F490738

General Info

Members Datasets Scaffolds Average Seq Length
1143 569 1049 336

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10161144|Ga0105238_101611443
Length 357
Sequence VARAERRGPGSTITTYHEEIVMNRRTLARSLAGLAAVALTALAPAYAWEPSKTVEFVVPAGTGGGADQMARLIQSIIAKHNLMKQPMVVVNKSGGAGAEGFLDVKGSKGDGHKIVITLSNLFTTPLATGVPFNWKDLTPVEMMALDEFVLWVNADTPYKTAKEYLDAVKAAGSGSDRKKMGGTGSKQEDQIITVNLEKQTGAKFIYVPFKGGGEVATQLVGKHIDSTVNNPIEAVAQWRAGSLRPLCVFDSKRMPYKDKVTKDMAWGDIPTCKESGVDVEYLMLRGIFMPGGVTPDVVKYYTDVLAKVRATDEWKKFMNDGAFNTTSMSGKEYADWVAKNEQLHMSLMKDAGFLAAK

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
9 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
10 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
16 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
17 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
18 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
19 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
20 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
21 2643221658 Variovorax sp. Root411 Isolate Unclassified
22 2643221660 Methylibium sp. Root1272 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
27 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
28 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
29 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
30 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
31 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
32 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
33 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
34 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
42 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
43 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
46 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
47 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
48 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
49 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
50 2842677519 Variovorax sp. R-72495 Isolate Unclassified
51 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
52 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
56 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
57 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
58 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
59 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
60 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
61 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
62 2885198086 Variovorax sp. 679 Isolate Unclassified
63 2885211737 Variovorax sp. 553 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
66 2899924645 Variovorax sp. 369 Isolate Unclassified
67 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
68 2904456579 Variovorax sp. 2002 Isolate Unclassified
69 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
70 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
71 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
72 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
73 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
74 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
75 2928037797 Variovorax sp. 1126 Isolate Unclassified
76 2928044640 Variovorax sp. 1128 Isolate Unclassified
77 2928051484 Variovorax sp. 1133 Isolate Unclassified
78 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
79 2928070936 Variovorax gossypii 1167 Isolate Unclassified
80 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
81 2929520902 Variovorax beijingensis 502 Isolate Unclassified
82 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
83 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
84 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
85 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
86 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
87 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
88 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
89 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
90 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
91 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
92 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
93 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
94 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
95 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
96 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
97 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
98 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
99 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
100 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
101 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
102 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
103 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
104 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
105 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
106 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
107 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
108 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
109 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
110 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
111 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
112 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
113 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
116 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
117 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
118 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
119 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
120 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
121 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
122 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
123 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
124 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
125 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
126 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
127 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
128 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
129 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
130 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
131 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
132 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
133 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
134 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
135 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
136 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
137 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
138 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
141 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
142 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
143 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
144 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
145 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
146 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
147 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
148 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
149 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
150 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
151 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
152 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
153 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
154 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
155 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
156 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
157 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
158 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
159 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
160 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
161 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
162 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
165 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
166 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
167 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
168 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
169 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
170 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
171 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
172 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
173 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
174 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
175 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
176 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
177 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
178 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
179 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
180 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
181 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
182 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
183 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
184 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
185 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
186 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
187 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
188 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
189 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
190 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
191 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
192 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
193 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
194 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
195 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
196 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
197 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
198 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
199 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
200 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
201 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
202 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
203 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
204 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
205 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
206 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
207 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
208 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
209 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
210 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
211 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
212 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
213 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
214 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
215 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
216 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
217 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
218 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
219 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
220 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
221 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
222 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
223 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
224 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
225 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
226 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
227 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
228 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
229 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
230 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
231 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
232 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
233 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
234 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
235 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
236 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
237 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
238 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
239 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
240 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
241 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
242 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
243 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
244 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
245 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
246 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
250 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
252 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
260 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
329 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
330 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
332 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
333 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
341 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
343 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
345 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
351 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
352 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
353 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
354 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
355 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
356 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
357 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
358 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
359 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
360 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
361 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
362 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
363 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
364 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
365 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
366 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
367 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
368 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
369 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
370 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
371 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
372 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
373 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
374 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
375 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
376 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
377 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
379 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
380 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
381 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
382 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
383 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
384 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
385 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
386 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
387 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
388 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
389 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
390 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
391 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
392 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
393 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
394 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
395 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
396 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
397 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
398 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
399 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
400 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
401 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
402 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
403 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
404 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
405 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
406 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
407 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
408 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
409 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
410 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
411 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
412 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
413 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
414 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
415 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
416 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
417 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
418 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
419 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
420 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
421 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
422 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
423 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
424 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
425 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
426 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
427 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
428 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
429 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
430 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
431 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
432 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
433 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
434 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
435 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
436 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
437 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
438 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
439 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
440 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
441 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
442 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
443 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
444 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
445 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
446 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
447 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
448 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
449 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
450 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
451 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
452 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
453 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
454 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
455 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
456 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
457 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
458 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
459 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
460 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
461 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
462 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
463 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
464 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
465 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
466 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
467 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
468 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
469 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
470 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
471 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
472 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
473 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
474 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
475 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
476 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
477 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
478 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
479 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
480 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
481 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
496 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
497 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
498 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
503 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
504 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
505 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
506 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
507 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
508 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
509 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
510 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
511 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
514 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
515 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
516 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
517 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
518 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
519 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
520 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
521 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
522 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
523 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
524 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
525 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
526 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
527 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
528 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
529 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
530 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
531 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
532 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
533 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
534 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
535 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
536 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
537 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
538 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
539 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
540 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
541 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
542 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
543 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
544 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
545 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
546 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
547 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
548 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
549 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
550 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
551 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
552 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
553 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
554 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
555 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
567 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
568 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
569 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.94
Metatranscriptomes 1.84
Isolates 8.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.97
Nodule 2.97
Rhizoplane 2.27
Rhizosphere 69.9
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014800 3300001979 Bacteria 2866
2 JGI24739J22299_10053786 3300001989 Bacteria 1291
3 JGI25152J39213_1003264 3300002773 Bacteria 5620
4 JGI25152J39213_1014338 3300002773 Bacteria 1611
5 JGI25150J39212_1001250 3300002774 Bacteria 7348
6 JGI25159J45721_1000172 3300002987 Bacteria 30295
7 JGI25159J45721_1018208 3300002987 Bacteria 1425
8 JGI25151J46595_10000484 3300003187 Bacteria 37639
9 JGI25151J46595_10000795 3300003187 Bacteria 25423
10 JGI25153J46596_10002000 3300003215 Bacteria 12047
11 JGI25153J46596_10002578 3300003215 Bacteria 10387
12 JGI25153J46596_10003655 3300003215 Bacteria 8519
13 JGI25153J46596_10011009 3300003215 Bacteria 4033
14 JGI25153J46596_10013460 3300003215 Bacteria 3453
15 JGI25160J50197_1000348 3300003354 Bacteria 30762
16 JGI25160J50197_1003589 3300003354 Bacteria 6887
17 JGI25160J50197_1014690 3300003354 Bacteria 2606
18 JGI25161J50226_1000337 3300003374 Bacteria 25212
19 Ga0055535_1000378 3300003761 Bacteria 42270
20 Ga0055542_1000036 3300003762 Bacteria 227346
21 Ga0055526_1001374 3300003771 Bacteria 17418
22 Ga0055526_1004796 3300003771 Bacteria 8003
23 Ga0055526_1009724 3300003771 Bacteria 4581
24 Ga0055537_1000208 3300003773 Bacteria 44120
25 Ga0055537_1001748 3300003773 Bacteria 8003
26 Ga0055537_1002770 3300003773 Bacteria 5655
27 Ga0055524_1000425 3300003775 Bacteria 35448
28 Ga0055524_1001707 3300003775 Bacteria 12218
29 Ga0055524_1017096 3300003775 Bacteria 2570
30 Ga0055534_1000198 3300003784 Bacteria 44120
31 Ga0055534_1000958 3300003784 Bacteria 12813
32 Ga0055534_1002072 3300003784 Bacteria 7237
33 Ga0055534_1003776 3300003784 Bacteria 4658
34 Ga0055528_1000306 3300003790 Bacteria 41629
35 Ga0055528_1009322 3300003790 Bacteria 4109
36 Ga0055528_1016769 3300003790 Bacteria 2570
37 Ga0055530_10001827 3300003791 Bacteria 14691
38 Ga0055530_10002550 3300003791 Bacteria 11591
39 Ga0055530_10003783 3300003791 Bacteria 8342
40 Ga0055530_10005532 3300003791 Bacteria 5964
41 Ga0055540_1000028 3300003792 Bacteria 184864
42 Ga0055540_1012589 3300003792 Bacteria 2644
43 Ga0055531_10001429 3300003794 Bacteria 17634
44 Ga0055531_10002132 3300003794 Bacteria 13551
45 Ga0055543_1000503 3300004625 Bacteria 22459
46 Ga0058863_10003707 3300004799 Bacteria 1117
47 Ga0058862_12772269 3300004803 Bacteria 1620
48 Ga0065165_1001031 3300005262 Bacteria 33766
49 Ga0065165_1001283 3300005262 Bacteria 28362
50 Ga0065165_1008884 3300005262 Bacteria 4609
51 Ga0065714_10015959 3300005288 Bacteria 1916
52 Ga0065707_10096561 3300005295 Bacteria 3256
53 Ga0065707_10234388 3300005295 Bacteria 1177
54 Ga0070658_10002654 3300005327 Bacteria 14881
55 Ga0070658_10046848 3300005327 Bacteria 3499
56 Ga0070658_10075930 3300005327 Bacteria 2757
57 Ga0070683_100014191 3300005329 Bacteria 6960
58 Ga0070683_100072206 3300005329 Bacteria 3221
59 Ga0070683_100139159 3300005329 Bacteria 2299
60 Ga0070670_100006352 3300005331 Bacteria 10003
61 Ga0070670_100098038 3300005331 Bacteria 2522
62 Ga0070670_100206049 3300005331 Bacteria 1709
63 Ga0070670_100216340 3300005331 Bacteria 1667
64 Ga0070670_100274809 3300005331 Bacteria 1471
65 Ga0070677_10066634 3300005333 Bacteria 1502
66 Ga0068869_100013906 3300005334 Bacteria 5366
67 Ga0068869_100116849 3300005334 Bacteria 2035
68 Ga0068869_100254894 3300005334 Bacteria 1403
69 Ga0070666_10004388 3300005335 Bacteria 8592
70 Ga0070666_10128550 3300005335 Bacteria 1759
71 Ga0070680_100003680 3300005336 Bacteria 11448
72 Ga0070680_100018826 3300005336 Bacteria 5462
73 Ga0070682_100016453 3300005337 Bacteria 4299
74 Ga0068868_100003486 3300005338 Bacteria 10947
75 Ga0068868_100045739 3300005338 Bacteria 3425
76 Ga0068868_100061582 3300005338 Bacteria 2973
77 Ga0068868_100114395 3300005338 Bacteria 2195
78 Ga0068868_100286429 3300005338 Bacteria 1396
79 Ga0070660_100186027 3300005339 Bacteria 1682
80 Ga0070689_100023973 3300005340 Bacteria 4573
81 Ga0070689_100039280 3300005340 Bacteria 3623
82 Ga0070691_10036068 3300005341 Bacteria 2330
83 Ga0070691_10060585 3300005341 Bacteria 1819
84 Ga0070687_100000018 3300005343 Bacteria 53672
85 Ga0070687_100249588 3300005343 Bacteria 1102
86 Ga0070661_100000474 3300005344 Bacteria 30640
87 Ga0070661_100005709 3300005344 Bacteria 8578
88 Ga0070661_100006617 3300005344 Bacteria 7993
89 Ga0070661_100011155 3300005344 Bacteria 6259
90 Ga0070661_100068111 3300005344 Bacteria 2616
91 Ga0070661_100091204 3300005344 Bacteria 2257
92 Ga0070661_100096885 3300005344 Bacteria 2189
93 Ga0070692_10001631 3300005345 Bacteria 8269
94 Ga0070692_10082902 3300005345 Bacteria 1730
95 Ga0070668_100081328 3300005347 Bacteria 2540
96 Ga0070669_100014865 3300005353 Bacteria 5546
97 Ga0070669_100019200 3300005353 Bacteria 4884
98 Ga0070669_100030223 3300005353 Bacteria 3908
99 Ga0070675_100012109 3300005354 Bacteria 6762
100 Ga0070671_100003012 3300005355 Bacteria 13118
101 Ga0070671_100011803 3300005355 Bacteria 7027
102 Ga0070671_100071629 3300005355 Bacteria 2893
103 Ga0070671_100213492 3300005355 Bacteria 1637
104 Ga0070674_100061792 3300005356 Bacteria 2615
105 Ga0070674_100139106 3300005356 Bacteria 1820
106 Ga0070688_100017944 3300005365 Bacteria 4071
107 Ga0070688_100020460 3300005365 Bacteria 3849
108 Ga0070688_100096298 3300005365 Bacteria 1944
109 Ga0070659_100001233 3300005366 Bacteria 18559
110 Ga0070659_100056895 3300005366 Bacteria 3083
111 Ga0070659_100099151 3300005366 Bacteria 2343
112 Ga0070659_100099881 3300005366 Bacteria 2335
113 Ga0070667_100029475 3300005367 Bacteria 4572
114 Ga0070667_100143144 3300005367 Bacteria 2095
115 Ga0070714_100000785 3300005435 Bacteria 22548
116 Ga0070714_100005767 3300005435 Bacteria 9495
117 Ga0070714_100292630 3300005435 Bacteria 1516
118 Ga0070713_100006452 3300005436 Bacteria 8134
119 Ga0070713_100085335 3300005436 Bacteria 2704
120 Ga0070701_10023640 3300005438 Bacteria 2964
121 Ga0070711_100030852 3300005439 Bacteria 3553
122 Ga0070705_100014462 3300005440 Bacteria 4060
123 Ga0070694_100059812 3300005444 Bacteria 2596
124 Ga0070678_100000773 3300005456 Bacteria 16046
125 Ga0070678_100038668 3300005456 Bacteria 3361
126 Ga0070678_100074121 3300005456 Bacteria 2557
127 Ga0070678_100265012 3300005456 Bacteria 1447
128 Ga0070678_100331502 3300005456 Bacteria 1302
129 Ga0070662_100030745 3300005457 Bacteria 3762
130 Ga0070662_100034510 3300005457 Bacteria 3567
131 Ga0070681_10002448 3300005458 Bacteria 17001
132 Ga0070681_10040960 3300005458 Bacteria 4641
133 Ga0070681_10105197 3300005458 Bacteria 2764
134 Ga0070681_10351450 3300005458 Bacteria 1384
135 Ga0070681_10405605 3300005458 Bacteria 1275
136 Ga0068867_100002021 3300005459 Bacteria 14179
137 Ga0068867_100040009 3300005459 Bacteria 3419
138 Ga0068867_100216929 3300005459 Bacteria 1540
139 Ga0070706_100165397 3300005467 Bacteria 2066
140 Ga0070707_100373997 3300005468 Bacteria 1384
141 Ga0070698_100069969 3300005471 Bacteria 3522
142 Ga0070698_100200629 3300005471 Bacteria 1931
143 Ga0070699_100037853 3300005518 Bacteria 4175
144 Ga0070699_100054610 3300005518 Bacteria 3458
145 Ga0070679_100007265 3300005530 Bacteria 10343
146 Ga0070679_100035432 3300005530 Bacteria 4952
147 Ga0070679_100072190 3300005530 Bacteria 3443
148 Ga0070679_100262736 3300005530 Bacteria 1681
149 Ga0070679_100283853 3300005530 Bacteria 1608
150 Ga0070684_100035493 3300005535 Bacteria 4267
151 Ga0070684_100098119 3300005535 Bacteria 2613
152 Ga0070697_100019630 3300005536 Bacteria 5339
153 Ga0068853_100012954 3300005539 Bacteria 6797
154 Ga0068853_100030460 3300005539 Bacteria 4557
155 Ga0068853_100035086 3300005539 Bacteria 4259
156 Ga0068853_100100885 3300005539 Bacteria 2552
157 Ga0070672_100015306 3300005543 Bacteria 5458
158 Ga0070672_100030272 3300005543 Bacteria 4065
159 Ga0070672_100041943 3300005543 Bacteria 3521
160 Ga0070672_100056572 3300005543 Bacteria 3077
161 Ga0070672_100091843 3300005543 Bacteria 2450
162 Ga0070695_100041991 3300005545 Bacteria 2901
163 Ga0070695_100044766 3300005545 Bacteria 2819
164 Ga0070695_100247102 3300005545 Bacteria 1297
165 Ga0070696_100009153 3300005546 Bacteria 6630
166 Ga0070696_100146532 3300005546 Bacteria 1730
167 Ga0070696_100166611 3300005546 Bacteria 1626
168 Ga0070696_100209143 3300005546 Bacteria 1460
169 Ga0070696_100284287 3300005546 Bacteria 1262
170 Ga0070693_100000931 3300005547 Bacteria 12987
171 Ga0070693_100004820 3300005547 Bacteria 6428
172 Ga0070693_100013718 3300005547 Bacteria 4135
173 Ga0070693_100070585 3300005547 Bacteria 2055
174 Ga0070693_100111821 3300005547 Bacteria 1681
175 Ga0070665_100033484 3300005548 Bacteria 5169
176 Ga0070665_100099169 3300005548 Bacteria 2917
177 Ga0070665_100129062 3300005548 Bacteria 2530
178 Ga0070665_100254627 3300005548 Bacteria 1756
179 Ga0070665_100263201 3300005548 Bacteria 1726
180 Ga0070665_100320584 3300005548 Bacteria 1554
181 Ga0070704_100019424 3300005549 Bacteria 4366
182 Ga0070704_100128992 3300005549 Bacteria 1956
183 Ga0070664_100001851 3300005564 Bacteria 16936
184 Ga0070664_100010293 3300005564 Bacteria 7589
185 Ga0070664_100111652 3300005564 Bacteria 2386
186 Ga0070664_100117886 3300005564 Bacteria 2322
187 Ga0070664_100189630 3300005564 Bacteria 1831
188 Ga0068857_100205610 3300005577 Bacteria 1796
189 Ga0068854_100005240 3300005578 Bacteria 8179
190 Ga0068854_100012314 3300005578 Bacteria 5597
191 Ga0068854_100012425 3300005578 Bacteria 5575
192 Ga0068854_100316253 3300005578 Bacteria 1267
193 Ga0068856_100008513 3300005614 Bacteria 9974
194 Ga0068856_100012538 3300005614 Bacteria 8205
195 Ga0068856_100076780 3300005614 Bacteria 3309
196 Ga0068856_100131262 3300005614 Bacteria 2510
197 Ga0068856_100169533 3300005614 Bacteria 2195
198 Ga0068856_100287330 3300005614 Bacteria 1661
199 Ga0068856_100314913 3300005614 Bacteria 1582
200 Ga0070702_100009464 3300005615 Bacteria 4771
201 Ga0070702_100096100 3300005615 Bacteria 1807
202 Ga0068852_100000325 3300005616 Bacteria 32471
203 Ga0068852_100036441 3300005616 Bacteria 4116
204 Ga0068852_100043473 3300005616 Bacteria 3811
205 Ga0068852_100044094 3300005616 Bacteria 3785
206 Ga0068859_100014988 3300005617 Bacteria 7781
207 Ga0068859_100036816 3300005617 Bacteria 4913
208 Ga0068859_100046715 3300005617 Bacteria 4348
209 Ga0068859_100056936 3300005617 Bacteria 3937
210 Ga0068859_100106483 3300005617 Bacteria 2863
211 Ga0068859_100259256 3300005617 Bacteria 1829
212 Ga0068859_100556906 3300005617 Bacteria 1241
213 Ga0068864_100002651 3300005618 Bacteria 14774
214 Ga0068864_100079737 3300005618 Bacteria 2867
215 Ga0068864_100466499 3300005618 Bacteria 1210
216 Ga0068866_10019847 3300005718 Bacteria 3068
217 Ga0068866_10061450 3300005718 Bacteria 1951
218 Ga0068861_100003649 3300005719 Bacteria 10260
219 Ga0068851_10001493 3300005834 Bacteria 10265
220 Ga0068851_10009796 3300005834 Bacteria 4463
221 Ga0068851_10056841 3300005834 Bacteria 1997
222 Ga0068863_100039786 3300005841 Bacteria 4472
223 Ga0068863_100055486 3300005841 Bacteria 3752
224 Ga0068863_100060886 3300005841 Bacteria 3569
225 Ga0068863_100061216 3300005841 Bacteria 3559
226 Ga0068863_100256068 3300005841 Bacteria 1691
227 Ga0068858_100000730 3300005842 Bacteria 34410
228 Ga0068858_100067139 3300005842 Bacteria 3321
229 Ga0068858_100103586 3300005842 Bacteria 2655
230 Ga0068860_100003477 3300005843 Bacteria 16211
231 Ga0068860_100016555 3300005843 Bacteria 7191
232 Ga0068860_100037729 3300005843 Bacteria 4624
233 Ga0068860_100083962 3300005843 Bacteria 3029
234 Ga0068860_100156219 3300005843 Bacteria 2198
235 Ga0068860_100436818 3300005843 Bacteria 1300
236 Ga0068862_100001654 3300005844 Bacteria 20281
237 Ga0068862_100010795 3300005844 Bacteria 7542
238 Ga0081455_10003517 3300005937 Bacteria 18002
239 Ga0081455_10007375 3300005937 Bacteria 11595
240 Ga0081455_10063531 3300005937 Bacteria 3098
241 Ga0081455_10102570 3300005937 Bacteria 2293
242 Ga0081538_10030556 3300005981 Bacteria 3654
243 Ga0081538_10065423 3300005981 Bacteria 2047
244 Ga0081540_1002531 3300005983 Bacteria 14829
245 Ga0081540_1016498 3300005983 Bacteria 4618
246 Ga0081540_1029880 3300005983 Bacteria 3028
247 Ga0081539_10004441 3300005985 Bacteria 15485
248 Ga0081539_10008485 3300005985 Bacteria 8928
249 Ga0075365_10014914 3300006038 Bacteria 4686
250 Ga0075365_10172845 3300006038 Bacteria 1508
251 Ga0075363_100197194 3300006048 Bacteria 1150
252 Ga0075363_100197851 3300006048 Bacteria 1148
253 Ga0075364_10019233 3300006051 Bacteria 4285
254 Ga0070716_100048821 3300006173 Bacteria 2395
255 Ga0070716_100096160 3300006173 Bacteria 1804
256 Ga0070712_100315159 3300006175 Bacteria 1270
257 Ga0075362_10006880 3300006177 Bacteria 4261
258 Ga0075362_10013195 3300006177 Bacteria 3301
259 Ga0075362_10078021 3300006177 Bacteria 1523
260 Ga0075362_10081810 3300006177 Bacteria 1489
261 Ga0075367_10228200 3300006178 Bacteria 1166
262 Ga0075369_10000082 3300006186 Bacteria 24871
263 Ga0075369_10021909 3300006186 Bacteria 2631
264 Ga0075366_10006869 3300006195 Bacteria 6262
265 Ga0075366_10008494 3300006195 Bacteria 5713
266 Ga0075366_10010447 3300006195 Bacteria 5213
267 Ga0075366_10012018 3300006195 Bacteria 4904
268 Ga0075366_10021262 3300006195 Bacteria 3771
269 Ga0075366_10052699 3300006195 Bacteria 2417
270 Ga0075366_10053401 3300006195 Bacteria 2400
271 Ga0075366_10065710 3300006195 Bacteria 2158
272 Ga0097621_100005770 3300006237 Bacteria 8740
273 Ga0097621_100019855 3300006237 Bacteria 5169
274 Ga0097621_100024461 3300006237 Bacteria 4717
275 Ga0097621_100063969 3300006237 Bacteria 3024
276 Ga0097621_100105151 3300006237 Bacteria 2379
277 Ga0097621_100136364 3300006237 Bacteria 2093
278 Ga0075370_10006736 3300006353 Bacteria 5798
279 Ga0075370_10023998 3300006353 Bacteria 3364
280 Ga0075370_10026465 3300006353 Bacteria 3214
281 Ga0075370_10043341 3300006353 Bacteria 2543
282 Ga0075370_10116077 3300006353 Bacteria 1556
283 Ga0075370_10182096 3300006353 Bacteria 1237
284 Ga0068871_100000344 3300006358 Bacteria 32279
285 Ga0068871_100001629 3300006358 Bacteria 15121
286 Ga0068871_100020265 3300006358 Bacteria 5092
287 Ga0068871_100063332 3300006358 Bacteria 3024
288 Ga0068871_100154529 3300006358 Bacteria 1958
289 Ga0068871_100191606 3300006358 Bacteria 1761
290 Ga0068871_100214566 3300006358 Bacteria 1665
291 Ga0075428_100000505 3300006844 Bacteria 39638
292 Ga0075428_100011999 3300006844 Bacteria 9640
293 Ga0075428_100077317 3300006844 Bacteria 3633
294 Ga0075428_100160813 3300006844 Bacteria 2438
295 Ga0075430_100022713 3300006846 Bacteria 5336
296 Ga0075430_100059137 3300006846 Bacteria 3222
297 Ga0075431_100000584 3300006847 Bacteria 30912
298 Ga0075431_100018872 3300006847 Bacteria 7025
299 Ga0075431_100019249 3300006847 Bacteria 6959
300 Ga0075431_100528896 3300006847 Bacteria 1168
301 Ga0075433_10251505 3300006852 Bacteria 1568
302 Ga0075434_100055910 3300006871 Bacteria 3922
303 Ga0075429_100000783 3300006880 Bacteria 25072
304 Ga0075429_100011050 3300006880 Bacteria 7815
305 Ga0075429_100014877 3300006880 Bacteria 6747
306 Ga0075429_100047247 3300006880 Bacteria 3745
307 Ga0068865_100007125 3300006881 Bacteria 6866
308 Ga0068865_100020089 3300006881 Bacteria 4331
309 Ga0068865_100066334 3300006881 Bacteria 2546
310 Ga0075436_100001608 3300006914 Bacteria 15441
311 Ga0075436_100053251 3300006914 Bacteria 2794
312 Ga0097620_100014989 3300006931 Bacteria 7781
313 Ga0097620_100036817 3300006931 Bacteria 4913
314 Ga0097620_100046715 3300006931 Bacteria 4348
315 Ga0097620_100056933 3300006931 Bacteria 3937
316 Ga0097620_100106485 3300006931 Bacteria 2863
317 Ga0097620_100259270 3300006931 Bacteria 1829
318 Ga0097620_100556997 3300006931 Bacteria 1241
319 Ga0099823_1033761 3300006944 Bacteria 4091
320 Ga0079104_1000194 3300006946 Bacteria 85426
321 Ga0099826_10073580 3300006948 Bacteria 2158
322 Ga0075435_100028705 3300007076 Bacteria 4364
323 Ga0075435_100168902 3300007076 Bacteria 1845
324 Ga0111539_10000490 3300009094 Bacteria 50162
325 Ga0111539_10000705 3300009094 Bacteria 43338
326 Ga0111539_10014358 3300009094 Bacteria 9888
327 Ga0111539_10030018 3300009094 Bacteria 6614
328 Ga0111539_10137142 3300009094 Bacteria 2865
329 Ga0111539_10186342 3300009094 Bacteria 2423
330 Ga0111539_10217210 3300009094 Bacteria 2227
331 Ga0105245_10041845 3300009098 Bacteria 4085
332 Ga0105245_10047188 3300009098 Bacteria 3850
333 Ga0105245_10090345 3300009098 Bacteria 2817
334 Ga0105245_10103159 3300009098 Bacteria 2642
335 Ga0105245_10148242 3300009098 Bacteria 2216
336 Ga0105247_10065504 3300009101 Bacteria 2260
337 Ga0114129_10000057 3300009147 Bacteria 99258
338 Ga0114129_10000341 3300009147 Bacteria 54331
339 Ga0114129_10140657 3300009147 Bacteria 3309
340 Ga0105243_10000346 3300009148 Bacteria 49790
341 Ga0105243_10008545 3300009148 Bacteria 7856
342 Ga0105243_10075395 3300009148 Bacteria 2738
343 Ga0105241_10099992 3300009174 Bacteria 2304
344 Ga0105241_10184458 3300009174 Bacteria 1733
345 Ga0105241_10212348 3300009174 Bacteria 1622
346 Ga0105242_10004136 3300009176 Bacteria 11293
347 Ga0105242_10159730 3300009176 Bacteria 1972
348 Ga0105248_10035140 3300009177 Bacteria 5607
349 Ga0105248_10076968 3300009177 Bacteria 3750
350 Ga0105248_10205294 3300009177 Bacteria 2220
351 Ga0105248_10238394 3300009177 Bacteria 2048
352 Ga0105248_10249923 3300009177 Bacteria 1996
353 Ga0105237_10021401 3300009545 Bacteria 6648
354 Ga0105237_10150584 3300009545 Bacteria 2323
355 Ga0105238_10014576 3300009551 Bacteria 7947
356 Ga0105238_10026008 3300009551 Bacteria 5965
357 Ga0105238_10034965 3300009551 Bacteria 5111
358 Ga0105238_10161144 3300009551 Bacteria 2219
359 Ga0105249_10010104 3300009553 Bacteria 8285
360 Ga0105249_10176132 3300009553 Bacteria 2078
361 Ga0105249_10380603 3300009553 Bacteria 1437
362 Ga0105249_10409923 3300009553 Bacteria 1387
363 Ga0105239_10019990 3300010375 Bacteria 7390
364 Ga0105239_10215152 3300010375 Bacteria 2154
365 Ga0105239_10272694 3300010375 Bacteria 1903
366 Ga0105246_10037203 3300011119 Bacteria 3265
367 Ga0157373_10007866 3300013100 Bacteria 7930
368 Ga0157373_10027114 3300013100 Bacteria 4134
369 Ga0157373_10041685 3300013100 Bacteria 3283
370 Ga0157373_10052531 3300013100 Bacteria 2900
371 Ga0157371_10051690 3300013102 Bacteria 2920
372 Ga0157371_10078904 3300013102 Bacteria 2332
373 Ga0157370_10001435 3300013104 Bacteria 29541
374 Ga0157370_10009451 3300013104 Bacteria 10414
375 Ga0157370_10081869 3300013104 Bacteria 3037
376 Ga0157370_10139287 3300013104 Bacteria 2261
377 Ga0157370_10163736 3300013104 Bacteria 2069
378 Ga0157369_10017534 3300013105 Bacteria 8045
379 Ga0157369_10148696 3300013105 Bacteria 2476
380 Ga0157369_10253549 3300013105 Bacteria 1836
381 Ga0157374_10001734 3300013296 Bacteria 18285
382 Ga0157374_10028606 3300013296 Bacteria 5036
383 Ga0157374_10153335 3300013296 Bacteria 2241
384 Ga0157374_10155005 3300013296 Bacteria 2229
385 Ga0157374_10182192 3300013296 Bacteria 2052
386 Ga0157378_10061851 3300013297 Bacteria 3343
387 Ga0157378_10082324 3300013297 Bacteria 2910
388 Ga0157378_10212139 3300013297 Bacteria 1836
389 Ga0157378_10301550 3300013297 Bacteria 1551
390 Ga0163162_10003566 3300013306 Bacteria 14886
391 Ga0163162_10042978 3300013306 Bacteria 4523
392 Ga0163162_10085275 3300013306 Bacteria 3235
393 Ga0163162_10127176 3300013306 Bacteria 2655
394 Ga0163162_10127640 3300013306 Bacteria 2651
395 Ga0157372_10045037 3300013307 Bacteria 4892
396 Ga0157372_10076502 3300013307 Bacteria 3779
397 Ga0157375_10007052 3300013308 Bacteria 9816
398 Ga0157375_10024702 3300013308 Bacteria 5567
399 Ga0163163_10047946 3300014325 Bacteria 4199
400 Ga0163163_10070822 3300014325 Bacteria 3473
401 Ga0157380_10151850 3300014326 Bacteria 2003
402 Ga0157377_10008943 3300014745 Bacteria 4900
403 Ga0157377_10027628 3300014745 Bacteria 3048
404 Ga0157379_10031503 3300014968 Bacteria 4724
405 Ga0157379_10072610 3300014968 Bacteria 3079
406 Ga0157379_10122996 3300014968 Bacteria 2335
407 Ga0157376_10024018 3300014969 Bacteria 4780
408 Ga0157376_10068402 3300014969 Bacteria 3007
409 Ga0157376_10168937 3300014969 Bacteria 1990
410 Ga0163161_10014997 3300017792 Bacteria 5399
411 Ga0197907_10590190 3300020069 Bacteria 1248
412 Ga0206356_10165203 3300020070 Bacteria 1149
413 Ga0206352_11255281 3300020078 Bacteria 1296
414 Ga0206352_11269377 3300020078 Bacteria 1239
415 Ga0206353_11895588 3300020082 Bacteria 2032
416 Ga0214544_1000004 3300021320 Bacteria 455869
417 Ga0214542_1000001 3300021321 Bacteria 1018696
418 Ga0214545_1000001 3300021324 Bacteria 1092817
419 Ga0214543_1000006 3300021327 Bacteria 443395
420 Ga0224712_10094181 3300022467 Bacteria 1260
421 Ga0209672_101176 3300025228 Bacteria 10682
422 Ga0209147_100472 3300025229 Bacteria 24613
423 Ga0209258_100091 3300025242 Bacteria 227454
424 Ga0207425_1000190 3300025245 Bacteria 49963
425 Ga0207425_1000598 3300025245 Bacteria 20958
426 Ga0209148_1000033 3300025254 Bacteria 555508
427 Ga0209129_1000038 3300025258 Bacteria 322778
428 Ga0209129_1000091 3300025258 Bacteria 175716
429 Ga0209129_1001758 3300025258 Bacteria 11609
430 Ga0209129_1018735 3300025258 Bacteria 1324
431 Ga0209565_1000020 3300025263 Bacteria 432627
432 Ga0209565_1000335 3300025263 Bacteria 41834
433 Ga0209565_1002488 3300025263 Bacteria 6592
434 Ga0209565_1006285 3300025263 Bacteria 3351
435 Ga0209673_1000072 3300025273 Bacteria 236935
436 Ga0209673_1000154 3300025273 Bacteria 146394
437 Ga0209673_1002551 3300025273 Bacteria 12441
438 Ga0209673_1004238 3300025273 Bacteria 7806
439 Ga0209673_1013792 3300025273 Bacteria 3170
440 Ga0209130_1000140 3300025284 Bacteria 115434
441 Ga0209130_1000782 3300025284 Bacteria 27407
442 Ga0209130_1001163 3300025284 Bacteria 19005
443 Ga0209130_1001760 3300025284 Bacteria 12841
444 Ga0209675_1000014 3300025291 Bacteria 421902
445 Ga0209675_1001002 3300025291 Bacteria 17764
446 Ga0209675_1001248 3300025291 Bacteria 15267
447 Ga0209675_1004489 3300025291 Bacteria 6183
448 Ga0209676_1000048 3300025292 Bacteria 403716
449 Ga0209676_1007117 3300025292 Bacteria 5346
450 Ga0209676_1018341 3300025292 Bacteria 2444
451 Ga0209025_1000207 3300025294 Bacteria 140774
452 Ga0209025_1000286 3300025294 Bacteria 114096
453 Ga0209025_1000328 3300025294 Bacteria 105594
454 Ga0209025_1000356 3300025294 Bacteria 98547
455 Ga0209025_1003562 3300025294 Bacteria 14591
456 Ga0209564_1000103 3300025295 Bacteria 221166
457 Ga0209564_1000129 3300025295 Bacteria 195163
458 Ga0209564_1000597 3300025295 Bacteria 56580
459 Ga0209758_1000092 3300025297 Bacteria 241910
460 Ga0209758_1000197 3300025297 Bacteria 133706
461 Ga0209758_1000209 3300025297 Bacteria 128038
462 Ga0209758_1000213 3300025297 Bacteria 126745
463 Ga0209758_1000613 3300025297 Bacteria 55154
464 Ga0209758_1001871 3300025297 Bacteria 23059
465 Ga0209758_1004235 3300025297 Bacteria 12142
466 Ga0209050_1000012 3300025298 Bacteria 813717
467 Ga0209050_1000178 3300025298 Bacteria 145314
468 Ga0209050_1000282 3300025298 Bacteria 108629
469 Ga0209050_1022724 3300025298 Bacteria 2236
470 Ga0209050_1040650 3300025298 Bacteria 1291
471 Ga0209256_1000015 3300025299 Bacteria 622953
472 Ga0209256_1000065 3300025299 Bacteria 248104
473 Ga0209256_1000094 3300025299 Bacteria 208177
474 Ga0207426_1000084 3300025302 Bacteria 298123
475 Ga0207426_1000161 3300025302 Bacteria 172765
476 Ga0207426_1000235 3300025302 Bacteria 126601
477 Ga0207426_1001703 3300025302 Bacteria 16900
478 Ga0207426_1004495 3300025302 Bacteria 6762
479 Ga0209051_1000022 3300025303 Bacteria 474879
480 Ga0209051_1000273 3300025303 Bacteria 84847
481 Ga0209051_1000461 3300025303 Bacteria 53478
482 Ga0209051_1004272 3300025303 Bacteria 8893
483 Ga0209051_1009904 3300025303 Bacteria 4865
484 Ga0209051_1018102 3300025303 Bacteria 3127
485 Ga0209257_1000030 3300025304 Bacteria 689812
486 Ga0209257_1001999 3300025304 Bacteria 21868
487 Ga0209257_1007808 3300025304 Bacteria 6340
488 Ga0207656_10000707 3300025321 Bacteria 10917
489 Ga0207656_10035021 3300025321 Bacteria 2099
490 Ga0207692_10056904 3300025898 Bacteria 2008
491 Ga0207642_10001781 3300025899 Bacteria 6660
492 Ga0207688_10026991 3300025901 Bacteria 3158
493 Ga0207688_10040362 3300025901 Bacteria 2593
494 Ga0207680_10011039 3300025903 Bacteria 4548
495 Ga0207647_10063202 3300025904 Bacteria 2252
496 Ga0207699_10074132 3300025906 Bacteria 2090
497 Ga0207645_10056399 3300025907 Bacteria 2508
498 Ga0207643_10039006 3300025908 Bacteria 2671
499 Ga0207705_10010757 3300025909 Bacteria 6643
500 Ga0207684_10060695 3300025910 Bacteria 3211
501 Ga0207654_10001352 3300025911 Bacteria 13006
502 Ga0207707_10005308 3300025912 Bacteria 11258
503 Ga0207707_10041797 3300025912 Bacteria 4003
504 Ga0207707_10053222 3300025912 Bacteria 3524
505 Ga0207707_10133476 3300025912 Bacteria 2171
506 Ga0207707_10158081 3300025912 Bacteria 1982
507 Ga0207707_10244778 3300025912 Bacteria 1558
508 Ga0207695_10043723 3300025913 Bacteria 4772
509 Ga0207671_10040140 3300025914 Bacteria 3465
510 Ga0207671_10053972 3300025914 Bacteria 2978
511 Ga0207671_10107413 3300025914 Bacteria 2120
512 Ga0207693_10000070 3300025915 Bacteria 90057
513 Ga0207663_10034707 3300025916 Bacteria 3020
514 Ga0207663_10101271 3300025916 Bacteria 1935
515 Ga0207660_10018761 3300025917 Bacteria 4617
516 Ga0207660_10025680 3300025917 Bacteria 4002
517 Ga0207660_10190659 3300025917 Bacteria 1596
518 Ga0207662_10000347 3300025918 Bacteria 20979
519 Ga0207657_10006160 3300025919 Bacteria 12468
520 Ga0207657_10105256 3300025919 Bacteria 2336
521 Ga0207657_10233343 3300025919 Bacteria 1471
522 Ga0207657_10243076 3300025919 Bacteria 1437
523 Ga0207649_10006855 3300025920 Bacteria 6189
524 Ga0207649_10017049 3300025920 Bacteria 4111
525 Ga0207649_10021160 3300025920 Bacteria 3739
526 Ga0207649_10024036 3300025920 Bacteria 3537
527 Ga0207649_10074248 3300025920 Bacteria 2181
528 Ga0207649_10171427 3300025920 Bacteria 1512
529 Ga0207652_10029293 3300025921 Bacteria 4602
530 Ga0207652_10221164 3300025921 Bacteria 1706
531 Ga0207646_10080148 3300025922 Bacteria 2919
532 Ga0207681_10022061 3300025923 Bacteria 4056
533 Ga0207694_10119003 3300025924 Bacteria 2107
534 Ga0207694_10142647 3300025924 Bacteria 1927
535 Ga0207650_10003752 3300025925 Bacteria 10390
536 Ga0207650_10022051 3300025925 Bacteria 4507
537 Ga0207650_10030088 3300025925 Bacteria 3909
538 Ga0207650_10048329 3300025925 Bacteria 3138
539 Ga0207650_10064049 3300025925 Bacteria 2751
540 Ga0207650_10227277 3300025925 Bacteria 1504
541 Ga0207650_10359410 3300025925 Bacteria 1199
542 Ga0207659_10044153 3300025926 Bacteria 3135
543 Ga0207659_10102613 3300025926 Bacteria 2159
544 Ga0207659_10203351 3300025926 Bacteria 1583
545 Ga0207687_10004204 3300025927 Bacteria 9630
546 Ga0207687_10037559 3300025927 Bacteria 3305
547 Ga0207687_10053692 3300025927 Bacteria 2817
548 Ga0207700_10009237 3300025928 Bacteria 6151
549 Ga0207700_10056892 3300025928 Bacteria 2946
550 Ga0207664_10001186 3300025929 Bacteria 17334
551 Ga0207644_10011121 3300025931 Bacteria 5945
552 Ga0207644_10011640 3300025931 Bacteria 5824
553 Ga0207644_10075156 3300025931 Bacteria 2482
554 Ga0207644_10120624 3300025931 Bacteria 1996
555 Ga0207644_10132129 3300025931 Bacteria 1912
556 Ga0207690_10000538 3300025932 Bacteria 24715
557 Ga0207690_10023590 3300025932 Bacteria 3841
558 Ga0207690_10097341 3300025932 Bacteria 2094
559 Ga0207690_10133755 3300025932 Bacteria 1818
560 Ga0207706_10073512 3300025933 Bacteria 3006
561 Ga0207686_10000520 3300025934 Bacteria 24908
562 Ga0207686_10085595 3300025934 Bacteria 2068
563 Ga0207686_10146353 3300025934 Bacteria 1639
564 Ga0207709_10000485 3300025935 Bacteria 36221
565 Ga0207709_10004462 3300025935 Bacteria 8082
566 Ga0207709_10370959 3300025935 Bacteria 1086
567 Ga0207670_10007266 3300025936 Bacteria 6172
568 Ga0207670_10039008 3300025936 Bacteria 3107
569 Ga0207669_10010756 3300025937 Bacteria 4419
570 Ga0207669_10034065 3300025937 Bacteria 2882
571 Ga0207669_10051238 3300025937 Bacteria 2472
572 Ga0207669_10073212 3300025937 Bacteria 2161
573 Ga0207669_10154485 3300025937 Bacteria 1612
574 Ga0207704_10007350 3300025938 Bacteria 5198
575 Ga0207704_10188533 3300025938 Bacteria 1498
576 Ga0207704_10222934 3300025938 Bacteria 1396
577 Ga0207665_10021996 3300025939 Bacteria 4192
578 Ga0207665_10082049 3300025939 Bacteria 2221
579 Ga0207691_10027404 3300025940 Bacteria 5341
580 Ga0207691_10049988 3300025940 Bacteria 3829
581 Ga0207691_10057620 3300025940 Bacteria 3535
582 Ga0207691_10218849 3300025940 Bacteria 1652
583 Ga0207691_10233158 3300025940 Bacteria 1593
584 Ga0207711_10192784 3300025941 Bacteria 1858
585 Ga0207711_10261434 3300025941 Bacteria 1591
586 Ga0207711_10305393 3300025941 Bacteria 1468
587 Ga0207689_10000488 3300025942 Bacteria 37483
588 Ga0207689_10018916 3300025942 Bacteria 5809
589 Ga0207689_10023643 3300025942 Bacteria 5153
590 Ga0207689_10072374 3300025942 Bacteria 2832
591 Ga0207689_10154799 3300025942 Bacteria 1890
592 Ga0207661_10039572 3300025944 Bacteria 3701
593 Ga0207679_10000542 3300025945 Bacteria 25399
594 Ga0207679_10021173 3300025945 Bacteria 4401
595 Ga0207679_10134289 3300025945 Bacteria 1990
596 Ga0207667_10077947 3300025949 Bacteria 3435
597 Ga0207667_10241526 3300025949 Bacteria 1848
598 Ga0207651_10016651 3300025960 Bacteria 4315
599 Ga0207651_10027002 3300025960 Bacteria 3598
600 Ga0207651_10027540 3300025960 Bacteria 3571
601 Ga0207651_10137482 3300025960 Bacteria 1882
602 Ga0207712_10023406 3300025961 Bacteria 4075
603 Ga0207668_10053142 3300025972 Bacteria 2806
604 Ga0207668_10074026 3300025972 Bacteria 2443
605 Ga0207668_10228414 3300025972 Bacteria 1499
606 Ga0207640_10133268 3300025981 Bacteria 1799
607 Ga0207658_10022101 3300025986 Bacteria 4425
608 Ga0207658_10149123 3300025986 Bacteria 1903
609 Ga0207677_10016950 3300026023 Bacteria 4329
610 Ga0207677_10029061 3300026023 Bacteria 3507
611 Ga0207677_10084777 3300026023 Bacteria 2285
612 Ga0207703_10022993 3300026035 Bacteria 4894
613 Ga0207703_10097347 3300026035 Bacteria 2486
614 Ga0207703_10205804 3300026035 Bacteria 1751
615 Ga0207639_10015836 3300026041 Bacteria 5324
616 Ga0207639_10107397 3300026041 Bacteria 2267
617 Ga0207639_10146596 3300026041 Bacteria 1972
618 Ga0207678_10053759 3300026067 Bacteria 3469
619 Ga0207708_10141554 3300026075 Bacteria 1887
620 Ga0207702_10004295 3300026078 Bacteria 12708
621 Ga0207702_10033733 3300026078 Bacteria 4277
622 Ga0207702_10123155 3300026078 Bacteria 2323
623 Ga0207702_10195819 3300026078 Bacteria 1870
624 Ga0207702_10298361 3300026078 Bacteria 1529
625 Ga0207641_10007815 3300026088 Bacteria 8880
626 Ga0207641_10055353 3300026088 Bacteria 3368
627 Ga0207648_10001364 3300026089 Bacteria 26988
628 Ga0207648_10021207 3300026089 Bacteria 5841
629 Ga0207648_10100675 3300026089 Bacteria 2532
630 Ga0207676_10002757 3300026095 Bacteria 12496
631 Ga0207676_10044753 3300026095 Bacteria 3416
632 Ga0207676_10045404 3300026095 Bacteria 3394
633 Ga0207674_10008147 3300026116 Bacteria 12150
634 Ga0207674_10015377 3300026116 Bacteria 8407
635 Ga0207674_10110494 3300026116 Bacteria 2724
636 Ga0207675_100000316 3300026118 Bacteria 46037
637 Ga0207675_100002430 3300026118 Bacteria 18452
638 Ga0207675_100015324 3300026118 Bacteria 7153
639 Ga0207675_100252636 3300026118 Bacteria 1707
640 Ga0207683_10000503 3300026121 Bacteria 36106
641 Ga0207683_10014682 3300026121 Bacteria 6669
642 Ga0207683_10015036 3300026121 Bacteria 6587
643 Ga0207683_10018772 3300026121 Bacteria 5899
644 Ga0207683_10047847 3300026121 Bacteria 3745
645 Ga0207683_10056247 3300026121 Bacteria 3450
646 Ga0207683_10520179 3300026121 Bacteria 1099
647 Ga0207698_10007138 3300026142 Bacteria 6996
648 Ga0207698_10010409 3300026142 Bacteria 5974
649 Ga0207698_10208279 3300026142 Bacteria 1757
650 Ga0207698_10321436 3300026142 Bacteria 1449
651 Ga0209281_1000083 3300027111 Bacteria 255034
652 Ga0209389_1000001 3300027296 Bacteria 463799
653 Ga0209969_1005346 3300027360 Bacteria 1799
654 Ga0209489_105217 3300027361 Bacteria 22905
655 Ga0209700_100007 3300027363 Bacteria 454608
656 Ga0209967_1000971 3300027364 Bacteria 3650
657 Ga0209996_1008152 3300027395 Bacteria 1371
658 Ga0209984_1004908 3300027424 Bacteria 1590
659 Ga0210000_1004391 3300027462 Bacteria 2037
660 Ga0209995_1010466 3300027471 Bacteria 1505
661 Ga0209968_1000171 3300027526 Bacteria 11334
662 Ga0209970_1008103 3300027614 Bacteria 1726
663 Ga0209282_1004201 3300027666 Bacteria 8656
664 Ga0209966_1000118 3300027695 Bacteria 35137
665 Ga0209813_10040887 3300027866 Bacteria 1411
666 Ga0209974_10001716 3300027876 Bacteria 7955
667 Ga0207428_10001513 3300027907 Bacteria 24320
668 Ga0207428_10001574 3300027907 Bacteria 23762
669 Ga0207428_10003990 3300027907 Bacteria 14165
670 Ga0268266_10002299 3300028379 Bacteria 20728
671 Ga0268266_10005672 3300028379 Bacteria 11578
672 Ga0268266_10024830 3300028379 Bacteria 5100
673 Ga0268266_10032022 3300028379 Bacteria 4467
674 Ga0268266_10120010 3300028379 Bacteria 2339
675 Ga0268266_10272887 3300028379 Bacteria 1570
676 Ga0268266_10476300 3300028379 Bacteria 1189
677 Ga0268265_10002823 3300028380 Bacteria 12777
678 Ga0268265_10003395 3300028380 Bacteria 11458
679 Ga0268265_10024517 3300028380 Bacteria 4269
680 Ga0268265_10055399 3300028380 Bacteria 3012
681 Ga0268265_10084165 3300028380 Bacteria 2521
682 Ga0268264_10007460 3300028381 Bacteria 9127
683 Ga0268264_10029236 3300028381 Bacteria 4512
684 Ga0268264_10061138 3300028381 Bacteria 3159
685 Ga0268264_10079331 3300028381 Bacteria 2800
686 Ga0268264_10363002 3300028381 Bacteria 1382
687 Ga0307517_10000579 3300028786 Bacteria 62428
688 Ga0307517_10236544 3300028786 Bacteria 1089
689 Ga0307515_10000030 3300028794 Bacteria 364482
690 Ga0307515_10000034 3300028794 Bacteria 344640
691 Ga0307515_10000150 3300028794 Bacteria 169644
692 Ga0307515_10000367 3300028794 Bacteria 111166
693 Ga0307515_10005608 3300028794 Bacteria 25370
694 Ga0307515_10020668 3300028794 Bacteria 11727
695 Ga0307515_10051395 3300028794 Bacteria 6146
696 Ga0307515_10054271 3300028794 Bacteria 5888
697 Ga0307515_10063415 3300028794 Bacteria 5191
698 Ga0307515_10087565 3300028794 Bacteria 3950
699 Ga0316177_1084583 3300030731 Bacteria 7782
700 Ga0316176_1043862 3300030732 Bacteria 3343
701 Ga0314311_1136633 3300030733 Bacteria 2731
702 Ga0316178_1001707 3300030735 Bacteria 6637
703 Ga0316183_1034028 3300030742 Bacteria 5300
704 Ga0316182_1352626 3300030745 Bacteria 3143
705 Ga0307513_10000514 3300031456 Bacteria 55608
706 Ga0307513_10000924 3300031456 Bacteria 42435
707 Ga0307513_10000991 3300031456 Bacteria 41018
708 Ga0307513_10008489 3300031456 Bacteria 13127
709 Ga0307513_10179781 3300031456 Bacteria 1980
710 Ga0307513_10183595 3300031456 Bacteria 1951
711 Ga0307509_10020754 3300031507 Bacteria 7452
712 Ga0307408_100049104 3300031548 Bacteria 3029
713 Ga0307508_10016499 3300031616 Bacteria 6724
714 Ga0307514_10100671 3300031649 Bacteria 2076
715 Ga0265314_10043562 3300031711 Bacteria 3190
716 Ga0307516_10000839 3300031730 Bacteria 42125
717 Ga0307516_10001570 3300031730 Bacteria 31465
718 Ga0307516_10003308 3300031730 Bacteria 20859
719 Ga0307516_10060979 3300031730 Bacteria 3662
720 Ga0307516_10099941 3300031730 Bacteria 2717
721 Ga0307405_10071431 3300031731 Bacteria 2233
722 Ga0307413_10170881 3300031824 Bacteria 1538
723 Ga0307413_10248844 3300031824 Bacteria 1317
724 Ga0307410_10047191 3300031852 Bacteria 2877
725 Ga0307410_10055265 3300031852 Bacteria 2695
726 Ga0307406_10168255 3300031901 Bacteria 1583
727 Ga0307412_10043577 3300031911 Bacteria 2922
728 Ga0307412_10150097 3300031911 Bacteria 1718
729 Ga0307412_10156718 3300031911 Bacteria 1686
730 Ga0307412_10294608 3300031911 Bacteria 1280
731 Ga0307409_100050443 3300031995 Bacteria 3178
732 Ga0307416_100102783 3300032002 Bacteria 2493
733 Ga0307416_100117706 3300032002 Bacteria 2359
734 Ga0307416_100132824 3300032002 Bacteria 2245
735 Ga0307414_10042351 3300032004 Bacteria 3093
736 Ga0307414_10049656 3300032004 Bacteria 2902
737 Ga0307414_10346151 3300032004 Bacteria 1274
738 Ga0307411_10031544 3300032005 Bacteria 3262
739 Ga0307415_100051380 3300032126 Bacteria 2797
740 Ga0307510_10002141 3300033180 Bacteria 22301
741 Ga0307510_10040933 3300033180 Bacteria 5076
742 Ga0373926_0001218 3300035083 Bacteria 7730
743 Ga0373926_0038908 3300035083 Bacteria 1695
744 Ga0373934_0023345 3300035086 Bacteria 2389
745 Ga0373934_0065656 3300035086 Bacteria 1449
746 Ga0373944_0014577 3300035089 Bacteria 2196
747 Ga0373936_0008312 3300035113 Bacteria 3904
748 Ga0373936_0071331 3300035113 Bacteria 1432
749 Ga0373939_0053786 3300035114 Bacteria 1259
750 Ga0373945_0001462 3300035116 Bacteria 7207
751 Ga0373945_0014320 3300035116 Bacteria 2655
752 Ga0373945_0022309 3300035116 Bacteria 2179
753 Ga0373954_0010094 3300035118 Bacteria 4160
754 Ga0373956_0022239 3300035119 Bacteria 2712
755 Ga0373957_0010902 3300035120 Bacteria 3019
756 Ga0373943_0004090 3300035170 Bacteria 6623
757 Ga0373943_0004457 3300035170 Bacteria 6339
758 Ga0373946_0019189 3300035171 Bacteria 2633
759 Ga0373931_0130953 3300035691 Bacteria 1444
760 Ga0373935_0017872 3300035692 Bacteria 4308
761 Ga0373935_0048671 3300035692 Bacteria 2684
762 Ga0373935_0069199 3300035692 Bacteria 2273
763 Ga0373935_0073556 3300035692 Bacteria 2208
764 Ga0373927_0009262 3300035695 Bacteria 6604
765 Ga0373927_0010401 3300035695 Bacteria 6207
766 Ga0373927_0067048 3300035695 Bacteria 2322
767 Ga0373933_0052787 3300035724 Bacteria 2433
768 Ga0373947_0018280 3300035725 Bacteria 4034
769 Ga0373947_0115911 3300035725 Bacteria 1698
770 Ga0373937_0073389 3300036401 Bacteria 3157
771 Ga0373937_0096628 3300036401 Bacteria 2740
772 Ga0373925_0021067 3300037068 Bacteria 4749
773 Ga0373925_0030730 3300037068 Bacteria 3943
774 Ga0373925_0032915 3300037068 Bacteria 3818
775 Ga0373925_0155395 3300037068 Bacteria 1799
776 Ga0395899_0002908 3300037312 Bacteria 13761
777 Ga0395900_0044462 3300037418 Bacteria 4576
778 Ga0395905_0041886 3300037471 Bacteria 4297
779 Ga0395905_0080961 3300037471 Bacteria 3043
780 Ga0395905_0116788 3300037471 Bacteria 2508
781 Ga0395901_0044397 3300038443 Bacteria 4610
782 Ga0436365_1320810 3300039437 Bacteria 2106
783 Ga0439466_0003499 3300041411 Bacteria 6080
784 Ga0439465_0000906 3300041413 Bacteria 9383
785 Ga0451804_0459646 3300041463 Bacteria 2168
786 Ga0439431_0017028 3300041997 Bacteria 1705
787 Ga0439433_0002551 3300041999 Bacteria 3866
788 Ga0439441_003356 3300042001 Bacteria 2355
789 Ga0439432_001993 3300042006 Bacteria 7725
790 Ga0439432_028886 3300042006 Bacteria 1805
791 Ga0439449_0009165 3300042007 Bacteria 3750
792 Ga0439452_006599 3300042010 Bacteria 3623
793 Ga0439457_001803 3300042014 Bacteria 6323
794 Ga0439462_0003738 3300042015 Bacteria 3671
795 Ga0450919_001126 3300042121 Bacteria 3466
796 Ga0450919_005256 3300042121 Bacteria 1561
797 Ga0450898_017655 3300042134 Bacteria 1229
798 Ga0439464_0002509 3300042439 Bacteria 4526
799 Ga0450918_000031 3300042531 Bacteria 28580
800 Ga0451577_0004664 3300042876 Bacteria 14392
801 Ga0451577_0005819 3300042876 Bacteria 12483
802 Ga0451577_0009097 3300042876 Bacteria 9586
803 Ga0451577_0017515 3300042876 Bacteria 6618
804 Ga0451577_0053684 3300042876 Bacteria 3597
805 Ga0451577_0105405 3300042876 Bacteria 2520
806 Ga0451577_0167861 3300042876 Bacteria 1977
807 Ga0466965_0020374 3300044683 Bacteria 3187
808 Ga0466961_0089476 3300044693 Bacteria 1944
809 Ga0453684_0189876 3300044712 Bacteria 2404
810 Ga0466957_0015102 3300044842 Bacteria 4507
811 Ga0466957_0017998 3300044842 Bacteria 4144
812 Ga0466957_0224568 3300044842 Bacteria 1241
813 Ga0451576_0000140 3300045051 Bacteria 183279
814 Ga0451576_0018448 3300045051 Bacteria 7648
815 Ga0451576_0033233 3300045051 Bacteria 5483
816 Ga0451576_0270087 3300045051 Bacteria 1778
817 Ga0495627_004268 3300046453 Bacteria 6029
818 Ga0495592_0000727 3300046454 Bacteria 23029
819 Ga0495592_0061687 3300046454 Bacteria 2755
820 Ga0495603_0015743 3300046455 Bacteria 4573
821 Ga0495629_0031121 3300046459 Bacteria 3779
822 Ga0495629_0241769 3300046459 Bacteria 1243
823 Ga0495638_0086632 3300046460 Bacteria 1893
824 Ga0495641_0045333 3300046461 Bacteria 2025
825 Ga0495651_0050662 3300046462 Bacteria 3203
826 Ga0495651_0175100 3300046462 Bacteria 1524
827 Ga0495653_0056762 3300046463 Bacteria 2983
828 Ga0495650_0072544 3300046471 Bacteria 1347
829 Ga0495639_0016075 3300046475 Bacteria 3246
830 Ga0495584_0059497 3300046491 Bacteria 1921
831 Ga0495585_0077745 3300046492 Bacteria 1801
832 Ga0495585_0098914 3300046492 Bacteria 1562
833 Ga0495606_0002171 3300046507 Bacteria 23603
834 Ga0495610_0056390 3300046512 Bacteria 1889
835 Ga0495620_0017826 3300046515 Bacteria 3530
836 Ga0495620_0053935 3300046515 Bacteria 1701
837 Ga0495630_0030549 3300046517 Bacteria 4009
838 Ga0495630_0056112 3300046517 Bacteria 2952
839 Ga0495632_0001754 3300046519 Bacteria 17540
840 Ga0495637_0049391 3300046520 Bacteria 1768
841 Ga0495652_0157146 3300046529 Bacteria 1769
842 Ga0495665_0009292 3300046531 Bacteria 5324
843 Ga0495665_0065868 3300046531 Bacteria 1912
844 Ga0495586_0004128 3300046535 Bacteria 7782
845 Ga0495587_0003976 3300046536 Bacteria 9802
846 Ga0495587_0143699 3300046536 Bacteria 1361
847 Ga0495598_0006159 3300046537 Bacteria 2697
848 Ga0495621_0063185 3300046539 Bacteria 1348
849 Ga0495621_0110149 3300046539 Bacteria 1055
850 Ga0495645_0000502 3300046543 Bacteria 27029
851 Ga0495667_0051856 3300046559 Bacteria 2705
852 Ga0495625_0002019 3300046660 Bacteria 22847
853 Ga0495625_0058844 3300046660 Bacteria 2728
854 Ga0495635_0048111 3300046663 Bacteria 2940
855 Ga0495588_0005471 3300046674 Bacteria 5654
856 Ga0495588_0021515 3300046674 Bacteria 3178
857 Ga0495588_0108957 3300046674 Bacteria 1458
858 Ga0495599_0003122 3300046678 Bacteria 9655
859 Ga0495647_0010668 3300046681 Bacteria 3132
860 Ga0495658_0001264 3300046683 Bacteria 13289
861 Ga0495658_0034976 3300046683 Bacteria 2760
862 Ga0495658_0082219 3300046683 Bacteria 1892
863 Ga0495613_0026742 3300046689 Bacteria 4297
864 Ga0495671_0009477 3300046692 Bacteria 5439
865 Ga0495581_0000535 3300047315 Bacteria 19542
866 Ga0495581_0025443 3300047315 Bacteria 3432
867 Ga0495604_0169307 3300047317 Bacteria 1538
868 Ga0495672_0040687 3300047320 Bacteria 2816
869 Ga0495676_0058042 3300047321 Bacteria 3048
870 Ga0495676_0104765 3300047321 Bacteria 2086
871 Ga0495680_0053268 3300047322 Bacteria 3150
872 Ga0495683_0082180 3300047323 Bacteria 1570
873 Ga0495687_031562 3300047443 Bacteria 2429
874 Ga0495684_0006061 3300047471 Bacteria 9398
875 Ga0495686_0005215 3300047472 Bacteria 10332
876 Ga0495686_0100679 3300047472 Bacteria 1743
877 Ga0495593_0042464 3300047673 Bacteria 2440
878 Ga0495602_0077123 3300048088 Bacteria 2821
879 Ga0496100_0020338 3300048903 Bacteria 3978
880 Ga0496100_0150311 3300048903 Bacteria 1660
881 Ga0496102_0007689 3300048905 Bacteria 9207
882 Ga0496102_0009712 3300048905 Bacteria 8273
883 Ga0496104_0004440 3300048907 Bacteria 12216
884 Ga0496104_0534702 3300048907 Bacteria 1083
885 Ga0496105_0152338 3300048908 Bacteria 1900
886 Ga0496106_0064186 3300048909 Bacteria 2793
887 Ga0496106_0141271 3300048909 Bacteria 1894
888 Ga0496107_0091925 3300048910 Bacteria 2218
889 Ga0496107_0260501 3300048910 Bacteria 1290
890 Ga0496108_0119966 3300048911 Bacteria 2255
891 Ga0496108_0417478 3300048911 Bacteria 1172
892 Ga0496109_0103560 3300048912 Bacteria 2642
893 Ga0496109_0104568 3300048912 Bacteria 2629
894 Ga0496111_0211874 3300048914 Bacteria 1439
895 Ga0496112_0000004 3300048915 Bacteria 553294
896 Ga0496112_0004395 3300048915 Bacteria 11926
897 Ga0496112_0133017 3300048915 Bacteria 2458
898 Ga0496113_0299682 3300048916 Bacteria 1287
899 Ga0496114_0033642 3300048917 Bacteria 4225
900 Ga0496114_0209093 3300048917 Bacteria 1711
901 Ga0496118_0005318 3300048921 Bacteria 14673
902 Ga0496119_0131216 3300048922 Bacteria 1365
903 Ga0496121_0027380 3300048924 Bacteria 5335
904 Ga0496121_0085596 3300048924 Bacteria 2481
905 Ga0496123_0067475 3300048926 Bacteria 2259
906 Ga0496124_0075596 3300048927 Bacteria 2782
907 Ga0496125_0027763 3300048928 Bacteria 5123
908 Ga0496125_0100358 3300048928 Bacteria 2134
909 Ga0501310_004251 3300049130 Bacteria 1432
910 Ga0501317_001111 3300049533 Bacteria 2223
911 Ga0501031_0015585 3300049568 Bacteria 4935
912 Ga0501034_0005172 3300049571 Bacteria 14310
913 Ga0501034_0018257 3300049571 Bacteria 7195
914 Ga0501036_0014495 3300049572 Bacteria 6565
915 Ga0501038_0102733 3300049574 Bacteria 2378
916 Ga0501039_0022016 3300049575 Bacteria 4891
917 Ga0501040_0039666 3300049576 Bacteria 3203
918 Ga0501041_0032509 3300049577 Bacteria 3153
919 Ga0501042_0102626 3300049578 Bacteria 2057
920 Ga0501043_0034397 3300049579 Bacteria 3986
921 Ga0501046_0068872 3300049580 Bacteria 2754
922 Ga0501046_0093936 3300049580 Bacteria 2305
923 Ga0501047_0044468 3300049581 Bacteria 4291
924 Ga0501048_0005866 3300049582 Bacteria 9345
925 Ga0501067_0003121 3300049583 Bacteria 9152
926 Ga0501067_0098000 3300049583 Bacteria 1629
927 Ga0501068_0317204 3300049584 Bacteria 999
928 Ga0501069_0099739 3300049585 Bacteria 1648
929 Ga0501069_0266890 3300049585 Bacteria 1000
930 Ga0501070_0001451 3300049586 Bacteria 21195
931 Ga0501072_0029027 3300049588 Bacteria 4317
932 Ga0501072_0030219 3300049588 Bacteria 4236
933 Ga0501072_0049620 3300049588 Bacteria 3304
934 Ga0501072_0097100 3300049588 Bacteria 2342
935 Ga0501073_0008058 3300049589 Bacteria 7817
936 Ga0501074_0062953 3300049590 Bacteria 2672
937 Ga0501076_0221425 3300049592 Bacteria 1546
938 Ga0501077_0009547 3300049593 Bacteria 6033
939 Ga0501249_005845 3300049679 Bacteria 2516
940 Ga0501079_0113768 3300049741 Bacteria 2104
941 Ga0501080_0015826 3300049742 Bacteria 6959
942 Ga0501080_0068473 3300049742 Bacteria 3302
943 Ga0501080_0072595 3300049742 Bacteria 3202
944 Ga0501080_0089937 3300049742 Bacteria 2852
945 Ga0501080_0228827 3300049742 Bacteria 1700
946 Ga0501081_0104384 3300049743 Bacteria 2006
947 Ga0501083_0004010 3300049744 Bacteria 10347
948 Ga0501241_019332 3300049758 Bacteria 1250
949 Ga0501262_000180 3300049759 Bacteria 7858
950 Ga0501035_0108325 3300049822 Bacteria 2436
951 Ga0501044_0374879 3300049823 Bacteria 1339
952 Ga0501045_0007316 3300049824 Bacteria 7671
953 nmdc:mga03683_10404_c1 3300050489 Bacteria 3336
954 nmdc:mga03683_32556_c1 3300050489 Bacteria 2098
955 nmdc:mga03683_662_c1 3300050489 Bacteria 9889
956 nmdc:mga03n38_21320_c1 3300050490 Bacteria 2606
957 nmdc:mga03n38_66667_c1 3300050490 Bacteria 1654
958 nmdc:mga00v17_86221_c1 3300050491 Bacteria 1967
959 nmdc:mga0yw44_22504_c1 3300050492 Bacteria 3536
960 nmdc:mga0yw44_73945_c1 3300050492 Bacteria 2122
961 nmdc:mga0k408_188809_c1 3300050493 Bacteria 1229
962 nmdc:mga0k408_19883_c1 3300050493 Bacteria 3759
963 nmdc:mga0k408_20741_c1 3300050493 Bacteria 3686
964 nmdc:mga0k408_28504_c1 3300050493 Bacteria 3175
965 nmdc:mga0k408_30386_c1 3300050493 Bacteria 3080
966 nmdc:mga0k408_5223_c1 3300050493 Bacteria 6891
967 nmdc:mga0k408_6810_c1 3300050493 Bacteria 6093
968 nmdc:mga0k408_8004_c1 3300050493 Bacteria 5667
969 nmdc:mga0k408_8592_c1 3300050493 Bacteria 5487
970 nmdc:mga0k408_9014_c1 3300050493 Bacteria 5370
971 nmdc:mga06z11_192751_c1 3300050494 Bacteria 1180
972 nmdc:mga06z11_42153_c1 3300050494 Bacteria 2288
973 nmdc:mga06z11_91772_c1 3300050494 Bacteria 1650
974 nmdc:mga04h51_16886_c1 3300050495 Bacteria 2125
975 nmdc:mga07m45_22715_c1 3300050496 Bacteria 3427
976 nmdc:mga07m45_5517_c1 3300050496 Bacteria 6304
977 nmdc:mga07m45_63905_c1 3300050496 Bacteria 2088
978 nmdc:mga07m45_71156_c1 3300050496 Bacteria 1979
979 nmdc:mga07m45_80719_c1 3300050496 Bacteria 1364
980 nmdc:mga05p37_165287_c1 3300050507 Bacteria 2701
981 nmdc:mga05p37_302592_c1 3300050507 Bacteria 1899
982 nmdc:mga05p37_368_c1 3300050507 Bacteria 48338
983 nmdc:mga05p37_5315_c1 3300050507 Bacteria 15118
984 nmdc:mga09592_1120_c1 3300050508 Bacteria 21354
985 nmdc:mga09592_1504_c1 3300050508 Bacteria 18770
986 nmdc:mga09592_301_c1 3300050508 Bacteria 35907
987 nmdc:mga09592_8084_c1 3300050508 Bacteria 8556
988 nmdc:mga0qj67_158070_c1 3300050509 Bacteria 1840
989 nmdc:mga0qj67_288881_c1 3300050509 Bacteria 1329
990 nmdc:mga0qj67_34644_c1 3300050509 Bacteria 3945
991 nmdc:mga0qj67_41135_c1 3300050509 Bacteria 3634
992 nmdc:mga06r32_1761_c1 3300050510 Bacteria 19420
993 nmdc:mga06r32_31271_c1 3300050510 Bacteria 4998
994 nmdc:mga08y16_107_c1 3300050511 Bacteria 69847
995 nmdc:mga08y16_217587_c1 3300050511 Bacteria 1978
996 nmdc:mga08y16_3339_c1 3300050511 Bacteria 16624
997 nmdc:mga08y16_354984_c1 3300050511 Bacteria 1505
998 nmdc:mga08y16_9580_c1 3300050511 Bacteria 10168
999 nmdc:mga0n895_105446_c1 3300050512 Bacteria 2831
1000 nmdc:mga0n895_45054_c1 3300050512 Bacteria 4303
1001 nmdc:mga0rr50_223902_c1 3300050513 Bacteria 1554
1002 nmdc:mga08x19_2660_c1 3300050514 Bacteria 10809
1003 nmdc:mga08x19_87726_c1 3300050514 Bacteria 2050
1004 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
1005 Ga0495601_0006136 3300053077 Bacteria 7009
1006 Ga0495619_0007995 3300053085 Bacteria 6693
1007 Ga0495619_0044597 3300053085 Bacteria 2911
1008 Ga0500578_0000393 3300053086 Bacteria 53719
1009 Ga0500644_0008964 3300053088 Bacteria 2659
1010 Ga0500581_076119 3300053089 Bacteria 1683
1011 Ga0500583_0041918 3300053092 Bacteria 2083
1012 Ga0500583_0075229 3300053092 Bacteria 1622
1013 Ga0500651_0012079 3300053093 Bacteria 5223
1014 Ga0500641_0038517 3300053096 Bacteria 1921
1015 Ga0500562_028862 3300053108 Bacteria 1459
1016 Ga0500593_000388 3300053117 Bacteria 17529
1017 Ga0500595_009117 3300053119 Bacteria 4023
1018 Ga0500617_075941 3300053124 Bacteria 1464
1019 Ga0500628_001546 3300053129 Bacteria 3916
1020 Ga0500652_001779 3300053131 Bacteria 6527
1021 Ga0500655_006375 3300053133 Bacteria 2124
1022 Ga0500568_0013120 3300053139 Bacteria 3786
1023 Ga0500568_0014416 3300053139 Bacteria 3570
1024 Ga0500568_0018255 3300053139 Bacteria 3074
1025 Ga0500568_0019136 3300053139 Bacteria 2982
1026 Ga0500589_070532 3300053147 Bacteria 1581
1027 Ga0500604_0015432 3300053151 Bacteria 2092
1028 Ga0500616_0000028 3300053153 Bacteria 435722
1029 Ga0500622_0000232 3300053156 Bacteria 57941
1030 Ga0500627_0000792 3300053158 Bacteria 8417
1031 Ga0500645_000228 3300053730 Bacteria 42875
1032 Ga0500645_011086 3300053730 Bacteria 2955
1033 Ga0501084_0060052 3300054114 Bacteria 3183
1034 Ga0501084_0145259 3300054114 Bacteria 1998
1035 Ga0501084_0231389 3300054114 Bacteria 1560
1036 Ga0590071_021107 3300059421 Bacteria 1535
1037 Ga0587077_015577 3300059493 Bacteria 1268
1038 Ga0587083_0007514 3300059505 Bacteria 1672
1039 Ga0587085_003754 3300059506 Bacteria 1680
1040 Ga0587086_007587 3300059507 Bacteria 1246
1041 Ga0587088_017683 3300059508 Bacteria 1151
1042 Ga0587109_011735 3300059624 Bacteria 1422
1043 Ga0587067_019455 3300059640 Bacteria 1151
1044 Ga0587072_021118 3300059643 Bacteria 1153
1045 Ga0587078_004027 3300059646 Bacteria 1523
1046 Ga0587079_013693 3300059647 Bacteria 1348
1047 Ga0587102_003400 3300059649 Bacteria 1293
1048 Ga0501082_0077066 3300060353 Bacteria 2874
1049 Ga0530510_0041648 3300061734 Bacteria 3316

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0110149 Ga0495621_0110149_14_829 271
2 3300041463 Ga0451804_0459646 Ga0451804_0459646_21_881 286
3 3300049579 Ga0501043_0034397 Ga0501043_0034397_3111_3974 287
4 3300049584 Ga0501068_0317204 Ga0501068_0317204_116_979 287
5 3300053133 Ga0500655_006375 Ga0500655_006375_1177_2082 301
6 3300053085 Ga0495619_0044597 Ga0495619_0044597_1987_2895 302
7 3300004803 Ga0058862_12772269 Ga0058862_127722692 305
8 3300005458 Ga0070681_10105197 Ga0070681_101051971 305
9 3300005530 Ga0070679_100035432 Ga0070679_1000354323 305
10 3300013104 Ga0157370_10081869 Ga0157370_100818692 305
11 3300020069 Ga0197907_10590190 Ga0197907_105901901 305
12 3300020078 Ga0206352_11255281 Ga0206352_112552811 305
13 3300025917 Ga0207660_10190659 Ga0207660_101906592 305
14 3300025921 Ga0207652_10221164 Ga0207652_102211642 305
15 3300049588 Ga0501072_0097100 Ga0501072_0097100_727_1701 305
16 3300006195 Ga0075366_10053401 Ga0075366_100534011 308
17 3300042134 Ga0450898_017655 Ga0450898_017655_87_1097 309
18 3300005347 Ga0070668_100081328 Ga0070668_1000813281 310
19 3300005353 Ga0070669_100030223 Ga0070669_1000302234 310
20 3300005459 Ga0068867_100002021 Ga0068867_1000020215 310
21 3300005543 Ga0070672_100091843 Ga0070672_1000918433 310
22 3300005617 Ga0068859_100046715 Ga0068859_1000467153 310
23 3300005718 Ga0068866_10061450 Ga0068866_100614502 310
24 3300005843 Ga0068860_100003477 Ga0068860_1000034775 310
25 3300006881 Ga0068865_100007125 Ga0068865_1000071255 310
26 3300006931 Ga0097620_100046715 Ga0097620_1000467153 310
27 3300013296 Ga0157374_10028606 Ga0157374_100286064 310
28 3300013297 Ga0157378_10061851 Ga0157378_100618513 310
29 3300025919 Ga0207657_10233343 Ga0207657_102333431 310
30 3300025923 Ga0207681_10022061 Ga0207681_100220614 310
31 3300025931 Ga0207644_10120624 Ga0207644_101206241 310
32 3300025937 Ga0207669_10010756 Ga0207669_100107563 310
33 3300025938 Ga0207704_10188533 Ga0207704_101885331 310
34 3300025940 Ga0207691_10049988 Ga0207691_100499883 310
35 3300025972 Ga0207668_10053142 Ga0207668_100531421 310
36 3300026089 Ga0207648_10001364 Ga0207648_1000136419 310
37 3300026118 Ga0207675_100002430 Ga0207675_10000243016 310
38 3300028380 Ga0268265_10003395 Ga0268265_100033957 310
39 3300028381 Ga0268264_10079331 Ga0268264_100793311 310
40 3300037312 Ga0395899_0002908 Ga0395899_0002908_2203_3180 310
41 3300042876 Ga0451577_0009097 Ga0451577_0009097_1346_2401 310
42 3300045051 Ga0451576_0000140 Ga0451576_0000140_142256_143251 310
43 3300045051 Ga0451576_0018448 Ga0451576_0018448_557_1612 310
44 3300045051 Ga0451576_0033233 Ga0451576_0033233_3055_4044 310
45 3300048905 Ga0496102_0009712 Ga0496102_0009712_6089_7048 310
46 3300050507 nmdc:mga05p37_5315_c1 nmdc:mga05p37_5315_c1_4645_5622 310
47 3300050508 nmdc:mga09592_301_c1 nmdc:mga09592_301_c1_33145_34122 310
48 3300050510 nmdc:mga06r32_31271_c1 nmdc:mga06r32_31271_c1_2261_3238 310
49 iso_pu_bacteria 2643221644 2644247463 310
50 iso_pu_bacteria 2844533157 2844539191 310
51 3300005295 Ga0065707_10096561 Ga0065707_100965611 311
52 3300005344 Ga0070661_100000474 Ga0070661_10000047429 311
53 3300005344 Ga0070661_100006617 Ga0070661_1000066173 311
54 3300005366 Ga0070659_100001233 Ga0070659_10000123311 311
55 3300005458 Ga0070681_10002448 Ga0070681_1000244813 311
56 3300005458 Ga0070681_10040960 Ga0070681_100409604 311
57 3300005530 Ga0070679_100007265 Ga0070679_1000072656 311
58 3300005539 Ga0068853_100012954 Ga0068853_1000129543 311
59 3300005564 Ga0070664_100001851 Ga0070664_1000018512 311
60 3300005577 Ga0068857_100205610 Ga0068857_1002056102 311
61 3300009094 Ga0111539_10217210 Ga0111539_102172102 311
62 3300013104 Ga0157370_10163736 Ga0157370_101637362 311
63 3300025912 Ga0207707_10158081 Ga0207707_101580812 311
64 3300025920 Ga0207649_10006855 Ga0207649_100068552 311
65 3300025920 Ga0207649_10021160 Ga0207649_100211601 311
66 3300025921 Ga0207652_10029293 Ga0207652_100292932 311
67 3300025932 Ga0207690_10000538 Ga0207690_100005387 311
68 3300025945 Ga0207679_10000542 Ga0207679_1000054219 311
69 3300028794 Ga0307515_10087565 Ga0307515_100875653 311
70 3300042006 Ga0439432_028886 Ga0439432_028886_820_1791 311
71 3300048909 Ga0496106_0064186 Ga0496106_0064186_1088_2077 311
72 3300050491 nmdc:mga00v17_86221_c1 nmdc:mga00v17_86221_c1_930_1892 311
73 3300050492 nmdc:mga0yw44_73945_c1 nmdc:mga0yw44_73945_c1_159_1130 311
74 3300050493 nmdc:mga0k408_20741_c1 nmdc:mga0k408_20741_c1_1742_2713 311
75 3300050493 nmdc:mga0k408_30386_c1 nmdc:mga0k408_30386_c1_926_1897 311
76 3300050495 nmdc:mga04h51_16886_c1 nmdc:mga04h51_16886_c1_328_1299 311
77 3300050516 nmdc:mga0sz30_15_c1 nmdc:mga0sz30_15_c1_60406_61377 311
78 iso_pu_bacteria 2513237092 2513622852 311
79 iso_pu_bacteria 2513237161 2514009646 311
80 iso_pu_bacteria 2585428057 2587729065 311
81 iso_pu_bacteria 2585428058 2587733636 311
82 iso_pu_bacteria 2588253510 2588294028 311
83 iso_pu_bacteria 2617270741 2617372497 311
84 iso_pu_bacteria 2643221592 2643967131 311
85 iso_pu_bacteria 2643221625 2644139961 311
86 iso_pu_bacteria 2643221648 2644271201 311
87 iso_pu_bacteria 2643221660 2644337365 311
88 iso_pu_bacteria 2824671348 2824675020 311
89 iso_pu_bacteria 2824687955 2824693357 311
90 iso_pu_bacteria 2824746037 2824747067 311
91 iso_pu_bacteria 2838122688 2838122876 311
92 iso_pu_bacteria 2841941048 2841944836 311
93 iso_pu_bacteria 2841966195 2841973687 311
94 iso_pu_bacteria 2841974524 2841978581 311
95 iso_pu_bacteria 2841983080 2841988943 311
96 iso_pu_bacteria 2885366525 2885369687 311
97 iso_pu_bacteria 2908775508 2908780949 311
98 iso_pu_bacteria 3005483717 3005484991 311
99 iso_pu_bacteria 3005587118 3005587267 311
100 3300002773 JGI25152J39213_1003264 JGI25152J39213_10032645 312
101 3300003215 JGI25153J46596_10002000 JGI25153J46596_100020007 312
102 3300003771 Ga0055526_1001374 Ga0055526_100137416 312
103 3300004799 Ga0058863_10003707 Ga0058863_100037071 312
104 3300005355 Ga0070671_100003012 Ga0070671_10000301210 312
105 3300005356 Ga0070674_100139106 Ga0070674_1001391062 312
106 3300005456 Ga0070678_100331502 Ga0070678_1003315021 312
107 3300005458 Ga0070681_10405605 Ga0070681_104056051 312
108 3300005543 Ga0070672_100056572 Ga0070672_1000565722 312
109 3300005937 Ga0081455_10007375 Ga0081455_1000737510 312
110 3300006237 Ga0097621_100105151 Ga0097621_1001051513 312
111 3300006844 Ga0075428_100077317 Ga0075428_1000773172 312
112 3300006844 Ga0075428_100160813 Ga0075428_1001608133 312
113 3300006846 Ga0075430_100022713 Ga0075430_1000227134 312
114 3300006847 Ga0075431_100018872 Ga0075431_1000188725 312
115 3300009177 Ga0105248_10035140 Ga0105248_100351403 312
116 3300009177 Ga0105248_10076968 Ga0105248_100769684 312
117 3300013296 Ga0157374_10155005 Ga0157374_101550052 312
118 3300020070 Ga0206356_10165203 Ga0206356_101652031 312
119 3300020078 Ga0206352_11269377 Ga0206352_112693772 312
120 3300020082 Ga0206353_11895588 Ga0206353_118955882 312
121 3300025245 Ga0207425_1000598 Ga0207425_100059820 312
122 3300025258 Ga0209129_1000038 Ga0209129_1000038180 312
123 3300025263 Ga0209565_1006285 Ga0209565_10062852 312
124 3300025273 Ga0209673_1013792 Ga0209673_10137923 312
125 3300025295 Ga0209564_1000129 Ga0209564_10001297 312
126 3300025297 Ga0209758_1000197 Ga0209758_10001977 312
127 3300025912 Ga0207707_10053222 Ga0207707_100532222 312
128 3300025925 Ga0207650_10030088 Ga0207650_100300882 312
129 3300025925 Ga0207650_10359410 Ga0207650_103594102 312
130 3300025931 Ga0207644_10011121 Ga0207644_100111214 312
131 3300025937 Ga0207669_10051238 Ga0207669_100512383 312
132 3300025940 Ga0207691_10057620 Ga0207691_100576203 312
133 3300026095 Ga0207676_10044753 Ga0207676_100447533 312
134 3300026121 Ga0207683_10014682 Ga0207683_100146824 312
135 3300026121 Ga0207683_10520179 Ga0207683_105201791 312
136 3300026142 Ga0207698_10208279 Ga0207698_102082792 312
137 3300031911 Ga0307412_10294608 Ga0307412_102946082 312
138 3300035692 Ga0373935_0069199 Ga0373935_0069199_505_1503 312
139 3300042121 Ga0450919_001126 Ga0450919_001126_141_1142 312
140 3300042121 Ga0450919_005256 Ga0450919_005256_274_1242 312
141 3300042531 Ga0450918_000031 Ga0450918_000031_24114_25115 312
142 3300042876 Ga0451577_0005819 Ga0451577_0005819_4711_5718 312
143 3300046683 Ga0495658_0034976 Ga0495658_0034976_852_1850 312
144 3300048912 Ga0496109_0103560 Ga0496109_0103560_227_1225 312
145 3300049583 Ga0501067_0098000 Ga0501067_0098000_40_1053 312
146 3300050507 nmdc:mga05p37_368_c1 nmdc:mga05p37_368_c1_24292_25296 312
147 3300050510 nmdc:mga06r32_1761_c1 nmdc:mga06r32_1761_c1_8602_9606 312
148 3300050511 nmdc:mga08y16_107_c1 nmdc:mga08y16_107_c1_32871_33875 312
149 3300059493 Ga0587077_015577 Ga0587077_015577_112_1125 312
150 3300059505 Ga0587083_0007514 Ga0587083_0007514_492_1505 312
151 3300059506 Ga0587085_003754 Ga0587085_003754_180_1193 312
152 3300059507 Ga0587086_007587 Ga0587086_007587_127_1140 312
153 3300059508 Ga0587088_017683 Ga0587088_017683_27_1040 312
154 3300059640 Ga0587067_019455 Ga0587067_019455_115_1128 312
155 3300059643 Ga0587072_021118 Ga0587072_021118_29_1042 312
156 3300059646 Ga0587078_004027 Ga0587078_004027_180_1193 312
157 3300059647 Ga0587079_013693 Ga0587079_013693_108_1121 312
158 iso_pu_bacteria 2513237139 2513878265 312
159 iso_pu_bacteria 2517093001 2517103927 312
160 iso_pu_bacteria 2528768022 2528854541 312
161 iso_pu_bacteria 2617270735 2617346587 312
162 iso_pu_bacteria 2802429603 2805918487 312
163 iso_pu_bacteria 2824600985 2824607074 312
164 iso_pu_bacteria 2824609381 2824613511 312
165 iso_pu_bacteria 2824617872 2824622866 312
166 iso_pu_bacteria 2824626560 2824631983 312
167 iso_pu_bacteria 2824635225 2824638562 312
168 iso_pu_bacteria 2824644064 2824647732 312
169 iso_pu_bacteria 2824653114 2824658268 312
170 iso_pu_bacteria 2824661429 2824665322 312
171 iso_pu_bacteria 2824679649 2824681489 312
172 iso_pu_bacteria 2824696289 2824699664 312
173 iso_pu_bacteria 2824714736 2824716216 312
174 iso_pu_bacteria 2824723954 2824726816 312
175 iso_pu_bacteria 2824773399 2824777332 312
176 iso_pu_bacteria 2847930680 2847937142 312
177 iso_pu_bacteria 2847939898 2847947523 312
178 iso_pu_bacteria 2849076700 2849078600 312
179 iso_pu_bacteria 2857509624 2857512989 312
180 iso_pu_bacteria 2874612657 2874614795 312
181 iso_pu_bacteria 2879083081 2879089194 312
182 iso_pu_bacteria 2881364244 2881364731 312
183 iso_pu_bacteria 2888419890 2888425389 312
184 iso_pu_bacteria 2906643746 2906650391 312
185 iso_pu_bacteria 2919450847 2919452556 312
186 iso_pu_bacteria 2922393267 2922397285 312
187 iso_pu_bacteria 2929615660 2929620464 312
188 iso_pu_bacteria 2929624759 2929626357 312
189 iso_pu_bacteria 2933577622 2933582382 312
190 iso_pu_bacteria 3005506211 3005507289 312
191 iso_pu_bacteria 8001845381 8001847094 312
192 iso_pu_bacteria 8055742211 8055745326 312
193 3300003775 Ga0055524_1000425 Ga0055524_100042515 313
194 3300003791 Ga0055530_10001827 Ga0055530_1000182713 313
195 3300003791 Ga0055530_10002550 Ga0055530_100025506 313
196 3300003792 Ga0055540_1000028 Ga0055540_100002844 313
197 3300003794 Ga0055531_10002132 Ga0055531_100021324 313
198 3300005333 Ga0070677_10066634 Ga0070677_100666342 313
199 3300005341 Ga0070691_10060585 Ga0070691_100605851 313
200 3300005617 Ga0068859_100259256 Ga0068859_1002592561 313
201 3300005841 Ga0068863_100061216 Ga0068863_1000612163 313
202 3300005844 Ga0068862_100010795 Ga0068862_1000107957 313
203 3300005937 Ga0081455_10003517 Ga0081455_100035175 313
204 3300005937 Ga0081455_10102570 Ga0081455_101025703 313
205 3300005983 Ga0081540_1002531 Ga0081540_100253111 313
206 3300006178 Ga0075367_10228200 Ga0075367_102282001 313
207 3300006195 Ga0075366_10065710 Ga0075366_100657103 313
208 3300006847 Ga0075431_100528896 Ga0075431_1005288961 313
209 3300006931 Ga0097620_100259270 Ga0097620_1002592701 313
210 3300006946 Ga0079104_1000194 Ga0079104_100019480 313
211 3300009094 Ga0111539_10186342 Ga0111539_101863421 313
212 3300009101 Ga0105247_10065504 Ga0105247_100655043 313
213 3300009148 Ga0105243_10075395 Ga0105243_100753952 313
214 3300009553 Ga0105249_10176132 Ga0105249_101761322 313
215 3300013306 Ga0163162_10003566 Ga0163162_100035663 313
216 3300013308 Ga0157375_10007052 Ga0157375_100070526 313
217 3300014968 Ga0157379_10072610 Ga0157379_100726102 313
218 3300025298 Ga0209050_1000282 Ga0209050_100028256 313
219 3300025298 Ga0209050_1022724 Ga0209050_10227242 313
220 3300025299 Ga0209256_1000015 Ga0209256_1000015142 313
221 3300025303 Ga0209051_1000022 Ga0209051_1000022309 313
222 3300025304 Ga0209257_1000030 Ga0209257_1000030507 313
223 3300025901 Ga0207688_10040362 Ga0207688_100403622 313
224 3300025912 Ga0207707_10244778 Ga0207707_102447782 313
225 3300025960 Ga0207651_10027540 Ga0207651_100275403 313
226 3300026089 Ga0207648_10100675 Ga0207648_101006753 313
227 3300027111 Ga0209281_1000083 Ga0209281_1000083145 313
228 3300028380 Ga0268265_10024517 Ga0268265_100245171 313
229 3300031730 Ga0307516_10003308 Ga0307516_1000330816 313
230 3300031852 Ga0307410_10055265 Ga0307410_100552652 313
231 3300031995 Ga0307409_100050443 Ga0307409_1000504433 313
232 3300032002 Ga0307416_100132824 Ga0307416_1001328242 313
233 3300032126 Ga0307415_100051380 Ga0307415_1000513803 313
234 3300035695 Ga0373927_0010401 Ga0373927_0010401_1950_2978 313
235 3300037068 Ga0373925_0032915 Ga0373925_0032915_888_1916 313
236 3300046683 Ga0495658_0082219 Ga0495658_0082219_136_1164 313
237 3300049568 Ga0501031_0015585 Ga0501031_0015585_3226_4239 313
238 3300049572 Ga0501036_0014495 Ga0501036_0014495_672_1685 313
239 3300049574 Ga0501038_0102733 Ga0501038_0102733_682_1695 313
240 3300049575 Ga0501039_0022016 Ga0501039_0022016_1527_2540 313
241 3300049577 Ga0501041_0032509 Ga0501041_0032509_1379_2392 313
242 3300049578 Ga0501042_0102626 Ga0501042_0102626_782_1795 313
243 3300049580 Ga0501046_0093936 Ga0501046_0093936_1214_2227 313
244 3300049582 Ga0501048_0005866 Ga0501048_0005866_6424_7437 313
245 3300049585 Ga0501069_0266890 Ga0501069_0266890_10_987 313
246 3300049588 Ga0501072_0029027 Ga0501072_0029027_2409_3422 313
247 3300049592 Ga0501076_0221425 Ga0501076_0221425_136_1149 313
248 3300049593 Ga0501077_0009547 Ga0501077_0009547_4247_5260 313
249 3300049742 Ga0501080_0089937 Ga0501080_0089937_69_1082 313
250 3300049743 Ga0501081_0104384 Ga0501081_0104384_638_1651 313
251 3300049822 Ga0501035_0108325 Ga0501035_0108325_180_1193 313
252 3300049823 Ga0501044_0374879 Ga0501044_0374879_126_1139 313
253 3300049824 Ga0501045_0007316 Ga0501045_0007316_750_1763 313
254 3300050493 nmdc:mga0k408_9014_c1 nmdc:mga0k408_9014_c1_2237_3262 313
255 3300050494 nmdc:mga06z11_192751_c1 nmdc:mga06z11_192751_c1_114_1139 313
256 3300050507 nmdc:mga05p37_165287_c1 nmdc:mga05p37_165287_c1_835_1845 313
257 3300050511 nmdc:mga08y16_354984_c1 nmdc:mga08y16_354984_c1_202_1227 313
258 3300054114 Ga0501084_0060052 Ga0501084_0060052_761_1774 313
259 3300060353 Ga0501082_0077066 Ga0501082_0077066_566_1579 313
260 3300061734 Ga0530510_0041648 Ga0530510_0041648_975_1988 313
261 3300003215 JGI25153J46596_10002578 JGI25153J46596_100025784 314
262 3300003215 JGI25153J46596_10003655 JGI25153J46596_100036552 314
263 3300003791 Ga0055530_10005532 Ga0055530_100055323 314
264 3300005262 Ga0065165_1008884 Ga0065165_10088842 314
265 3300005295 Ga0065707_10234388 Ga0065707_102343881 314
266 3300005327 Ga0070658_10046848 Ga0070658_100468483 314
267 3300005329 Ga0070683_100014191 Ga0070683_1000141916 314
268 3300005331 Ga0070670_100206049 Ga0070670_1002060492 314
269 3300005331 Ga0070670_100216340 Ga0070670_1002163402 314
270 3300005344 Ga0070661_100005709 Ga0070661_1000057092 314
271 3300005366 Ga0070659_100056895 Ga0070659_1000568952 314
272 3300005366 Ga0070659_100099881 Ga0070659_1000998813 314
273 3300005435 Ga0070714_100292630 Ga0070714_1002926302 314
274 3300005471 Ga0070698_100069969 Ga0070698_1000699692 314
275 3300005535 Ga0070684_100098119 Ga0070684_1000981192 314
276 3300005539 Ga0068853_100035086 Ga0068853_1000350864 314
277 3300005545 Ga0070695_100247102 Ga0070695_1002471022 314
278 3300005548 Ga0070665_100033484 Ga0070665_1000334847 314
279 3300005548 Ga0070665_100099169 Ga0070665_1000991693 314
280 3300005564 Ga0070664_100117886 Ga0070664_1001178862 314
281 3300005578 Ga0068854_100012425 Ga0068854_1000124252 314
282 3300005614 Ga0068856_100008513 Ga0068856_1000085138 314
283 3300005616 Ga0068852_100043473 Ga0068852_1000434733 314
284 3300005617 Ga0068859_100014988 Ga0068859_1000149885 314
285 3300005617 Ga0068859_100556906 Ga0068859_1005569062 314
286 3300005719 Ga0068861_100003649 Ga0068861_1000036498 314
287 3300005843 Ga0068860_100436818 Ga0068860_1004368181 314
288 3300005981 Ga0081538_10065423 Ga0081538_100654232 314
289 3300005985 Ga0081539_10004441 Ga0081539_100044417 314
290 3300005985 Ga0081539_10008485 Ga0081539_100084855 314
291 3300006038 Ga0075365_10014914 Ga0075365_100149144 314
292 3300006048 Ga0075363_100197851 Ga0075363_1001978511 314
293 3300006177 Ga0075362_10006880 Ga0075362_100068804 314
294 3300006177 Ga0075362_10013195 Ga0075362_100131953 314
295 3300006177 Ga0075362_10078021 Ga0075362_100780212 314
296 3300006177 Ga0075362_10081810 Ga0075362_100818102 314
297 3300006186 Ga0075369_10000082 Ga0075369_1000008212 314
298 3300006353 Ga0075370_10043341 Ga0075370_100433412 314
299 3300006353 Ga0075370_10182096 Ga0075370_101820961 314
300 3300006358 Ga0068871_100214566 Ga0068871_1002145662 314
301 3300006847 Ga0075431_100019249 Ga0075431_1000192493 314
302 3300006852 Ga0075433_10251505 Ga0075433_102515052 314
303 3300006880 Ga0075429_100000783 Ga0075429_1000007833 314
304 3300006931 Ga0097620_100014989 Ga0097620_1000149893 314
305 3300006931 Ga0097620_100556997 Ga0097620_1005569972 314
306 3300007076 Ga0075435_100168902 Ga0075435_1001689022 314
307 3300009147 Ga0114129_10000341 Ga0114129_100003414 314
308 3300009551 Ga0105238_10014576 Ga0105238_100145766 314
309 3300009553 Ga0105249_10010104 Ga0105249_100101042 314
310 3300013100 Ga0157373_10007866 Ga0157373_100078668 314
311 3300013104 Ga0157370_10139287 Ga0157370_101392872 314
312 3300013105 Ga0157369_10017534 Ga0157369_100175342 314
313 3300014968 Ga0157379_10122996 Ga0157379_101229962 314
314 3300025258 Ga0209129_1018735 Ga0209129_10187352 314
315 3300025273 Ga0209673_1004238 Ga0209673_100423810 314
316 3300025297 Ga0209758_1000209 Ga0209758_100020910 314
317 3300025297 Ga0209758_1000213 Ga0209758_100021341 314
318 3300025297 Ga0209758_1000613 Ga0209758_100061345 314
319 3300025298 Ga0209050_1000178 Ga0209050_100017826 314
320 3300025303 Ga0209051_1004272 Ga0209051_10042722 314
321 3300025920 Ga0207649_10024036 Ga0207649_100240363 314
322 3300025925 Ga0207650_10227277 Ga0207650_102272772 314
323 3300025932 Ga0207690_10023590 Ga0207690_100235902 314
324 3300025945 Ga0207679_10021173 Ga0207679_100211733 314
325 3300025961 Ga0207712_10023406 Ga0207712_100234064 314
326 3300026041 Ga0207639_10146596 Ga0207639_101465962 314
327 3300026078 Ga0207702_10004295 Ga0207702_100042952 314
328 3300026116 Ga0207674_10015377 Ga0207674_100153774 314
329 3300026118 Ga0207675_100015324 Ga0207675_1000153241 314
330 3300026142 Ga0207698_10007138 Ga0207698_100071383 314
331 3300027526 Ga0209968_1000171 Ga0209968_10001713 314
332 3300027695 Ga0209966_1000118 Ga0209966_100011816 314
333 3300027866 Ga0209813_10040887 Ga0209813_100408871 314
334 3300028379 Ga0268266_10002299 Ga0268266_100022993 314
335 3300028379 Ga0268266_10032022 Ga0268266_100320222 314
336 3300028380 Ga0268265_10084165 Ga0268265_100841653 314
337 3300028794 Ga0307515_10000150 Ga0307515_10000150145 314
338 3300028794 Ga0307515_10000367 Ga0307515_1000036778 314
339 3300028794 Ga0307515_10005608 Ga0307515_1000560814 314
340 3300028794 Ga0307515_10054271 Ga0307515_100542714 314
341 3300028794 Ga0307515_10063415 Ga0307515_100634154 314
342 3300031456 Ga0307513_10000514 Ga0307513_100005141 314
343 3300031456 Ga0307513_10000991 Ga0307513_1000099123 314
344 3300031507 Ga0307509_10020754 Ga0307509_100207542 314
345 3300031548 Ga0307408_100049104 Ga0307408_1000491042 314
346 3300031730 Ga0307516_10060979 Ga0307516_100609792 314
347 3300031730 Ga0307516_10099941 Ga0307516_100999412 314
348 3300032002 Ga0307416_100117706 Ga0307416_1001177063 314
349 3300037471 Ga0395905_0080961 Ga0395905_0080961_1371_2378 314
350 3300042876 Ga0451577_0105405 Ga0451577_0105405_418_1425 314
351 3300044712 Ga0453684_0189876 Ga0453684_0189876_888_1898 314
352 3300046515 Ga0495620_0053935 Ga0495620_0053935_442_1446 314
353 3300046519 Ga0495632_0001754 Ga0495632_0001754_7547_8551 314
354 3300046537 Ga0495598_0006159 Ga0495598_0006159_1526_2545 314
355 3300047320 Ga0495672_0040687 Ga0495672_0040687_297_1301 314
356 3300048924 Ga0496121_0085596 Ga0496121_0085596_1009_2013 314
357 3300050489 nmdc:mga03683_10404_c1 nmdc:mga03683_10404_c1_935_1948 314
358 3300050493 nmdc:mga0k408_28504_c1 nmdc:mga0k408_28504_c1_1803_2807 314
359 3300053086 Ga0500578_0000393 Ga0500578_0000393_13342_14346 314
360 3300053088 Ga0500644_0008964 Ga0500644_0008964_680_1693 314
361 3300053092 Ga0500583_0041918 Ga0500583_0041918_229_1233 314
362 3300053093 Ga0500651_0012079 Ga0500651_0012079_1445_2449 314
363 3300053096 Ga0500641_0038517 Ga0500641_0038517_304_1314 314
364 3300053108 Ga0500562_028862 Ga0500562_028862_373_1377 314
365 3300053129 Ga0500628_001546 Ga0500628_001546_18_1022 314
366 3300053131 Ga0500652_001779 Ga0500652_001779_3514_4518 314
367 3300053139 Ga0500568_0013120 Ga0500568_0013120_1883_2890 314
368 3300053139 Ga0500568_0014416 Ga0500568_0014416_2016_3020 314
369 3300053156 Ga0500622_0000232 Ga0500622_0000232_22909_23913 314
370 3300053730 Ga0500645_000228 Ga0500645_000228_2684_3706 314
371 iso_pu_bacteria 2522572158 2523107081 314
372 iso_pu_bacteria 2842333319 2842336811 314
373 3300003215 JGI25153J46596_10013460 JGI25153J46596_100134604 315
374 3300003354 JGI25160J50197_1014690 JGI25160J50197_10146901 315
375 3300005262 Ga0065165_1001283 Ga0065165_100128313 315
376 3300005459 Ga0068867_100216929 Ga0068867_1002169291 315
377 3300005530 Ga0070679_100072190 Ga0070679_1000721903 315
378 3300005545 Ga0070695_100041991 Ga0070695_1000419913 315
379 3300005546 Ga0070696_100284287 Ga0070696_1002842871 315
380 3300005548 Ga0070665_100254627 Ga0070665_1002546272 315
381 3300005614 Ga0068856_100131262 Ga0068856_1001312622 315
382 3300005615 Ga0070702_100096100 Ga0070702_1000961001 315
383 3300005617 Ga0068859_100106483 Ga0068859_1001064832 315
384 3300005841 Ga0068863_100256068 Ga0068863_1002560682 315
385 3300005843 Ga0068860_100016555 Ga0068860_1000165553 315
386 3300005843 Ga0068860_100156219 Ga0068860_1001562192 315
387 3300005937 Ga0081455_10063531 Ga0081455_100635313 315
388 3300005983 Ga0081540_1016498 Ga0081540_10164984 315
389 3300005983 Ga0081540_1029880 Ga0081540_10298803 315
390 3300006038 Ga0075365_10172845 Ga0075365_101728451 315
391 3300006048 Ga0075363_100197194 Ga0075363_1001971941 315
392 3300006186 Ga0075369_10021909 Ga0075369_100219092 315
393 3300006353 Ga0075370_10026465 Ga0075370_100264652 315
394 3300006353 Ga0075370_10116077 Ga0075370_101160771 315
395 3300006931 Ga0097620_100106485 Ga0097620_1001064852 315
396 3300006944 Ga0099823_1033761 Ga0099823_10337612 315
397 3300009098 Ga0105245_10047188 Ga0105245_100471883 315
398 3300009177 Ga0105248_10249923 Ga0105248_102499232 315
399 3300009553 Ga0105249_10380603 Ga0105249_103806031 315
400 3300009553 Ga0105249_10409923 Ga0105249_104099231 315
401 3300010375 Ga0105239_10019990 Ga0105239_100199906 315
402 3300021320 Ga0214544_1000004 Ga0214544_1000004330 315
403 3300021321 Ga0214542_1000001 Ga0214542_100000123 315
404 3300021324 Ga0214545_1000001 Ga0214545_100000190 315
405 3300021327 Ga0214543_1000006 Ga0214543_100000687 315
406 3300022467 Ga0224712_10094181 Ga0224712_100941811 315
407 3300025297 Ga0209758_1004235 Ga0209758_10042352 315
408 3300025302 Ga0207426_1001703 Ga0207426_10017034 315
409 3300025302 Ga0207426_1004495 Ga0207426_10044956 315
410 3300025912 Ga0207707_10133476 Ga0207707_101334762 315
411 3300025914 Ga0207671_10040140 Ga0207671_100401403 315
412 3300025917 Ga0207660_10025680 Ga0207660_100256804 315
413 3300025919 Ga0207657_10243076 Ga0207657_102430762 315
414 3300025932 Ga0207690_10097341 Ga0207690_100973411 315
415 3300025940 Ga0207691_10218849 Ga0207691_102188491 315
416 3300025941 Ga0207711_10305393 Ga0207711_103053932 315
417 3300025949 Ga0207667_10241526 Ga0207667_102415262 315
418 3300025960 Ga0207651_10137482 Ga0207651_101374821 315
419 3300025972 Ga0207668_10228414 Ga0207668_102284142 315
420 3300025986 Ga0207658_10149123 Ga0207658_101491232 315
421 3300026023 Ga0207677_10084777 Ga0207677_100847772 315
422 3300026067 Ga0207678_10053759 Ga0207678_100537592 315
423 3300026078 Ga0207702_10123155 Ga0207702_101231551 315
424 3300026142 Ga0207698_10321436 Ga0207698_103214361 315
425 3300027296 Ga0209389_1000001 Ga0209389_1000001328 315
426 3300027360 Ga0209969_1005346 Ga0209969_10053462 315
427 3300027361 Ga0209489_105217 Ga0209489_10521716 315
428 3300027363 Ga0209700_100007 Ga0209700_10000799 315
429 3300027364 Ga0209967_1000971 Ga0209967_10009712 315
430 3300027395 Ga0209996_1008152 Ga0209996_10081522 315
431 3300027424 Ga0209984_1004908 Ga0209984_10049082 315
432 3300027462 Ga0210000_1004391 Ga0210000_10043912 315
433 3300027471 Ga0209995_1010466 Ga0209995_10104661 315
434 3300027614 Ga0209970_1008103 Ga0209970_10081032 315
435 3300028379 Ga0268266_10476300 Ga0268266_104763001 315
436 3300028380 Ga0268265_10055399 Ga0268265_100553993 315
437 3300028381 Ga0268264_10363002 Ga0268264_103630021 315
438 3300028786 Ga0307517_10000579 Ga0307517_1000057935 315
439 3300028794 Ga0307515_10020668 Ga0307515_100206688 315
440 3300031456 Ga0307513_10008489 Ga0307513_1000848911 315
441 3300032004 Ga0307414_10346151 Ga0307414_103461511 315
442 3300033180 Ga0307510_10040933 Ga0307510_100409332 315
443 3300035114 Ga0373939_0053786 Ga0373939_0053786_75_1088 315
444 3300035691 Ga0373931_0130953 Ga0373931_0130953_292_1305 315
445 3300044842 Ga0466957_0224568 Ga0466957_0224568_35_1042 315
446 3300045051 Ga0451576_0270087 Ga0451576_0270087_460_1464 315
447 3300046459 Ga0495629_0241769 Ga0495629_0241769_220_1233 315
448 3300046461 Ga0495641_0045333 Ga0495641_0045333_687_1700 315
449 3300046471 Ga0495650_0072544 Ga0495650_0072544_240_1253 315
450 3300046491 Ga0495584_0059497 Ga0495584_0059497_444_1457 315
451 3300046492 Ga0495585_0077745 Ga0495585_0077745_143_1156 315
452 3300046492 Ga0495585_0098914 Ga0495585_0098914_301_1314 315
453 3300046507 Ga0495606_0002171 Ga0495606_0002171_17680_18693 315
454 3300046520 Ga0495637_0049391 Ga0495637_0049391_291_1304 315
455 3300046539 Ga0495621_0063185 Ga0495621_0063185_250_1263 315
456 3300047317 Ga0495604_0169307 Ga0495604_0169307_496_1500 315
457 3300047321 Ga0495676_0058042 Ga0495676_0058042_1053_2066 315
458 3300047323 Ga0495683_0082180 Ga0495683_0082180_460_1473 315
459 3300047472 Ga0495686_0100679 Ga0495686_0100679_411_1418 315
460 3300048903 Ga0496100_0020338 Ga0496100_0020338_893_1909 315
461 3300048907 Ga0496104_0534702 Ga0496104_0534702_28_1035 315
462 3300048910 Ga0496107_0260501 Ga0496107_0260501_76_1083 315
463 3300048911 Ga0496108_0417478 Ga0496108_0417478_67_1083 315
464 3300048914 Ga0496111_0211874 Ga0496111_0211874_26_1039 315
465 3300048915 Ga0496112_0000004 Ga0496112_0000004_445397_446410 315
466 3300048915 Ga0496112_0133017 Ga0496112_0133017_986_1999 315
467 3300048917 Ga0496114_0033642 Ga0496114_0033642_719_1735 315
468 3300048922 Ga0496119_0131216 Ga0496119_0131216_235_1248 315
469 3300048927 Ga0496124_0075596 Ga0496124_0075596_361_1374 315
470 3300048928 Ga0496125_0100358 Ga0496125_0100358_348_1361 315
471 3300049571 Ga0501034_0005172 Ga0501034_0005172_3924_4937 315
472 3300049742 Ga0501080_0068473 Ga0501080_0068473_442_1434 315
473 3300050490 nmdc:mga03n38_66667_c1 nmdc:mga03n38_66667_c1_475_1488 315
474 3300050494 nmdc:mga06z11_42153_c1 nmdc:mga06z11_42153_c1_837_1850 315
475 3300050494 nmdc:mga06z11_91772_c1 nmdc:mga06z11_91772_c1_150_1163 315
476 3300050496 nmdc:mga07m45_22715_c1 nmdc:mga07m45_22715_c1_591_1604 315
477 3300050509 nmdc:mga0qj67_288881_c1 nmdc:mga0qj67_288881_c1_13_1044 315
478 3300050512 nmdc:mga0n895_105446_c1 nmdc:mga0n895_105446_c1_1568_2575 315
479 3300050513 nmdc:mga0rr50_223902_c1 nmdc:mga0rr50_223902_c1_536_1543 315
480 3300053089 Ga0500581_076119 Ga0500581_076119_48_1061 315
481 3300053119 Ga0500595_009117 Ga0500595_009117_1956_2963 315
482 3300053124 Ga0500617_075941 Ga0500617_075941_56_1069 315
483 3300053139 Ga0500568_0018255 Ga0500568_0018255_835_1842 315
484 3300053147 Ga0500589_070532 Ga0500589_070532_63_1076 315
485 3300053151 Ga0500604_0015432 Ga0500604_0015432_610_1623 315
486 3300053153 Ga0500616_0000028 Ga0500616_0000028_273405_274415 315
487 3300053730 Ga0500645_011086 Ga0500645_011086_812_1825 315
488 3300005329 Ga0070683_100072206 Ga0070683_1000722062 316
489 3300005336 Ga0070680_100003680 Ga0070680_1000036806 316
490 3300005338 Ga0068868_100003486 Ga0068868_1000034865 316
491 3300005343 Ga0070687_100000018 Ga0070687_10000001813 316
492 3300005344 Ga0070661_100091204 Ga0070661_1000912041 316
493 3300005345 Ga0070692_10082902 Ga0070692_100829022 316
494 3300005564 Ga0070664_100010293 Ga0070664_1000102933 316
495 3300005614 Ga0068856_100012538 Ga0068856_1000125386 316
496 3300005616 Ga0068852_100044094 Ga0068852_1000440943 316
497 3300005841 Ga0068863_100055486 Ga0068863_1000554863 316
498 3300005844 Ga0068862_100001654 Ga0068862_1000016547 316
499 3300006195 Ga0075366_10021262 Ga0075366_100212622 316
500 3300006358 Ga0068871_100000344 Ga0068871_1000003443 316
501 3300006844 Ga0075428_100000505 Ga0075428_10000050522 316
502 3300006880 Ga0075429_100047247 Ga0075429_1000472474 316
503 3300009094 Ga0111539_10000490 Ga0111539_100004905 316
504 3300009094 Ga0111539_10030018 Ga0111539_100300184 316
505 3300009148 Ga0105243_10000346 Ga0105243_1000034625 316
506 3300009545 Ga0105237_10150584 Ga0105237_101505843 316
507 3300009551 Ga0105238_10026008 Ga0105238_100260083 316
508 3300013102 Ga0157371_10078904 Ga0157371_100789043 316
509 3300013105 Ga0157369_10148696 Ga0157369_101486961 316
510 3300013307 Ga0157372_10045037 Ga0157372_100450372 316
511 3300025904 Ga0207647_10063202 Ga0207647_100632023 316
512 3300025914 Ga0207671_10053972 Ga0207671_100539723 316
513 3300025918 Ga0207662_10000347 Ga0207662_1000034713 316
514 3300025920 Ga0207649_10017049 Ga0207649_100170494 316
515 3300025924 Ga0207694_10142647 Ga0207694_101426472 316
516 3300025927 Ga0207687_10004204 Ga0207687_100042045 316
517 3300025935 Ga0207709_10000485 Ga0207709_1000048521 316
518 3300025942 Ga0207689_10000488 Ga0207689_100004885 316
519 3300026088 Ga0207641_10055353 Ga0207641_100553533 316
520 3300026118 Ga0207675_100000316 Ga0207675_10000031626 316
521 3300027907 Ga0207428_10001574 Ga0207428_100015743 316
522 3300028380 Ga0268265_10002823 Ga0268265_100028235 316
523 3300028381 Ga0268264_10007460 Ga0268264_100074607 316
524 3300032002 Ga0307416_100102783 Ga0307416_1001027832 316
525 3300035083 Ga0373926_0001218 Ga0373926_0001218_2150_3157 316
526 3300035089 Ga0373944_0014577 Ga0373944_0014577_876_1877 316
527 3300035113 Ga0373936_0008312 Ga0373936_0008312_2083_3084 316
528 3300035116 Ga0373945_0001462 Ga0373945_0001462_457_1464 316
529 3300035170 Ga0373943_0004457 Ga0373943_0004457_3479_4486 316
530 3300035692 Ga0373935_0048671 Ga0373935_0048671_39_1046 316
531 3300037068 Ga0373925_0155395 Ga0373925_0155395_502_1500 316
532 3300046455 Ga0495603_0015743 Ga0495603_0015743_1473_2474 316
533 3300046475 Ga0495639_0016075 Ga0495639_0016075_1413_2420 316
534 3300046531 Ga0495665_0065868 Ga0495665_0065868_258_1259 316
535 3300046535 Ga0495586_0004128 Ga0495586_0004128_5986_6993 316
536 3300046674 Ga0495588_0005471 Ga0495588_0005471_3480_4487 316
537 3300046683 Ga0495658_0001264 Ga0495658_0001264_7602_8609 316
538 3300047315 Ga0495581_0025443 Ga0495581_0025443_2329_3336 316
539 3300047321 Ga0495676_0104765 Ga0495676_0104765_685_1686 316
540 3300049742 Ga0501080_0228827 Ga0501080_0228827_433_1440 316
541 3300050493 nmdc:mga0k408_19883_c1 nmdc:mga0k408_19883_c1_1582_2583 316
542 3300050493 nmdc:mga0k408_5223_c1 nmdc:mga0k408_5223_c1_3384_4388 316
543 3300050496 nmdc:mga07m45_63905_c1 nmdc:mga07m45_63905_c1_638_1639 316
544 3300050508 nmdc:mga09592_1504_c1 nmdc:mga09592_1504_c1_913_1929 316
545 3300050511 nmdc:mga08y16_217587_c1 nmdc:mga08y16_217587_c1_407_1411 316
546 3300050511 nmdc:mga08y16_3339_c1 nmdc:mga08y16_3339_c1_5642_6658 316
547 3300054114 Ga0501084_0145259 Ga0501084_0145259_374_1381 316
548 3300002987 JGI25159J45721_1018208 JGI25159J45721_10182081 317
549 3300003187 JGI25151J46595_10000795 JGI25151J46595_100007955 317
550 3300005329 Ga0070683_100139159 Ga0070683_1001391592 317
551 3300005334 Ga0068869_100013906 Ga0068869_1000139064 317
552 3300005334 Ga0068869_100254894 Ga0068869_1002548941 317
553 3300005335 Ga0070666_10004388 Ga0070666_100043888 317
554 3300005335 Ga0070666_10128550 Ga0070666_101285501 317
555 3300005336 Ga0070680_100018826 Ga0070680_1000188265 317
556 3300005337 Ga0070682_100016453 Ga0070682_1000164533 317
557 3300005338 Ga0068868_100045739 Ga0068868_1000457394 317
558 3300005338 Ga0068868_100061582 Ga0068868_1000615823 317
559 3300005338 Ga0068868_100114395 Ga0068868_1001143953 317
560 3300005340 Ga0070689_100039280 Ga0070689_1000392803 317
561 3300005341 Ga0070691_10036068 Ga0070691_100360683 317
562 3300005343 Ga0070687_100249588 Ga0070687_1002495881 317
563 3300005344 Ga0070661_100011155 Ga0070661_1000111552 317
564 3300005345 Ga0070692_10001631 Ga0070692_100016316 317
565 3300005353 Ga0070669_100014865 Ga0070669_1000148651 317
566 3300005355 Ga0070671_100011803 Ga0070671_1000118036 317
567 3300005355 Ga0070671_100213492 Ga0070671_1002134922 317
568 3300005356 Ga0070674_100061792 Ga0070674_1000617922 317
569 3300005365 Ga0070688_100020460 Ga0070688_1000204603 317
570 3300005365 Ga0070688_100096298 Ga0070688_1000962982 317
571 3300005366 Ga0070659_100099151 Ga0070659_1000991513 317
572 3300005367 Ga0070667_100029475 Ga0070667_1000294752 317
573 3300005367 Ga0070667_100143144 Ga0070667_1001431442 317
574 3300005435 Ga0070714_100000785 Ga0070714_10000078513 317
575 3300005436 Ga0070713_100006452 Ga0070713_1000064525 317
576 3300005436 Ga0070713_100085335 Ga0070713_1000853353 317
577 3300005438 Ga0070701_10023640 Ga0070701_100236403 317
578 3300005439 Ga0070711_100030852 Ga0070711_1000308523 317
579 3300005440 Ga0070705_100014462 Ga0070705_1000144622 317
580 3300005444 Ga0070694_100059812 Ga0070694_1000598123 317
581 3300005456 Ga0070678_100000773 Ga0070678_1000007733 317
582 3300005457 Ga0070662_100030745 Ga0070662_1000307454 317
583 3300005457 Ga0070662_100034510 Ga0070662_1000345103 317
584 3300005458 Ga0070681_10351450 Ga0070681_103514501 317
585 3300005459 Ga0068867_100040009 Ga0068867_1000400093 317
586 3300005467 Ga0070706_100165397 Ga0070706_1001653972 317
587 3300005468 Ga0070707_100373997 Ga0070707_1003739971 317
588 3300005471 Ga0070698_100200629 Ga0070698_1002006292 317
589 3300005518 Ga0070699_100037853 Ga0070699_1000378534 317
590 3300005530 Ga0070679_100262736 Ga0070679_1002627362 317
591 3300005535 Ga0070684_100035493 Ga0070684_1000354932 317
592 3300005536 Ga0070697_100019630 Ga0070697_1000196303 317
593 3300005539 Ga0068853_100100885 Ga0068853_1001008853 317
594 3300005545 Ga0070695_100044766 Ga0070695_1000447663 317
595 3300005546 Ga0070696_100166611 Ga0070696_1001666112 317
596 3300005547 Ga0070693_100000931 Ga0070693_1000009316 317
597 3300005547 Ga0070693_100070585 Ga0070693_1000705852 317
598 3300005547 Ga0070693_100111821 Ga0070693_1001118212 317
599 3300005548 Ga0070665_100129062 Ga0070665_1001290622 317
600 3300005549 Ga0070704_100128992 Ga0070704_1001289922 317
601 3300005564 Ga0070664_100189630 Ga0070664_1001896302 317
602 3300005578 Ga0068854_100005240 Ga0068854_1000052404 317
603 3300005578 Ga0068854_100012314 Ga0068854_1000123145 317
604 3300005614 Ga0068856_100076780 Ga0068856_1000767802 317
605 3300005614 Ga0068856_100169533 Ga0068856_1001695333 317
606 3300005614 Ga0068856_100314913 Ga0068856_1003149132 317
607 3300005615 Ga0070702_100009464 Ga0070702_1000094643 317
608 3300005616 Ga0068852_100036441 Ga0068852_1000364414 317
609 3300005617 Ga0068859_100056936 Ga0068859_1000569363 317
610 3300005618 Ga0068864_100002651 Ga0068864_10000265112 317
611 3300005718 Ga0068866_10019847 Ga0068866_100198473 317
612 3300005834 Ga0068851_10009796 Ga0068851_100097963 317
613 3300005841 Ga0068863_100060886 Ga0068863_1000608862 317
614 3300005842 Ga0068858_100067139 Ga0068858_1000671391 317
615 3300005843 Ga0068860_100037729 Ga0068860_1000377294 317
616 3300005843 Ga0068860_100083962 Ga0068860_1000839623 317
617 3300005981 Ga0081538_10030556 Ga0081538_100305564 317
618 3300006173 Ga0070716_100048821 Ga0070716_1000488213 317
619 3300006173 Ga0070716_100096160 Ga0070716_1000961602 317
620 3300006175 Ga0070712_100315159 Ga0070712_1003151592 317
621 3300006195 Ga0075366_10012018 Ga0075366_100120183 317
622 3300006237 Ga0097621_100063969 Ga0097621_1000639693 317
623 3300006237 Ga0097621_100136364 Ga0097621_1001363642 317
624 3300006358 Ga0068871_100063332 Ga0068871_1000633323 317
625 3300006358 Ga0068871_100191606 Ga0068871_1001916062 317
626 3300006846 Ga0075430_100059137 Ga0075430_1000591372 317
627 3300006847 Ga0075431_100000584 Ga0075431_10000058420 317
628 3300006880 Ga0075429_100011050 Ga0075429_1000110504 317
629 3300006881 Ga0068865_100066334 Ga0068865_1000663343 317
630 3300006914 Ga0075436_100053251 Ga0075436_1000532513 317
631 3300006931 Ga0097620_100056933 Ga0097620_1000569333 317
632 3300009094 Ga0111539_10000705 Ga0111539_100007053 317
633 3300009098 Ga0105245_10090345 Ga0105245_100903453 317
634 3300009098 Ga0105245_10103159 Ga0105245_101031592 317
635 3300009098 Ga0105245_10148242 Ga0105245_101482423 317
636 3300009147 Ga0114129_10000057 Ga0114129_1000005742 317
637 3300009174 Ga0105241_10099992 Ga0105241_100999922 317
638 3300009174 Ga0105241_10184458 Ga0105241_101844582 317
639 3300009174 Ga0105241_10212348 Ga0105241_102123481 317
640 3300009176 Ga0105242_10004136 Ga0105242_100041369 317
641 3300009176 Ga0105242_10159730 Ga0105242_101597301 317
642 3300009177 Ga0105248_10205294 Ga0105248_102052942 317
643 3300009545 Ga0105237_10021401 Ga0105237_100214014 317
644 3300009551 Ga0105238_10034965 Ga0105238_100349654 317
645 3300010375 Ga0105239_10215152 Ga0105239_102151522 317
646 3300011119 Ga0105246_10037203 Ga0105246_100372032 317
647 3300013100 Ga0157373_10041685 Ga0157373_100416853 317
648 3300013102 Ga0157371_10051690 Ga0157371_100516903 317
649 3300013104 Ga0157370_10009451 Ga0157370_100094518 317
650 3300013105 Ga0157369_10253549 Ga0157369_102535492 317
651 3300013296 Ga0157374_10001734 Ga0157374_100017344 317
652 3300013297 Ga0157378_10082324 Ga0157378_100823243 317
653 3300013306 Ga0163162_10127176 Ga0163162_101271762 317
654 3300013306 Ga0163162_10127640 Ga0163162_101276402 317
655 3300014325 Ga0163163_10070822 Ga0163163_100708222 317
656 3300014745 Ga0157377_10027628 Ga0157377_100276282 317
657 3300014968 Ga0157379_10031503 Ga0157379_100315033 317
658 3300014969 Ga0157376_10068402 Ga0157376_100684023 317
659 3300014969 Ga0157376_10168937 Ga0157376_101689371 317
660 3300017792 Ga0163161_10014997 Ga0163161_100149974 317
661 3300025284 Ga0209130_1001163 Ga0209130_100116313 317
662 3300025294 Ga0209025_1000328 Ga0209025_10003285 317
663 3300025297 Ga0209758_1001871 Ga0209758_100187114 317
664 3300025302 Ga0207426_1000235 Ga0207426_100023599 317
665 3300025898 Ga0207692_10056904 Ga0207692_100569042 317
666 3300025899 Ga0207642_10001781 Ga0207642_100017816 317
667 3300025903 Ga0207680_10011039 Ga0207680_100110393 317
668 3300025906 Ga0207699_10074132 Ga0207699_100741322 317
669 3300025907 Ga0207645_10056399 Ga0207645_100563992 317
670 3300025910 Ga0207684_10060695 Ga0207684_100606954 317
671 3300025911 Ga0207654_10001352 Ga0207654_1000135210 317
672 3300025912 Ga0207707_10005308 Ga0207707_100053088 317
673 3300025913 Ga0207695_10043723 Ga0207695_100437231 317
674 3300025914 Ga0207671_10107413 Ga0207671_101074132 317
675 3300025915 Ga0207693_10000070 Ga0207693_100000709 317
676 3300025916 Ga0207663_10034707 Ga0207663_100347073 317
677 3300025916 Ga0207663_10101271 Ga0207663_101012712 317
678 3300025917 Ga0207660_10018761 Ga0207660_100187614 317
679 3300025919 Ga0207657_10006160 Ga0207657_100061607 317
680 3300025920 Ga0207649_10171427 Ga0207649_101714272 317
681 3300025922 Ga0207646_10080148 Ga0207646_100801483 317
682 3300025925 Ga0207650_10064049 Ga0207650_100640493 317
683 3300025927 Ga0207687_10053692 Ga0207687_100536923 317
684 3300025928 Ga0207700_10009237 Ga0207700_100092375 317
685 3300025928 Ga0207700_10056892 Ga0207700_100568922 317
686 3300025929 Ga0207664_10001186 Ga0207664_1000118614 317
687 3300025931 Ga0207644_10011640 Ga0207644_100116401 317
688 3300025931 Ga0207644_10075156 Ga0207644_100751562 317
689 3300025932 Ga0207690_10133755 Ga0207690_101337551 317
690 3300025933 Ga0207706_10073512 Ga0207706_100735123 317
691 3300025934 Ga0207686_10000520 Ga0207686_100005209 317
692 3300025934 Ga0207686_10085595 Ga0207686_100855953 317
693 3300025935 Ga0207709_10370959 Ga0207709_103709591 317
694 3300025936 Ga0207670_10039008 Ga0207670_100390082 317
695 3300025937 Ga0207669_10034065 Ga0207669_100340652 317
696 3300025938 Ga0207704_10007350 Ga0207704_100073503 317
697 3300025939 Ga0207665_10021996 Ga0207665_100219964 317
698 3300025939 Ga0207665_10082049 Ga0207665_100820492 317
699 3300025940 Ga0207691_10233158 Ga0207691_102331582 317
700 3300025941 Ga0207711_10261434 Ga0207711_102614342 317
701 3300025942 Ga0207689_10018916 Ga0207689_100189164 317
702 3300025942 Ga0207689_10023643 Ga0207689_100236433 317
703 3300025944 Ga0207661_10039572 Ga0207661_100395724 317
704 3300025945 Ga0207679_10134289 Ga0207679_101342892 317
705 3300025949 Ga0207667_10077947 Ga0207667_100779474 317
706 3300025972 Ga0207668_10074026 Ga0207668_100740262 317
707 3300025981 Ga0207640_10133268 Ga0207640_101332682 317
708 3300025986 Ga0207658_10022101 Ga0207658_100221012 317
709 3300026023 Ga0207677_10029061 Ga0207677_100290613 317
710 3300026035 Ga0207703_10022993 Ga0207703_100229934 317
711 3300026035 Ga0207703_10205804 Ga0207703_102058041 317
712 3300026041 Ga0207639_10015836 Ga0207639_100158363 317
713 3300026075 Ga0207708_10141554 Ga0207708_101415542 317
714 3300026078 Ga0207702_10033733 Ga0207702_100337332 317
715 3300026078 Ga0207702_10195819 Ga0207702_101958191 317
716 3300026088 Ga0207641_10007815 Ga0207641_100078156 317
717 3300026089 Ga0207648_10021207 Ga0207648_100212073 317
718 3300026095 Ga0207676_10002757 Ga0207676_1000275711 317
719 3300026116 Ga0207674_10008147 Ga0207674_100081476 317
720 3300026118 Ga0207675_100252636 Ga0207675_1002526362 317
721 3300026121 Ga0207683_10000503 Ga0207683_100005036 317
722 3300026121 Ga0207683_10018772 Ga0207683_100187723 317
723 3300027907 Ga0207428_10001513 Ga0207428_100015139 317
724 3300028379 Ga0268266_10005672 Ga0268266_100056728 317
725 3300028379 Ga0268266_10024830 Ga0268266_100248304 317
726 3300028381 Ga0268264_10029236 Ga0268264_100292363 317
727 3300028381 Ga0268264_10061138 Ga0268264_100611382 317
728 3300031711 Ga0265314_10043562 Ga0265314_100435623 317
729 3300031731 Ga0307405_10071431 Ga0307405_100714312 317
730 3300031824 Ga0307413_10170881 Ga0307413_101708812 317
731 3300031852 Ga0307410_10047191 Ga0307410_100471913 317
732 3300032004 Ga0307414_10042351 Ga0307414_100423512 317
733 3300032005 Ga0307411_10031544 Ga0307411_100315442 317
734 3300035083 Ga0373926_0038908 Ga0373926_0038908_414_1433 317
735 3300035086 Ga0373934_0023345 Ga0373934_0023345_868_1887 317
736 3300035113 Ga0373936_0071331 Ga0373936_0071331_217_1236 317
737 3300035116 Ga0373945_0014320 Ga0373945_0014320_230_1249 317
738 3300035116 Ga0373945_0022309 Ga0373945_0022309_781_1800 317
739 3300035118 Ga0373954_0010094 Ga0373954_0010094_1798_2817 317
740 3300035119 Ga0373956_0022239 Ga0373956_0022239_1008_2027 317
741 3300035120 Ga0373957_0010902 Ga0373957_0010902_1014_2033 317
742 3300035170 Ga0373943_0004090 Ga0373943_0004090_1142_2161 317
743 3300035171 Ga0373946_0019189 Ga0373946_0019189_1022_2041 317
744 3300035692 Ga0373935_0017872 Ga0373935_0017872_430_1449 317
745 3300035692 Ga0373935_0073556 Ga0373935_0073556_970_1989 317
746 3300035695 Ga0373927_0009262 Ga0373927_0009262_1841_2860 317
747 3300035695 Ga0373927_0067048 Ga0373927_0067048_472_1491 317
748 3300035724 Ga0373933_0052787 Ga0373933_0052787_535_1554 317
749 3300035725 Ga0373947_0018280 Ga0373947_0018280_564_1583 317
750 3300035725 Ga0373947_0115911 Ga0373947_0115911_318_1337 317
751 3300036401 Ga0373937_0073389 Ga0373937_0073389_605_1624 317
752 3300037068 Ga0373925_0021067 Ga0373925_0021067_1841_2860 317
753 3300037068 Ga0373925_0030730 Ga0373925_0030730_736_1755 317
754 3300042876 Ga0451577_0053684 Ga0451577_0053684_609_1628 317
755 3300042876 Ga0451577_0167861 Ga0451577_0167861_271_1281 317
756 3300046459 Ga0495629_0031121 Ga0495629_0031121_1270_2289 317
757 3300046462 Ga0495651_0175100 Ga0495651_0175100_368_1387 317
758 3300046512 Ga0495610_0056390 Ga0495610_0056390_179_1195 317
759 3300046517 Ga0495630_0030549 Ga0495630_0030549_1107_2126 317
760 3300046531 Ga0495665_0009292 Ga0495665_0009292_673_1692 317
761 3300046536 Ga0495587_0143699 Ga0495587_0143699_40_1059 317
762 3300046674 Ga0495588_0108957 Ga0495588_0108957_397_1416 317
763 3300046681 Ga0495647_0010668 Ga0495647_0010668_1270_2289 317
764 3300046689 Ga0495613_0026742 Ga0495613_0026742_1530_2549 317
765 3300047315 Ga0495581_0000535 Ga0495581_0000535_15643_16662 317
766 3300047322 Ga0495680_0053268 Ga0495680_0053268_1957_2976 317
767 3300047471 Ga0495684_0006061 Ga0495684_0006061_4400_5419 317
768 3300047673 Ga0495593_0042464 Ga0495593_0042464_812_1831 317
769 3300048905 Ga0496102_0007689 Ga0496102_0007689_149_1168 317
770 3300048907 Ga0496104_0004440 Ga0496104_0004440_10750_11769 317
771 3300048908 Ga0496105_0152338 Ga0496105_0152338_257_1276 317
772 3300048909 Ga0496106_0141271 Ga0496106_0141271_817_1836 317
773 3300048910 Ga0496107_0091925 Ga0496107_0091925_1016_2035 317
774 3300048911 Ga0496108_0119966 Ga0496108_0119966_1085_2104 317
775 3300048912 Ga0496109_0104568 Ga0496109_0104568_1097_2116 317
776 3300048915 Ga0496112_0004395 Ga0496112_0004395_149_1168 317
777 3300048916 Ga0496113_0299682 Ga0496113_0299682_120_1139 317
778 3300048917 Ga0496114_0209093 Ga0496114_0209093_21_1040 317
779 3300049580 Ga0501046_0068872 Ga0501046_0068872_962_1990 317
780 3300050508 nmdc:mga09592_8084_c1 nmdc:mga09592_8084_c1_5915_6925 317
781 3300050509 nmdc:mga0qj67_41135_c1 nmdc:mga0qj67_41135_c1_830_1840 317
782 3300050514 nmdc:mga08x19_87726_c1 nmdc:mga08x19_87726_c1_789_1808 317
783 3300053085 Ga0495619_0007995 Ga0495619_0007995_2681_3700 317
784 3300053139 Ga0500568_0019136 Ga0500568_0019136_23_1039 317
785 3300059421 Ga0590071_021107 Ga0590071_021107_366_1358 317
786 3300005327 Ga0070658_10002654 Ga0070658_1000265414 318
787 3300005327 Ga0070658_10075930 Ga0070658_100759302 318
788 3300005331 Ga0070670_100098038 Ga0070670_1000980382 318
789 3300005334 Ga0068869_100116849 Ga0068869_1001168492 318
790 3300005338 Ga0068868_100286429 Ga0068868_1002864291 318
791 3300005339 Ga0070660_100186027 Ga0070660_1001860272 318
792 3300005340 Ga0070689_100023973 Ga0070689_1000239733 318
793 3300005353 Ga0070669_100019200 Ga0070669_1000192002 318
794 3300005365 Ga0070688_100017944 Ga0070688_1000179444 318
795 3300005435 Ga0070714_100005767 Ga0070714_1000057675 318
796 3300005456 Ga0070678_100265012 Ga0070678_1002650122 318
797 3300005518 Ga0070699_100054610 Ga0070699_1000546103 318
798 3300005530 Ga0070679_100283853 Ga0070679_1002838532 318
799 3300005543 Ga0070672_100041943 Ga0070672_1000419433 318
800 3300005546 Ga0070696_100009153 Ga0070696_1000091533 318
801 3300005546 Ga0070696_100146532 Ga0070696_1001465322 318
802 3300005546 Ga0070696_100209143 Ga0070696_1002091432 318
803 3300005547 Ga0070693_100004820 Ga0070693_1000048205 318
804 3300005547 Ga0070693_100013718 Ga0070693_1000137183 318
805 3300005548 Ga0070665_100320584 Ga0070665_1003205842 318
806 3300005549 Ga0070704_100019424 Ga0070704_1000194243 318
807 3300005616 Ga0068852_100000325 Ga0068852_1000003253 318
808 3300005617 Ga0068859_100036816 Ga0068859_1000368163 318
809 3300005618 Ga0068864_100466499 Ga0068864_1004664991 318
810 3300005834 Ga0068851_10001493 Ga0068851_100014936 318
811 3300005842 Ga0068858_100103586 Ga0068858_1001035862 318
812 3300006195 Ga0075366_10006869 Ga0075366_100068692 318
813 3300006237 Ga0097621_100005770 Ga0097621_1000057708 318
814 3300006237 Ga0097621_100019855 Ga0097621_1000198553 318
815 3300006358 Ga0068871_100001629 Ga0068871_1000016297 318
816 3300006358 Ga0068871_100020265 Ga0068871_1000202655 318
817 3300006358 Ga0068871_100154529 Ga0068871_1001545292 318
818 3300006871 Ga0075434_100055910 Ga0075434_1000559104 318
819 3300006881 Ga0068865_100020089 Ga0068865_1000200893 318
820 3300006914 Ga0075436_100001608 Ga0075436_1000016088 318
821 3300006931 Ga0097620_100036817 Ga0097620_1000368173 318
822 3300007076 Ga0075435_100028705 Ga0075435_1000287052 318
823 3300009098 Ga0105245_10041845 Ga0105245_100418454 318
824 3300009177 Ga0105248_10238394 Ga0105248_102383943 318
825 3300013100 Ga0157373_10052531 Ga0157373_100525312 318
826 3300013296 Ga0157374_10153335 Ga0157374_101533353 318
827 3300013296 Ga0157374_10182192 Ga0157374_101821922 318
828 3300013297 Ga0157378_10212139 Ga0157378_102121392 318
829 3300013306 Ga0163162_10042978 Ga0163162_100429782 318
830 3300013307 Ga0157372_10076502 Ga0157372_100765023 318
831 3300014326 Ga0157380_10151850 Ga0157380_101518503 318
832 3300014745 Ga0157377_10008943 Ga0157377_100089434 318
833 3300025321 Ga0207656_10000707 Ga0207656_100007076 318
834 3300025908 Ga0207643_10039006 Ga0207643_100390063 318
835 3300025909 Ga0207705_10010757 Ga0207705_100107573 318
836 3300025912 Ga0207707_10041797 Ga0207707_100417972 318
837 3300025924 Ga0207694_10119003 Ga0207694_101190032 318
838 3300025925 Ga0207650_10048329 Ga0207650_100483293 318
839 3300025926 Ga0207659_10044153 Ga0207659_100441533 318
840 3300025926 Ga0207659_10102613 Ga0207659_101026132 318
841 3300025927 Ga0207687_10037559 Ga0207687_100375593 318
842 3300025934 Ga0207686_10146353 Ga0207686_101463532 318
843 3300025936 Ga0207670_10007266 Ga0207670_100072663 318
844 3300025937 Ga0207669_10073212 Ga0207669_100732122 318
845 3300025938 Ga0207704_10222934 Ga0207704_102229342 318
846 3300025941 Ga0207711_10192784 Ga0207711_101927842 318
847 3300025942 Ga0207689_10072374 Ga0207689_100723743 318
848 3300025942 Ga0207689_10154799 Ga0207689_101547992 318
849 3300026023 Ga0207677_10016950 Ga0207677_100169503 318
850 3300026035 Ga0207703_10097347 Ga0207703_100973473 318
851 3300026121 Ga0207683_10047847 Ga0207683_100478473 318
852 3300026142 Ga0207698_10010409 Ga0207698_100104091 318
853 3300028379 Ga0268266_10272887 Ga0268266_102728872 318
854 3300028794 Ga0307515_10000030 Ga0307515_10000030163 318
855 3300031730 Ga0307516_10000839 Ga0307516_100008399 318
856 3300035086 Ga0373934_0065656 Ga0373934_0065656_264_1271 318
857 3300037418 Ga0395900_0044462 Ga0395900_0044462_1640_2644 318
858 3300038443 Ga0395901_0044397 Ga0395901_0044397_1419_2423 318
859 3300044693 Ga0466961_0089476 Ga0466961_0089476_508_1512 318
860 3300044842 Ga0466957_0015102 Ga0466957_0015102_1420_2424 318
861 3300046454 Ga0495592_0061687 Ga0495592_0061687_597_1604 318
862 3300046462 Ga0495651_0050662 Ga0495651_0050662_69_1076 318
863 3300046463 Ga0495653_0056762 Ga0495653_0056762_318_1325 318
864 3300046529 Ga0495652_0157146 Ga0495652_0157146_644_1651 318
865 3300046536 Ga0495587_0003976 Ga0495587_0003976_8217_9224 318
866 3300046543 Ga0495645_0000502 Ga0495645_0000502_14919_15926 318
867 3300046559 Ga0495667_0051856 Ga0495667_0051856_621_1628 318
868 3300046660 Ga0495625_0058844 Ga0495625_0058844_906_1940 318
869 3300046663 Ga0495635_0048111 Ga0495635_0048111_53_1060 318
870 3300046678 Ga0495599_0003122 Ga0495599_0003122_1743_2750 318
871 3300047472 Ga0495686_0005215 Ga0495686_0005215_5227_6237 318
872 3300048088 Ga0495602_0077123 Ga0495602_0077123_345_1352 318
873 3300049571 Ga0501034_0018257 Ga0501034_0018257_1637_2776 318
874 3300049581 Ga0501047_0044468 Ga0501047_0044468_1904_3043 318
875 3300049583 Ga0501067_0003121 Ga0501067_0003121_1611_2750 318
876 3300049585 Ga0501069_0099739 Ga0501069_0099739_18_1157 318
877 3300049586 Ga0501070_0001451 Ga0501070_0001451_7148_8287 318
878 3300049588 Ga0501072_0030219 Ga0501072_0030219_2198_3337 318
879 3300049589 Ga0501073_0008058 Ga0501073_0008058_2263_3402 318
880 3300049590 Ga0501074_0062953 Ga0501074_0062953_1111_2250 318
881 3300049741 Ga0501079_0113768 Ga0501079_0113768_753_1892 318
882 3300049742 Ga0501080_0015826 Ga0501080_0015826_4036_5175 318
883 3300049742 Ga0501080_0072595 Ga0501080_0072595_1035_2174 318
884 3300049744 Ga0501083_0004010 Ga0501083_0004010_5361_6500 318
885 3300050496 nmdc:mga07m45_71156_c1 nmdc:mga07m45_71156_c1_351_1358 318
886 3300050512 nmdc:mga0n895_45054_c1 nmdc:mga0n895_45054_c1_2664_3671 318
887 3300050514 nmdc:mga08x19_2660_c1 nmdc:mga08x19_2660_c1_4824_5831 318
888 3300053077 Ga0495601_0006136 Ga0495601_0006136_784_1791 318
889 3300054114 Ga0501084_0231389 Ga0501084_0231389_408_1547 318
890 iso_pu_bacteria 2738543013 2739248044 318
891 iso_pu_bacteria 2904449895 2904452686 318
892 iso_pu_bacteria 2904541872 2904547091 318
893 iso_pu_bacteria 2929160207 2929165627 318
894 iso_pu_bacteria 2929520902 2929522636 318
895 iso_pu_bacteria 2954767861 2954769126 318
896 3300005456 Ga0070678_100038668 Ga0070678_1000386683 319
897 3300005543 Ga0070672_100015306 Ga0070672_1000153062 319
898 3300005548 Ga0070665_100263201 Ga0070665_1002632012 319
899 3300005842 Ga0068858_100000730 Ga0068858_10000073032 319
900 3300009147 Ga0114129_10140657 Ga0114129_101406573 319
901 3300010375 Ga0105239_10272694 Ga0105239_102726942 319
902 3300025294 Ga0209025_1000286 Ga0209025_100028665 319
903 3300025919 Ga0207657_10105256 Ga0207657_101052561 319
904 3300025937 Ga0207669_10154485 Ga0207669_101544852 319
905 3300025940 Ga0207691_10027404 Ga0207691_100274045 319
906 3300026116 Ga0207674_10110494 Ga0207674_101104943 319
907 3300026121 Ga0207683_10056247 Ga0207683_100562473 319
908 3300031730 Ga0307516_10001570 Ga0307516_1000157019 319
909 3300031824 Ga0307413_10248844 Ga0307413_102488442 319
910 3300039437 Ga0436365_1320810 Ga0436365_1320810_330_1340 319
911 3300042001 Ga0439441_003356 Ga0439441_003356_922_1929 319
912 3300049576 Ga0501040_0039666 Ga0501040_0039666_664_1686 319
913 3300049588 Ga0501072_0049620 Ga0501072_0049620_178_1200 319
914 3300050507 nmdc:mga05p37_302592_c1 nmdc:mga05p37_302592_c1_122_1171 319
915 3300050509 nmdc:mga0qj67_34644_c1 nmdc:mga0qj67_34644_c1_368_1417 319
916 3300059624 Ga0587109_011735 Ga0587109_011735_142_1191 319
917 3300059649 Ga0587102_003400 Ga0587102_003400_109_1158 319
918 iso_pu_bacteria 2842677519 2842680239 319
919 iso_pu_bacteria 2885192300 2885194412 319
920 iso_pu_bacteria 2904456579 2904460717 319
921 iso_pu_bacteria 2919462493 2919463685 319
922 iso_pu_bacteria 2945945610 2945945803 319
923 iso_pu_bacteria 2945972063 2945975433 319
924 3300005331 Ga0070670_100006352 Ga0070670_1000063526 320
925 3300005354 Ga0070675_100012109 Ga0070675_1000121095 320
926 3300005355 Ga0070671_100071629 Ga0070671_1000716294 320
927 3300005456 Ga0070678_100074121 Ga0070678_1000741211 320
928 3300005543 Ga0070672_100030272 Ga0070672_1000302724 320
929 3300005618 Ga0068864_100079737 Ga0068864_1000797372 320
930 3300005841 Ga0068863_100039786 Ga0068863_1000397863 320
931 3300006237 Ga0097621_100024461 Ga0097621_1000244614 320
932 3300006844 Ga0075428_100011999 Ga0075428_1000119997 320
933 3300009094 Ga0111539_10014358 Ga0111539_100143584 320
934 3300009094 Ga0111539_10137142 Ga0111539_101371421 320
935 3300013306 Ga0163162_10085275 Ga0163162_100852754 320
936 3300013308 Ga0157375_10024702 Ga0157375_100247022 320
937 3300014325 Ga0163163_10047946 Ga0163163_100479463 320
938 3300014969 Ga0157376_10024018 Ga0157376_100240183 320
939 3300025925 Ga0207650_10022051 Ga0207650_100220514 320
940 3300025926 Ga0207659_10203351 Ga0207659_102033511 320
941 3300025931 Ga0207644_10132129 Ga0207644_101321293 320
942 3300025960 Ga0207651_10016651 Ga0207651_100166514 320
943 3300026095 Ga0207676_10045404 Ga0207676_100454041 320
944 3300026121 Ga0207683_10015036 Ga0207683_100150368 320
945 3300027907 Ga0207428_10003990 Ga0207428_1000399011 320
946 3300028794 Ga0307515_10051395 Ga0307515_100513953 320
947 3300031456 Ga0307513_10000924 Ga0307513_1000092424 320
948 3300037471 Ga0395905_0041886 Ga0395905_0041886_2848_3879 320
949 3300047443 Ga0495687_031562 Ga0495687_031562_611_1636 320
950 3300049130 Ga0501310_004251 Ga0501310_004251_18_1016 320
951 3300050511 nmdc:mga08y16_9580_c1 nmdc:mga08y16_9580_c1_1931_2938 320
952 iso_pu_bacteria 2945909444 2945909698 320
953 iso_pu_bacteria 2945984333 2945988333 320
954 3300005331 Ga0070670_100274809 Ga0070670_1002748091 321
955 3300005344 Ga0070661_100068111 Ga0070661_1000681113 321
956 3300005344 Ga0070661_100096885 Ga0070661_1000968852 321
957 3300005564 Ga0070664_100111652 Ga0070664_1001116523 321
958 3300005578 Ga0068854_100316253 Ga0068854_1003162532 321
959 3300006195 Ga0075366_10008494 Ga0075366_100084947 321
960 3300006353 Ga0075370_10006736 Ga0075370_100067367 321
961 3300013297 Ga0157378_10301550 Ga0157378_103015501 321
962 3300025901 Ga0207688_10026991 Ga0207688_100269912 321
963 3300025920 Ga0207649_10074248 Ga0207649_100742482 321
964 3300025925 Ga0207650_10003752 Ga0207650_100037523 321
965 3300025960 Ga0207651_10027002 Ga0207651_100270023 321
966 3300026041 Ga0207639_10107397 Ga0207639_101073972 321
967 3300027876 Ga0209974_10001716 Ga0209974_100017167 321
968 3300028379 Ga0268266_10120010 Ga0268266_101200103 321
969 3300037471 Ga0395905_0116788 Ga0395905_0116788_521_1549 321
970 3300042876 Ga0451577_0004664 Ga0451577_0004664_8019_9074 321
971 3300042876 Ga0451577_0017515 Ga0451577_0017515_2173_3414 321
972 3300046454 Ga0495592_0000727 Ga0495592_0000727_5044_6078 321
973 3300050493 nmdc:mga0k408_8592_c1 nmdc:mga0k408_8592_c1_1219_2253 321
974 3300050496 nmdc:mga07m45_5517_c1 nmdc:mga07m45_5517_c1_1287_2321 321
975 3300003784 Ga0055534_1000958 Ga0055534_10009586 322
976 3300005288 Ga0065714_10015959 Ga0065714_100159591 322
977 3300006195 Ga0075366_10010447 Ga0075366_100104477 322
978 3300006880 Ga0075429_100014877 Ga0075429_1000148773 322
979 3300025284 Ga0209130_1001760 Ga0209130_10017606 322
980 3300025291 Ga0209675_1001002 Ga0209675_10010029 322
981 3300025292 Ga0209676_1007117 Ga0209676_10071176 322
982 3300025298 Ga0209050_1040650 Ga0209050_10406501 322
983 3300025303 Ga0209051_1018102 Ga0209051_10181023 322
984 3300025304 Ga0209257_1007808 Ga0209257_10078085 322
985 3300030745 Ga0316182_1352626 Ga0316182_13526263 322
986 3300031456 Ga0307513_10179781 Ga0307513_101797811 322
987 3300031616 Ga0307508_10016499 Ga0307508_100164996 322
988 3300031649 Ga0307514_10100671 Ga0307514_101006712 322
989 3300033180 Ga0307510_10002141 Ga0307510_1000214120 322
990 3300044842 Ga0466957_0017998 Ga0466957_0017998_331_1359 322
991 3300046460 Ga0495638_0086632 Ga0495638_0086632_211_1248 322
992 3300046660 Ga0495625_0002019 Ga0495625_0002019_15415_16437 322
993 3300048903 Ga0496100_0150311 Ga0496100_0150311_479_1507 322
994 3300048924 Ga0496121_0027380 Ga0496121_0027380_3044_4072 322
995 3300049533 Ga0501317_001111 Ga0501317_001111_1153_2184 322
996 3300049759 Ga0501262_000180 Ga0501262_000180_3649_4671 322
997 3300050492 nmdc:mga0yw44_22504_c1 nmdc:mga0yw44_22504_c1_570_1592 322
998 3300050493 nmdc:mga0k408_8004_c1 nmdc:mga0k408_8004_c1_3797_4831 322
999 3300050508 nmdc:mga09592_1120_c1 nmdc:mga09592_1120_c1_15832_16869 322
1000 3300050509 nmdc:mga0qj67_158070_c1 nmdc:mga0qj67_158070_c1_476_1513 322
1001 3300053092 Ga0500583_0075229 Ga0500583_0075229_406_1443 322
1002 iso_pu_bacteria 2597490356 2599103642 322
1003 iso_pu_bacteria 2599185214 2599626470 322
1004 iso_pu_bacteria 2599185226 2599677077 322
1005 iso_pu_bacteria 2599185227 2599682171 322
1006 iso_pu_bacteria 2599185229 2599695822 322
1007 iso_pu_bacteria 2643221658 2644328626 322
1008 iso_pu_bacteria 2818991446 2819601742 322
1009 iso_pu_bacteria 2831265667 2831272177 322
1010 iso_pu_bacteria 2838054893 2838059341 322
1011 iso_pu_bacteria 2846952575 2846957326 322
1012 iso_pu_bacteria 2848858292 2848863333 322
1013 iso_pu_bacteria 2885198086 2885202922 322
1014 iso_pu_bacteria 2885211737 2885216681 322
1015 iso_pu_bacteria 2899924645 2899930809 322
1016 iso_pu_bacteria 2928037797 2928040870 322
1017 iso_pu_bacteria 2928044640 2928047712 322
1018 iso_pu_bacteria 2928051484 2928055602 322
1019 iso_pu_bacteria 2928064002 2928069699 322
1020 iso_pu_bacteria 2928070936 2928075441 322
1021 3300001989 JGI24739J22299_10053786 JGI24739J22299_100537861 323
1022 3300003773 Ga0055537_1000208 Ga0055537_100020838 323
1023 3300003784 Ga0055534_1000198 Ga0055534_10001987 323
1024 3300003790 Ga0055528_1000306 Ga0055528_10003065 323
1025 3300006051 Ga0075364_10019233 Ga0075364_100192334 323
1026 3300006195 Ga0075366_10052699 Ga0075366_100526992 323
1027 3300006353 Ga0075370_10023998 Ga0075370_100239983 323
1028 3300006948 Ga0099826_10073580 Ga0099826_100735802 323
1029 3300013100 Ga0157373_10027114 Ga0157373_100271143 323
1030 3300025263 Ga0209565_1000020 Ga0209565_1000020195 323
1031 3300025273 Ga0209673_1000072 Ga0209673_10000725 323
1032 3300025291 Ga0209675_1000014 Ga0209675_1000014184 323
1033 3300025292 Ga0209676_1018341 Ga0209676_10183413 323
1034 3300025303 Ga0209051_1000461 Ga0209051_100046111 323
1035 3300027666 Ga0209282_1004201 Ga0209282_10042017 323
1036 3300028786 Ga0307517_10236544 Ga0307517_102365441 323
1037 3300028794 Ga0307515_10000034 Ga0307515_10000034234 323
1038 3300030731 Ga0316177_1084583 Ga0316177_10845834 323
1039 3300030732 Ga0316176_1043862 Ga0316176_10438623 323
1040 3300030733 Ga0314311_1136633 Ga0314311_11366333 323
1041 3300030735 Ga0316178_1001707 Ga0316178_10017074 323
1042 3300030742 Ga0316183_1034028 Ga0316183_10340285 323
1043 3300031456 Ga0307513_10183595 Ga0307513_101835952 323
1044 3300031901 Ga0307406_10168255 Ga0307406_101682552 323
1045 3300031911 Ga0307412_10150097 Ga0307412_101500972 323
1046 3300031911 Ga0307412_10156718 Ga0307412_101567182 323
1047 3300032004 Ga0307414_10049656 Ga0307414_100496564 323
1048 3300036401 Ga0373937_0096628 Ga0373937_0096628_796_1902 323
1049 3300041411 Ga0439466_0003499 Ga0439466_0003499_1672_2703 323
1050 3300041413 Ga0439465_0000906 Ga0439465_0000906_5733_6764 323
1051 3300041997 Ga0439431_0017028 Ga0439431_0017028_230_1261 323
1052 3300041999 Ga0439433_0002551 Ga0439433_0002551_1511_2542 323
1053 3300042006 Ga0439432_001993 Ga0439432_001993_5412_6443 323
1054 3300042007 Ga0439449_0009165 Ga0439449_0009165_2287_3318 323
1055 3300042010 Ga0439452_006599 Ga0439452_006599_1859_2890 323
1056 3300042014 Ga0439457_001803 Ga0439457_001803_1675_2706 323
1057 3300042015 Ga0439462_0003738 Ga0439462_0003738_1660_2691 323
1058 3300042439 Ga0439464_0002509 Ga0439464_0002509_3340_4374 323
1059 3300044683 Ga0466965_0020374 Ga0466965_0020374_1047_2078 323
1060 3300046517 Ga0495630_0056112 Ga0495630_0056112_1321_2379 323
1061 3300049679 Ga0501249_005845 Ga0501249_005845_903_1928 323
1062 3300049758 Ga0501241_019332 Ga0501241_019332_107_1132 323
1063 3300050489 nmdc:mga03683_32556_c1 nmdc:mga03683_32556_c1_409_1434 323
1064 3300050489 nmdc:mga03683_662_c1 nmdc:mga03683_662_c1_7185_8210 323
1065 3300050490 nmdc:mga03n38_21320_c1 nmdc:mga03n38_21320_c1_824_1849 323
1066 3300050493 nmdc:mga0k408_188809_c1 nmdc:mga0k408_188809_c1_22_1053 323
1067 3300050493 nmdc:mga0k408_6810_c1 nmdc:mga0k408_6810_c1_4333_5358 323
1068 3300002773 JGI25152J39213_1014338 JGI25152J39213_10143381 324
1069 3300003187 JGI25151J46595_10000484 JGI25151J46595_100004843 324
1070 3300009148 Ga0105243_10008545 Ga0105243_100085452 324
1071 3300013104 Ga0157370_10001435 Ga0157370_1000143512 324
1072 3300025258 Ga0209129_1001758 Ga0209129_100175813 324
1073 3300025294 Ga0209025_1000207 Ga0209025_1000207106 324
1074 3300025935 Ga0207709_10004462 Ga0207709_100044623 324
1075 3300031911 Ga0307412_10043577 Ga0307412_100435772 324
1076 3300046453 Ga0495627_004268 Ga0495627_004268_3396_4424 324
1077 3300046515 Ga0495620_0017826 Ga0495620_0017826_1130_2158 324
1078 3300046674 Ga0495588_0021515 Ga0495588_0021515_1801_2829 324
1079 3300046692 Ga0495671_0009477 Ga0495671_0009477_1162_2190 324
1080 3300053117 Ga0500593_000388 Ga0500593_000388_14708_15736 324
1081 3300053158 Ga0500627_0000792 Ga0500627_0000792_5586_6614 324
1082 3300003215 JGI25153J46596_10011009 JGI25153J46596_100110094 325
1083 3300003354 JGI25160J50197_1003589 JGI25160J50197_10035893 325
1084 3300003771 Ga0055526_1009724 Ga0055526_10097244 325
1085 3300003773 Ga0055537_1002770 Ga0055537_10027704 325
1086 3300003775 Ga0055524_1001707 Ga0055524_10017079 325
1087 3300003784 Ga0055534_1003776 Ga0055534_10037764 325
1088 3300003790 Ga0055528_1009322 Ga0055528_10093223 325
1089 3300003791 Ga0055530_10003783 Ga0055530_100037837 325
1090 3300003794 Ga0055531_10001429 Ga0055531_100014294 325
1091 3300009551 Ga0105238_10161144 Ga0105238_101611443 325
1092 3300025263 Ga0209565_1002488 Ga0209565_10024884 325
1093 3300025273 Ga0209673_1000154 Ga0209673_100015431 325
1094 3300025284 Ga0209130_1000782 Ga0209130_10007824 325
1095 3300025291 Ga0209675_1004489 Ga0209675_10044893 325
1096 3300025292 Ga0209676_1000048 Ga0209676_100004816 325
1097 3300025294 Ga0209025_1003562 Ga0209025_10035623 325
1098 3300025295 Ga0209564_1000103 Ga0209564_100010337 325
1099 3300025298 Ga0209050_1000012 Ga0209050_100001216 325
1100 3300025299 Ga0209256_1000065 Ga0209256_10000657 325
1101 3300025302 Ga0207426_1000161 Ga0207426_1000161157 325
1102 3300025303 Ga0209051_1000273 Ga0209051_100027358 325
1103 3300025304 Ga0209257_1001999 Ga0209257_10019997 325
1104 3300050496 nmdc:mga07m45_80719_c1 nmdc:mga07m45_80719_c1_211_1242 325
1105 3300001979 JGI24740J21852_10014800 JGI24740J21852_100148003 326
1106 3300002774 JGI25150J39212_1001250 JGI25150J39212_10012505 326
1107 3300002987 JGI25159J45721_1000172 JGI25159J45721_100017235 326
1108 3300003354 JGI25160J50197_1000348 JGI25160J50197_10003483 326
1109 3300003374 JGI25161J50226_1000337 JGI25161J50226_10003373 326
1110 3300003761 Ga0055535_1000378 Ga0055535_10003783 326
1111 3300003762 Ga0055542_1000036 Ga0055542_1000036176 326
1112 3300003771 Ga0055526_1004796 Ga0055526_10047967 326
1113 3300003773 Ga0055537_1001748 Ga0055537_10017483 326
1114 3300003775 Ga0055524_1017096 Ga0055524_10170963 326
1115 3300003784 Ga0055534_1002072 Ga0055534_10020725 326
1116 3300003790 Ga0055528_1016769 Ga0055528_10167693 326
1117 3300003792 Ga0055540_1012589 Ga0055540_10125894 326
1118 3300004625 Ga0055543_1000503 Ga0055543_10005033 326
1119 3300005262 Ga0065165_1001031 Ga0065165_100103139 326
1120 3300005539 Ga0068853_100030460 Ga0068853_1000304603 326
1121 3300005614 Ga0068856_100287330 Ga0068856_1002873301 326
1122 3300005834 Ga0068851_10056841 Ga0068851_100568413 326
1123 3300025228 Ga0209672_101176 Ga0209672_1011763 326
1124 3300025229 Ga0209147_100472 Ga0209147_10047223 326
1125 3300025242 Ga0209258_100091 Ga0209258_100091177 326
1126 3300025245 Ga0207425_1000190 Ga0207425_100019015 326
1127 3300025254 Ga0209148_1000033 Ga0209148_1000033307 326
1128 3300025258 Ga0209129_1000091 Ga0209129_100009128 326
1129 3300025263 Ga0209565_1000335 Ga0209565_100033510 326
1130 3300025273 Ga0209673_1002551 Ga0209673_10025514 326
1131 3300025284 Ga0209130_1000140 Ga0209130_100014090 326
1132 3300025291 Ga0209675_1001248 Ga0209675_100124810 326
1133 3300025294 Ga0209025_1000356 Ga0209025_100035665 326
1134 3300025295 Ga0209564_1000597 Ga0209564_100059710 326
1135 3300025297 Ga0209758_1000092 Ga0209758_1000092120 326
1136 3300025299 Ga0209256_1000094 Ga0209256_100009490 326
1137 3300025302 Ga0207426_1000084 Ga0207426_1000084113 326
1138 3300025303 Ga0209051_1009904 Ga0209051_10099043 326
1139 3300025321 Ga0207656_10035021 Ga0207656_100350213 326
1140 3300026078 Ga0207702_10298361 Ga0207702_102983612 326
1141 3300048921 Ga0496118_0005318 Ga0496118_0005318_13153_14184 326
1142 3300048926 Ga0496123_0067475 Ga0496123_0067475_1101_2132 326
1143 3300048928 Ga0496125_0027763 Ga0496125_0027763_2206_3237 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

69

353

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.8936 20 324
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.8878 20 324
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8731 23 320
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.8663 20 320
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8648 23 320
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9011 118 249 3.40.190.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8962 20 317 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8872 118 249 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8796 20 317 3.40.190.150
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8704 20 317 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A536ZIM3-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9348 56 321 GO:0051537
AF-A0A5A7MKX6-F1-model_v4 MFS transporter 0.9305 39 320
AF-A0A0T2YKM7-F1-model_v4 LacI family transcriptional regulator 0.9299 53 320
AF-A0A261UF47-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9291 20 325
AF-U7GDX3-F1-model_v4 deleted 0.9267 27 324

Feature Viewer

pLDDT pTM Quality
91.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map