | Ga0157376_10068402 | Ga0157376_100684023 | 317 |
| 659 | 3300014969 | Ga0157376_10168937 | Ga0157376_101689371 | 317 |
| 660 | 3300017792 | Ga0163161_10014997 | Ga0163161_100149974 | 317 |
| 661 | 3300025284 | Ga0209130_1001163 | Ga0209130_100116313 | 317 |
| 662 | 3300025294 | Ga0209025_1000328 | Ga0209025_10003285 | 317 |
| 663 | 3300025297 | Ga0209758_1001871 | Ga0209758_100187114 | 317 |
| 664 | 3300025302 | Ga0207426_1000235 | Ga0207426_100023599 | 317 |
| 665 | 3300025898 | Ga0207692_10056904 | Ga0207692_100569042 | 317 |
| 666 | 3300025899 | Ga0207642_10001781 | Ga0207642_100017816 | 317 |
| 667 | 3300025903 | Ga0207680_10011039 | Ga0207680_100110393 | 317 |
| 668 | 3300025906 | Ga0207699_10074132 | Ga0207699_100741322 | 317 |
| 669 | 3300025907 | Ga0207645_10056399 | Ga0207645_100563992 | 317 |
| 670 | 3300025910 | Ga0207684_10060695 | Ga0207684_100606954 | 317 |
| 671 | 3300025911 | Ga0207654_10001352 | Ga0207654_1000135210 | 317 |
| 672 | 3300025912 | Ga0207707_10005308 | Ga0207707_100053088 | 317 |
| 673 | 3300025913 | Ga0207695_10043723 | Ga0207695_100437231 | 317 |
| 674 | 3300025914 | Ga0207671_10107413 | Ga0207671_101074132 | 317 |
| 675 | 3300025915 | Ga0207693_10000070 | Ga0207693_100000709 | 317 |
| 676 | 3300025916 | Ga0207663_10034707 | Ga0207663_100347073 | 317 |
| 677 | 3300025916 | Ga0207663_10101271 | Ga0207663_101012712 | 317 |
| 678 | 3300025917 | Ga0207660_10018761 | Ga0207660_100187614 | 317 |
| 679 | 3300025919 | Ga0207657_10006160 | Ga0207657_100061607 | 317 |
| 680 | 3300025920 | Ga0207649_10171427 | Ga0207649_101714272 | 317 |
| 681 | 3300025922 | Ga0207646_10080148 | Ga0207646_100801483 | 317 |
| 682 | 3300025925 | Ga0207650_10064049 | Ga0207650_100640493 | 317 |
| 683 | 3300025927 | Ga0207687_10053692 | Ga0207687_100536923 | 317 |
| 684 | 3300025928 | Ga0207700_10009237 | Ga0207700_100092375 | 317 |
| 685 | 3300025928 | Ga0207700_10056892 | Ga0207700_100568922 | 317 |
| 686 | 3300025929 | Ga0207664_10001186 | Ga0207664_1000118614 | 317 |
| 687 | 3300025931 | Ga0207644_10011640 | Ga0207644_100116401 | 317 |
| 688 | 3300025931 | Ga0207644_10075156 | Ga0207644_100751562 | 317 |
| 689 | 3300025932 | Ga0207690_10133755 | Ga0207690_101337551 | 317 |
| 690 | 3300025933 | Ga0207706_10073512 | Ga0207706_100735123 | 317 |
| 691 | 3300025934 | Ga0207686_10000520 | Ga0207686_100005209 | 317 |
| 692 | 3300025934 | Ga0207686_10085595 | Ga0207686_100855953 | 317 |
| 693 | 3300025935 | Ga0207709_10370959 | Ga0207709_103709591 | 317 |
| 694 | 3300025936 | Ga0207670_10039008 | Ga0207670_100390082 | 317 |
| 695 | 3300025937 | Ga0207669_10034065 | Ga0207669_100340652 | 317 |
| 696 | 3300025938 | Ga0207704_10007350 | Ga0207704_100073503 | 317 |
| 697 | 3300025939 | Ga0207665_10021996 | Ga0207665_100219964 | 317 |
| 698 | 3300025939 | Ga0207665_10082049 | Ga0207665_100820492 | 317 |
| 699 | 3300025940 | Ga0207691_10233158 | Ga0207691_102331582 | 317 |
| 700 | 3300025941 | Ga0207711_10261434 | Ga0207711_102614342 | 317 |
| 701 | 3300025942 | Ga0207689_10018916 | Ga0207689_100189164 | 317 |
| 702 | 3300025942 | Ga0207689_10023643 | Ga0207689_100236433 | 317 |
| 703 | 3300025944 | Ga0207661_10039572 | Ga0207661_100395724 | 317 |
| 704 | 3300025945 | Ga0207679_10134289 | Ga0207679_101342892 | 317 |
| 705 | 3300025949 | Ga0207667_10077947 | Ga0207667_100779474 | 317 |
| 706 | 3300025972 | Ga0207668_10074026 | Ga0207668_100740262 | 317 |
| 707 | 3300025981 | Ga0207640_10133268 | Ga0207640_101332682 | 317 |
| 708 | 3300025986 | Ga0207658_10022101 | Ga0207658_100221012 | 317 |
| 709 | 3300026023 | Ga0207677_10029061 | Ga0207677_100290613 | 317 |
| 710 | 3300026035 | Ga0207703_10022993 | Ga0207703_100229934 | 317 |
| 711 | 3300026035 | Ga0207703_10205804 | Ga0207703_102058041 | 317 |
| 712 | 3300026041 | Ga0207639_10015836 | Ga0207639_100158363 | 317 |
| 713 | 3300026075 | Ga0207708_10141554 | Ga0207708_101415542 | 317 |
| 714 | 3300026078 | Ga0207702_10033733 | Ga0207702_100337332 | 317 |
| 715 | 3300026078 | Ga0207702_10195819 | Ga0207702_101958191 | 317 |
| 716 | 3300026088 | Ga0207641_10007815 | Ga0207641_100078156 | 317 |
| 717 | 3300026089 | Ga0207648_10021207 | Ga0207648_100212073 | 317 |
| 718 | 3300026095 | Ga0207676_10002757 | Ga0207676_1000275711 | 317 |
| 719 | 3300026116 | Ga0207674_10008147 | Ga0207674_100081476 | 317 |
| 720 | 3300026118 | Ga0207675_100252636 | Ga0207675_1002526362 | 317 |
| 721 | 3300026121 | Ga0207683_10000503 | Ga0207683_100005036 | 317 |
| 722 | 3300026121 | Ga0207683_10018772 | Ga0207683_100187723 | 317 |
| 723 | 3300027907 | Ga0207428_10001513 | Ga0207428_100015139 | 317 |
| 724 | 3300028379 | Ga0268266_10005672 | Ga0268266_100056728 | 317 |
| 725 | 3300028379 | Ga0268266_10024830 | Ga0268266_100248304 | 317 |
| 726 | 3300028381 | Ga0268264_10029236 | Ga0268264_100292363 | 317 |
| 727 | 3300028381 | Ga0268264_10061138 | Ga0268264_100611382 | 317 |
| 728 | 3300031711 | Ga0265314_10043562 | Ga0265314_100435623 | 317 |
| 729 | 3300031731 | Ga0307405_10071431 | Ga0307405_100714312 | 317 |
| 730 | 3300031824 | Ga0307413_10170881 | Ga0307413_101708812 | 317 |
| 731 | 3300031852 | Ga0307410_10047191 | Ga0307410_100471913 | 317 |
| 732 | 3300032004 | Ga0307414_10042351 | Ga0307414_100423512 | 317 |
| 733 | 3300032005 | Ga0307411_10031544 | Ga0307411_100315442 | 317 |
| 734 | 3300035083 | Ga0373926_0038908 | Ga0373926_0038908_414_1433 | 317 |
| 735 | 3300035086 | Ga0373934_0023345 | Ga0373934_0023345_868_1887 | 317 |
| 736 | 3300035113 | Ga0373936_0071331 | Ga0373936_0071331_217_1236 | 317 |
| 737 | 3300035116 | Ga0373945_0014320 | Ga0373945_0014320_230_1249 | 317 |
| 738 | 3300035116 | Ga0373945_0022309 | Ga0373945_0022309_781_1800 | 317 |
| 739 | 3300035118 | Ga0373954_0010094 | Ga0373954_0010094_1798_2817 | 317 |
| 740 | 3300035119 | Ga0373956_0022239 | Ga0373956_0022239_1008_2027 | 317 |
| 741 | 3300035120 | Ga0373957_0010902 | Ga0373957_0010902_1014_2033 | 317 |
| 742 | 3300035170 | Ga0373943_0004090 | Ga0373943_0004090_1142_2161 | 317 |
| 743 | 3300035171 | Ga0373946_0019189 | Ga0373946_0019189_1022_2041 | 317 |
| 744 | 3300035692 | Ga0373935_0017872 | Ga0373935_0017872_430_1449 | 317 |
| 745 | 3300035692 | Ga0373935_0073556 | Ga0373935_0073556_970_1989 | 317 |
| 746 | 3300035695 | Ga0373927_0009262 | Ga0373927_0009262_1841_2860 | 317 |
| 747 | 3300035695 | Ga0373927_0067048 | Ga0373927_0067048_472_1491 | 317 |
| 748 | 3300035724 | Ga0373933_0052787 | Ga0373933_0052787_535_1554 | 317 |
| 749 | 3300035725 | Ga0373947_0018280 | Ga0373947_0018280_564_1583 | 317 |
| 750 | 3300035725 | Ga0373947_0115911 | Ga0373947_0115911_318_1337 | 317 |
| 751 | 3300036401 | Ga0373937_0073389 | Ga0373937_0073389_605_1624 | 317 |
| 752 | 3300037068 | Ga0373925_0021067 | Ga0373925_0021067_1841_2860 | 317 |
| 753 | 3300037068 | Ga0373925_0030730 | Ga0373925_0030730_736_1755 | 317 |
| 754 | 3300042876 | Ga0451577_0053684 | Ga0451577_0053684_609_1628 | 317 |
| 755 | 3300042876 | Ga0451577_0167861 | Ga0451577_0167861_271_1281 | 317 |
| 756 | 3300046459 | Ga0495629_0031121 | Ga0495629_0031121_1270_2289 | 317 |
| 757 | 3300046462 | Ga0495651_0175100 | Ga0495651_0175100_368_1387 | 317 |
| 758 | 3300046512 | Ga0495610_0056390 | Ga0495610_0056390_179_1195 | 317 |
| 759 | 3300046517 | Ga0495630_0030549 | Ga0495630_0030549_1107_2126 | 317 |
| 760 | 3300046531 | Ga0495665_0009292 | Ga0495665_0009292_673_1692 | 317 |
| 761 | 3300046536 | Ga0495587_0143699 | Ga0495587_0143699_40_1059 | 317 |
| 762 | 3300046674 | Ga0495588_0108957 | Ga0495588_0108957_397_1416 | 317 |
| 763 | 3300046681 | Ga0495647_0010668 | Ga0495647_0010668_1270_2289 | 317 |
| 764 | 3300046689 | Ga0495613_0026742 | Ga0495613_0026742_1530_2549 | 317 |
| 765 | 3300047315 | Ga0495581_0000535 | Ga0495581_0000535_15643_16662 | 317 |
| 766 | 3300047322 | Ga0495680_0053268 | Ga0495680_0053268_1957_2976 | 317 |
| 767 | 3300047471 | Ga0495684_0006061 | Ga0495684_0006061_4400_5419 | 317 |
| 768 | 3300047673 | Ga0495593_0042464 | Ga0495593_0042464_812_1831 | 317 |
| 769 | 3300048905 | Ga0496102_0007689 | Ga0496102_0007689_149_1168 | 317 |
| 770 | 3300048907 | Ga0496104_0004440 | Ga0496104_0004440_10750_11769 | 317 |
| 771 | 3300048908 | Ga0496105_0152338 | Ga0496105_0152338_257_1276 | 317 |
| 772 | 3300048909 | Ga0496106_0141271 | Ga0496106_0141271_817_1836 | 317 |
| 773 | 3300048910 | Ga0496107_0091925 | Ga0496107_0091925_1016_2035 | 317 |
| 774 | 3300048911 | Ga0496108_0119966 | Ga0496108_0119966_1085_2104 | 317 |
| 775 | 3300048912 | Ga0496109_0104568 | Ga0496109_0104568_1097_2116 | 317 |
| 776 | 3300048915 | Ga0496112_0004395 | Ga0496112_0004395_149_1168 | 317 |
| 777 | 3300048916 | Ga0496113_0299682 | Ga0496113_0299682_120_1139 | 317 |
| 778 | 3300048917 | Ga0496114_0209093 | Ga0496114_0209093_21_1040 | 317 |
| 779 | 3300049580 | Ga0501046_0068872 | Ga0501046_0068872_962_1990 | 317 |
| 780 | 3300050508 | nmdc:mga09592_8084_c1 | nmdc:mga09592_8084_c1_5915_6925 | 317 |
| 781 | 3300050509 | nmdc:mga0qj67_41135_c1 | nmdc:mga0qj67_41135_c1_830_1840 | 317 |
| 782 | 3300050514 | nmdc:mga08x19_87726_c1 | nmdc:mga08x19_87726_c1_789_1808 | 317 |
| 783 | 3300053085 | Ga0495619_0007995 | Ga0495619_0007995_2681_3700 | 317 |
| 784 | 3300053139 | Ga0500568_0019136 | Ga0500568_0019136_23_1039 | 317 |
| 785 | 3300059421 | Ga0590071_021107 | Ga0590071_021107_366_1358 | 317 |
| 786 | 3300005327 | Ga0070658_10002654 | Ga0070658_1000265414 | 318 |
| 787 | 3300005327 | Ga0070658_10075930 | Ga0070658_100759302 | 318 |
| 788 | 3300005331 | Ga0070670_100098038 | Ga0070670_1000980382 | 318 |
| 789 | 3300005334 | Ga0068869_100116849 | Ga0068869_1001168492 | 318 |
| 790 | 3300005338 | Ga0068868_100286429 | Ga0068868_1002864291 | 318 |
| 791 | 3300005339 | Ga0070660_100186027 | Ga0070660_1001860272 | 318 |
| 792 | 3300005340 | Ga0070689_100023973 | Ga0070689_1000239733 | 318 |
| 793 | 3300005353 | Ga0070669_100019200 | Ga0070669_1000192002 | 318 |
| 794 | 3300005365 | Ga0070688_100017944 | Ga0070688_1000179444 | 318 |
| 795 | 3300005435 | Ga0070714_100005767 | Ga0070714_1000057675 | 318 |
| 796 | 3300005456 | Ga0070678_100265012 | Ga0070678_1002650122 | 318 |
| 797 | 3300005518 | Ga0070699_100054610 | Ga0070699_1000546103 | 318 |
| 798 | 3300005530 | Ga0070679_100283853 | Ga0070679_1002838532 | 318 |
| 799 | 3300005543 | Ga0070672_100041943 | Ga0070672_1000419433 | 318 |
| 800 | 3300005546 | Ga0070696_100009153 | Ga0070696_1000091533 | 318 |
| 801 | 3300005546 | Ga0070696_100146532 | Ga0070696_1001465322 | 318 |
| 802 | 3300005546 | Ga0070696_100209143 | Ga0070696_1002091432 | 318 |
| 803 | 3300005547 | Ga0070693_100004820 | Ga0070693_1000048205 | 318 |
| 804 | 3300005547 | Ga0070693_100013718 | Ga0070693_1000137183 | 318 |
| 805 | 3300005548 | Ga0070665_100320584 | Ga0070665_1003205842 | 318 |
| 806 | 3300005549 | Ga0070704_100019424 | Ga0070704_1000194243 | 318 |
| 807 | 3300005616 | Ga0068852_100000325 | Ga0068852_1000003253 | 318 |
| 808 | 3300005617 | Ga0068859_100036816 | Ga0068859_1000368163 | 318 |
| 809 | 3300005618 | Ga0068864_100466499 | Ga0068864_1004664991 | 318 |
| 810 | 3300005834 | Ga0068851_10001493 | Ga0068851_100014936 | 318 |
| 811 | 3300005842 | Ga0068858_100103586 | Ga0068858_1001035862 | 318 |
| 812 | 3300006195 | Ga0075366_10006869 | Ga0075366_100068692 | 318 |
| 813 | 3300006237 | Ga0097621_100005770 | Ga0097621_1000057708 | 318 |
| 814 | 3300006237 | Ga0097621_100019855 | Ga0097621_1000198553 | 318 |
| 815 | 3300006358 | Ga0068871_100001629 | Ga0068871_1000016297 | 318 |
| 816 | 3300006358 | Ga0068871_100020265 | Ga0068871_1000202655 | 318 |
| 817 | 3300006358 | Ga0068871_100154529 | Ga0068871_1001545292 | 318 |
| 818 | 3300006871 | Ga0075434_100055910 | Ga0075434_1000559104 | 318 |
| 819 | 3300006881 | Ga0068865_100020089 | Ga0068865_1000200893 | 318 |
| 820 | 3300006914 | Ga0075436_100001608 | Ga0075436_1000016088 | 318 |
| 821 | 3300006931 | Ga0097620_100036817 | Ga0097620_1000368173 | 318 |
| 822 | 3300007076 | Ga0075435_100028705 | Ga0075435_1000287052 | 318 |
| 823 | 3300009098 | Ga0105245_10041845 | Ga0105245_100418454 | 318 |
| 824 | 3300009177 | Ga0105248_10238394 | Ga0105248_102383943 | 318 |
| 825 | 3300013100 | Ga0157373_10052531 | Ga0157373_100525312 | 318 |
| 826 | 3300013296 | Ga0157374_10153335 | Ga0157374_101533353 | 318 |
| 827 | 3300013296 | Ga0157374_10182192 | Ga0157374_101821922 | 318 |
| 828 | 3300013297 | Ga0157378_10212139 | Ga0157378_102121392 | 318 |
| 829 | 3300013306 | Ga0163162_10042978 | Ga0163162_100429782 | 318 |
| 830 | 3300013307 | Ga0157372_10076502 | Ga0157372_100765023 | 318 |
| 831 | 3300014326 | Ga0157380_10151850 | Ga0157380_101518503 | 318 |
| 832 | 3300014745 | Ga0157377_10008943 | Ga0157377_100089434 | 318 |
| 833 | 3300025321 | Ga0207656_10000707 | Ga0207656_100007076 | 318 |
| 834 | 3300025908 | Ga0207643_10039006 | Ga0207643_100390063 | 318 |
| 835 | 3300025909 | Ga0207705_10010757 | Ga0207705_100107573 | 318 |
| 836 | 3300025912 | Ga0207707_10041797 | Ga0207707_100417972 | 318 |
| 837 | 3300025924 | Ga0207694_10119003 | Ga0207694_101190032 | 318 |
| 838 | 3300025925 | Ga0207650_10048329 | Ga0207650_100483293 | 318 |
| 839 | 3300025926 | Ga0207659_10044153 | Ga0207659_100441533 | 318 |
| 840 | 3300025926 | Ga0207659_10102613 | Ga0207659_101026132 | 318 |
| 841 | 3300025927 | Ga0207687_10037559 | Ga0207687_100375593 | 318 |
| 842 | 3300025934 | Ga0207686_10146353 | Ga0207686_101463532 | 318 |
| 843 | 3300025936 | Ga0207670_10007266 | Ga0207670_100072663 | 318 |
| 844 | 3300025937 | Ga0207669_10073212 | Ga0207669_100732122 | 318 |
| 845 | 3300025938 | Ga0207704_10222934 | Ga0207704_102229342 | 318 |
| 846 | 3300025941 | Ga0207711_10192784 | Ga0207711_101927842 | 318 |
| 847 | 3300025942 | Ga0207689_10072374 | Ga0207689_100723743 | 318 |
| 848 | 3300025942 | Ga0207689_10154799 | Ga0207689_101547992 | 318 |
| 849 | 3300026023 | Ga0207677_10016950 | Ga0207677_100169503 | 318 |
| 850 | 3300026035 | Ga0207703_10097347 | Ga0207703_100973473 | 318 |
| 851 | 3300026121 | Ga0207683_10047847 | Ga0207683_100478473 | 318 |
| 852 | 3300026142 | Ga0207698_10010409 | Ga0207698_100104091 | 318 |
| 853 | 3300028379 | Ga0268266_10272887 | Ga0268266_102728872 | 318 |
| 854 | 3300028794 | Ga0307515_10000030 | Ga0307515_10000030163 | 318 |
| 855 | 3300031730 | Ga0307516_10000839 | Ga0307516_100008399 | 318 |
| 856 | 3300035086 | Ga0373934_0065656 | Ga0373934_0065656_264_1271 | 318 |
| 857 | 3300037418 | Ga0395900_0044462 | Ga0395900_0044462_1640_2644 | 318 |
| 858 | 3300038443 | Ga0395901_0044397 | Ga0395901_0044397_1419_2423 | 318 |
| 859 | 3300044693 | Ga0466961_0089476 | Ga0466961_0089476_508_1512 | 318 |
| 860 | 3300044842 | Ga0466957_0015102 | Ga0466957_0015102_1420_2424 | 318 |
| 861 | 3300046454 | Ga0495592_0061687 | Ga0495592_0061687_597_1604 | 318 |
| 862 | 3300046462 | Ga0495651_0050662 | Ga0495651_0050662_69_1076 | 318 |
| 863 | 3300046463 | Ga0495653_0056762 | Ga0495653_0056762_318_1325 | 318 |
| 864 | 3300046529 | Ga0495652_0157146 | Ga0495652_0157146_644_1651 | 318 |
| 865 | 3300046536 | Ga0495587_0003976 | Ga0495587_0003976_8217_9224 | 318 |
| 866 | 3300046543 | Ga0495645_0000502 | Ga0495645_0000502_14919_15926 | 318 |
| 867 | 3300046559 | Ga0495667_0051856 | Ga0495667_0051856_621_1628 | 318 |
| 868 | 3300046660 | Ga0495625_0058844 | Ga0495625_0058844_906_1940 | 318 |
| 869 | 3300046663 | Ga0495635_0048111 | Ga0495635_0048111_53_1060 | 318 |
| 870 | 3300046678 | Ga0495599_0003122 | Ga0495599_0003122_1743_2750 | 318 |
| 871 | 3300047472 | Ga0495686_0005215 | Ga0495686_0005215_5227_6237 | 318 |
| 872 | 3300048088 | Ga0495602_0077123 | Ga0495602_0077123_345_1352 | 318 |
| 873 | 3300049571 | Ga0501034_0018257 | Ga0501034_0018257_1637_2776 | 318 |
| 874 | 3300049581 | Ga0501047_0044468 | Ga0501047_0044468_1904_3043 | 318 |
| 875 | 3300049583 | Ga0501067_0003121 | Ga0501067_0003121_1611_2750 | 318 |
| 876 | 3300049585 | Ga0501069_0099739 | Ga0501069_0099739_18_1157 | 318 |
| 877 | 3300049586 | Ga0501070_0001451 | Ga0501070_0001451_7148_8287 | 318 |
| 878 | 3300049588 | Ga0501072_0030219 | Ga0501072_0030219_2198_3337 | 318 |
| 879 | 3300049589 | Ga0501073_0008058 | Ga0501073_0008058_2263_3402 | 318 |
| 880 | 3300049590 | Ga0501074_0062953 | Ga0501074_0062953_1111_2250 | 318 |
| 881 | 3300049741 | Ga0501079_0113768 | Ga0501079_0113768_753_1892 | 318 |
| 882 | 3300049742 | Ga0501080_0015826 | Ga0501080_0015826_4036_5175 | 318 |
| 883 | 3300049742 | Ga0501080_0072595 | Ga0501080_0072595_1035_2174 | 318 |
| 884 | 3300049744 | Ga0501083_0004010 | Ga0501083_0004010_5361_6500 | 318 |
| 885 | 3300050496 | nmdc:mga07m45_71156_c1 | nmdc:mga07m45_71156_c1_351_1358 | 318 |
| 886 | 3300050512 | nmdc:mga0n895_45054_c1 | nmdc:mga0n895_45054_c1_2664_3671 | 318 |
| 887 | 3300050514 | nmdc:mga08x19_2660_c1 | nmdc:mga08x19_2660_c1_4824_5831 | 318 |
| 888 | 3300053077 | Ga0495601_0006136 | Ga0495601_0006136_784_1791 | 318 |
| 889 | 3300054114 | Ga0501084_0231389 | Ga0501084_0231389_408_1547 | 318 |
| 890 | iso_pu_bacteria | 2738543013 | 2739248044 | 318 |
| 891 | iso_pu_bacteria | 2904449895 | 2904452686 | 318 |
| 892 | iso_pu_bacteria | 2904541872 | 2904547091 | 318 |
| 893 | iso_pu_bacteria | 2929160207 | 2929165627 | 318 |
| 894 | iso_pu_bacteria | 2929520902 | 2929522636 | 318 |
| 895 | iso_pu_bacteria | 2954767861 | 2954769126 | 318 |
| 896 | 3300005456 | Ga0070678_100038668 | Ga0070678_1000386683 | 319 |
| 897 | 3300005543 | Ga0070672_100015306 | Ga0070672_1000153062 | 319 |
| 898 | 3300005548 | Ga0070665_100263201 | Ga0070665_1002632012 | 319 |
| 899 | 3300005842 | Ga0068858_100000730 | Ga0068858_10000073032 | 319 |
| 900 | 3300009147 | Ga0114129_10140657 | Ga0114129_101406573 | 319 |
| 901 | 3300010375 | Ga0105239_10272694 | Ga0105239_102726942 | 319 |
| 902 | 3300025294 | Ga0209025_1000286 | Ga0209025_100028665 | 319 |
| 903 | 3300025919 | Ga0207657_10105256 | Ga0207657_101052561 | 319 |
| 904 | 3300025937 | Ga0207669_10154485 | Ga0207669_101544852 | 319 |
| 905 | 3300025940 | Ga0207691_10027404 | Ga0207691_100274045 | 319 |
| 906 | 3300026116 | Ga0207674_10110494 | Ga0207674_101104943 | 319 |
| 907 | 3300026121 | Ga0207683_10056247 | Ga0207683_100562473 | 319 |
| 908 | 3300031730 | Ga0307516_10001570 | Ga0307516_1000157019 | 319 |
| 909 | 3300031824 | Ga0307413_10248844 | Ga0307413_102488442 | 319 |
| 910 | 3300039437 | Ga0436365_1320810 | Ga0436365_1320810_330_1340 | 319 |
| 911 | 3300042001 | Ga0439441_003356 | Ga0439441_003356_922_1929 | 319 |
| 912 | 3300049576 | Ga0501040_0039666 | Ga0501040_0039666_664_1686 | 319 |
| 913 | 3300049588 | Ga0501072_0049620 | Ga0501072_0049620_178_1200 | 319 |
| 914 | 3300050507 | nmdc:mga05p37_302592_c1 | nmdc:mga05p37_302592_c1_122_1171 | 319 |
| 915 | 3300050509 | nmdc:mga0qj67_34644_c1 | nmdc:mga0qj67_34644_c1_368_1417 | 319 |
| 916 | 3300059624 | Ga0587109_011735 | Ga0587109_011735_142_1191 | 319 |
| 917 | 3300059649 | Ga0587102_003400 | Ga0587102_003400_109_1158 | 319 |
| 918 | iso_pu_bacteria | 2842677519 | 2842680239 | 319 |
| 919 | iso_pu_bacteria | 2885192300 | 2885194412 | 319 |
| 920 | iso_pu_bacteria | 2904456579 | 2904460717 | 319 |
| 921 | iso_pu_bacteria | 2919462493 | 2919463685 | 319 |
| 922 | iso_pu_bacteria | 2945945610 | 2945945803 | 319 |
| 923 | iso_pu_bacteria | 2945972063 | 2945975433 | 319 |
| 924 | 3300005331 | Ga0070670_100006352 | Ga0070670_1000063526 | 320 |
| 925 | 3300005354 | Ga0070675_100012109 | Ga0070675_1000121095 | 320 |
| 926 | 3300005355 | Ga0070671_100071629 | Ga0070671_1000716294 | 320 |
| 927 | 3300005456 | Ga0070678_100074121 | Ga0070678_1000741211 | 320 |
| 928 | 3300005543 | Ga0070672_100030272 | Ga0070672_1000302724 | 320 |
| 929 | 3300005618 | Ga0068864_100079737 | Ga0068864_1000797372 | 320 |
| 930 | 3300005841 | Ga0068863_100039786 | Ga0068863_1000397863 | 320 |
| 931 | 3300006237 | Ga0097621_100024461 | Ga0097621_1000244614 | 320 |
| 932 | 3300006844 | Ga0075428_100011999 | Ga0075428_1000119997 | 320 |
| 933 | 3300009094 | Ga0111539_10014358 | Ga0111539_100143584 | 320 |
| 934 | 3300009094 | Ga0111539_10137142 | Ga0111539_101371421 | 320 |
| 935 | 3300013306 | Ga0163162_10085275 | Ga0163162_100852754 | 320 |
| 936 | 3300013308 | Ga0157375_10024702 | Ga0157375_100247022 | 320 |
| 937 | 3300014325 | Ga0163163_10047946 | Ga0163163_100479463 | 320 |
| 938 | 3300014969 | Ga0157376_10024018 | Ga0157376_100240183 | 320 |
| 939 | 3300025925 | Ga0207650_10022051 | Ga0207650_100220514 | 320 |
| 940 | 3300025926 | Ga0207659_10203351 | Ga0207659_102033511 | 320 |
| 941 | 3300025931 | Ga0207644_10132129 | Ga0207644_101321293 | 320 |
| 942 | 3300025960 | Ga0207651_10016651 | Ga0207651_100166514 | 320 |
| 943 | 3300026095 | Ga0207676_10045404 | Ga0207676_100454041 | 320 |
| 944 | 3300026121 | Ga0207683_10015036 | Ga0207683_100150368 | 320 |
| 945 | 3300027907 | Ga0207428_10003990 | Ga0207428_1000399011 | 320 |
| 946 | 3300028794 | Ga0307515_10051395 | Ga0307515_100513953 | 320 |
| 947 | 3300031456 | Ga0307513_10000924 | Ga0307513_1000092424 | 320 |
| 948 | 3300037471 | Ga0395905_0041886 | Ga0395905_0041886_2848_3879 | 320 |
| 949 | 3300047443 | Ga0495687_031562 | Ga0495687_031562_611_1636 | 320 |
| 950 | 3300049130 | Ga0501310_004251 | Ga0501310_004251_18_1016 | 320 |
| 951 | 3300050511 | nmdc:mga08y16_9580_c1 | nmdc:mga08y16_9580_c1_1931_2938 | 320 |
| 952 | iso_pu_bacteria | 2945909444 | 2945909698 | 320 |
| 953 | iso_pu_bacteria | 2945984333 | 2945988333 | 320 |
| 954 | 3300005331 | Ga0070670_100274809 | Ga0070670_1002748091 | 321 |
| 955 | 3300005344 | Ga0070661_100068111 | Ga0070661_1000681113 | 321 |
| 956 | 3300005344 | Ga0070661_100096885 | Ga0070661_1000968852 | 321 |
| 957 | 3300005564 | Ga0070664_100111652 | Ga0070664_1001116523 | 321 |
| 958 | 3300005578 | Ga0068854_100316253 | Ga0068854_1003162532 | 321 |
| 959 | 3300006195 | Ga0075366_10008494 | Ga0075366_100084947 | 321 |
| 960 | 3300006353 | Ga0075370_10006736 | Ga0075370_100067367 | 321 |
| 961 | 3300013297 | Ga0157378_10301550 | Ga0157378_103015501 | 321 |
| 962 | 3300025901 | Ga0207688_10026991 | Ga0207688_100269912 | 321 |
| 963 | 3300025920 | Ga0207649_10074248 | Ga0207649_100742482 | 321 |
| 964 | 3300025925 | Ga0207650_10003752 | Ga0207650_100037523 | 321 |
| 965 | 3300025960 | Ga0207651_10027002 | Ga0207651_100270023 | 321 |
| 966 | 3300026041 | Ga0207639_10107397 | Ga0207639_101073972 | 321 |
| 967 | 3300027876 | Ga0209974_10001716 | Ga0209974_100017167 | 321 |
| 968 | 3300028379 | Ga0268266_10120010 | Ga0268266_101200103 | 321 |
| 969 | 3300037471 | Ga0395905_0116788 | Ga0395905_0116788_521_1549 | 321 |
| 970 | 3300042876 | Ga0451577_0004664 | Ga0451577_0004664_8019_9074 | 321 |
| 971 | 3300042876 | Ga0451577_0017515 | Ga0451577_0017515_2173_3414 | 321 |
| 972 | 3300046454 | Ga0495592_0000727 | Ga0495592_0000727_5044_6078 | 321 |
| 973 | 3300050493 | nmdc:mga0k408_8592_c1 | nmdc:mga0k408_8592_c1_1219_2253 | 321 |
| 974 | 3300050496 | nmdc:mga07m45_5517_c1 | nmdc:mga07m45_5517_c1_1287_2321 | 321 |
| 975 | 3300003784 | Ga0055534_1000958 | Ga0055534_10009586 | 322 |
| 976 | 3300005288 | Ga0065714_10015959 | Ga0065714_100159591 | 322 |
| 977 | 3300006195 | Ga0075366_10010447 | Ga0075366_100104477 | 322 |
| 978 | 3300006880 | Ga0075429_100014877 | Ga0075429_1000148773 | 322 |
| 979 | 3300025284 | Ga0209130_1001760 | Ga0209130_10017606 | 322 |
| 980 | 3300025291 | Ga0209675_1001002 | Ga0209675_10010029 | 322 |
| 981 | 3300025292 | Ga0209676_1007117 | Ga0209676_10071176 | 322 |
| 982 | 3300025298 | Ga0209050_1040650 | Ga0209050_10406501 | 322 |
| 983 | 3300025303 | Ga0209051_1018102 | Ga0209051_10181023 | 322 |
| 984 | 3300025304 | Ga0209257_1007808 | Ga0209257_10078085 | 322 |
| 985 | 3300030745 | Ga0316182_1352626 | Ga0316182_13526263 | 322 |
| 986 | 3300031456 | Ga0307513_10179781 | Ga0307513_101797811 | 322 |
| 987 | 3300031616 | Ga0307508_10016499 | Ga0307508_100164996 | 322 |
| 988 | 3300031649 | Ga0307514_10100671 | Ga0307514_101006712 | 322 |
| 989 | 3300033180 | Ga0307510_10002141 | Ga0307510_1000214120 | 322 |
| 990 | 3300044842 | Ga0466957_0017998 | Ga0466957_0017998_331_1359 | 322 |
| 991 | 3300046460 | Ga0495638_0086632 | Ga0495638_0086632_211_1248 | 322 |
| 992 | 3300046660 | Ga0495625_0002019 | Ga0495625_0002019_15415_16437 | 322 |
| 993 | 3300048903 | Ga0496100_0150311 | Ga0496100_0150311_479_1507 | 322 |
| 994 | 3300048924 | Ga0496121_0027380 | Ga0496121_0027380_3044_4072 | 322 |
| 995 | 3300049533 | Ga0501317_001111 | Ga0501317_001111_1153_2184 | 322 |
| 996 | 3300049759 | Ga0501262_000180 | Ga0501262_000180_3649_4671 | 322 |
| 997 | 3300050492 | nmdc:mga0yw44_22504_c1 | nmdc:mga0yw44_22504_c1_570_1592 | 322 |
| 998 | 3300050493 | nmdc:mga0k408_8004_c1 | nmdc:mga0k408_8004_c1_3797_4831 | 322 |
| 999 | 3300050508 | nmdc:mga09592_1120_c1 | nmdc:mga09592_1120_c1_15832_16869 | 322 |
| 1000 | 3300050509 | nmdc:mga0qj67_158070_c1 | nmdc:mga0qj67_158070_c1_476_1513 | 322 |
| 1001 | 3300053092 | Ga0500583_0075229 | Ga0500583_0075229_406_1443 | 322 |
| 1002 | iso_pu_bacteria | 2597490356 | 2599103642 | 322 |
| 1003 | iso_pu_bacteria | 2599185214 | 2599626470 | 322 |
| 1004 | iso_pu_bacteria | 2599185226 | 2599677077 | 322 |
| 1005 | iso_pu_bacteria | 2599185227 | 2599682171 | 322 |
| 1006 | iso_pu_bacteria | 2599185229 | 2599695822 | 322 |
| 1007 | iso_pu_bacteria | 2643221658 | 2644328626 | 322 |
| 1008 | iso_pu_bacteria | 2818991446 | 2819601742 | 322 |
| 1009 | iso_pu_bacteria | 2831265667 | 2831272177 | 322 |
| 1010 | iso_pu_bacteria | 2838054893 | 2838059341 | 322 |
| 1011 | iso_pu_bacteria | 2846952575 | 2846957326 | 322 |
| 1012 | iso_pu_bacteria | 2848858292 | 2848863333 | 322 |
| 1013 | iso_pu_bacteria | 2885198086 | 2885202922 | 322 |
| 1014 | iso_pu_bacteria | 2885211737 | 2885216681 | 322 |
| 1015 | iso_pu_bacteria | 2899924645 | 2899930809 | 322 |
| 1016 | iso_pu_bacteria | 2928037797 | 2928040870 | 322 |
| 1017 | iso_pu_bacteria | 2928044640 | 2928047712 | 322 |
| 1018 | iso_pu_bacteria | 2928051484 | 2928055602 | 322 |
| 1019 | iso_pu_bacteria | 2928064002 | 2928069699 | 322 |
| 1020 | iso_pu_bacteria | 2928070936 | 2928075441 | 322 |
| 1021 | 3300001989 | JGI24739J22299_10053786 | JGI24739J22299_100537861 | 323 |
| 1022 | 3300003773 | Ga0055537_1000208 | Ga0055537_100020838 | 323 |
| 1023 | 3300003784 | Ga0055534_1000198 | Ga0055534_10001987 | 323 |
| 1024 | 3300003790 | Ga0055528_1000306 | Ga0055528_10003065 | 323 |
| 1025 | 3300006051 | Ga0075364_10019233 | Ga0075364_100192334 | 323 |
| 1026 | 3300006195 | Ga0075366_10052699 | Ga0075366_100526992 | 323 |
| 1027 | 3300006353 | Ga0075370_10023998 | Ga0075370_100239983 | 323 |
| 1028 | 3300006948 | Ga0099826_10073580 | Ga0099826_100735802 | 323 |
| 1029 | 3300013100 | Ga0157373_10027114 | Ga0157373_100271143 | 323 |
| 1030 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020195 | 323 |
| 1031 | 3300025273 | Ga0209673_1000072 | Ga0209673_10000725 | 323 |
| 1032 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014184 | 323 |
| 1033 | 3300025292 | Ga0209676_1018341 | Ga0209676_10183413 | 323 |
| 1034 | 3300025303 | Ga0209051_1000461 | Ga0209051_100046111 | 323 |
| 1035 | 3300027666 | Ga0209282_1004201 | Ga0209282_10042017 | 323 |
| 1036 | 3300028786 | Ga0307517_10236544 | Ga0307517_102365441 | 323 |
| 1037 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034234 | 323 |
| 1038 | 3300030731 | Ga0316177_1084583 | Ga0316177_10845834 | 323 |
| 1039 | 3300030732 | Ga0316176_1043862 | Ga0316176_10438623 | 323 |
| 1040 | 3300030733 | Ga0314311_1136633 | Ga0314311_11366333 | 323 |
| 1041 | 3300030735 | Ga0316178_1001707 | Ga0316178_10017074 | 323 |
| 1042 | 3300030742 | Ga0316183_1034028 | Ga0316183_10340285 | 323 |
| 1043 | 3300031456 | Ga0307513_10183595 | Ga0307513_101835952 | 323 |
| 1044 | 3300031901 | Ga0307406_10168255 | Ga0307406_101682552 | 323 |
| 1045 | 3300031911 | Ga0307412_10150097 | Ga0307412_101500972 | 323 |
| 1046 | 3300031911 | Ga0307412_10156718 | Ga0307412_101567182 | 323 |
| 1047 | 3300032004 | Ga0307414_10049656 | Ga0307414_100496564 | 323 |
| 1048 | 3300036401 | Ga0373937_0096628 | Ga0373937_0096628_796_1902 | 323 |
| 1049 | 3300041411 | Ga0439466_0003499 | Ga0439466_0003499_1672_2703 | 323 |
| 1050 | 3300041413 | Ga0439465_0000906 | Ga0439465_0000906_5733_6764 | 323 |
| 1051 | 3300041997 | Ga0439431_0017028 | Ga0439431_0017028_230_1261 | 323 |
| 1052 | 3300041999 | Ga0439433_0002551 | Ga0439433_0002551_1511_2542 | 323 |
| 1053 | 3300042006 | Ga0439432_001993 | Ga0439432_001993_5412_6443 | 323 |
| 1054 | 3300042007 | Ga0439449_0009165 | Ga0439449_0009165_2287_3318 | 323 |
| 1055 | 3300042010 | Ga0439452_006599 | Ga0439452_006599_1859_2890 | 323 |
| 1056 | 3300042014 | Ga0439457_001803 | Ga0439457_001803_1675_2706 | 323 |
| 1057 | 3300042015 | Ga0439462_0003738 | Ga0439462_0003738_1660_2691 | 323 |
| 1058 | 3300042439 | Ga0439464_0002509 | Ga0439464_0002509_3340_4374 | 323 |
| 1059 | 3300044683 | Ga0466965_0020374 | Ga0466965_0020374_1047_2078 | 323 |
| 1060 | 3300046517 | Ga0495630_0056112 | Ga0495630_0056112_1321_2379 | 323 |
| 1061 | 3300049679 | Ga0501249_005845 | Ga0501249_005845_903_1928 | 323 |
| 1062 | 3300049758 | Ga0501241_019332 | Ga0501241_019332_107_1132 | 323 |
| 1063 | 3300050489 | nmdc:mga03683_32556_c1 | nmdc:mga03683_32556_c1_409_1434 | 323 |
| 1064 | 3300050489 | nmdc:mga03683_662_c1 | nmdc:mga03683_662_c1_7185_8210 | 323 |
| 1065 | 3300050490 | nmdc:mga03n38_21320_c1 | nmdc:mga03n38_21320_c1_824_1849 | 323 |
| 1066 | 3300050493 | nmdc:mga0k408_188809_c1 | nmdc:mga0k408_188809_c1_22_1053 | 323 |
| 1067 | 3300050493 | nmdc:mga0k408_6810_c1 | nmdc:mga0k408_6810_c1_4333_5358 | 323 |
| 1068 | 3300002773 | JGI25152J39213_1014338 | JGI25152J39213_10143381 | 324 |
| 1069 | 3300003187 | JGI25151J46595_10000484 | JGI25151J46595_100004843 | 324 |
| 1070 | 3300009148 | Ga0105243_10008545 | Ga0105243_100085452 | 324 |
| 1071 | 3300013104 | Ga0157370_10001435 | Ga0157370_1000143512 | 324 |
| 1072 | 3300025258 | Ga0209129_1001758 | Ga0209129_100175813 | 324 |
| 1073 | 3300025294 | Ga0209025_1000207 | Ga0209025_1000207106 | 324 |
| 1074 | 3300025935 | Ga0207709_10004462 | Ga0207709_100044623 | 324 |
| 1075 | 3300031911 | Ga0307412_10043577 | Ga0307412_100435772 | 324 |
| 1076 | 3300046453 | Ga0495627_004268 | Ga0495627_004268_3396_4424 | 324 |
| 1077 | 3300046515 | Ga0495620_0017826 | Ga0495620_0017826_1130_2158 | 324 |
| 1078 | 3300046674 | Ga0495588_0021515 | Ga0495588_0021515_1801_2829 | 324 |
| 1079 | 3300046692 | Ga0495671_0009477 | Ga0495671_0009477_1162_2190 | 324 |
| 1080 | 3300053117 | Ga0500593_000388 | Ga0500593_000388_14708_15736 | 324 |
| 1081 | 3300053158 | Ga0500627_0000792 | Ga0500627_0000792_5586_6614 | 324 |
| 1082 | 3300003215 | JGI25153J46596_10011009 | JGI25153J46596_100110094 | 325 |
| 1083 | 3300003354 | JGI25160J50197_1003589 | JGI25160J50197_10035893 | 325 |
| 1084 | 3300003771 | Ga0055526_1009724 | Ga0055526_10097244 | 325 |
| 1085 | 3300003773 | Ga0055537_1002770 | Ga0055537_10027704 | 325 |
| 1086 | 3300003775 | Ga0055524_1001707 | Ga0055524_10017079 | 325 |
| 1087 | 3300003784 | Ga0055534_1003776 | Ga0055534_10037764 | 325 |
| 1088 | 3300003790 | Ga0055528_1009322 | Ga0055528_10093223 | 325 |
| 1089 | 3300003791 | Ga0055530_10003783 | Ga0055530_100037837 | 325 |
| 1090 | 3300003794 | Ga0055531_10001429 | Ga0055531_100014294 | 325 |
| 1091 | 3300009551 | Ga0105238_10161144 | Ga0105238_101611443 | 325 |
| 1092 | 3300025263 | Ga0209565_1002488 | Ga0209565_10024884 | 325 |
| 1093 | 3300025273 | Ga0209673_1000154 | Ga0209673_100015431 | 325 |
| 1094 | 3300025284 | Ga0209130_1000782 | Ga0209130_10007824 | 325 |
| 1095 | 3300025291 | Ga0209675_1004489 | Ga0209675_10044893 | 325 |
| 1096 | 3300025292 | Ga0209676_1000048 | Ga0209676_100004816 | 325 |
| 1097 | 3300025294 | Ga0209025_1003562 | Ga0209025_10035623 | 325 |
| 1098 | 3300025295 | Ga0209564_1000103 | Ga0209564_100010337 | 325 |
| 1099 | 3300025298 | Ga0209050_1000012 | Ga0209050_100001216 | 325 |
| 1100 | 3300025299 | Ga0209256_1000065 | Ga0209256_10000657 | 325 |
| 1101 | 3300025302 | Ga0207426_1000161 | Ga0207426_1000161157 | 325 |
| 1102 | 3300025303 | Ga0209051_1000273 | Ga0209051_100027358 | 325 |
| 1103 | 3300025304 | Ga0209257_1001999 | Ga0209257_10019997 | 325 |
| 1104 | 3300050496 | nmdc:mga07m45_80719_c1 | nmdc:mga07m45_80719_c1_211_1242 | 325 |
| 1105 | 3300001979 | JGI24740J21852_10014800 | JGI24740J21852_100148003 | 326 |
| 1106 | 3300002774 | JGI25150J39212_1001250 | JGI25150J39212_10012505 | 326 |
| 1107 | 3300002987 | JGI25159J45721_1000172 | JGI25159J45721_100017235 | 326 |
| 1108 | 3300003354 | JGI25160J50197_1000348 | JGI25160J50197_10003483 | 326 |
| 1109 | 3300003374 | JGI25161J50226_1000337 | JGI25161J50226_10003373 | 326 |
| 1110 | 3300003761 | Ga0055535_1000378 | Ga0055535_10003783 | 326 |
| 1111 | 3300003762 | Ga0055542_1000036 | Ga0055542_1000036176 | 326 |
| 1112 | 3300003771 | Ga0055526_1004796 | Ga0055526_10047967 | 326 |
| 1113 | 3300003773 | Ga0055537_1001748 | Ga0055537_10017483 | 326 |
| 1114 | 3300003775 | Ga0055524_1017096 | Ga0055524_10170963 | 326 |
| 1115 | 3300003784 | Ga0055534_1002072 | Ga0055534_10020725 | 326 |
| 1116 | 3300003790 | Ga0055528_1016769 | Ga0055528_10167693 | 326 |
| 1117 | 3300003792 | Ga0055540_1012589 | Ga0055540_10125894 | 326 |
| 1118 | 3300004625 | Ga0055543_1000503 | Ga0055543_10005033 | 326 |
| 1119 | 3300005262 | Ga0065165_1001031 | Ga0065165_100103139 | 326 |
| 1120 | 3300005539 | Ga0068853_100030460 | Ga0068853_1000304603 | 326 |
| 1121 | 3300005614 | Ga0068856_100287330 | Ga0068856_1002873301 | 326 |
| 1122 | 3300005834 | Ga0068851_10056841 | Ga0068851_100568413 | 326 |
| 1123 | 3300025228 | Ga0209672_101176 | Ga0209672_1011763 | 326 |
| 1124 | 3300025229 | Ga0209147_100472 | Ga0209147_10047223 | 326 |
| 1125 | 3300025242 | Ga0209258_100091 | Ga0209258_100091177 | 326 |
| 1126 | 3300025245 | Ga0207425_1000190 | Ga0207425_100019015 | 326 |
| 1127 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033307 | 326 |
| 1128 | 3300025258 | Ga0209129_1000091 | Ga0209129_100009128 | 326 |
| 1129 | 3300025263 | Ga0209565_1000335 | Ga0209565_100033510 | 326 |
| 1130 | 3300025273 | Ga0209673_1002551 | Ga0209673_10025514 | 326 |
| 1131 | 3300025284 | Ga0209130_1000140 | Ga0209130_100014090 | 326 |
| 1132 | 3300025291 | Ga0209675_1001248 | Ga0209675_100124810 | 326 |
| 1133 | 3300025294 | Ga0209025_1000356 | Ga0209025_100035665 | 326 |
| 1134 | 3300025295 | Ga0209564_1000597 | Ga0209564_100059710 | 326 |
| 1135 | 3300025297 | Ga0209758_1000092 | Ga0209758_1000092120 | 326 |
| 1136 | 3300025299 | Ga0209256_1000094 | Ga0209256_100009490 | 326 |
| 1137 | 3300025302 | Ga0207426_1000084 | Ga0207426_1000084113 | 326 |
| 1138 | 3300025303 | Ga0209051_1009904 | Ga0209051_10099043 | 326 |
| 1139 | 3300025321 | Ga0207656_10035021 | Ga0207656_100350213 | 326 |
| 1140 | 3300026078 | Ga0207702_10298361 | Ga0207702_102983612 | 326 |
| 1141 | 3300048921 | Ga0496118_0005318 | Ga0496118_0005318_13153_14184 | 326 |
| 1142 | 3300048926 | Ga0496123_0067475 | Ga0496123_0067475_1101_2132 | 326 |
| 1143 | 3300048928 | Ga0496125_0027763 | Ga0496125_0027763_2206_3237 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.8936 | 20 | 324 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.8878 | 20 | 324 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.8731 | 23 | 320 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.8663 | 20 | 320 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.8648 | 23 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9011 | 118 | 249 | 3.40.190.10 |
| 4x9tA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.8962 | 20 | 317 | 3.40.190.150 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8872 | 118 | 249 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.8796 | 20 | 317 | 3.40.190.150 |
| 4x9tA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.8704 | 20 | 317 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZIM3-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9348 | 56 | 321 |
GO:0051537
|
| AF-A0A5A7MKX6-F1-model_v4 | MFS transporter | 0.9305 | 39 | 320 |
|
| AF-A0A0T2YKM7-F1-model_v4 | LacI family transcriptional regulator | 0.9299 | 53 | 320 |
|
| AF-A0A261UF47-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9291 | 20 | 325 |
|
| AF-U7GDX3-F1-model_v4 | deleted | 0.9267 | 27 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar