F490740
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1143 | 688 | 2286 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300012505|Ga0157339_1011728|Ga0157339_10117281 |
| Length | 229 |
| Sequence | VLTVSALNQYYGGSHTLRDVAFEAPSGAVTAILGRNGVGKTTLLRCLAGLLAARSGTIRFEGTDVTRLPPHERARLGLGYVPQGREIFPRLTVLENLRLGLATRPARSAIPDRVFEMFPVLKDMVHRRGGDLSGGQQQQLAIGRALVMRPKLLVLDEPTEGIQPSIIKDIGRAISYLRNLGSIAIVLVEQYLDFACELGDSFAVMDRGAVKSCIPARPPTWTCPRCAAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 94 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 220 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 239 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 256 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 257 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 258 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 259 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 331 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 383 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 384 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 390 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 392 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 394 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 395 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 401 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 411 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 416 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 418 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 420 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 422 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 423 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 424 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 425 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 426 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 427 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 428 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 429 | 2512875024 | |||
| 430 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 431 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 432 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 433 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 434 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 435 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 436 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 437 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 438 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 439 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 440 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 441 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 442 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 443 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 444 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 445 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 446 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 447 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 448 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 449 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 450 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 451 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 452 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 453 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 454 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 455 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 456 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 457 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 458 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 459 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 460 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 461 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 462 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 463 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 464 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 465 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 466 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 467 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 468 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 469 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 470 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 471 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 472 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 473 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 474 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 475 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 476 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 477 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 478 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 479 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 480 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 481 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 482 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 483 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 484 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 485 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 486 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 487 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 488 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 489 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 490 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 491 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 492 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 493 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 494 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 495 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 496 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 497 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 498 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 499 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 500 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 501 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 502 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 503 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 504 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 505 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 506 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 507 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 508 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 509 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 510 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 511 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 512 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 513 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 514 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 515 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 516 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 517 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 518 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 519 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 520 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 521 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 522 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 523 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 524 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 525 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 526 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 527 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 528 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 529 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 530 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 531 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 532 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 533 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 534 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 535 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 536 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 537 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 538 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 539 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 540 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 541 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 542 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 543 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 544 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 545 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 546 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 547 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 548 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 549 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 550 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 551 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 552 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 553 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 554 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 555 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 556 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 557 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 558 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 559 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 560 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 561 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 562 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 563 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 564 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 565 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 566 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 567 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 568 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 569 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 570 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 571 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 572 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 573 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 574 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 575 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 576 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 577 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 578 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 579 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 580 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 581 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 582 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 583 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 584 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 585 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 586 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 587 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 588 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 589 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 590 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 591 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 592 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 593 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 594 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 595 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 596 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 597 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 598 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 599 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 600 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 601 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 602 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 603 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 604 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 605 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 606 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 607 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 608 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 609 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 610 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 611 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 612 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 613 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 614 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 615 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 616 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 617 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 618 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 619 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 620 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 621 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 622 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 623 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 624 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 625 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 626 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 627 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 628 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 629 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 630 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 631 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 632 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 633 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 634 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 635 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 636 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 637 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 638 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 639 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 640 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 641 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 642 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 643 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 644 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 645 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 646 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 647 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 648 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 649 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 650 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 651 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 652 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 653 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 654 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 655 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 656 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 657 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 658 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 659 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 660 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 661 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 662 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 663 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 664 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 665 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 666 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 667 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 668 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 669 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 670 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 671 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 672 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 673 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 674 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 675 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 676 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 677 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 678 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 679 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 680 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 681 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 682 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 683 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 684 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 685 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 686 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 687 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 688 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.47 |
| Metatranscriptomes | 0.09 |
| Isolates | 23.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.06 |
| Nodule | 21.26 |
| Rhizoplane | 2.54 |
| Rhizosphere | 59.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157339_1011728 | 3300012505 | Bacteria | 812 |
| 2 | JGI24740J21852_10009490 | 3300001979 | Bacteria | 3806 |
| 3 | JGI24751J29686_10029641 | 3300002459 | Bacteria | 1136 |
| 4 | JGI25157J39369_1001294 | 3300002741 | Bacteria | 10022 |
| 5 | JGI25406J46586_10014352 | 3300003203 | Bacteria | 3372 |
| 6 | JGI25153J46596_10017786 | 3300003215 | Bacteria | 2786 |
| 7 | rootH1_10000936 | 3300003323 | Bacteria | 32038 |
| 8 | rootH1_10008698 | 3300003323 | Bacteria | 22564 |
| 9 | JGI25404J52841_10013017 | 3300003659 | Bacteria | 1804 |
| 10 | Ga0055542_1000775 | 3300003762 | Bacteria | 24034 |
| 11 | Ga0055529_1002235 | 3300003763 | Bacteria | 3951 |
| 12 | Ga0065712_10020326 | 3300005290 | Bacteria | 2466 |
| 13 | Ga0065715_10121096 | 3300005293 | Bacteria | 2238 |
| 14 | Ga0065715_10352229 | 3300005293 | Bacteria | 949 |
| 15 | Ga0070658_10088079 | 3300005327 | Bacteria | 2556 |
| 16 | Ga0070658_10133802 | 3300005327 | Bacteria | 2067 |
| 17 | Ga0070658_10249162 | 3300005327 | Bacteria | 1507 |
| 18 | Ga0070676_10116664 | 3300005328 | Bacteria | 1670 |
| 19 | Ga0070676_10334371 | 3300005328 | Bacteria | 1037 |
| 20 | Ga0070683_100059968 | 3300005329 | Bacteria | 3535 |
| 21 | Ga0070670_100542790 | 3300005331 | Bacteria | 1037 |
| 22 | Ga0070677_10026835 | 3300005333 | Bacteria | 2163 |
| 23 | Ga0068869_100003218 | 3300005334 | Bacteria | 9982 |
| 24 | Ga0068869_100439513 | 3300005334 | Bacteria | 1079 |
| 25 | Ga0070680_100048987 | 3300005336 | Bacteria | 3443 |
| 26 | Ga0070680_100318622 | 3300005336 | Bacteria | 1320 |
| 27 | Ga0070680_100451141 | 3300005336 | Bacteria | 1098 |
| 28 | Ga0070680_100494620 | 3300005336 | Bacteria | 1046 |
| 29 | Ga0070682_100023021 | 3300005337 | Bacteria | 3697 |
| 30 | Ga0068868_100656117 | 3300005338 | Bacteria | 935 |
| 31 | Ga0070660_100395616 | 3300005339 | Bacteria | 1142 |
| 32 | Ga0070691_10154219 | 3300005341 | Bacteria | 1180 |
| 33 | Ga0070661_100073843 | 3300005344 | Bacteria | 2511 |
| 34 | Ga0070675_100052858 | 3300005354 | Bacteria | 3341 |
| 35 | Ga0070675_100082169 | 3300005354 | Bacteria | 2688 |
| 36 | Ga0070675_100084106 | 3300005354 | Bacteria | 2657 |
| 37 | Ga0070671_100018362 | 3300005355 | Bacteria | 5680 |
| 38 | Ga0070671_100203660 | 3300005355 | Bacteria | 1678 |
| 39 | Ga0070671_100431752 | 3300005355 | Bacteria | 1129 |
| 40 | Ga0070674_100068091 | 3300005356 | Bacteria | 2506 |
| 41 | Ga0070674_100860703 | 3300005356 | Bacteria | 787 |
| 42 | Ga0070673_100027881 | 3300005364 | Bacteria | 4192 |
| 43 | Ga0070673_100036731 | 3300005364 | Bacteria | 3727 |
| 44 | Ga0070688_100179388 | 3300005365 | Bacteria | 1468 |
| 45 | Ga0070688_100216359 | 3300005365 | Bacteria | 1348 |
| 46 | Ga0070659_100018350 | 3300005366 | Bacteria | 5281 |
| 47 | Ga0070659_100055791 | 3300005366 | Bacteria | 3114 |
| 48 | Ga0070659_100247872 | 3300005366 | Bacteria | 1476 |
| 49 | Ga0070667_100372473 | 3300005367 | Bacteria | 1296 |
| 50 | Ga0070709_10011341 | 3300005434 | Bacteria | 4963 |
| 51 | Ga0070709_10042115 | 3300005434 | Bacteria | 2817 |
| 52 | Ga0070709_10068928 | 3300005434 | Bacteria | 2276 |
| 53 | Ga0070709_10243424 | 3300005434 | Bacteria | 1292 |
| 54 | Ga0070714_100017392 | 3300005435 | Bacteria | 5824 |
| 55 | Ga0070714_100080276 | 3300005435 | Bacteria | 2838 |
| 56 | Ga0070713_100007558 | 3300005436 | Bacteria | 7639 |
| 57 | Ga0070713_100015955 | 3300005436 | Bacteria | 5636 |
| 58 | Ga0070713_100016717 | 3300005436 | Bacteria | 5523 |
| 59 | Ga0070713_100031430 | 3300005436 | Bacteria | 4228 |
| 60 | Ga0070710_10007309 | 3300005437 | Bacteria | 5343 |
| 61 | Ga0070711_100020389 | 3300005439 | Bacteria | 4272 |
| 62 | Ga0070711_100027190 | 3300005439 | Bacteria | 3754 |
| 63 | Ga0070711_100041309 | 3300005439 | Bacteria | 3114 |
| 64 | Ga0070711_100076214 | 3300005439 | Bacteria | 2377 |
| 65 | Ga0070708_100616473 | 3300005445 | Bacteria | 1023 |
| 66 | Ga0070663_100010007 | 3300005455 | Bacteria | 5897 |
| 67 | Ga0070663_100302487 | 3300005455 | Bacteria | 1281 |
| 68 | Ga0070678_100047257 | 3300005456 | Bacteria | 3091 |
| 69 | Ga0070681_10000509 | 3300005458 | Bacteria | 31765 |
| 70 | Ga0070681_10053509 | 3300005458 | Bacteria | 4023 |
| 71 | Ga0070681_10064749 | 3300005458 | Bacteria | 3625 |
| 72 | Ga0070681_10197411 | 3300005458 | Bacteria | 1931 |
| 73 | Ga0070681_10612104 | 3300005458 | Bacteria | 1004 |
| 74 | Ga0070681_10638136 | 3300005458 | Bacteria | 980 |
| 75 | Ga0070681_10930652 | 3300005458 | Bacteria | 788 |
| 76 | Ga0068867_100104271 | 3300005459 | Bacteria | 2170 |
| 77 | Ga0068867_100466695 | 3300005459 | Bacteria | 1079 |
| 78 | Ga0068867_100587420 | 3300005459 | Bacteria | 969 |
| 79 | Ga0070706_100310250 | 3300005467 | Bacteria | 1472 |
| 80 | Ga0070698_100037846 | 3300005471 | Bacteria | 4973 |
| 81 | Ga0070698_100180884 | 3300005471 | Bacteria | 2047 |
| 82 | Ga0070698_100246398 | 3300005471 | Bacteria | 1720 |
| 83 | Ga0070679_100023336 | 3300005530 | Bacteria | 6054 |
| 84 | Ga0070679_100161142 | 3300005530 | Bacteria | 2218 |
| 85 | Ga0070679_100254244 | 3300005530 | Bacteria | 1713 |
| 86 | Ga0070684_100010129 | 3300005535 | Bacteria | 7453 |
| 87 | Ga0070684_100046744 | 3300005535 | Bacteria | 3750 |
| 88 | Ga0070697_100111750 | 3300005536 | Bacteria | 2278 |
| 89 | Ga0070697_100172590 | 3300005536 | Bacteria | 1831 |
| 90 | Ga0068853_100067677 | 3300005539 | Bacteria | 3103 |
| 91 | Ga0068853_100252069 | 3300005539 | Bacteria | 1620 |
| 92 | Ga0068853_100322792 | 3300005539 | Bacteria | 1432 |
| 93 | Ga0068853_100442988 | 3300005539 | Bacteria | 1221 |
| 94 | Ga0068853_100607931 | 3300005539 | Bacteria | 1039 |
| 95 | Ga0068853_100684369 | 3300005539 | Bacteria | 978 |
| 96 | Ga0070672_100080702 | 3300005543 | Bacteria | 2606 |
| 97 | Ga0070672_100274356 | 3300005543 | Bacteria | 1424 |
| 98 | Ga0070686_100244810 | 3300005544 | Bacteria | 1307 |
| 99 | Ga0070686_100512879 | 3300005544 | Bacteria | 932 |
| 100 | Ga0070696_100198074 | 3300005546 | Bacteria | 1498 |
| 101 | Ga0070693_100101637 | 3300005547 | Bacteria | 1753 |
| 102 | Ga0070665_100107922 | 3300005548 | Bacteria | 2786 |
| 103 | Ga0070665_100225890 | 3300005548 | Bacteria | 1872 |
| 104 | Ga0070665_100692068 | 3300005548 | Bacteria | 1032 |
| 105 | Ga0068855_100075791 | 3300005563 | Bacteria | 3905 |
| 106 | Ga0068855_100676345 | 3300005563 | Bacteria | 1106 |
| 107 | Ga0068855_100685653 | 3300005563 | Bacteria | 1098 |
| 108 | Ga0070664_100091744 | 3300005564 | Bacteria | 2629 |
| 109 | Ga0070664_100641202 | 3300005564 | Bacteria | 987 |
| 110 | Ga0068857_100025776 | 3300005577 | Bacteria | 5177 |
| 111 | Ga0068857_100045564 | 3300005577 | Bacteria | 3891 |
| 112 | Ga0068857_100085007 | 3300005577 | Bacteria | 2827 |
| 113 | Ga0068857_100110102 | 3300005577 | Bacteria | 2475 |
| 114 | Ga0068854_100498001 | 3300005578 | Bacteria | 1026 |
| 115 | Ga0068856_100019492 | 3300005614 | Bacteria | 6584 |
| 116 | Ga0068856_100188914 | 3300005614 | Bacteria | 2074 |
| 117 | Ga0068852_100020134 | 3300005616 | Bacteria | 5300 |
| 118 | Ga0068859_100062589 | 3300005617 | Bacteria | 3751 |
| 119 | Ga0068859_100266275 | 3300005617 | Bacteria | 1806 |
| 120 | Ga0068864_100099419 | 3300005618 | Bacteria | 2577 |
| 121 | Ga0068851_10037476 | 3300005834 | Bacteria | 2431 |
| 122 | Ga0068851_10043364 | 3300005834 | Bacteria | 2268 |
| 123 | Ga0068863_100453253 | 3300005841 | Bacteria | 1259 |
| 124 | Ga0068858_100075077 | 3300005842 | Bacteria | 3140 |
| 125 | Ga0068858_100103740 | 3300005842 | Bacteria | 2653 |
| 126 | Ga0068858_100419779 | 3300005842 | Bacteria | 1286 |
| 127 | Ga0068860_100073539 | 3300005843 | Bacteria | 3249 |
| 128 | Ga0068860_100156599 | 3300005843 | Bacteria | 2196 |
| 129 | Ga0068862_100667541 | 3300005844 | Bacteria | 1004 |
| 130 | Ga0081455_10000142 | 3300005937 | Bacteria | 84680 |
| 131 | Ga0081455_10001715 | 3300005937 | Bacteria | 26531 |
| 132 | Ga0081455_10028348 | 3300005937 | Bacteria | 5117 |
| 133 | Ga0081455_10212197 | 3300005937 | Bacteria | 1442 |
| 134 | Ga0081540_1006097 | 3300005983 | Bacteria | 8858 |
| 135 | Ga0081539_10003011 | 3300005985 | Bacteria | 21952 |
| 136 | Ga0081539_10003789 | 3300005985 | Bacteria | 17853 |
| 137 | Ga0081539_10016697 | 3300005985 | Bacteria | 5217 |
| 138 | Ga0081539_10024885 | 3300005985 | Bacteria | 3870 |
| 139 | Ga0081539_10036208 | 3300005985 | Bacteria | 2956 |
| 140 | Ga0070717_10006086 | 3300006028 | Bacteria | 8856 |
| 141 | Ga0070717_10014983 | 3300006028 | Bacteria | 5972 |
| 142 | Ga0070717_10187097 | 3300006028 | Bacteria | 1808 |
| 143 | Ga0070717_10212601 | 3300006028 | Bacteria | 1698 |
| 144 | Ga0075365_10014170 | 3300006038 | Bacteria | 4790 |
| 145 | Ga0075365_10083995 | 3300006038 | Bacteria | 2160 |
| 146 | Ga0075365_10138962 | 3300006038 | Bacteria | 1685 |
| 147 | Ga0075368_10093631 | 3300006042 | Bacteria | 1230 |
| 148 | Ga0075368_10096675 | 3300006042 | Bacteria | 1211 |
| 149 | Ga0075363_100051055 | 3300006048 | Bacteria | 2204 |
| 150 | Ga0075363_100115698 | 3300006048 | Bacteria | 1493 |
| 151 | Ga0075363_100127543 | 3300006048 | Bacteria | 1425 |
| 152 | Ga0075363_100174066 | 3300006048 | Bacteria | 1223 |
| 153 | Ga0075363_100340530 | 3300006048 | Bacteria | 874 |
| 154 | Ga0075364_10032560 | 3300006051 | Bacteria | 3352 |
| 155 | Ga0075364_10039017 | 3300006051 | Bacteria | 3077 |
| 156 | Ga0070715_10001945 | 3300006163 | Bacteria | 6220 |
| 157 | Ga0070716_100003460 | 3300006173 | Bacteria | 7432 |
| 158 | Ga0070716_100100258 | 3300006173 | Bacteria | 1774 |
| 159 | Ga0070712_100294326 | 3300006175 | Bacteria | 1312 |
| 160 | Ga0070712_100406563 | 3300006175 | Bacteria | 1125 |
| 161 | Ga0075362_10031084 | 3300006177 | Bacteria | 2309 |
| 162 | Ga0075362_10148340 | 3300006177 | Bacteria | 1124 |
| 163 | Ga0075367_10020138 | 3300006178 | Bacteria | 3710 |
| 164 | Ga0075367_10104871 | 3300006178 | Bacteria | 1731 |
| 165 | Ga0075367_10123154 | 3300006178 | Bacteria | 1599 |
| 166 | Ga0075367_10259816 | 3300006178 | Bacteria | 1090 |
| 167 | Ga0075367_10294456 | 3300006178 | Bacteria | 1021 |
| 168 | Ga0075369_10002893 | 3300006186 | Bacteria | 6191 |
| 169 | Ga0075366_10056051 | 3300006195 | Bacteria | 2340 |
| 170 | Ga0075366_10179854 | 3300006195 | Bacteria | 1284 |
| 171 | Ga0075366_10318275 | 3300006195 | Bacteria | 953 |
| 172 | Ga0097621_100073805 | 3300006237 | Bacteria | 2825 |
| 173 | Ga0097621_100993647 | 3300006237 | Bacteria | 785 |
| 174 | Ga0075370_10129113 | 3300006353 | Bacteria | 1474 |
| 175 | Ga0075370_10202400 | 3300006353 | Bacteria | 1171 |
| 176 | Ga0068871_100643138 | 3300006358 | Bacteria | 968 |
| 177 | Ga0075428_100010071 | 3300006844 | Bacteria | 10503 |
| 178 | Ga0075428_100621787 | 3300006844 | Bacteria | 1153 |
| 179 | Ga0075428_100700737 | 3300006844 | Bacteria | 1079 |
| 180 | Ga0075430_100000066 | 3300006846 | Bacteria | 56729 |
| 181 | Ga0075431_100455294 | 3300006847 | Bacteria | 1275 |
| 182 | Ga0075433_10130326 | 3300006852 | Bacteria | 2234 |
| 183 | Ga0075434_100025332 | 3300006871 | Bacteria | 5804 |
| 184 | Ga0075429_100204653 | 3300006880 | Bacteria | 1729 |
| 185 | Ga0075429_100369191 | 3300006880 | Bacteria | 1256 |
| 186 | Ga0068865_100081248 | 3300006881 | Bacteria | 2327 |
| 187 | Ga0075436_100069355 | 3300006914 | Bacteria | 2436 |
| 188 | Ga0097620_100062596 | 3300006931 | Bacteria | 3751 |
| 189 | Ga0097620_100266269 | 3300006931 | Bacteria | 1806 |
| 190 | Ga0099824_1020962 | 3300006942 | Bacteria | 4670 |
| 191 | Ga0099822_1011448 | 3300006943 | Bacteria | 10808 |
| 192 | Ga0075435_100109349 | 3300007076 | Bacteria | 2298 |
| 193 | Ga0075435_100696174 | 3300007076 | Bacteria | 883 |
| 194 | Ga0099794_10069546 | 3300007265 | Bacteria | 1722 |
| 195 | Ga0099794_10173713 | 3300007265 | Bacteria | 1099 |
| 196 | Ga0099795_10035212 | 3300007788 | Bacteria | 1749 |
| 197 | Ga0105240_10025071 | 3300009093 | Bacteria | 7850 |
| 198 | Ga0105240_10073053 | 3300009093 | Bacteria | 4237 |
| 199 | Ga0105240_10313661 | 3300009093 | Bacteria | 1790 |
| 200 | Ga0105240_10322294 | 3300009093 | Bacteria | 1761 |
| 201 | Ga0105240_10449290 | 3300009093 | Bacteria | 1443 |
| 202 | Ga0111539_10021821 | 3300009094 | Bacteria | 7874 |
| 203 | Ga0111539_10082461 | 3300009094 | Bacteria | 3782 |
| 204 | Ga0111539_10818960 | 3300009094 | Bacteria | 1083 |
| 205 | Ga0105245_10073316 | 3300009098 | Bacteria | 3113 |
| 206 | Ga0105245_10457520 | 3300009098 | Bacteria | 1286 |
| 207 | Ga0105247_10308056 | 3300009101 | Bacteria | 1101 |
| 208 | Ga0114129_10001651 | 3300009147 | Bacteria | 30336 |
| 209 | Ga0114129_10109125 | 3300009147 | Bacteria | 3820 |
| 210 | Ga0114129_10336055 | 3300009147 | Bacteria | 2005 |
| 211 | Ga0114129_10783343 | 3300009147 | Bacteria | 1218 |
| 212 | Ga0105243_10395666 | 3300009148 | Bacteria | 1282 |
| 213 | Ga0105241_10051648 | 3300009174 | Bacteria | 3136 |
| 214 | Ga0105241_10101531 | 3300009174 | Bacteria | 2287 |
| 215 | Ga0105241_10289506 | 3300009174 | Bacteria | 1402 |
| 216 | Ga0105242_10032744 | 3300009176 | Bacteria | 4158 |
| 217 | Ga0105242_10093354 | 3300009176 | Bacteria | 2537 |
| 218 | Ga0105242_10305092 | 3300009176 | Bacteria | 1454 |
| 219 | Ga0105248_10006018 | 3300009177 | Bacteria | 13316 |
| 220 | Ga0105248_10033707 | 3300009177 | Bacteria | 5722 |
| 221 | Ga0105248_10035084 | 3300009177 | Bacteria | 5612 |
| 222 | Ga0105248_10044373 | 3300009177 | Bacteria | 4986 |
| 223 | Ga0105248_10089880 | 3300009177 | Bacteria | 3458 |
| 224 | Ga0105248_10157928 | 3300009177 | Bacteria | 2559 |
| 225 | Ga0105248_10413806 | 3300009177 | Bacteria | 1518 |
| 226 | Ga0105248_10916811 | 3300009177 | Bacteria | 989 |
| 227 | Ga0105237_10017110 | 3300009545 | Bacteria | 7521 |
| 228 | Ga0105237_10113090 | 3300009545 | Bacteria | 2707 |
| 229 | Ga0105237_10178604 | 3300009545 | Bacteria | 2123 |
| 230 | Ga0105237_10903388 | 3300009545 | Bacteria | 890 |
| 231 | Ga0105238_10075306 | 3300009551 | Bacteria | 3367 |
| 232 | Ga0105238_10143365 | 3300009551 | Bacteria | 2365 |
| 233 | Ga0105238_10166827 | 3300009551 | Bacteria | 2178 |
| 234 | Ga0105238_10195097 | 3300009551 | Bacteria | 2001 |
| 235 | Ga0105238_10291275 | 3300009551 | Bacteria | 1615 |
| 236 | Ga0105238_10346574 | 3300009551 | Bacteria | 1474 |
| 237 | Ga0105238_10348807 | 3300009551 | Bacteria | 1469 |
| 238 | Ga0105238_10467326 | 3300009551 | Bacteria | 1260 |
| 239 | Ga0105238_10647001 | 3300009551 | Bacteria | 1067 |
| 240 | Ga0105249_10000966 | 3300009553 | Bacteria | 25437 |
| 241 | Ga0105249_10297802 | 3300009553 | Bacteria | 1617 |
| 242 | Ga0105239_10059018 | 3300010375 | Bacteria | 4211 |
| 243 | Ga0105239_10106215 | 3300010375 | Bacteria | 3110 |
| 244 | Ga0105239_10229979 | 3300010375 | Bacteria | 2080 |
| 245 | Ga0105246_10011785 | 3300011119 | Bacteria | 5433 |
| 246 | Ga0157371_10113120 | 3300013102 | Bacteria | 1927 |
| 247 | Ga0157371_10614287 | 3300013102 | Bacteria | 809 |
| 248 | Ga0157370_10016717 | 3300013104 | Bacteria | 7424 |
| 249 | Ga0157370_10054269 | 3300013104 | Bacteria | 3820 |
| 250 | Ga0157370_10077887 | 3300013104 | Bacteria | 3122 |
| 251 | Ga0157369_10004452 | 3300013105 | Bacteria | 16503 |
| 252 | Ga0157369_10014713 | 3300013105 | Bacteria | 8827 |
| 253 | Ga0157369_10174636 | 3300013105 | Bacteria | 2262 |
| 254 | Ga0157374_10069050 | 3300013296 | Bacteria | 3327 |
| 255 | Ga0157374_10534305 | 3300013296 | Bacteria | 1179 |
| 256 | Ga0157378_10860871 | 3300013297 | Bacteria | 935 |
| 257 | Ga0163162_10171606 | 3300013306 | Bacteria | 2294 |
| 258 | Ga0163162_10240868 | 3300013306 | Bacteria | 1940 |
| 259 | Ga0163162_10655867 | 3300013306 | Bacteria | 1173 |
| 260 | Ga0157372_10033715 | 3300013307 | Bacteria | 5626 |
| 261 | Ga0157372_10564407 | 3300013307 | Bacteria | 1327 |
| 262 | Ga0157375_10008454 | 3300013308 | Bacteria | 9016 |
| 263 | Ga0157375_10391030 | 3300013308 | Bacteria | 1557 |
| 264 | Ga0157375_11130458 | 3300013308 | Bacteria | 917 |
| 265 | Ga0163163_10178983 | 3300014325 | Bacteria | 2167 |
| 266 | Ga0163163_10527199 | 3300014325 | Bacteria | 1244 |
| 267 | Ga0157380_10000903 | 3300014326 | Bacteria | 18696 |
| 268 | Ga0157380_10015620 | 3300014326 | Bacteria | 5582 |
| 269 | Ga0157380_10083652 | 3300014326 | Bacteria | 2615 |
| 270 | Ga0157377_10311151 | 3300014745 | Bacteria | 1043 |
| 271 | Ga0157379_10038839 | 3300014968 | Bacteria | 4246 |
| 272 | Ga0157379_10997562 | 3300014968 | Bacteria | 798 |
| 273 | Ga0157376_10267225 | 3300014969 | Bacteria | 1605 |
| 274 | Ga0157376_10316652 | 3300014969 | Bacteria | 1482 |
| 275 | Ga0157376_10377734 | 3300014969 | Bacteria | 1364 |
| 276 | Ga0157376_10486339 | 3300014969 | Bacteria | 1210 |
| 277 | Ga0182005_1014368 | 3300015265 | Bacteria | 2215 |
| 278 | Ga0163161_10217294 | 3300017792 | Bacteria | 1479 |
| 279 | Ga0206356_10788712 | 3300020070 | Bacteria | 988 |
| 280 | Ga0213873_10015136 | 3300021358 | Bacteria | 1722 |
| 281 | Ga0213874_10015852 | 3300021377 | Bacteria | 1994 |
| 282 | Ga0213876_10069114 | 3300021384 | Bacteria | 1866 |
| 283 | Ga0213876_10092020 | 3300021384 | Bacteria | 1606 |
| 284 | Ga0213876_10187711 | 3300021384 | Bacteria | 1099 |
| 285 | Ga0213876_10269826 | 3300021384 | Bacteria | 904 |
| 286 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 287 | Ga0209677_103245 | 3300025253 | Bacteria | 5419 |
| 288 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 289 | Ga0209759_1000238 | 3300025256 | Bacteria | 81844 |
| 290 | Ga0209233_1001163 | 3300025261 | Bacteria | 10659 |
| 291 | Ga0209233_1003251 | 3300025261 | Bacteria | 5762 |
| 292 | Ga0209455_1000133 | 3300025272 | Bacteria | 155670 |
| 293 | Ga0209455_1007678 | 3300025272 | Bacteria | 3012 |
| 294 | Ga0209676_1000159 | 3300025292 | Bacteria | 161731 |
| 295 | Ga0209025_1075848 | 3300025294 | Bacteria | 1168 |
| 296 | Ga0209758_1002512 | 3300025297 | Bacteria | 18622 |
| 297 | Ga0209758_1011055 | 3300025297 | Bacteria | 5285 |
| 298 | Ga0209758_1013103 | 3300025297 | Bacteria | 4558 |
| 299 | Ga0209050_1019353 | 3300025298 | Bacteria | 2590 |
| 300 | Ga0207682_10018378 | 3300025893 | Bacteria | 2733 |
| 301 | Ga0207692_10042518 | 3300025898 | Bacteria | 2256 |
| 302 | Ga0207692_10062177 | 3300025898 | Bacteria | 1937 |
| 303 | Ga0207692_10064809 | 3300025898 | Bacteria | 1904 |
| 304 | Ga0207692_10103275 | 3300025898 | Bacteria | 1569 |
| 305 | Ga0207710_10075341 | 3300025900 | Bacteria | 1555 |
| 306 | Ga0207688_10221004 | 3300025901 | Bacteria | 1141 |
| 307 | Ga0207680_10069321 | 3300025903 | Bacteria | 2179 |
| 308 | Ga0207647_10028081 | 3300025904 | Bacteria | 3660 |
| 309 | Ga0207685_10022096 | 3300025905 | Bacteria | 2144 |
| 310 | Ga0207699_10029708 | 3300025906 | Bacteria | 3050 |
| 311 | Ga0207699_10042426 | 3300025906 | Bacteria | 2635 |
| 312 | Ga0207699_10060836 | 3300025906 | Bacteria | 2270 |
| 313 | Ga0207699_10080233 | 3300025906 | Bacteria | 2021 |
| 314 | Ga0207699_10223517 | 3300025906 | Bacteria | 1286 |
| 315 | Ga0207645_10022003 | 3300025907 | Bacteria | 4152 |
| 316 | Ga0207645_10089776 | 3300025907 | Bacteria | 1976 |
| 317 | Ga0207705_10099634 | 3300025909 | Bacteria | 2136 |
| 318 | Ga0207705_10102494 | 3300025909 | Bacteria | 2107 |
| 319 | Ga0207705_10542103 | 3300025909 | Bacteria | 904 |
| 320 | Ga0207684_10273670 | 3300025910 | Bacteria | 1457 |
| 321 | Ga0207654_10025069 | 3300025911 | Bacteria | 3213 |
| 322 | Ga0207654_10025705 | 3300025911 | Bacteria | 3180 |
| 323 | Ga0207707_10000706 | 3300025912 | Bacteria | 33199 |
| 324 | Ga0207707_10002136 | 3300025912 | Bacteria | 17901 |
| 325 | Ga0207707_10023258 | 3300025912 | Bacteria | 5422 |
| 326 | Ga0207707_10203073 | 3300025912 | Bacteria | 1728 |
| 327 | Ga0207695_10032870 | 3300025913 | Bacteria | 5671 |
| 328 | Ga0207695_10101196 | 3300025913 | Bacteria | 2876 |
| 329 | Ga0207695_10134404 | 3300025913 | Bacteria | 2428 |
| 330 | Ga0207695_10144924 | 3300025913 | Bacteria | 2320 |
| 331 | Ga0207695_10181939 | 3300025913 | Bacteria | 2023 |
| 332 | Ga0207695_10263494 | 3300025913 | Bacteria | 1621 |
| 333 | Ga0207671_10048021 | 3300025914 | Bacteria | 3159 |
| 334 | Ga0207671_10178522 | 3300025914 | Bacteria | 1652 |
| 335 | Ga0207693_10001853 | 3300025915 | Bacteria | 18527 |
| 336 | Ga0207693_10024596 | 3300025915 | Bacteria | 4776 |
| 337 | Ga0207693_10038993 | 3300025915 | Bacteria | 3740 |
| 338 | Ga0207693_10051541 | 3300025915 | Bacteria | 3229 |
| 339 | Ga0207693_10106698 | 3300025915 | Bacteria | 2197 |
| 340 | Ga0207693_10495385 | 3300025915 | Bacteria | 954 |
| 341 | Ga0207663_10047300 | 3300025916 | Bacteria | 2655 |
| 342 | Ga0207663_10121066 | 3300025916 | Bacteria | 1792 |
| 343 | Ga0207660_10002043 | 3300025917 | Bacteria | 13422 |
| 344 | Ga0207660_10086669 | 3300025917 | Bacteria | 2312 |
| 345 | Ga0207660_10090850 | 3300025917 | Bacteria | 2263 |
| 346 | Ga0207660_10420912 | 3300025917 | Bacteria | 1077 |
| 347 | Ga0207662_10343747 | 3300025918 | Bacteria | 1000 |
| 348 | Ga0207657_10002667 | 3300025919 | Bacteria | 19257 |
| 349 | Ga0207657_10004672 | 3300025919 | Bacteria | 14460 |
| 350 | Ga0207652_10001458 | 3300025921 | Bacteria | 20929 |
| 351 | Ga0207652_10221012 | 3300025921 | Bacteria | 1707 |
| 352 | Ga0207652_10590962 | 3300025921 | Bacteria | 996 |
| 353 | Ga0207646_10151697 | 3300025922 | Bacteria | 2090 |
| 354 | Ga0207694_10000426 | 3300025924 | Bacteria | 39173 |
| 355 | Ga0207694_10034603 | 3300025924 | Bacteria | 3874 |
| 356 | Ga0207694_10181788 | 3300025924 | Bacteria | 1705 |
| 357 | Ga0207694_10387088 | 3300025924 | Bacteria | 1161 |
| 358 | Ga0207650_10014724 | 3300025925 | Bacteria | 5436 |
| 359 | Ga0207650_10266069 | 3300025925 | Bacteria | 1392 |
| 360 | Ga0207650_10413782 | 3300025925 | Bacteria | 1118 |
| 361 | Ga0207650_10698783 | 3300025925 | Bacteria | 857 |
| 362 | Ga0207659_10141312 | 3300025926 | Bacteria | 1869 |
| 363 | Ga0207659_10583129 | 3300025926 | Bacteria | 952 |
| 364 | Ga0207659_10727304 | 3300025926 | Bacteria | 851 |
| 365 | Ga0207687_10002927 | 3300025927 | Bacteria | 11596 |
| 366 | Ga0207700_10023163 | 3300025928 | Bacteria | 4276 |
| 367 | Ga0207700_10059333 | 3300025928 | Bacteria | 2893 |
| 368 | Ga0207700_10136160 | 3300025928 | Bacteria | 2012 |
| 369 | Ga0207700_10334237 | 3300025928 | Bacteria | 1316 |
| 370 | Ga0207664_10036603 | 3300025929 | Bacteria | 3794 |
| 371 | Ga0207664_10173182 | 3300025929 | Bacteria | 1848 |
| 372 | Ga0207664_10269816 | 3300025929 | Bacteria | 1490 |
| 373 | Ga0207664_10418555 | 3300025929 | Bacteria | 1193 |
| 374 | Ga0207644_10141114 | 3300025931 | Bacteria | 1855 |
| 375 | Ga0207644_10695877 | 3300025931 | Bacteria | 847 |
| 376 | Ga0207690_10050630 | 3300025932 | Bacteria | 2773 |
| 377 | Ga0207690_10409491 | 3300025932 | Bacteria | 1083 |
| 378 | Ga0207690_10474259 | 3300025932 | Bacteria | 1009 |
| 379 | Ga0207686_10027871 | 3300025934 | Bacteria | 3313 |
| 380 | Ga0207686_10039863 | 3300025934 | Bacteria | 2852 |
| 381 | Ga0207686_10373399 | 3300025934 | Bacteria | 1080 |
| 382 | Ga0207670_10173218 | 3300025936 | Bacteria | 1620 |
| 383 | Ga0207669_10051994 | 3300025937 | Bacteria | 2458 |
| 384 | Ga0207669_10494405 | 3300025937 | Bacteria | 977 |
| 385 | Ga0207669_10711292 | 3300025937 | Bacteria | 826 |
| 386 | Ga0207665_10001158 | 3300025939 | Bacteria | 17723 |
| 387 | Ga0207665_10194274 | 3300025939 | Bacteria | 1476 |
| 388 | Ga0207665_10215048 | 3300025939 | Bacteria | 1406 |
| 389 | Ga0207691_10013601 | 3300025940 | Bacteria | 7779 |
| 390 | Ga0207691_10296056 | 3300025940 | Bacteria | 1391 |
| 391 | Ga0207711_10026007 | 3300025941 | Bacteria | 4909 |
| 392 | Ga0207711_10045472 | 3300025941 | Bacteria | 3752 |
| 393 | Ga0207711_10627032 | 3300025941 | Bacteria | 1003 |
| 394 | Ga0207689_10044976 | 3300025942 | Bacteria | 3651 |
| 395 | Ga0207689_10054965 | 3300025942 | Bacteria | 3278 |
| 396 | Ga0207661_10001495 | 3300025944 | Bacteria | 15826 |
| 397 | Ga0207661_10354106 | 3300025944 | Bacteria | 1325 |
| 398 | Ga0207667_10007733 | 3300025949 | Bacteria | 12851 |
| 399 | Ga0207667_10075757 | 3300025949 | Bacteria | 3493 |
| 400 | Ga0207667_10137662 | 3300025949 | Bacteria | 2514 |
| 401 | Ga0207651_10353562 | 3300025960 | Bacteria | 1238 |
| 402 | Ga0207712_10001525 | 3300025961 | Bacteria | 15681 |
| 403 | Ga0207712_10062382 | 3300025961 | Bacteria | 2649 |
| 404 | Ga0207668_10152446 | 3300025972 | Bacteria | 1791 |
| 405 | Ga0207658_10390307 | 3300025986 | Bacteria | 1221 |
| 406 | Ga0207658_10639787 | 3300025986 | Bacteria | 958 |
| 407 | Ga0207703_10005220 | 3300026035 | Bacteria | 10497 |
| 408 | Ga0207703_10273626 | 3300026035 | Bacteria | 1531 |
| 409 | Ga0207703_10280570 | 3300026035 | Bacteria | 1513 |
| 410 | Ga0207703_10444813 | 3300026035 | Bacteria | 1210 |
| 411 | Ga0207639_10098359 | 3300026041 | Bacteria | 2358 |
| 412 | Ga0207639_10364706 | 3300026041 | Bacteria | 1293 |
| 413 | Ga0207639_10500078 | 3300026041 | Bacteria | 1110 |
| 414 | Ga0207678_10018939 | 3300026067 | Bacteria | 6049 |
| 415 | Ga0207708_10252605 | 3300026075 | Bacteria | 1421 |
| 416 | Ga0207702_10047548 | 3300026078 | Bacteria | 3616 |
| 417 | Ga0207702_10185517 | 3300026078 | Bacteria | 1918 |
| 418 | Ga0207702_10604158 | 3300026078 | Bacteria | 1076 |
| 419 | Ga0207641_10439960 | 3300026088 | Bacteria | 1258 |
| 420 | Ga0207648_10039754 | 3300026089 | Bacteria | 4135 |
| 421 | Ga0207648_10082512 | 3300026089 | Bacteria | 2803 |
| 422 | Ga0207676_10035526 | 3300026095 | Bacteria | 3783 |
| 423 | Ga0207674_10046693 | 3300026116 | Bacteria | 4445 |
| 424 | Ga0207674_10063123 | 3300026116 | Bacteria | 3740 |
| 425 | Ga0207674_10115730 | 3300026116 | Bacteria | 2653 |
| 426 | Ga0207674_10138200 | 3300026116 | Bacteria | 2397 |
| 427 | Ga0207674_10505399 | 3300026116 | Bacteria | 1168 |
| 428 | Ga0207675_100576205 | 3300026118 | Bacteria | 1127 |
| 429 | Ga0207683_10140063 | 3300026121 | Bacteria | 2179 |
| 430 | Ga0207698_10049902 | 3300026142 | Bacteria | 3188 |
| 431 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 432 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 433 | Ga0209589_1000055 | 3300027357 | Bacteria | 111890 |
| 434 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 435 | Ga0209489_100128 | 3300027361 | Bacteria | 111890 |
| 436 | Ga0209700_100137 | 3300027363 | Bacteria | 111890 |
| 437 | Ga0209588_1018216 | 3300027671 | Bacteria | 2186 |
| 438 | Ga0209588_1053981 | 3300027671 | Bacteria | 1299 |
| 439 | Ga0209813_10041459 | 3300027866 | Bacteria | 1403 |
| 440 | Ga0209813_10117252 | 3300027866 | Bacteria | 923 |
| 441 | Ga0207428_10327690 | 3300027907 | Bacteria | 1130 |
| 442 | Ga0268266_10059855 | 3300028379 | Bacteria | 3281 |
| 443 | Ga0268266_10256732 | 3300028379 | Bacteria | 1618 |
| 444 | Ga0268266_10336109 | 3300028379 | Bacteria | 1417 |
| 445 | Ga0268266_10338317 | 3300028379 | Bacteria | 1412 |
| 446 | Ga0268265_11031113 | 3300028380 | Bacteria | 814 |
| 447 | Ga0268264_10044627 | 3300028381 | Bacteria | 3677 |
| 448 | Ga0265318_10046685 | 3300028577 | Bacteria | 1634 |
| 449 | Ga0265338_10078256 | 3300028800 | Bacteria | 2790 |
| 450 | Ga0265325_10005877 | 3300031241 | Bacteria | 7519 |
| 451 | Ga0265325_10140940 | 3300031241 | Bacteria | 1147 |
| 452 | Ga0265325_10145294 | 3300031241 | Bacteria | 1125 |
| 453 | Ga0265329_10054334 | 3300031242 | Bacteria | 1272 |
| 454 | Ga0265340_10001703 | 3300031247 | Bacteria | 12620 |
| 455 | Ga0265340_10031016 | 3300031247 | Bacteria | 2676 |
| 456 | Ga0265339_10000281 | 3300031249 | Bacteria | 41044 |
| 457 | Ga0265316_10002875 | 3300031344 | Bacteria | 17630 |
| 458 | Ga0265316_10143679 | 3300031344 | Bacteria | 1791 |
| 459 | Ga0307408_100000394 | 3300031548 | Bacteria | 39710 |
| 460 | Ga0307408_100005603 | 3300031548 | Bacteria | 8394 |
| 461 | Ga0265313_10024804 | 3300031595 | Bacteria | 3193 |
| 462 | Ga0307508_10109636 | 3300031616 | Bacteria | 2360 |
| 463 | Ga0316575_10184744 | 3300031665 | Bacteria | 866 |
| 464 | Ga0265314_10094954 | 3300031711 | Bacteria | 1931 |
| 465 | Ga0265314_10097023 | 3300031711 | Bacteria | 1905 |
| 466 | Ga0265342_10271966 | 3300031712 | Bacteria | 899 |
| 467 | Ga0316576_10206791 | 3300031727 | Bacteria | 1478 |
| 468 | Ga0316578_10018002 | 3300031728 | Bacteria | 3859 |
| 469 | Ga0316578_10033662 | 3300031728 | Bacteria | 2938 |
| 470 | Ga0316578_10102161 | 3300031728 | Bacteria | 1719 |
| 471 | Ga0307406_10001502 | 3300031901 | Bacteria | 12882 |
| 472 | Ga0307414_10192732 | 3300032004 | Bacteria | 1651 |
| 473 | Ga0307414_10459121 | 3300032004 | Bacteria | 1119 |
| 474 | Ga0307510_10041241 | 3300033180 | Bacteria | 5052 |
| 475 | Ga0316215_1000933 | 3300033544 | Bacteria | 2849 |
| 476 | Ga0373952_0037037 | 3300035092 | Bacteria | 1111 |
| 477 | Ga0373936_0129841 | 3300035113 | Bacteria | 1082 |
| 478 | Ga0373939_0104127 | 3300035114 | Bacteria | 979 |
| 479 | Ga0373953_0034219 | 3300035117 | Bacteria | 1991 |
| 480 | Ga0373953_0074970 | 3300035117 | Bacteria | 1400 |
| 481 | Ga0373954_0078468 | 3300035118 | Bacteria | 1575 |
| 482 | Ga0373955_0023876 | 3300035172 | Bacteria | 3120 |
| 483 | Ga0373955_0045640 | 3300035172 | Bacteria | 2365 |
| 484 | Ga0373924_0179132 | 3300035410 | Bacteria | 932 |
| 485 | Ga0373931_0036143 | 3300035691 | Bacteria | 2573 |
| 486 | Ga0373935_0097602 | 3300035692 | Bacteria | 1933 |
| 487 | Ga0373935_0177872 | 3300035692 | Bacteria | 1459 |
| 488 | Ga0373927_0018419 | 3300035695 | Bacteria | 4590 |
| 489 | Ga0373927_0132297 | 3300035695 | Bacteria | 1630 |
| 490 | Ga0373927_0253162 | 3300035695 | Bacteria | 1158 |
| 491 | Ga0373933_0000105 | 3300035724 | Bacteria | 53488 |
| 492 | Ga0373933_0005822 | 3300035724 | Bacteria | 6707 |
| 493 | Ga0373933_0044569 | 3300035724 | Bacteria | 2628 |
| 494 | Ga0373933_0241193 | 3300035724 | Bacteria | 1162 |
| 495 | Ga0373947_0021248 | 3300035725 | Bacteria | 3756 |
| 496 | Ga0373947_0235245 | 3300035725 | Bacteria | 1208 |
| 497 | Ga0373937_0006367 | 3300036401 | Bacteria | 10182 |
| 498 | Ga0373937_0020230 | 3300036401 | Bacteria | 5966 |
| 499 | Ga0373937_0026584 | 3300036401 | Bacteria | 5229 |
| 500 | Ga0373937_0036084 | 3300036401 | Bacteria | 4504 |
| 501 | Ga0373937_0254810 | 3300036401 | Bacteria | 1654 |
| 502 | Ga0373937_0344661 | 3300036401 | Bacteria | 1411 |
| 503 | Ga0316582_0174477 | 3300036647 | Bacteria | 1461 |
| 504 | Ga0316582_0362958 | 3300036647 | Bacteria | 997 |
| 505 | Ga0316584_0045589 | 3300036712 | Bacteria | 3273 |
| 506 | Ga0373925_0703248 | 3300037068 | Bacteria | 833 |
| 507 | Ga0395899_0161981 | 3300037312 | Bacteria | 1580 |
| 508 | Ga0395900_0036754 | 3300037418 | Bacteria | 5048 |
| 509 | Ga0395898_0012482 | 3300037466 | Bacteria | 8784 |
| 510 | Ga0395898_0437813 | 3300037466 | Bacteria | 1245 |
| 511 | Ga0395905_0222072 | 3300037471 | Bacteria | 1768 |
| 512 | Ga0395905_0258847 | 3300037471 | Bacteria | 1625 |
| 513 | Ga0436364_0257495 | 3300037853 | Bacteria | 4176 |
| 514 | Ga0436364_0356065 | 3300037853 | Bacteria | 752 |
| 515 | Ga0395901_0009035 | 3300038443 | Bacteria | 10088 |
| 516 | Ga0395901_0046917 | 3300038443 | Bacteria | 4488 |
| 517 | Ga0400483_082903 | 3300039062 | Bacteria | 3141 |
| 518 | Ga0436365_0115993 | 3300039437 | Bacteria | 1116 |
| 519 | Ga0436365_0219669 | 3300039437 | Bacteria | 2419 |
| 520 | Ga0436365_0472623 | 3300039437 | Bacteria | 785 |
| 521 | Ga0436365_0507057 | 3300039437 | Bacteria | 5857 |
| 522 | Ga0436365_0621927 | 3300039437 | Bacteria | 1798 |
| 523 | Ga0436365_0699198 | 3300039437 | Bacteria | 2999 |
| 524 | Ga0436365_1885077 | 3300039437 | Bacteria | 735 |
| 525 | Ga0436360_0068302 | 3300039438 | Bacteria | 5133 |
| 526 | Ga0436361_0885416 | 3300039447 | Bacteria | 1865 |
| 527 | Ga0436363_1200244 | 3300039450 | Bacteria | 2773 |
| 528 | Ga0436363_1323175 | 3300039450 | Bacteria | 5568 |
| 529 | Ga0436362_0387585 | 3300039453 | Bacteria | 3934 |
| 530 | Ga0436362_0576405 | 3300039453 | Bacteria | 1089 |
| 531 | Ga0439453_0001364 | 3300041408 | Bacteria | 3115 |
| 532 | Ga0439453_0045008 | 3300041408 | Bacteria | 877 |
| 533 | Ga0439465_0095152 | 3300041413 | Bacteria | 1023 |
| 534 | Ga0439465_0110872 | 3300041413 | Bacteria | 955 |
| 535 | Ga0451845_0689861 | 3300041501 | Bacteria | 837 |
| 536 | Ga0439443_013683 | 3300042003 | Bacteria | 1215 |
| 537 | Ga0450891_003705 | 3300042129 | Bacteria | 1459 |
| 538 | Ga0439435_0005297 | 3300042436 | Bacteria | 2832 |
| 539 | Ga0439435_0006166 | 3300042436 | Bacteria | 2683 |
| 540 | Ga0439460_0034968 | 3300042461 | Bacteria | 1451 |
| 541 | Ga0439460_0139946 | 3300042461 | Bacteria | 802 |
| 542 | Ga0466969_0017044 | 3300044656 | Bacteria | 3797 |
| 543 | Ga0466972_0035561 | 3300044658 | Bacteria | 2437 |
| 544 | Ga0466966_0048180 | 3300044684 | Bacteria | 2715 |
| 545 | Ga0466963_0065235 | 3300044694 | Bacteria | 2441 |
| 546 | Ga0466963_0126272 | 3300044694 | Bacteria | 1764 |
| 547 | Ga0466964_0118568 | 3300044706 | Bacteria | 1190 |
| 548 | Ga0466971_0110697 | 3300044719 | Bacteria | 1267 |
| 549 | Ga0466970_0150007 | 3300044765 | Bacteria | 1287 |
| 550 | Ga0466960_0102594 | 3300044901 | Bacteria | 1475 |
| 551 | Ga0466960_0171288 | 3300044901 | Bacteria | 1172 |
| 552 | Ga0466959_0033654 | 3300045049 | Bacteria | 3790 |
| 553 | Ga0466959_0035729 | 3300045049 | Bacteria | 3673 |
| 554 | Ga0466967_0052523 | 3300045976 | Bacteria | 3578 |
| 555 | Ga0466967_0122587 | 3300045976 | Bacteria | 2404 |
| 556 | Ga0466967_0606946 | 3300045976 | Bacteria | 1080 |
| 557 | Ga0495592_0157182 | 3300046454 | Bacteria | 1567 |
| 558 | Ga0495590_0092510 | 3300046457 | Bacteria | 1071 |
| 559 | Ga0495638_0025833 | 3300046460 | Bacteria | 3813 |
| 560 | Ga0495641_0137318 | 3300046461 | Bacteria | 1092 |
| 561 | Ga0495651_0096787 | 3300046462 | Bacteria | 2205 |
| 562 | Ga0495653_0071960 | 3300046463 | Bacteria | 2583 |
| 563 | Ga0495580_0009473 | 3300046472 | Bacteria | 7660 |
| 564 | Ga0495580_0198447 | 3300046472 | Bacteria | 1383 |
| 565 | Ga0495639_0148919 | 3300046475 | Bacteria | 1128 |
| 566 | Ga0495639_0209217 | 3300046475 | Bacteria | 957 |
| 567 | Ga0495664_0120799 | 3300046477 | Bacteria | 1585 |
| 568 | Ga0495664_0195298 | 3300046477 | Bacteria | 1227 |
| 569 | Ga0495606_0133981 | 3300046507 | Bacteria | 1470 |
| 570 | Ga0495608_0123244 | 3300046511 | Bacteria | 1661 |
| 571 | Ga0495618_0046607 | 3300046514 | Bacteria | 2736 |
| 572 | Ga0495618_0217691 | 3300046514 | Bacteria | 1205 |
| 573 | Ga0495628_0133081 | 3300046516 | Bacteria | 1901 |
| 574 | Ga0495628_0347102 | 3300046516 | Bacteria | 1092 |
| 575 | Ga0495628_0556398 | 3300046516 | Bacteria | 823 |
| 576 | Ga0495628_0601303 | 3300046516 | Bacteria | 785 |
| 577 | Ga0495666_0051861 | 3300046526 | Bacteria | 1970 |
| 578 | Ga0495652_0095736 | 3300046529 | Bacteria | 2419 |
| 579 | Ga0495652_0107274 | 3300046529 | Bacteria | 2253 |
| 580 | Ga0495652_0140888 | 3300046529 | Bacteria | 1896 |
| 581 | Ga0495652_0511413 | 3300046529 | Bacteria | 831 |
| 582 | Ga0495654_0226549 | 3300046530 | Bacteria | 788 |
| 583 | Ga0495665_0103492 | 3300046531 | Bacteria | 1494 |
| 584 | Ga0495640_0131317 | 3300046533 | Bacteria | 1621 |
| 585 | Ga0495640_0317776 | 3300046533 | Bacteria | 965 |
| 586 | Ga0495586_0140476 | 3300046535 | Bacteria | 1355 |
| 587 | Ga0495586_0171847 | 3300046535 | Bacteria | 1225 |
| 588 | Ga0495586_0432528 | 3300046535 | Bacteria | 758 |
| 589 | Ga0495587_0038304 | 3300046536 | Bacteria | 2876 |
| 590 | Ga0495587_0058935 | 3300046536 | Bacteria | 2255 |
| 591 | Ga0495587_0088937 | 3300046536 | Bacteria | 1785 |
| 592 | Ga0495645_0109202 | 3300046543 | Bacteria | 1958 |
| 593 | Ga0495645_0383108 | 3300046543 | Bacteria | 899 |
| 594 | Ga0495667_0062621 | 3300046559 | Bacteria | 2437 |
| 595 | Ga0495667_0067195 | 3300046559 | Bacteria | 2343 |
| 596 | Ga0495667_0153065 | 3300046559 | Bacteria | 1484 |
| 597 | Ga0495634_0068709 | 3300046642 | Bacteria | 2339 |
| 598 | Ga0495634_0423584 | 3300046642 | Bacteria | 788 |
| 599 | Ga0495635_0020974 | 3300046663 | Bacteria | 4554 |
| 600 | Ga0495599_0039931 | 3300046678 | Bacteria | 2949 |
| 601 | Ga0495599_0301832 | 3300046678 | Bacteria | 966 |
| 602 | Ga0495646_0155575 | 3300046680 | Bacteria | 1269 |
| 603 | Ga0495658_0241701 | 3300046683 | Bacteria | 1134 |
| 604 | Ga0495669_0001461 | 3300046684 | Bacteria | 9740 |
| 605 | Ga0495624_0199865 | 3300046690 | Bacteria | 1215 |
| 606 | Ga0495600_0056746 | 3300046809 | Bacteria | 2559 |
| 607 | Ga0495581_0129225 | 3300047315 | Bacteria | 1472 |
| 608 | Ga0495604_0085845 | 3300047317 | Bacteria | 2348 |
| 609 | Ga0495604_0142810 | 3300047317 | Bacteria | 1709 |
| 610 | Ga0495674_0175836 | 3300047319 | Bacteria | 1784 |
| 611 | Ga0495674_0178589 | 3300047319 | Bacteria | 1769 |
| 612 | Ga0495674_0246562 | 3300047319 | Bacteria | 1471 |
| 613 | Ga0495672_0222970 | 3300047320 | Bacteria | 930 |
| 614 | Ga0495676_0111898 | 3300047321 | Bacteria | 2002 |
| 615 | Ga0495680_0033486 | 3300047322 | Bacteria | 4159 |
| 616 | Ga0495680_0095921 | 3300047322 | Bacteria | 2216 |
| 617 | Ga0495680_0242207 | 3300047322 | Bacteria | 1280 |
| 618 | Ga0495683_0047183 | 3300047323 | Bacteria | 2162 |
| 619 | Ga0495675_0033866 | 3300047444 | Bacteria | 3261 |
| 620 | Ga0495673_0017803 | 3300047469 | Bacteria | 3596 |
| 621 | Ga0495673_0158890 | 3300047469 | Bacteria | 869 |
| 622 | Ga0495684_0214045 | 3300047471 | Bacteria | 1415 |
| 623 | Ga0495684_0428192 | 3300047471 | Bacteria | 924 |
| 624 | Ga0495686_0170306 | 3300047472 | Bacteria | 1267 |
| 625 | Ga0495602_0014932 | 3300048088 | Bacteria | 7859 |
| 626 | Ga0495602_0290933 | 3300048088 | Bacteria | 1199 |
| 627 | Ga0496100_0020431 | 3300048903 | Bacteria | 3970 |
| 628 | Ga0496100_0116399 | 3300048903 | Bacteria | 1865 |
| 629 | Ga0496101_0023314 | 3300048904 | Bacteria | 4274 |
| 630 | Ga0496101_0096353 | 3300048904 | Bacteria | 2208 |
| 631 | Ga0496102_0563932 | 3300048905 | Bacteria | 1061 |
| 632 | Ga0496103_0085541 | 3300048906 | Bacteria | 1987 |
| 633 | Ga0496104_0341923 | 3300048907 | Bacteria | 1409 |
| 634 | Ga0496105_0374774 | 3300048908 | Bacteria | 1133 |
| 635 | Ga0496106_0055368 | 3300048909 | Bacteria | 2998 |
| 636 | Ga0496106_0657955 | 3300048909 | Bacteria | 837 |
| 637 | Ga0496107_0331096 | 3300048910 | Bacteria | 1133 |
| 638 | Ga0496108_0005061 | 3300048911 | Bacteria | 10650 |
| 639 | Ga0496108_0903180 | 3300048911 | Bacteria | 758 |
| 640 | Ga0496109_0003617 | 3300048912 | Bacteria | 12923 |
| 641 | Ga0496109_0021676 | 3300048912 | Bacteria | 5685 |
| 642 | Ga0496110_0001002 | 3300048913 | Bacteria | 19876 |
| 643 | Ga0496110_0080492 | 3300048913 | Bacteria | 2903 |
| 644 | Ga0496110_0361839 | 3300048913 | Bacteria | 1322 |
| 645 | Ga0496110_0699405 | 3300048913 | Bacteria | 915 |
| 646 | Ga0496111_0009201 | 3300048914 | Bacteria | 6578 |
| 647 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 648 | Ga0496112_0053753 | 3300048915 | Bacteria | 3956 |
| 649 | Ga0496112_0077956 | 3300048915 | Bacteria | 3277 |
| 650 | Ga0496113_0008012 | 3300048916 | Bacteria | 6851 |
| 651 | Ga0496114_0002919 | 3300048917 | Bacteria | 13104 |
| 652 | Ga0496114_0074669 | 3300048917 | Bacteria | 2854 |
| 653 | Ga0496114_0306662 | 3300048917 | Bacteria | 1402 |
| 654 | Ga0496115_0065909 | 3300048918 | Bacteria | 2926 |
| 655 | Ga0496117_0104508 | 3300048920 | Bacteria | 1782 |
| 656 | Ga0496118_0023875 | 3300048921 | Bacteria | 5297 |
| 657 | Ga0496119_0018058 | 3300048922 | Bacteria | 5270 |
| 658 | Ga0496119_0072006 | 3300048922 | Bacteria | 2021 |
| 659 | Ga0496119_0097459 | 3300048922 | Bacteria | 1657 |
| 660 | Ga0496120_0010285 | 3300048923 | Bacteria | 6545 |
| 661 | Ga0496121_0002330 | 3300048924 | Bacteria | 29336 |
| 662 | Ga0496121_0003220 | 3300048924 | Bacteria | 23485 |
| 663 | Ga0496121_0007746 | 3300048924 | Bacteria | 12872 |
| 664 | Ga0496121_0078537 | 3300048924 | Bacteria | 2623 |
| 665 | Ga0496121_0085327 | 3300048924 | Bacteria | 2486 |
| 666 | Ga0496121_0096049 | 3300048924 | Bacteria | 2301 |
| 667 | Ga0496122_0006145 | 3300048925 | Bacteria | 13965 |
| 668 | Ga0496123_0020508 | 3300048926 | Bacteria | 5167 |
| 669 | Ga0496126_0026588 | 3300048929 | Bacteria | 5545 |
| 670 | Ga0496126_0028761 | 3300048929 | Bacteria | 5291 |
| 671 | Ga0496126_0045009 | 3300048929 | Bacteria | 4059 |
| 672 | Ga0496126_0045843 | 3300048929 | Bacteria | 4015 |
| 673 | Ga0496126_0071815 | 3300048929 | Bacteria | 3080 |
| 674 | Ga0496126_0075172 | 3300048929 | Bacteria | 2999 |
| 675 | Ga0496126_0240584 | 3300048929 | Bacteria | 1512 |
| 676 | Ga0496126_0415817 | 3300048929 | Bacteria | 1088 |
| 677 | Ga0501031_0002222 | 3300049568 | Bacteria | 12267 |
| 678 | Ga0501031_0174810 | 3300049568 | Bacteria | 1403 |
| 679 | Ga0501031_0199371 | 3300049568 | Bacteria | 1306 |
| 680 | Ga0501032_0000312 | 3300049569 | Bacteria | 40889 |
| 681 | Ga0501032_0001543 | 3300049569 | Bacteria | 18382 |
| 682 | Ga0501032_0107164 | 3300049569 | Bacteria | 1851 |
| 683 | Ga0501033_0000286 | 3300049570 | Bacteria | 48628 |
| 684 | Ga0501033_0005202 | 3300049570 | Bacteria | 10338 |
| 685 | Ga0501033_0039481 | 3300049570 | Bacteria | 3525 |
| 686 | Ga0501033_0052666 | 3300049570 | Bacteria | 3016 |
| 687 | Ga0501033_0067066 | 3300049570 | Bacteria | 2639 |
| 688 | Ga0501033_0193124 | 3300049570 | Bacteria | 1456 |
| 689 | Ga0501034_0003164 | 3300049571 | Bacteria | 18921 |
| 690 | Ga0501034_0003735 | 3300049571 | Bacteria | 17202 |
| 691 | Ga0501034_0013285 | 3300049571 | Bacteria | 8484 |
| 692 | Ga0501034_0055187 | 3300049571 | Bacteria | 3999 |
| 693 | Ga0501036_0000310 | 3300049572 | Bacteria | 33917 |
| 694 | Ga0501036_0002522 | 3300049572 | Bacteria | 14368 |
| 695 | Ga0501036_0225245 | 3300049572 | Bacteria | 1574 |
| 696 | Ga0501037_0000118 | 3300049573 | Bacteria | 73584 |
| 697 | Ga0501037_0003508 | 3300049573 | Bacteria | 11381 |
| 698 | Ga0501037_0046610 | 3300049573 | Bacteria | 3179 |
| 699 | Ga0501037_0114507 | 3300049573 | Bacteria | 1941 |
| 700 | Ga0501038_0000248 | 3300049574 | Bacteria | 45662 |
| 701 | Ga0501038_0001954 | 3300049574 | Bacteria | 19027 |
| 702 | Ga0501038_0045196 | 3300049574 | Bacteria | 3824 |
| 703 | Ga0501038_0084361 | 3300049574 | Bacteria | 2673 |
| 704 | Ga0501038_0246566 | 3300049574 | Bacteria | 1416 |
| 705 | Ga0501039_0000048 | 3300049575 | Bacteria | 102012 |
| 706 | Ga0501039_0001321 | 3300049575 | Bacteria | 18130 |
| 707 | Ga0501039_0179849 | 3300049575 | Bacteria | 1663 |
| 708 | Ga0501041_0106737 | 3300049577 | Bacteria | 1736 |
| 709 | Ga0501042_0129952 | 3300049578 | Bacteria | 1815 |
| 710 | Ga0501043_0001719 | 3300049579 | Bacteria | 18921 |
| 711 | Ga0501043_0006987 | 3300049579 | Bacteria | 8990 |
| 712 | Ga0501043_0122966 | 3300049579 | Bacteria | 2035 |
| 713 | Ga0501043_0253294 | 3300049579 | Bacteria | 1355 |
| 714 | Ga0501046_0013782 | 3300049580 | Bacteria | 6834 |
| 715 | Ga0501046_0104587 | 3300049580 | Bacteria | 2170 |
| 716 | Ga0501046_0117272 | 3300049580 | Bacteria | 2028 |
| 717 | Ga0501046_0411450 | 3300049580 | Bacteria | 976 |
| 718 | Ga0501047_0003356 | 3300049581 | Bacteria | 15165 |
| 719 | Ga0501047_0007161 | 3300049581 | Bacteria | 10480 |
| 720 | Ga0501047_0058375 | 3300049581 | Bacteria | 3728 |
| 721 | Ga0501047_0063735 | 3300049581 | Bacteria | 3555 |
| 722 | Ga0501047_0088476 | 3300049581 | Bacteria | 2974 |
| 723 | Ga0501047_0205420 | 3300049581 | Bacteria | 1829 |
| 724 | Ga0501067_0172216 | 3300049583 | Bacteria | 1206 |
| 725 | Ga0501068_0018033 | 3300049584 | Bacteria | 4087 |
| 726 | Ga0501068_0063992 | 3300049584 | Bacteria | 2238 |
| 727 | Ga0501069_0204331 | 3300049585 | Bacteria | 1145 |
| 728 | Ga0501070_0003393 | 3300049586 | Bacteria | 13825 |
| 729 | Ga0501070_0010716 | 3300049586 | Bacteria | 7748 |
| 730 | Ga0501070_0028481 | 3300049586 | Bacteria | 4685 |
| 731 | Ga0501070_0035001 | 3300049586 | Bacteria | 4197 |
| 732 | Ga0501070_0078249 | 3300049586 | Bacteria | 2737 |
| 733 | Ga0501070_0109124 | 3300049586 | Bacteria | 2286 |
| 734 | Ga0501071_0053840 | 3300049587 | Bacteria | 2903 |
| 735 | Ga0501071_0375349 | 3300049587 | Bacteria | 1084 |
| 736 | Ga0501073_0066345 | 3300049589 | Bacteria | 2516 |
| 737 | Ga0501073_0137288 | 3300049589 | Bacteria | 1694 |
| 738 | Ga0501073_0186799 | 3300049589 | Bacteria | 1434 |
| 739 | Ga0501074_0074802 | 3300049590 | Bacteria | 2432 |
| 740 | Ga0501074_0149270 | 3300049590 | Bacteria | 1671 |
| 741 | Ga0501075_0012911 | 3300049591 | Bacteria | 5950 |
| 742 | Ga0501076_0042884 | 3300049592 | Bacteria | 3564 |
| 743 | Ga0501076_0381836 | 3300049592 | Bacteria | 1158 |
| 744 | Ga0501079_0156857 | 3300049741 | Bacteria | 1774 |
| 745 | Ga0501079_0495317 | 3300049741 | Bacteria | 961 |
| 746 | Ga0501080_0026461 | 3300049742 | Bacteria | 5390 |
| 747 | Ga0501080_0050954 | 3300049742 | Bacteria | 3852 |
| 748 | Ga0501080_0065807 | 3300049742 | Bacteria | 3371 |
| 749 | Ga0501080_0165418 | 3300049742 | Bacteria | 2041 |
| 750 | Ga0501081_0225242 | 3300049743 | Bacteria | 1364 |
| 751 | Ga0501083_0021184 | 3300049744 | Bacteria | 4518 |
| 752 | Ga0501083_0056277 | 3300049744 | Bacteria | 2636 |
| 753 | Ga0501083_0288329 | 3300049744 | Bacteria | 1068 |
| 754 | Ga0501035_0000118 | 3300049822 | Bacteria | 95482 |
| 755 | Ga0501035_0000516 | 3300049822 | Bacteria | 43429 |
| 756 | Ga0501035_0002724 | 3300049822 | Bacteria | 17145 |
| 757 | Ga0501035_0063754 | 3300049822 | Bacteria | 3277 |
| 758 | Ga0501035_0096310 | 3300049822 | Bacteria | 2600 |
| 759 | Ga0501035_0148828 | 3300049822 | Bacteria | 2032 |
| 760 | Ga0501044_0004188 | 3300049823 | Bacteria | 16214 |
| 761 | Ga0501044_0012550 | 3300049823 | Bacteria | 9177 |
| 762 | Ga0501044_0016160 | 3300049823 | Bacteria | 8022 |
| 763 | Ga0501044_0026844 | 3300049823 | Bacteria | 6095 |
| 764 | Ga0501044_0130412 | 3300049823 | Bacteria | 2508 |
| 765 | Ga0501044_0138273 | 3300049823 | Bacteria | 2425 |
| 766 | Ga0501044_0217450 | 3300049823 | Bacteria | 1862 |
| 767 | Ga0501045_0025321 | 3300049824 | Bacteria | 4264 |
| 768 | nmdc:mga03683_45827_c1 | 3300050489 | Bacteria | 1811 |
| 769 | nmdc:mga03n38_164088_c1 | 3300050490 | Bacteria | 1127 |
| 770 | nmdc:mga03n38_200075_c1 | 3300050490 | Bacteria | 1034 |
| 771 | nmdc:mga00v17_13000_c1 | 3300050491 | Bacteria | 4611 |
| 772 | nmdc:mga0yw44_12835_c1 | 3300050492 | Bacteria | 4384 |
| 773 | nmdc:mga0yw44_205452_c1 | 3300050492 | Bacteria | 1302 |
| 774 | nmdc:mga0yw44_84561_c1 | 3300050492 | Bacteria | 1995 |
| 775 | nmdc:mga0yw44_8644_c1 | 3300050492 | Bacteria | 5088 |
| 776 | nmdc:mga0k408_147178_c1 | 3300050493 | Bacteria | 1402 |
| 777 | nmdc:mga0k408_36688_c1 | 3300050493 | Bacteria | 2814 |
| 778 | nmdc:mga06z11_12988_c1 | 3300050494 | Bacteria | 3640 |
| 779 | nmdc:mga06z11_148777_c1 | 3300050494 | Bacteria | 1329 |
| 780 | nmdc:mga06z11_328747_c1 | 3300050494 | Bacteria | 913 |
| 781 | nmdc:mga06z11_37634_c1 | 3300050494 | Bacteria | 2397 |
| 782 | nmdc:mga06z11_61221_c2 | 3300050494 | Bacteria | 1410 |
| 783 | nmdc:mga06z11_94407_c1 | 3300050494 | Bacteria | 1630 |
| 784 | nmdc:mga07m45_140461_c1 | 3300050496 | Bacteria | 1399 |
| 785 | nmdc:mga07m45_252996_c1 | 3300050496 | Bacteria | 1025 |
| 786 | nmdc:mga05p37_2215_c1 | 3300050507 | Bacteria | 22641 |
| 787 | nmdc:mga05p37_552998_c1 | 3300050507 | Bacteria | 1310 |
| 788 | nmdc:mga05p37_662574_c1 | 3300050507 | Bacteria | 1166 |
| 789 | nmdc:mga09592_261656_c1 | 3300050508 | Bacteria | 1500 |
| 790 | nmdc:mga0qj67_212290_c1 | 3300050509 | Bacteria | 1572 |
| 791 | nmdc:mga0qj67_221_c1 | 3300050509 | Bacteria | 38873 |
| 792 | nmdc:mga0qj67_494106_c1 | 3300050509 | Bacteria | 984 |
| 793 | nmdc:mga06r32_54301_c1 | 3300050510 | Bacteria | 3841 |
| 794 | nmdc:mga06r32_76282_c1 | 3300050510 | Bacteria | 3255 |
| 795 | nmdc:mga0n895_19634_c1 | 3300050512 | Bacteria | 6285 |
| 796 | nmdc:mga0rr50_59329_c1 | 3300050513 | Bacteria | 2872 |
| 797 | nmdc:mga08x19_21652_c1 | 3300050514 | Bacteria | 3972 |
| 798 | nmdc:mga08x19_249883_c1 | 3300050514 | Bacteria | 1224 |
| 799 | nmdc:mga08x19_37584_c1 | 3300050514 | Bacteria | 3073 |
| 800 | nmdc:mga08x19_608564_c1 | 3300050514 | Bacteria | 774 |
| 801 | nmdc:mga0a205_100676_c1 | 3300050515 | Bacteria | 2788 |
| 802 | nmdc:mga0a205_23024_c1 | 3300050515 | Bacteria | 5907 |
| 803 | nmdc:mga0sz30_3779_c1 | 3300050516 | Bacteria | 5451 |
| 804 | Ga0495601_0058391 | 3300053077 | Bacteria | 2445 |
| 805 | Ga0495601_0142710 | 3300053077 | Bacteria | 1562 |
| 806 | Ga0495601_0176034 | 3300053077 | Bacteria | 1398 |
| 807 | Ga0500610_0060134 | 3300053079 | Bacteria | 1983 |
| 808 | Ga0500635_0009468 | 3300053080 | Bacteria | 2704 |
| 809 | Ga0495655_0021216 | 3300053083 | Bacteria | 1468 |
| 810 | Ga0495595_0079907 | 3300053084 | Bacteria | 1556 |
| 811 | Ga0495619_0006785 | 3300053085 | Bacteria | 7242 |
| 812 | Ga0495619_0011552 | 3300053085 | Bacteria | 5564 |
| 813 | Ga0495619_0012982 | 3300053085 | Bacteria | 5248 |
| 814 | Ga0495619_0191913 | 3300053085 | Bacteria | 1414 |
| 815 | Ga0495619_0256127 | 3300053085 | Bacteria | 1213 |
| 816 | Ga0495619_0324181 | 3300053085 | Bacteria | 1066 |
| 817 | Ga0495619_0565934 | 3300053085 | Bacteria | 779 |
| 818 | Ga0500643_010040 | 3300053087 | Bacteria | 3562 |
| 819 | Ga0500643_012614 | 3300053087 | Bacteria | 3021 |
| 820 | Ga0500644_0004361 | 3300053088 | Bacteria | 3538 |
| 821 | Ga0500651_0051806 | 3300053093 | Bacteria | 2575 |
| 822 | Ga0500566_0001659 | 3300053094 | Bacteria | 13060 |
| 823 | Ga0500566_0008714 | 3300053094 | Bacteria | 6001 |
| 824 | Ga0500566_0020899 | 3300053094 | Bacteria | 3850 |
| 825 | Ga0500640_018114 | 3300053095 | Bacteria | 2999 |
| 826 | Ga0500641_0008450 | 3300053096 | Bacteria | 3674 |
| 827 | Ga0500650_0252984 | 3300053098 | Bacteria | 790 |
| 828 | Ga0500554_012174 | 3300053102 | Bacteria | 2156 |
| 829 | Ga0500556_0000956 | 3300053104 | Bacteria | 15501 |
| 830 | Ga0500572_000255 | 3300053111 | Bacteria | 19104 |
| 831 | Ga0500572_001715 | 3300053111 | Bacteria | 5691 |
| 832 | Ga0500594_0023611 | 3300053118 | Bacteria | 1561 |
| 833 | Ga0500595_000029 | 3300053119 | Bacteria | 122318 |
| 834 | Ga0500595_003805 | 3300053119 | Bacteria | 6938 |
| 835 | Ga0500595_011603 | 3300053119 | Bacteria | 3439 |
| 836 | Ga0500595_013783 | 3300053119 | Bacteria | 3090 |
| 837 | Ga0500595_044037 | 3300053119 | Bacteria | 1417 |
| 838 | Ga0500595_059184 | 3300053119 | Bacteria | 1162 |
| 839 | Ga0500608_033992 | 3300053122 | Bacteria | 2428 |
| 840 | Ga0500614_004614 | 3300053123 | Bacteria | 2904 |
| 841 | Ga0500642_0014749 | 3300053130 | Bacteria | 2917 |
| 842 | Ga0500652_005799 | 3300053131 | Bacteria | 3924 |
| 843 | Ga0500652_135207 | 3300053131 | Bacteria | 1027 |
| 844 | Ga0500559_0000299 | 3300053136 | Bacteria | 38041 |
| 845 | Ga0500559_0004223 | 3300053136 | Bacteria | 6873 |
| 846 | Ga0500568_0000035 | 3300053139 | Bacteria | 137912 |
| 847 | Ga0500568_0045993 | 3300053139 | Bacteria | 1735 |
| 848 | Ga0500603_002486 | 3300053150 | Bacteria | 4028 |
| 849 | Ga0500603_007058 | 3300053150 | Bacteria | 2457 |
| 850 | Ga0500603_017879 | 3300053150 | Bacteria | 1700 |
| 851 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 852 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 853 | Ga0500620_008801 | 3300053155 | Bacteria | 2571 |
| 854 | Ga0500622_0005458 | 3300053156 | Bacteria | 7632 |
| 855 | Ga0500622_0028257 | 3300053156 | Bacteria | 2952 |
| 856 | Ga0500622_0067368 | 3300053156 | Bacteria | 1816 |
| 857 | Ga0500627_0097927 | 3300053158 | Bacteria | 1315 |
| 858 | Ga0500630_008925 | 3300053159 | Bacteria | 4923 |
| 859 | Ga0500638_023336 | 3300053162 | Bacteria | 2940 |
| 860 | Ga0500638_030769 | 3300053162 | Bacteria | 2586 |
| 861 | Ga0500639_000477 | 3300053163 | Bacteria | 19965 |
| 862 | Ga0500636_0263892 | 3300053177 | Bacteria | 870 |
| 863 | Ga0500637_0002325 | 3300053178 | Bacteria | 8416 |
| 864 | Ga0500637_0016108 | 3300053178 | Bacteria | 3979 |
| 865 | Ga0500576_033923 | 3300053725 | Bacteria | 2313 |
| 866 | Ga0500645_000290 | 3300053730 | Bacteria | 36019 |
| 867 | Ga0500645_005569 | 3300053730 | Bacteria | 4612 |
| 868 | Ga0500596_000406 | 3300053735 | Bacteria | 7868 |
| 869 | Ga0501084_0114989 | 3300054114 | Bacteria | 2262 |
| 870 | Ga0500661_003768 | 3300055283 | Bacteria | 2846 |
| 871 | Ga0501082_0087994 | 3300060353 | Bacteria | 2680 |
| 872 | Ga0501082_0185310 | 3300060353 | Bacteria | 1811 |
| 873 | Ga0501082_0212855 | 3300060353 | Bacteria | 1681 |
| 874 | Ga0501082_0339302 | 3300060353 | Bacteria | 1309 |
| 875 | Ga0530510_0144391 | 3300061734 | Bacteria | 1755 |
| 876 | 2503202214 | 2503198000 | Bacteria | 6884444 |
| 877 | 2509117019 | 2508501123 | Bacteria | 6283661 |
| 878 | 2509140637 | 2508501127 | Bacteria | 7037543 |
| 879 | 2509370709 | 2509276018 | Bacteria | 6910194 |
| 880 | 2509396862 | 2509276022 | Bacteria | 6200534 |
| 881 | 2510317500 | 2510065059 | Bacteria | 6847884 |
| 882 | 2512930887 | 2512875016 | Bacteria | 6529530 |
| 883 | 2512958613 | 2512875024 | Bacteria | 7195110 |
| 884 | 2513609925 | 2513237090 | Bacteria | 7096802 |
| 885 | 2514034972 | 2513237164 | Bacteria | 7563725 |
| 886 | 2514418934 | 2513237305 | Bacteria | 7293571 |
| 887 | 2514589371 | 2513237351 | Bacteria | 6968952 |
| 888 | 2588516567 | 2588253730 | Bacteria | 6881675 |
| 889 | 2597814095 | 2597489875 | Bacteria | 7010078 |
| 890 | 2599938077 | 2599185301 | Bacteria | 6161860 |
| 891 | 2643989390 | 2643221595 | Bacteria | 6565519 |
| 892 | 2644152962 | 2643221627 | Bacteria | 6761570 |
| 893 | 2688599424 | 2687453392 | Bacteria | 6880454 |
| 894 | 2694632210 | 2693429783 | Bacteria | 7019804 |
| 895 | 2694634382 | 2693429784 | Bacteria | 7241525 |
| 896 | 2723576384 | 2721755686 | Bacteria | 7343952 |
| 897 | 2723842321 | 2721755755 | Bacteria | 8322773 |
| 898 | 2738716120 | 2738541276 | Bacteria | 4690596 |
| 899 | 2756675899 | 2756170246 | Bacteria | 7451806 |
| 900 | 2792748537 | 2791355123 | Bacteria | 8049106 |
| 901 | 2841740015 | 2841734538 | Bacteria | 6784580 |
| 902 | 2844006439 | 2844002411 | Bacteria | 7168230 |
| 903 | 2844014702 | 2844009547 | Bacteria | 6728125 |
| 904 | 2847672505 | 2847670302 | Bacteria | 6165597 |
| 905 | 2856315520 | 2856314179 | Bacteria | 6477897 |
| 906 | 2856325846 | 2856320880 | Bacteria | 7263508 |
| 907 | 2856328976 | 2856328259 | Bacteria | 6528202 |
| 908 | 2856340026 | 2856334872 | Bacteria | 7037011 |
| 909 | 2856343182 | 2856342000 | Bacteria | 7176905 |
| 910 | 2856354497 | 2856349417 | Bacteria | 6230045 |
| 911 | 2856363299 | 2856356410 | Bacteria | 6297484 |
| 912 | 2856368821 | 2856364286 | Bacteria | 6939991 |
| 913 | 2857350207 | 2857349434 | Bacteria | 7926032 |
| 914 | 2857368576 | 2857367948 | Bacteria | 6965560 |
| 915 | 2869165264 | 2869162929 | Bacteria | 6399702 |
| 916 | 2869174789 | 2869169390 | Bacteria | 6659796 |
| 917 | 2869240792 | 2869234852 | Bacteria | 6654993 |
| 918 | 2869249563 | 2869242130 | Bacteria | 6609239 |
| 919 | 2869252189 | 2869249662 | Bacteria | 6868783 |
| 920 | 2869262533 | 2869256925 | Bacteria | 6981691 |
| 921 | 2869268000 | 2869264136 | Bacteria | 6880765 |
| 922 | 2869278626 | 2869278585 | Bacteria | 7077053 |
| 923 | 2869291316 | 2869285874 | Bacteria | 6901219 |
| 924 | 2871433596 | 2871429161 | Bacteria | 6547891 |
| 925 | 2871441738 | 2871435913 | Bacteria | 6880295 |
| 926 | 2871458147 | 2871451962 | Bacteria | 7336357 |
| 927 | 2871466359 | 2871459585 | Bacteria | 6866887 |
| 928 | 2871473865 | 2871466892 | Bacteria | 6923287 |
| 929 | 2871475309 | 2871474448 | Bacteria | 6806570 |
| 930 | 2871484947 | 2871481445 | Bacteria | 6700002 |
| 931 | 2871495782 | 2871488783 | Bacteria | 6929816 |
| 932 | 2871502990 | 2871495908 | Bacteria | 6935695 |
| 933 | 2874103483 | 2874102143 | Bacteria | 6342645 |
| 934 | 2874111774 | 2874109183 | Bacteria | 6517025 |
| 935 | 2874117825 | 2874116593 | Bacteria | 6674494 |
| 936 | 2874125997 | 2874123672 | Bacteria | 7238285 |
| 937 | 2874132040 | 2874131515 | Bacteria | 6820270 |
| 938 | 2874145212 | 2874139085 | Bacteria | 7021506 |
| 939 | 2874153197 | 2874146452 | Bacteria | 7533118 |
| 940 | 2874160462 | 2874155637 | Bacteria | 6724144 |
| 941 | 2874167276 | 2874162495 | Bacteria | 6174670 |
| 942 | 2874176202 | 2874168670 | Bacteria | 8062617 |
| 943 | 2874616504 | 2874612657 | Bacteria | 8252029 |
| 944 | 2876365441 | 2876363079 | Bacteria | 6544991 |
| 945 | 2876386079 | 2876386047 | Bacteria | 6698674 |
| 946 | 2876394971 | 2876392853 | Bacteria | 6660880 |
| 947 | 2876405863 | 2876399893 | Bacteria | 6927900 |
| 948 | 2876407655 | 2876406927 | Bacteria | 6191900 |
| 949 | 2876419488 | 2876413966 | Bacteria | 6831344 |
| 950 | 2876426508 | 2876420981 | Bacteria | 6687741 |
| 951 | 2878037193 | 2878035449 | Bacteria | 6555736 |
| 952 | 2878743409 | 2878738818 | Bacteria | 7136951 |
| 953 | 2878751207 | 2878745973 | Bacteria | 6867388 |
| 954 | 2878753419 | 2878753008 | Bacteria | 6922523 |
| 955 | 2878766879 | 2878760144 | Bacteria | 6823465 |
| 956 | 2878774077 | 2878767105 | Bacteria | 6898628 |
| 957 | 2878774794 | 2878774303 | Bacteria | 6108671 |
| 958 | 2878786450 | 2878781027 | Bacteria | 6834456 |
| 959 | 2878796839 | 2878788777 | Bacteria | 6567085 |
| 960 | 2881152865 | 2881147464 | Bacteria | 7779814 |
| 961 | 2881156358 | 2881155292 | Bacteria | 6461656 |
| 962 | 2881168310 | 2881161766 | Bacteria | 7127907 |
| 963 | 2881860674 | 2881853255 | Bacteria | 6698367 |
| 964 | 2881863389 | 2881861095 | Bacteria | 7128710 |
| 965 | 2882637878 | 2882632389 | Bacteria | 8154593 |
| 966 | 2882918488 | 2882912400 | Bacteria | 6801539 |
| 967 | 2885310306 | 2885305155 | Bacteria | 7348390 |
| 968 | 2885317118 | 2885312484 | Bacteria | 6415165 |
| 969 | 2885319195 | 2885318864 | Bacteria | 6729568 |
| 970 | 2885329306 | 2885326080 | Bacteria | 7134805 |
| 971 | 2885339137 | 2885334103 | Bacteria | 7216818 |
| 972 | 2885350761 | 2885350715 | Bacteria | 6787678 |
| 973 | 2885380852 | 2885374607 | Bacteria | 8927485 |
| 974 | 2888340142 | 2888337043 | Bacteria | 6629336 |
| 975 | 2888347467 | 2888343758 | Bacteria | 6611049 |
| 976 | 2888356551 | 2888350351 | Bacteria | 7372807 |
| 977 | 2889011458 | 2889010040 | Bacteria | 6749192 |
| 978 | 2889016812 | 2889016732 | Bacteria | 6700763 |
| 979 | 2903455607 | 2903448605 | Bacteria | 7357801 |
| 980 | 2903495274 | 2903492973 | Bacteria | 13473544 |
| 981 | 2903501705 | 2903492973 | Bacteria | 13473544 |
| 982 | 2903513687 | 2903513507 | Bacteria | 6344008 |
| 983 | 2903522797 | 2903521522 | Bacteria | 6525694 |
| 984 | 2903532987 | 2903528002 | Bacteria | 6586099 |
| 985 | 2903548179 | 2903540706 | Bacteria | 7062119 |
| 986 | 2904661602 | 2904659560 | Bacteria | 6685615 |
| 987 | 2904692035 | 2904690495 | Bacteria | 9412302 |
| 988 | 2906313148 | 2906308376 | Bacteria | 6841989 |
| 989 | 2906325859 | 2906321335 | Bacteria | 6579571 |
| 990 | 2906331885 | 2906328253 | Bacteria | 6585166 |
| 991 | 2906360990 | 2906354277 | Bacteria | 6991324 |
| 992 | 2906365864 | 2906363423 | Bacteria | 6856682 |
| 993 | 2906370795 | 2906370794 | Bacteria | 6881062 |
| 994 | 2906391321 | 2906386501 | Bacteria | 5977019 |
| 995 | 2906394524 | 2906393657 | Bacteria | 6790866 |
| 996 | 2906402998 | 2906401398 | Bacteria | 6693206 |
| 997 | 2906412644 | 2906408224 | Bacteria | 6162342 |
| 998 | 2906415657 | 2906414383 | Bacteria | 6580790 |
| 999 | 2906429386 | 2906427513 | Bacteria | 6375796 |
| 1000 | 2908746533 | 2908739725 | Bacteria | 8628932 |
| 1001 | 2908757314 | 2908756301 | Bacteria | 8864324 |
| 1002 | 2922134506 | 2922130491 | Bacteria | 7173936 |
| 1003 | 2922163040 | 2922158528 | Bacteria | 6573167 |
| 1004 | 2922177105 | 2922172374 | Bacteria | 6167644 |
| 1005 | 2922181129 | 2922178524 | Bacteria | 6025201 |
| 1006 | 2922187576 | 2922185730 | Bacteria | 7113964 |
| 1007 | 2924710530 | 2924710171 | Bacteria | 6752351 |
| 1008 | 2924732086 | 2924726620 | Bacteria | 6271473 |
| 1009 | 2924736249 | 2924733363 | Bacteria | 7574837 |
| 1010 | 2924747242 | 2924741084 | Bacteria | 6661321 |
| 1011 | 2924750849 | 2924748358 | Bacteria | 6154725 |
| 1012 | 2924759740 | 2924754689 | Bacteria | 6774424 |
| 1013 | 2924768981 | 2924762789 | Bacteria | 6561353 |
| 1014 | 2924781221 | 2924776078 | Bacteria | 7492003 |
| 1015 | 2924789666 | 2924784321 | Bacteria | 7416538 |
| 1016 | 2935632847 | 2935630451 | Bacteria | 8169952 |
| 1017 | 2937820701 | 2937813078 | Bacteria | 7783518 |
| 1018 | 2937827301 | 2937822353 | Bacteria | 7290551 |
| 1019 | 2937837770 | 2937836603 | Bacteria | 6811263 |
| 1020 | 2937849134 | 2937848649 | Bacteria | 6983481 |
| 1021 | 2937866851 | 2937861824 | Bacteria | 6660327 |
| 1022 | 2937869017 | 2937868953 | Bacteria | 6639878 |
| 1023 | 2937878982 | 2937877337 | Bacteria | 7246526 |
| 1024 | 2937895569 | 2937891427 | Bacteria | 6357007 |
| 1025 | 2937975272 | 2937972304 | Bacteria | 7532020 |
| 1026 | 2938002004 | 2937994558 | Bacteria | 7036190 |
| 1027 | 2938017392 | 2938014810 | Bacteria | 6700592 |
| 1028 | 2939672808 | 2939669807 | Bacteria | 5028511 |
| 1029 | 2941508488 | 2941507105 | Bacteria | 8166816 |
| 1030 | 2941516319 | 2941515067 | Bacteria | 8166720 |
| 1031 | 2941524665 | 2941523033 | Bacteria | 8169134 |
| 1032 | 2952254677 | 2952252522 | Bacteria | 4171745 |
| 1033 | 2958034742 | 2958034702 | Bacteria | 6989922 |
| 1034 | 2958043130 | 2958041894 | Bacteria | 13082850 |
| 1035 | 2958066990 | 2958064165 | Bacteria | 7158582 |
| 1036 | 2958077509 | 2958071322 | Bacteria | 6815895 |
| 1037 | 2958086156 | 2958084443 | Bacteria | 7312792 |
| 1038 | 2958092415 | 2958092219 | Bacteria | 6861151 |
| 1039 | 2958103053 | 2958100919 | Bacteria | 6800575 |
| 1040 | 2958121501 | 2958115193 | Bacteria | 6923548 |
| 1041 | 2958123717 | 2958122699 | Bacteria | 7280457 |
| 1042 | 2958135716 | 2958130278 | Bacteria | 6897202 |
| 1043 | 2958141789 | 2958137437 | Bacteria | 6050276 |
| 1044 | 2958145593 | 2958144490 | Bacteria | 6677056 |
| 1045 | 2958162603 | 2958158011 | Bacteria | 6058449 |
| 1046 | 2958172058 | 2958165035 | Bacteria | 6906348 |
| 1047 | 2958177823 | 2958172287 | Bacteria | 6716688 |
| 1048 | 2958185207 | 2958179912 | Bacteria | 6874908 |
| 1049 | 2961083474 | 2961077736 | Bacteria | 7079850 |
| 1050 | 2961116755 | 2961114664 | Bacteria | 6680456 |
| 1051 | 2961132800 | 2961127735 | Bacteria | 7196641 |
| 1052 | 2961141162 | 2961136820 | Bacteria | 6775228 |
| 1053 | 2961170505 | 2961163497 | Bacteria | 6901077 |
| 1054 | 2961177863 | 2961170736 | Bacteria | 7072258 |
| 1055 | 2961187358 | 2961183825 | Bacteria | 6688536 |
| 1056 | 2963648338 | 2963644680 | Bacteria | 6530403 |
| 1057 | 2965025252 | 2965018300 | Bacteria | 6883036 |
| 1058 | 2965029525 | 2965025482 | Bacteria | 6532201 |
| 1059 | 2965037238 | 2965032056 | Bacteria | 6887443 |
| 1060 | 2965043381 | 2965040258 | Bacteria | 6855979 |
| 1061 | 2965052370 | 2965047637 | Bacteria | 6623551 |
| 1062 | 2965065780 | 2965062239 | Bacteria | 7412989 |
| 1063 | 2965095798 | 2965089291 | Bacteria | 6866420 |
| 1064 | 2965103067 | 2965102966 | Bacteria | 6800987 |
| 1065 | 2968003130 | 2967996073 | Bacteria | 6787468 |
| 1066 | 2968003956 | 2968003550 | Bacteria | 6929263 |
| 1067 | 2968017850 | 2968016561 | Bacteria | 7022047 |
| 1068 | 2968084851 | 2968083720 | Bacteria | 7351627 |
| 1069 | 2968095321 | 2968091066 | Bacteria | 6052692 |
| 1070 | 2968103129 | 2968097103 | Bacteria | 6107094 |
| 1071 | 2968112662 | 2968110612 | Bacteria | 6814636 |
| 1072 | 2968123104 | 2968117919 | Bacteria | 6536078 |
| 1073 | 2968128561 | 2968128360 | Bacteria | 6270294 |
| 1074 | 2968144975 | 2968138860 | Bacteria | 6605449 |
| 1075 | 2968178891 | 2968171901 | Bacteria | 6894245 |
| 1076 | 2970471975 | 2970469710 | Bacteria | 6969209 |
| 1077 | 2970495821 | 2970489779 | Bacteria | 6517260 |
| 1078 | 2970510539 | 2970503327 | Bacteria | 7099517 |
| 1079 | 2970512671 | 2970510686 | Bacteria | 7006402 |
| 1080 | 2970531713 | 2970524798 | Bacteria | 6840927 |
| 1081 | 2970542133 | 2970540015 | Bacteria | 6977556 |
| 1082 | 2970550037 | 2970547951 | Bacteria | 6931819 |
| 1083 | 2970561735 | 2970554993 | Bacteria | 6814252 |
| 1084 | 2970593222 | 2970593180 | Bacteria | 7073582 |
| 1085 | 2970621111 | 2970619444 | Bacteria | 6986144 |
| 1086 | 2970632268 | 2970627176 | Bacteria | 6680862 |
| 1087 | 2977822641 | 2977821940 | Bacteria | 6906439 |
| 1088 | 2977833372 | 2977828996 | Bacteria | 7007971 |
| 1089 | 2977848999 | 2977843712 | Bacteria | 6753583 |
| 1090 | 2977858093 | 2977851361 | Bacteria | 6694324 |
| 1091 | 2977861628 | 2977858184 | Bacteria | 6215359 |
| 1092 | 2977872514 | 2977864932 | Bacteria | 7534097 |
| 1093 | 2977873520 | 2977872689 | Bacteria | 7270173 |
| 1094 | 2977906501 | 2977898635 | Bacteria | 6675551 |
| 1095 | 2977914146 | 2977907340 | Bacteria | 6577984 |
| 1096 | 2977919572 | 2977915119 | Bacteria | 6829656 |
| 1097 | 2977923087 | 2977922695 | Bacteria | 6956781 |
| 1098 | 2977941406 | 2977935797 | Bacteria | 6252826 |
| 1099 | 2977948247 | 2977942078 | Bacteria | 7570577 |
| 1100 | 2977991877 | 2977986579 | Bacteria | 6581278 |
| 1101 | 2979713358 | 2979710463 | Bacteria | 6785254 |
| 1102 | 2979769314 | 2979764755 | Bacteria | 6610066 |
| 1103 | 2979773494 | 2979772303 | Bacteria | 6618277 |
| 1104 | 2979784879 | 2979779861 | Bacteria | 6219781 |
| 1105 | 2979795513 | 2979793036 | Bacteria | 6808957 |
| 1106 | 2979815413 | 2979808191 | Bacteria | 7179355 |
| 1107 | 2987637395 | 2987636660 | Bacteria | 8088555 |
| 1108 | 2987653983 | 2987652177 | Bacteria | 6969023 |
| 1109 | 2987666745 | 2987659509 | Bacteria | 6966464 |
| 1110 | 2987670659 | 2987666974 | Bacteria | 6509233 |
| 1111 | 2987676196 | 2987673487 | Bacteria | 6884027 |
| 1112 | 2996314777 | 2996310559 | Bacteria | 6357320 |
| 1113 | 2996345397 | 2996341866 | Bacteria | 6643098 |
| 1114 | 2996350908 | 2996348954 | Bacteria | 7239054 |
| 1115 | 2996392567 | 2996386984 | Bacteria | 6978667 |
| 1116 | 3000138489 | 3000135777 | Bacteria | 6891109 |
| 1117 | 3004169588 | 3004167301 | Bacteria | 8330599 |
| 1118 | 3004195748 | 3004188549 | Bacteria | 6952365 |
| 1119 | 3004197932 | 3004195979 | Bacteria | 6776956 |
| 1120 | 3004206208 | 3004203850 | Bacteria | 7307914 |
| 1121 | 3004211683 | 3004211236 | Bacteria | 7417683 |
| 1122 | 3004218930 | 3004218560 | Bacteria | 7421728 |
| 1123 | 3004238893 | 3004232784 | Bacteria | 6662140 |
| 1124 | 3004242976 | 3004239961 | Bacteria | 6892290 |
| 1125 | 3004254293 | 3004248173 | Bacteria | 6563236 |
| 1126 | 3004275201 | 3004268573 | Bacteria | 7043476 |
| 1127 | 3004277606 | 3004275668 | Bacteria | 7114440 |
| 1128 | 3004341002 | 3004334049 | Bacteria | 8449246 |
| 1129 | 637073933 | 637000159 | Bacteria | 7596297 |
| 1130 | 649873928 | 649633066 | Bacteria | 6690028 |
| 1131 | 8004305512 | 8004300914 | Bacteria | 6132239 |
| 1132 | 8004313106 | 8004312739 | Bacteria | 7444653 |
| 1133 | 8004363790 | 8004361976 | Bacteria | 6858373 |
| 1134 | 8004374991 | 8004374579 | Bacteria | 6898112 |
| 1135 | 8004394128 | 8004387939 | Bacteria | 7049250 |
| 1136 | 8004449876 | 8004445564 | Bacteria | 6322258 |
| 1137 | 8004634074 | 8004633249 | Bacteria | 6723080 |
| 1138 | 8004646674 | 8004640170 | Bacteria | 6723001 |
| 1139 | 8004713234 | 8004703790 | Bacteria | 8006957 |
| 1140 | 8004719405 | 8004714634 | Bacteria | 6776161 |
| 1141 | 8004733261 | 8004727605 | Bacteria | 6643904 |
| 1142 | 8006996938 | 8006994254 | Bacteria | 8309700 |
| 1143 | 8055621529 | 8055617313 | Bacteria | 7548464 |
| 1144 | Ga0157339_1011728 | |||
| 1145 | JGI24740J21852_10009490 | |||
| 1146 | JGI24751J29686_10029641 | |||
| 1147 | JGI25157J39369_1001294 | |||
| 1148 | JGI25406J46586_10014352 | |||
| 1149 | JGI25153J46596_10017786 | |||
| 1150 | rootH1_10000936 | |||
| 1151 | rootH1_10008698 | |||
| 1152 | JGI25404J52841_10013017 | |||
| 1153 | Ga0055542_1000775 | |||
| 1154 | Ga0055529_1002235 | |||
| 1155 | Ga0065712_10020326 | |||
| 1156 | Ga0065715_10121096 | |||
| 1157 | Ga0065715_10352229 | |||
| 1158 | Ga0070658_10088079 | |||
| 1159 | Ga0070658_10133802 | |||
| 1160 | Ga0070658_10249162 | |||
| 1161 | Ga0070676_10116664 | |||
| 1162 | Ga0070676_10334371 | |||
| 1163 | Ga0070683_100059968 | |||
| 1164 | Ga0070670_100542790 | |||
| 1165 | Ga0070677_10026835 | |||
| 1166 | Ga0068869_100003218 | |||
| 1167 | Ga0068869_100439513 | |||
| 1168 | Ga0070680_100048987 | |||
| 1169 | Ga0070680_100318622 | |||
| 1170 | Ga0070680_100451141 | |||
| 1171 | Ga0070680_100494620 | |||
| 1172 | Ga0070682_100023021 | |||
| 1173 | Ga0068868_100656117 | |||
| 1174 | Ga0070660_100395616 | |||
| 1175 | Ga0070691_10154219 | |||
| 1176 | Ga0070661_100073843 | |||
| 1177 | Ga0070675_100052858 | |||
| 1178 | Ga0070675_100082169 | |||
| 1179 | Ga0070675_100084106 | |||
| 1180 | Ga0070671_100018362 | |||
| 1181 | Ga0070671_100203660 | |||
| 1182 | Ga0070671_100431752 | |||
| 1183 | Ga0070674_100068091 | |||
| 1184 | Ga0070674_100860703 | |||
| 1185 | Ga0070673_100027881 | |||
| 1186 | Ga0070673_100036731 | |||
| 1187 | Ga0070688_100179388 | |||
| 1188 | Ga0070688_100216359 | |||
| 1189 | Ga0070659_100018350 | |||
| 1190 | Ga0070659_100055791 | |||
| 1191 | Ga0070659_100247872 | |||
| 1192 | Ga0070667_100372473 | |||
| 1193 | Ga0070709_10011341 | |||
| 1194 | Ga0070709_10042115 | |||
| 1195 | Ga0070709_10068928 | |||
| 1196 | Ga0070709_10243424 | |||
| 1197 | Ga0070714_100017392 | |||
| 1198 | Ga0070714_100080276 | |||
| 1199 | Ga0070713_100007558 | |||
| 1200 | Ga0070713_100015955 | |||
| 1201 | Ga0070713_100016717 | |||
| 1202 | Ga0070713_100031430 | |||
| 1203 | Ga0070710_10007309 | |||
| 1204 | Ga0070711_100020389 | |||
| 1205 | Ga0070711_100027190 | |||
| 1206 | Ga0070711_100041309 | |||
| 1207 | Ga0070711_100076214 | |||
| 1208 | Ga0070708_100616473 | |||
| 1209 | Ga0070663_100010007 | |||
| 1210 | Ga0070663_100302487 | |||
| 1211 | Ga0070678_100047257 | |||
| 1212 | Ga0070681_10000509 | |||
| 1213 | Ga0070681_10053509 | |||
| 1214 | Ga0070681_10064749 | |||
| 1215 | Ga0070681_10197411 | |||
| 1216 | Ga0070681_10612104 | |||
| 1217 | Ga0070681_10638136 | |||
| 1218 | Ga0070681_10930652 | |||
| 1219 | Ga0068867_100104271 | |||
| 1220 | Ga0068867_100466695 | |||
| 1221 | Ga0068867_100587420 | |||
| 1222 | Ga0070706_100310250 | |||
| 1223 | Ga0070698_100037846 | |||
| 1224 | Ga0070698_100180884 | |||
| 1225 | Ga0070698_100246398 | |||
| 1226 | Ga0070679_100023336 | |||
| 1227 | Ga0070679_100161142 | |||
| 1228 | Ga0070679_100254244 | |||
| 1229 | Ga0070684_100010129 | |||
| 1230 | Ga0070684_100046744 | |||
| 1231 | Ga0070697_100111750 | |||
| 1232 | Ga0070697_100172590 | |||
| 1233 | Ga0068853_100067677 | |||
| 1234 | Ga0068853_100252069 | |||
| 1235 | Ga0068853_100322792 | |||
| 1236 | Ga0068853_100442988 | |||
| 1237 | Ga0068853_100607931 | |||
| 1238 | Ga0068853_100684369 | |||
| 1239 | Ga0070672_100080702 | |||
| 1240 | Ga0070672_100274356 | |||
| 1241 | Ga0070686_100244810 | |||
| 1242 | Ga0070686_100512879 | |||
| 1243 | Ga0070696_100198074 | |||
| 1244 | Ga0070693_100101637 | |||
| 1245 | Ga0070665_100107922 | |||
| 1246 | Ga0070665_100225890 | |||
| 1247 | Ga0070665_100692068 | |||
| 1248 | Ga0068855_100075791 | |||
| 1249 | Ga0068855_100676345 | |||
| 1250 | Ga0068855_100685653 | |||
| 1251 | Ga0070664_100091744 | |||
| 1252 | Ga0070664_100641202 | |||
| 1253 | Ga0068857_100025776 | |||
| 1254 | Ga0068857_100045564 | |||
| 1255 | Ga0068857_100085007 | |||
| 1256 | Ga0068857_100110102 | |||
| 1257 | Ga0068854_100498001 | |||
| 1258 | Ga0068856_100019492 | |||
| 1259 | Ga0068856_100188914 | |||
| 1260 | Ga0068852_100020134 | |||
| 1261 | Ga0068859_100062589 | |||
| 1262 | Ga0068859_100266275 | |||
| 1263 | Ga0068864_100099419 | |||
| 1264 | Ga0068851_10037476 | |||
| 1265 | Ga0068851_10043364 | |||
| 1266 | Ga0068863_100453253 | |||
| 1267 | Ga0068858_100075077 | |||
| 1268 | Ga0068858_100103740 | |||
| 1269 | Ga0068858_100419779 | |||
| 1270 | Ga0068860_100073539 | |||
| 1271 | Ga0068860_100156599 | |||
| 1272 | Ga0068862_100667541 | |||
| 1273 | Ga0081455_10000142 | |||
| 1274 | Ga0081455_10001715 | |||
| 1275 | Ga0081455_10028348 | |||
| 1276 | Ga0081455_10212197 | |||
| 1277 | Ga0081540_1006097 | |||
| 1278 | Ga0081539_10003011 | |||
| 1279 | Ga0081539_10003789 | |||
| 1280 | Ga0081539_10016697 | |||
| 1281 | Ga0081539_10024885 | |||
| 1282 | Ga0081539_10036208 | |||
| 1283 | Ga0070717_10006086 | |||
| 1284 | Ga0070717_10014983 | |||
| 1285 | Ga0070717_10187097 | |||
| 1286 | Ga0070717_10212601 | |||
| 1287 | Ga0075365_10014170 | |||
| 1288 | Ga0075365_10083995 | |||
| 1289 | Ga0075365_10138962 | |||
| 1290 | Ga0075368_10093631 | |||
| 1291 | Ga0075368_10096675 | |||
| 1292 | Ga0075363_100051055 | |||
| 1293 | Ga0075363_100115698 | |||
| 1294 | Ga0075363_100127543 | |||
| 1295 | Ga0075363_100174066 | |||
| 1296 | Ga0075363_100340530 | |||
| 1297 | Ga0075364_10032560 | |||
| 1298 | Ga0075364_10039017 | |||
| 1299 | Ga0070715_10001945 | |||
| 1300 | Ga0070716_100003460 | |||
| 1301 | Ga0070716_100100258 | |||
| 1302 | Ga0070712_100294326 | |||
| 1303 | Ga0070712_100406563 | |||
| 1304 | Ga0075362_10031084 | |||
| 1305 | Ga0075362_10148340 | |||
| 1306 | Ga0075367_10020138 | |||
| 1307 | Ga0075367_10104871 | |||
| 1308 | Ga0075367_10123154 | |||
| 1309 | Ga0075367_10259816 | |||
| 1310 | Ga0075367_10294456 | |||
| 1311 | Ga0075369_10002893 | |||
| 1312 | Ga0075366_10056051 | |||
| 1313 | Ga0075366_10179854 | |||
| 1314 | Ga0075366_10318275 | |||
| 1315 | Ga0097621_100073805 | |||
| 1316 | Ga0097621_100993647 | |||
| 1317 | Ga0075370_10129113 | |||
| 1318 | Ga0075370_10202400 | |||
| 1319 | Ga0068871_100643138 | |||
| 1320 | Ga0075428_100010071 | |||
| 1321 | Ga0075428_100621787 | |||
| 1322 | Ga0075428_100700737 | |||
| 1323 | Ga0075430_100000066 | |||
| 1324 | Ga0075431_100455294 | |||
| 1325 | Ga0075433_10130326 | |||
| 1326 | Ga0075434_100025332 | |||
| 1327 | Ga0075429_100204653 | |||
| 1328 | Ga0075429_100369191 | |||
| 1329 | Ga0068865_100081248 | |||
| 1330 | Ga0075436_100069355 | |||
| 1331 | Ga0097620_100062596 | |||
| 1332 | Ga0097620_100266269 | |||
| 1333 | Ga0099824_1020962 | |||
| 1334 | Ga0099822_1011448 | |||
| 1335 | Ga0075435_100109349 | |||
| 1336 | Ga0075435_100696174 | |||
| 1337 | Ga0099794_10069546 | |||
| 1338 | Ga0099794_10173713 | |||
| 1339 | Ga0099795_10035212 | |||
| 1340 | Ga0105240_10025071 | |||
| 1341 | Ga0105240_10073053 | |||
| 1342 | Ga0105240_10313661 | |||
| 1343 | Ga0105240_10322294 | |||
| 1344 | Ga0105240_10449290 | |||
| 1345 | Ga0111539_10021821 | |||
| 1346 | Ga0111539_10082461 | |||
| 1347 | Ga0111539_10818960 | |||
| 1348 | Ga0105245_10073316 | |||
| 1349 | Ga0105245_10457520 | |||
| 1350 | Ga0105247_10308056 | |||
| 1351 | Ga0114129_10001651 | |||
| 1352 | Ga0114129_10109125 | |||
| 1353 | Ga0114129_10336055 | |||
| 1354 | Ga0114129_10783343 | |||
| 1355 | Ga0105243_10395666 | |||
| 1356 | Ga0105241_10051648 | |||
| 1357 | Ga0105241_10101531 | |||
| 1358 | Ga0105241_10289506 | |||
| 1359 | Ga0105242_10032744 | |||
| 1360 | Ga0105242_10093354 | |||
| 1361 | Ga0105242_10305092 | |||
| 1362 | Ga0105248_10006018 | |||
| 1363 | Ga0105248_10033707 | |||
| 1364 | Ga0105248_10035084 | |||
| 1365 | Ga0105248_10044373 | |||
| 1366 | Ga0105248_10089880 | |||
| 1367 | Ga0105248_10157928 | |||
| 1368 | Ga0105248_10413806 | |||
| 1369 | Ga0105248_10916811 | |||
| 1370 | Ga0105237_10017110 | |||
| 1371 | Ga0105237_10113090 | |||
| 1372 | Ga0105237_10178604 | |||
| 1373 | Ga0105237_10903388 | |||
| 1374 | Ga0105238_10075306 | |||
| 1375 | Ga0105238_10143365 | |||
| 1376 | Ga0105238_10166827 | |||
| 1377 | Ga0105238_10195097 | |||
| 1378 | Ga0105238_10291275 | |||
| 1379 | Ga0105238_10346574 | |||
| 1380 | Ga0105238_10348807 | |||
| 1381 | Ga0105238_10467326 | |||
| 1382 | Ga0105238_10647001 | |||
| 1383 | Ga0105249_10000966 | |||
| 1384 | Ga0105249_10297802 | |||
| 1385 | Ga0105239_10059018 | |||
| 1386 | Ga0105239_10106215 | |||
| 1387 | Ga0105239_10229979 | |||
| 1388 | Ga0105246_10011785 | |||
| 1389 | Ga0157371_10113120 | |||
| 1390 | Ga0157371_10614287 | |||
| 1391 | Ga0157370_10016717 | |||
| 1392 | Ga0157370_10054269 | |||
| 1393 | Ga0157370_10077887 | |||
| 1394 | Ga0157369_10004452 | |||
| 1395 | Ga0157369_10014713 | |||
| 1396 | Ga0157369_10174636 | |||
| 1397 | Ga0157374_10069050 | |||
| 1398 | Ga0157374_10534305 | |||
| 1399 | Ga0157378_10860871 | |||
| 1400 | Ga0163162_10171606 | |||
| 1401 | Ga0163162_10240868 | |||
| 1402 | Ga0163162_10655867 | |||
| 1403 | Ga0157372_10033715 | |||
| 1404 | Ga0157372_10564407 | |||
| 1405 | Ga0157375_10008454 | |||
| 1406 | Ga0157375_10391030 | |||
| 1407 | Ga0157375_11130458 | |||
| 1408 | Ga0163163_10178983 | |||
| 1409 | Ga0163163_10527199 | |||
| 1410 | Ga0157380_10000903 | |||
| 1411 | Ga0157380_10015620 | |||
| 1412 | Ga0157380_10083652 | |||
| 1413 | Ga0157377_10311151 | |||
| 1414 | Ga0157379_10038839 | |||
| 1415 | Ga0157379_10997562 | |||
| 1416 | Ga0157376_10267225 | |||
| 1417 | Ga0157376_10316652 | |||
| 1418 | Ga0157376_10377734 | |||
| 1419 | Ga0157376_10486339 | |||
| 1420 | Ga0182005_1014368 | |||
| 1421 | Ga0163161_10217294 | |||
| 1422 | Ga0206356_10788712 | |||
| 1423 | Ga0213873_10015136 | |||
| 1424 | Ga0213874_10015852 | |||
| 1425 | Ga0213876_10069114 | |||
| 1426 | Ga0213876_10092020 | |||
| 1427 | Ga0213876_10187711 | |||
| 1428 | Ga0213876_10269826 | |||
| 1429 | Ga0209026_1000002 | |||
| 1430 | Ga0209677_103245 | |||
| 1431 | Ga0209148_1000072 | |||
| 1432 | Ga0209759_1000238 | |||
| 1433 | Ga0209233_1001163 | |||
| 1434 | Ga0209233_1003251 | |||
| 1435 | Ga0209455_1000133 | |||
| 1436 | Ga0209455_1007678 | |||
| 1437 | Ga0209676_1000159 | |||
| 1438 | Ga0209025_1075848 | |||
| 1439 | Ga0209758_1002512 | |||
| 1440 | Ga0209758_1011055 | |||
| 1441 | Ga0209758_1013103 | |||
| 1442 | Ga0209050_1019353 | |||
| 1443 | Ga0207682_10018378 | |||
| 1444 | Ga0207692_10042518 | |||
| 1445 | Ga0207692_10062177 | |||
| 1446 | Ga0207692_10064809 | |||
| 1447 | Ga0207692_10103275 | |||
| 1448 | Ga0207710_10075341 | |||
| 1449 | Ga0207688_10221004 | |||
| 1450 | Ga0207680_10069321 | |||
| 1451 | Ga0207647_10028081 | |||
| 1452 | Ga0207685_10022096 | |||
| 1453 | Ga0207699_10029708 | |||
| 1454 | Ga0207699_10042426 | |||
| 1455 | Ga0207699_10060836 | |||
| 1456 | Ga0207699_10080233 | |||
| 1457 | Ga0207699_10223517 | |||
| 1458 | Ga0207645_10022003 | |||
| 1459 | Ga0207645_10089776 | |||
| 1460 | Ga0207705_10099634 | |||
| 1461 | Ga0207705_10102494 | |||
| 1462 | Ga0207705_10542103 | |||
| 1463 | Ga0207684_10273670 | |||
| 1464 | Ga0207654_10025069 | |||
| 1465 | Ga0207654_10025705 | |||
| 1466 | Ga0207707_10000706 | |||
| 1467 | Ga0207707_10002136 | |||
| 1468 | Ga0207707_10023258 | |||
| 1469 | Ga0207707_10203073 | |||
| 1470 | Ga0207695_10032870 | |||
| 1471 | Ga0207695_10101196 | |||
| 1472 | Ga0207695_10134404 | |||
| 1473 | Ga0207695_10144924 | |||
| 1474 | Ga0207695_10181939 | |||
| 1475 | Ga0207695_10263494 | |||
| 1476 | Ga0207671_10048021 | |||
| 1477 | Ga0207671_10178522 | |||
| 1478 | Ga0207693_10001853 | |||
| 1479 | Ga0207693_10024596 | |||
| 1480 | Ga0207693_10038993 | |||
| 1481 | Ga0207693_10051541 | |||
| 1482 | Ga0207693_10106698 | |||
| 1483 | Ga0207693_10495385 | |||
| 1484 | Ga0207663_10047300 | |||
| 1485 | Ga0207663_10121066 | |||
| 1486 | Ga0207660_10002043 | |||
| 1487 | Ga0207660_10086669 | |||
| 1488 | Ga0207660_10090850 | |||
| 1489 | Ga0207660_10420912 | |||
| 1490 | Ga0207662_10343747 | |||
| 1491 | Ga0207657_10002667 | |||
| 1492 | Ga0207657_10004672 | |||
| 1493 | Ga0207652_10001458 | |||
| 1494 | Ga0207652_10221012 | |||
| 1495 | Ga0207652_10590962 | |||
| 1496 | Ga0207646_10151697 | |||
| 1497 | Ga0207694_10000426 | |||
| 1498 | Ga0207694_10034603 | |||
| 1499 | Ga0207694_10181788 | |||
| 1500 | Ga0207694_10387088 | |||
| 1501 | Ga0207650_10014724 | |||
| 1502 | Ga0207650_10266069 | |||
| 1503 | Ga0207650_10413782 | |||
| 1504 | Ga0207650_10698783 | |||
| 1505 | Ga0207659_10141312 | |||
| 1506 | Ga0207659_10583129 | |||
| 1507 | Ga0207659_10727304 | |||
| 1508 | Ga0207687_10002927 | |||
| 1509 | Ga0207700_10023163 | |||
| 1510 | Ga0207700_10059333 | |||
| 1511 | Ga0207700_10136160 | |||
| 1512 | Ga0207700_10334237 | |||
| 1513 | Ga0207664_10036603 | |||
| 1514 | Ga0207664_10173182 | |||
| 1515 | Ga0207664_10269816 | |||
| 1516 | Ga0207664_10418555 | |||
| 1517 | Ga0207644_10141114 | |||
| 1518 | Ga0207644_10695877 | |||
| 1519 | Ga0207690_10050630 | |||
| 1520 | Ga0207690_10409491 | |||
| 1521 | Ga0207690_10474259 | |||
| 1522 | Ga0207686_10027871 | |||
| 1523 | Ga0207686_10039863 | |||
| 1524 | Ga0207686_10373399 | |||
| 1525 | Ga0207670_10173218 | |||
| 1526 | Ga0207669_10051994 | |||
| 1527 | Ga0207669_10494405 | |||
| 1528 | Ga0207669_10711292 | |||
| 1529 | Ga0207665_10001158 | |||
| 1530 | Ga0207665_10194274 | |||
| 1531 | Ga0207665_10215048 | |||
| 1532 | Ga0207691_10013601 | |||
| 1533 | Ga0207691_10296056 | |||
| 1534 | Ga0207711_10026007 | |||
| 1535 | Ga0207711_10045472 | |||
| 1536 | Ga0207711_10627032 | |||
| 1537 | Ga0207689_10044976 | |||
| 1538 | Ga0207689_10054965 | |||
| 1539 | Ga0207661_10001495 | |||
| 1540 | Ga0207661_10354106 | |||
| 1541 | Ga0207667_10007733 | |||
| 1542 | Ga0207667_10075757 | |||
| 1543 | Ga0207667_10137662 | |||
| 1544 | Ga0207651_10353562 | |||
| 1545 | Ga0207712_10001525 | |||
| 1546 | Ga0207712_10062382 | |||
| 1547 | Ga0207668_10152446 | |||
| 1548 | Ga0207658_10390307 | |||
| 1549 | Ga0207658_10639787 | |||
| 1550 | Ga0207703_10005220 | |||
| 1551 | Ga0207703_10273626 | |||
| 1552 | Ga0207703_10280570 | |||
| 1553 | Ga0207703_10444813 | |||
| 1554 | Ga0207639_10098359 | |||
| 1555 | Ga0207639_10364706 | |||
| 1556 | Ga0207639_10500078 | |||
| 1557 | Ga0207678_10018939 | |||
| 1558 | Ga0207708_10252605 | |||
| 1559 | Ga0207702_10047548 | |||
| 1560 | Ga0207702_10185517 | |||
| 1561 | Ga0207702_10604158 | |||
| 1562 | Ga0207641_10439960 | |||
| 1563 | Ga0207648_10039754 | |||
| 1564 | Ga0207648_10082512 | |||
| 1565 | Ga0207676_10035526 | |||
| 1566 | Ga0207674_10046693 | |||
| 1567 | Ga0207674_10063123 | |||
| 1568 | Ga0207674_10115730 | |||
| 1569 | Ga0207674_10138200 | |||
| 1570 | Ga0207674_10505399 | |||
| 1571 | Ga0207675_100576205 | |||
| 1572 | Ga0207683_10140063 | |||
| 1573 | Ga0207698_10049902 | |||
| 1574 | Ga0209389_1000034 | |||
| 1575 | Ga0209589_1000038 | |||
| 1576 | Ga0209589_1000055 | |||
| 1577 | Ga0209489_100023 | |||
| 1578 | Ga0209489_100128 | |||
| 1579 | Ga0209700_100137 | |||
| 1580 | Ga0209588_1018216 | |||
| 1581 | Ga0209588_1053981 | |||
| 1582 | Ga0209813_10041459 | |||
| 1583 | Ga0209813_10117252 | |||
| 1584 | Ga0207428_10327690 | |||
| 1585 | Ga0268266_10059855 | |||
| 1586 | Ga0268266_10256732 | |||
| 1587 | Ga0268266_10336109 | |||
| 1588 | Ga0268266_10338317 | |||
| 1589 | Ga0268265_11031113 | |||
| 1590 | Ga0268264_10044627 | |||
| 1591 | Ga0265318_10046685 | |||
| 1592 | Ga0265338_10078256 | |||
| 1593 | Ga0265325_10005877 | |||
| 1594 | Ga0265325_10140940 | |||
| 1595 | Ga0265325_10145294 | |||
| 1596 | Ga0265329_10054334 | |||
| 1597 | Ga0265340_10001703 | |||
| 1598 | Ga0265340_10031016 | |||
| 1599 | Ga0265339_10000281 | |||
| 1600 | Ga0265316_10002875 | |||
| 1601 | Ga0265316_10143679 | |||
| 1602 | Ga0307408_100000394 | |||
| 1603 | Ga0307408_100005603 | |||
| 1604 | Ga0265313_10024804 | |||
| 1605 | Ga0307508_10109636 | |||
| 1606 | Ga0316575_10184744 | |||
| 1607 | Ga0265314_10094954 | |||
| 1608 | Ga0265314_10097023 | |||
| 1609 | Ga0265342_10271966 | |||
| 1610 | Ga0316576_10206791 | |||
| 1611 | Ga0316578_10018002 | |||
| 1612 | Ga0316578_10033662 | |||
| 1613 | Ga0316578_10102161 | |||
| 1614 | Ga0307406_10001502 | |||
| 1615 | Ga0307414_10192732 | |||
| 1616 | Ga0307414_10459121 | |||
| 1617 | Ga0307510_10041241 | |||
| 1618 | Ga0316215_1000933 | |||
| 1619 | Ga0373952_0037037 | |||
| 1620 | Ga0373936_0129841 | |||
| 1621 | Ga0373939_0104127 | |||
| 1622 | Ga0373953_0034219 | |||
| 1623 | Ga0373953_0074970 | |||
| 1624 | Ga0373954_0078468 | |||
| 1625 | Ga0373955_0023876 | |||
| 1626 | Ga0373955_0045640 | |||
| 1627 | Ga0373924_0179132 | |||
| 1628 | Ga0373931_0036143 | |||
| 1629 | Ga0373935_0097602 | |||
| 1630 | Ga0373935_0177872 | |||
| 1631 | Ga0373927_0018419 | |||
| 1632 | Ga0373927_0132297 | |||
| 1633 | Ga0373927_0253162 | |||
| 1634 | Ga0373933_0000105 | |||
| 1635 | Ga0373933_0005822 | |||
| 1636 | Ga0373933_0044569 | |||
| 1637 | Ga0373933_0241193 | |||
| 1638 | Ga0373947_0021248 | |||
| 1639 | Ga0373947_0235245 | |||
| 1640 | Ga0373937_0006367 | |||
| 1641 | Ga0373937_0020230 | |||
| 1642 | Ga0373937_0026584 | |||
| 1643 | Ga0373937_0036084 | |||
| 1644 | Ga0373937_0254810 | |||
| 1645 | Ga0373937_0344661 | |||
| 1646 | Ga0316582_0174477 | |||
| 1647 | Ga0316582_0362958 | |||
| 1648 | Ga0316584_0045589 | |||
| 1649 | Ga0373925_0703248 | |||
| 1650 | Ga0395899_0161981 | |||
| 1651 | Ga0395900_0036754 | |||
| 1652 | Ga0395898_0012482 | |||
| 1653 | Ga0395898_0437813 | |||
| 1654 | Ga0395905_0222072 | |||
| 1655 | Ga0395905_0258847 | |||
| 1656 | Ga0436364_0257495 | |||
| 1657 | Ga0436364_0356065 | |||
| 1658 | Ga0395901_0009035 | |||
| 1659 | Ga0395901_0046917 | |||
| 1660 | Ga0400483_082903 | |||
| 1661 | Ga0436365_0115993 | |||
| 1662 | Ga0436365_0219669 | |||
| 1663 | Ga0436365_0472623 | |||
| 1664 | Ga0436365_0507057 | |||
| 1665 | Ga0436365_0621927 | |||
| 1666 | Ga0436365_0699198 | |||
| 1667 | Ga0436365_1885077 | |||
| 1668 | Ga0436360_0068302 | |||
| 1669 | Ga0436361_0885416 | |||
| 1670 | Ga0436363_1200244 | |||
| 1671 | Ga0436363_1323175 | |||
| 1672 | Ga0436362_0387585 | |||
| 1673 | Ga0436362_0576405 | |||
| 1674 | Ga0439453_0001364 | |||
| 1675 | Ga0439453_0045008 | |||
| 1676 | Ga0439465_0095152 | |||
| 1677 | Ga0439465_0110872 | |||
| 1678 | Ga0451845_0689861 | |||
| 1679 | Ga0439443_013683 | |||
| 1680 | Ga0450891_003705 | |||
| 1681 | Ga0439435_0005297 | |||
| 1682 | Ga0439435_0006166 | |||
| 1683 | Ga0439460_0034968 | |||
| 1684 | Ga0439460_0139946 | |||
| 1685 | Ga0466969_0017044 | |||
| 1686 | Ga0466972_0035561 | |||
| 1687 | Ga0466966_0048180 | |||
| 1688 | Ga0466963_0065235 | |||
| 1689 | Ga0466963_0126272 | |||
| 1690 | Ga0466964_0118568 | |||
| 1691 | Ga0466971_0110697 | |||
| 1692 | Ga0466970_0150007 | |||
| 1693 | Ga0466960_0102594 | |||
| 1694 | Ga0466960_0171288 | |||
| 1695 | Ga0466959_0033654 | |||
| 1696 | Ga0466959_0035729 | |||
| 1697 | Ga0466967_0052523 | |||
| 1698 | Ga0466967_0122587 | |||
| 1699 | Ga0466967_0606946 | |||
| 1700 | Ga0495592_0157182 | |||
| 1701 | Ga0495590_0092510 | |||
| 1702 | Ga0495638_0025833 | |||
| 1703 | Ga0495641_0137318 | |||
| 1704 | Ga0495651_0096787 | |||
| 1705 | Ga0495653_0071960 | |||
| 1706 | Ga0495580_0009473 | |||
| 1707 | Ga0495580_0198447 | |||
| 1708 | Ga0495639_0148919 | |||
| 1709 | Ga0495639_0209217 | |||
| 1710 | Ga0495664_0120799 | |||
| 1711 | Ga0495664_0195298 | |||
| 1712 | Ga0495606_0133981 | |||
| 1713 | Ga0495608_0123244 | |||
| 1714 | Ga0495618_0046607 | |||
| 1715 | Ga0495618_0217691 | |||
| 1716 | Ga0495628_0133081 | |||
| 1717 | Ga0495628_0347102 | |||
| 1718 | Ga0495628_0556398 | |||
| 1719 | Ga0495628_0601303 | |||
| 1720 | Ga0495666_0051861 | |||
| 1721 | Ga0495652_0095736 | |||
| 1722 | Ga0495652_0107274 | |||
| 1723 | Ga0495652_0140888 | |||
| 1724 | Ga0495652_0511413 | |||
| 1725 | Ga0495654_0226549 | |||
| 1726 | Ga0495665_0103492 | |||
| 1727 | Ga0495640_0131317 | |||
| 1728 | Ga0495640_0317776 | |||
| 1729 | Ga0495586_0140476 | |||
| 1730 | Ga0495586_0171847 | |||
| 1731 | Ga0495586_0432528 | |||
| 1732 | Ga0495587_0038304 | |||
| 1733 | Ga0495587_0058935 | |||
| 1734 | Ga0495587_0088937 | |||
| 1735 | Ga0495645_0109202 | |||
| 1736 | Ga0495645_0383108 | |||
| 1737 | Ga0495667_0062621 | |||
| 1738 | Ga0495667_0067195 | |||
| 1739 | Ga0495667_0153065 | |||
| 1740 | Ga0495634_0068709 | |||
| 1741 | Ga0495634_0423584 | |||
| 1742 | Ga0495635_0020974 | |||
| 1743 | Ga0495599_0039931 | |||
| 1744 | Ga0495599_0301832 | |||
| 1745 | Ga0495646_0155575 | |||
| 1746 | Ga0495658_0241701 | |||
| 1747 | Ga0495669_0001461 | |||
| 1748 | Ga0495624_0199865 | |||
| 1749 | Ga0495600_0056746 | |||
| 1750 | Ga0495581_0129225 | |||
| 1751 | Ga0495604_0085845 | |||
| 1752 | Ga0495604_0142810 | |||
| 1753 | Ga0495674_0175836 | |||
| 1754 | Ga0495674_0178589 | |||
| 1755 | Ga0495674_0246562 | |||
| 1756 | Ga0495672_0222970 | |||
| 1757 | Ga0495676_0111898 | |||
| 1758 | Ga0495680_0033486 | |||
| 1759 | Ga0495680_0095921 | |||
| 1760 | Ga0495680_0242207 | |||
| 1761 | Ga0495683_0047183 | |||
| 1762 | Ga0495675_0033866 | |||
| 1763 | Ga0495673_0017803 | |||
| 1764 | Ga0495673_0158890 | |||
| 1765 | Ga0495684_0214045 | |||
| 1766 | Ga0495684_0428192 | |||
| 1767 | Ga0495686_0170306 | |||
| 1768 | Ga0495602_0014932 | |||
| 1769 | Ga0495602_0290933 | |||
| 1770 | Ga0496100_0020431 | |||
| 1771 | Ga0496100_0116399 | |||
| 1772 | Ga0496101_0023314 | |||
| 1773 | Ga0496101_0096353 | |||
| 1774 | Ga0496102_0563932 | |||
| 1775 | Ga0496103_0085541 | |||
| 1776 | Ga0496104_0341923 | |||
| 1777 | Ga0496105_0374774 | |||
| 1778 | Ga0496106_0055368 | |||
| 1779 | Ga0496106_0657955 | |||
| 1780 | Ga0496107_0331096 | |||
| 1781 | Ga0496108_0005061 | |||
| 1782 | Ga0496108_0903180 | |||
| 1783 | Ga0496109_0003617 | |||
| 1784 | Ga0496109_0021676 | |||
| 1785 | Ga0496110_0001002 | |||
| 1786 | Ga0496110_0080492 | |||
| 1787 | Ga0496110_0361839 | |||
| 1788 | Ga0496110_0699405 | |||
| 1789 | Ga0496111_0009201 | |||
| 1790 | Ga0496112_0000029 | |||
| 1791 | Ga0496112_0053753 | |||
| 1792 | Ga0496112_0077956 | |||
| 1793 | Ga0496113_0008012 | |||
| 1794 | Ga0496114_0002919 | |||
| 1795 | Ga0496114_0074669 | |||
| 1796 | Ga0496114_0306662 | |||
| 1797 | Ga0496115_0065909 | |||
| 1798 | Ga0496117_0104508 | |||
| 1799 | Ga0496118_0023875 | |||
| 1800 | Ga0496119_0018058 | |||
| 1801 | Ga0496119_0072006 | |||
| 1802 | Ga0496119_0097459 | |||
| 1803 | Ga0496120_0010285 | |||
| 1804 | Ga0496121_0002330 | |||
| 1805 | Ga0496121_0003220 | |||
| 1806 | Ga0496121_0007746 | |||
| 1807 | Ga0496121_0078537 | |||
| 1808 | Ga0496121_0085327 | |||
| 1809 | Ga0496121_0096049 | |||
| 1810 | Ga0496122_0006145 | |||
| 1811 | Ga0496123_0020508 | |||
| 1812 | Ga0496126_0026588 | |||
| 1813 | Ga0496126_0028761 | |||
| 1814 | Ga0496126_0045009 | |||
| 1815 | Ga0496126_0045843 | |||
| 1816 | Ga0496126_0071815 | |||
| 1817 | Ga0496126_0075172 | |||
| 1818 | Ga0496126_0240584 | |||
| 1819 | Ga0496126_0415817 | |||
| 1820 | Ga0501031_0002222 | |||
| 1821 | Ga0501031_0174810 | |||
| 1822 | Ga0501031_0199371 | |||
| 1823 | Ga0501032_0000312 | |||
| 1824 | Ga0501032_0001543 | |||
| 1825 | Ga0501032_0107164 | |||
| 1826 | Ga0501033_0000286 | |||
| 1827 | Ga0501033_0005202 | |||
| 1828 | Ga0501033_0039481 | |||
| 1829 | Ga0501033_0052666 | |||
| 1830 | Ga0501033_0067066 | |||
| 1831 | Ga0501033_0193124 | |||
| 1832 | Ga0501034_0003164 | |||
| 1833 | Ga0501034_0003735 | |||
| 1834 | Ga0501034_0013285 | |||
| 1835 | Ga0501034_0055187 | |||
| 1836 | Ga0501036_0000310 | |||
| 1837 | Ga0501036_0002522 | |||
| 1838 | Ga0501036_0225245 | |||
| 1839 | Ga0501037_0000118 | |||
| 1840 | Ga0501037_0003508 | |||
| 1841 | Ga0501037_0046610 | |||
| 1842 | Ga0501037_0114507 | |||
| 1843 | Ga0501038_0000248 | |||
| 1844 | Ga0501038_0001954 | |||
| 1845 | Ga0501038_0045196 | |||
| 1846 | Ga0501038_0084361 | |||
| 1847 | Ga0501038_0246566 | |||
| 1848 | Ga0501039_0000048 | |||
| 1849 | Ga0501039_0001321 | |||
| 1850 | Ga0501039_0179849 | |||
| 1851 | Ga0501041_0106737 | |||
| 1852 | Ga0501042_0129952 | |||
| 1853 | Ga0501043_0001719 | |||
| 1854 | Ga0501043_0006987 | |||
| 1855 | Ga0501043_0122966 | |||
| 1856 | Ga0501043_0253294 | |||
| 1857 | Ga0501046_0013782 | |||
| 1858 | Ga0501046_0104587 | |||
| 1859 | Ga0501046_0117272 | |||
| 1860 | Ga0501046_0411450 | |||
| 1861 | Ga0501047_0003356 | |||
| 1862 | Ga0501047_0007161 | |||
| 1863 | Ga0501047_0058375 | |||
| 1864 | Ga0501047_0063735 | |||
| 1865 | Ga0501047_0088476 | |||
| 1866 | Ga0501047_0205420 | |||
| 1867 | Ga0501067_0172216 | |||
| 1868 | Ga0501068_0018033 | |||
| 1869 | Ga0501068_0063992 | |||
| 1870 | Ga0501069_0204331 | |||
| 1871 | Ga0501070_0003393 | |||
| 1872 | Ga0501070_0010716 | |||
| 1873 | Ga0501070_0028481 | |||
| 1874 | Ga0501070_0035001 | |||
| 1875 | Ga0501070_0078249 | |||
| 1876 | Ga0501070_0109124 | |||
| 1877 | Ga0501071_0053840 | |||
| 1878 | Ga0501071_0375349 | |||
| 1879 | Ga0501073_0066345 | |||
| 1880 | Ga0501073_0137288 | |||
| 1881 | Ga0501073_0186799 | |||
| 1882 | Ga0501074_0074802 | |||
| 1883 | Ga0501074_0149270 | |||
| 1884 | Ga0501075_0012911 | |||
| 1885 | Ga0501076_0042884 | |||
| 1886 | Ga0501076_0381836 | |||
| 1887 | Ga0501079_0156857 | |||
| 1888 | Ga0501079_0495317 | |||
| 1889 | Ga0501080_0026461 | |||
| 1890 | Ga0501080_0050954 | |||
| 1891 | Ga0501080_0065807 | |||
| 1892 | Ga0501080_0165418 | |||
| 1893 | Ga0501081_0225242 | |||
| 1894 | Ga0501083_0021184 | |||
| 1895 | Ga0501083_0056277 | |||
| 1896 | Ga0501083_0288329 | |||
| 1897 | Ga0501035_0000118 | |||
| 1898 | Ga0501035_0000516 | |||
| 1899 | Ga0501035_0002724 | |||
| 1900 | Ga0501035_0063754 | |||
| 1901 | Ga0501035_0096310 | |||
| 1902 | Ga0501035_0148828 | |||
| 1903 | Ga0501044_0004188 | |||
| 1904 | Ga0501044_0012550 | |||
| 1905 | Ga0501044_0016160 | |||
| 1906 | Ga0501044_0026844 | |||
| 1907 | Ga0501044_0130412 | |||
| 1908 | Ga0501044_0138273 | |||
| 1909 | Ga0501044_0217450 | |||
| 1910 | Ga0501045_0025321 | |||
| 1911 | nmdc:mga03683_45827_c1 | |||
| 1912 | nmdc:mga03n38_164088_c1 | |||
| 1913 | nmdc:mga03n38_200075_c1 | |||
| 1914 | nmdc:mga00v17_13000_c1 | |||
| 1915 | nmdc:mga0yw44_12835_c1 | |||
| 1916 | nmdc:mga0yw44_205452_c1 | |||
| 1917 | nmdc:mga0yw44_84561_c1 | |||
| 1918 | nmdc:mga0yw44_8644_c1 | |||
| 1919 | nmdc:mga0k408_147178_c1 | |||
| 1920 | nmdc:mga0k408_36688_c1 | |||
| 1921 | nmdc:mga06z11_12988_c1 | |||
| 1922 | nmdc:mga06z11_148777_c1 | |||
| 1923 | nmdc:mga06z11_328747_c1 | |||
| 1924 | nmdc:mga06z11_37634_c1 | |||
| 1925 | nmdc:mga06z11_61221_c2 | |||
| 1926 | nmdc:mga06z11_94407_c1 | |||
| 1927 | nmdc:mga07m45_140461_c1 | |||
| 1928 | nmdc:mga07m45_252996_c1 | |||
| 1929 | nmdc:mga05p37_2215_c1 | |||
| 1930 | nmdc:mga05p37_552998_c1 | |||
| 1931 | nmdc:mga05p37_662574_c1 | |||
| 1932 | nmdc:mga09592_261656_c1 | |||
| 1933 | nmdc:mga0qj67_212290_c1 | |||
| 1934 | nmdc:mga0qj67_221_c1 | |||
| 1935 | nmdc:mga0qj67_494106_c1 | |||
| 1936 | nmdc:mga06r32_54301_c1 | |||
| 1937 | nmdc:mga06r32_76282_c1 | |||
| 1938 | nmdc:mga0n895_19634_c1 | |||
| 1939 | nmdc:mga0rr50_59329_c1 | |||
| 1940 | nmdc:mga08x19_21652_c1 | |||
| 1941 | nmdc:mga08x19_249883_c1 | |||
| 1942 | nmdc:mga08x19_37584_c1 | |||
| 1943 | nmdc:mga08x19_608564_c1 | |||
| 1944 | nmdc:mga0a205_100676_c1 | |||
| 1945 | nmdc:mga0a205_23024_c1 | |||
| 1946 | nmdc:mga0sz30_3779_c1 | |||
| 1947 | Ga0495601_0058391 | |||
| 1948 | Ga0495601_0142710 | |||
| 1949 | Ga0495601_0176034 | |||
| 1950 | Ga0500610_0060134 | |||
| 1951 | Ga0500635_0009468 | |||
| 1952 | Ga0495655_0021216 | |||
| 1953 | Ga0495595_0079907 | |||
| 1954 | Ga0495619_0006785 | |||
| 1955 | Ga0495619_0011552 | |||
| 1956 | Ga0495619_0012982 | |||
| 1957 | Ga0495619_0191913 | |||
| 1958 | Ga0495619_0256127 | |||
| 1959 | Ga0495619_0324181 | |||
| 1960 | Ga0495619_0565934 | |||
| 1961 | Ga0500643_010040 | |||
| 1962 | Ga0500643_012614 | |||
| 1963 | Ga0500644_0004361 | |||
| 1964 | Ga0500651_0051806 | |||
| 1965 | Ga0500566_0001659 | |||
| 1966 | Ga0500566_0008714 | |||
| 1967 | Ga0500566_0020899 | |||
| 1968 | Ga0500640_018114 | |||
| 1969 | Ga0500641_0008450 | |||
| 1970 | Ga0500650_0252984 | |||
| 1971 | Ga0500554_012174 | |||
| 1972 | Ga0500556_0000956 | |||
| 1973 | Ga0500572_000255 | |||
| 1974 | Ga0500572_001715 | |||
| 1975 | Ga0500594_0023611 | |||
| 1976 | Ga0500595_000029 | |||
| 1977 | Ga0500595_003805 | |||
| 1978 | Ga0500595_011603 | |||
| 1979 | Ga0500595_013783 | |||
| 1980 | Ga0500595_044037 | |||
| 1981 | Ga0500595_059184 | |||
| 1982 | Ga0500608_033992 | |||
| 1983 | Ga0500614_004614 | |||
| 1984 | Ga0500642_0014749 | |||
| 1985 | Ga0500652_005799 | |||
| 1986 | Ga0500652_135207 | |||
| 1987 | Ga0500559_0000299 | |||
| 1988 | Ga0500559_0004223 | |||
| 1989 | Ga0500568_0000035 | |||
| 1990 | Ga0500568_0045993 | |||
| 1991 | Ga0500603_002486 | |||
| 1992 | Ga0500603_007058 | |||
| 1993 | Ga0500603_017879 | |||
| 1994 | Ga0500616_0000006 | |||
| 1995 | Ga0500616_0000038 | |||
| 1996 | Ga0500620_008801 | |||
| 1997 | Ga0500622_0005458 | |||
| 1998 | Ga0500622_0028257 | |||
| 1999 | Ga0500622_0067368 | |||
| 2000 | Ga0500627_0097927 | |||
| 2001 | Ga0500630_008925 | |||
| 2002 | Ga0500638_023336 | |||
| 2003 | Ga0500638_030769 | |||
| 2004 | Ga0500639_000477 | |||
| 2005 | Ga0500636_0263892 | |||
| 2006 | Ga0500637_0002325 | |||
| 2007 | Ga0500637_0016108 | |||
| 2008 | Ga0500576_033923 | |||
| 2009 | Ga0500645_000290 | |||
| 2010 | Ga0500645_005569 | |||
| 2011 | Ga0500596_000406 | |||
| 2012 | Ga0501084_0114989 | |||
| 2013 | Ga0500661_003768 | |||
| 2014 | Ga0501082_0087994 | |||
| 2015 | Ga0501082_0185310 | |||
| 2016 | Ga0501082_0212855 | |||
| 2017 | Ga0501082_0339302 | |||
| 2018 | Ga0530510_0144391 | |||
| 2019 | 2503202214 | |||
| 2020 | 2509117019 | |||
| 2021 | 2509140637 | |||
| 2022 | 2509370709 | |||
| 2023 | 2509396862 | |||
| 2024 | 2510317500 | |||
| 2025 | 2512930887 | |||
| 2026 | 2512958613 | |||
| 2027 | 2513609925 | |||
| 2028 | 2514034972 | |||
| 2029 | 2514418934 | |||
| 2030 | 2514589371 | |||
| 2031 | 2588516567 | |||
| 2032 | 2597814095 | |||
| 2033 | 2599938077 | |||
| 2034 | 2643989390 | |||
| 2035 | 2644152962 | |||
| 2036 | 2688599424 | |||
| 2037 | 2694632210 | |||
| 2038 | 2694634382 | |||
| 2039 | 2723576384 | |||
| 2040 | 2723842321 | |||
| 2041 | 2738716120 | |||
| 2042 | 2756675899 | |||
| 2043 | 2792748537 | |||
| 2044 | 2841740015 | |||
| 2045 | 2844006439 | |||
| 2046 | 2844014702 | |||
| 2047 | 2847672505 | |||
| 2048 | 2856315520 | |||
| 2049 | 2856325846 | |||
| 2050 | 2856328976 | |||
| 2051 | 2856340026 | |||
| 2052 | 2856343182 | |||
| 2053 | 2856354497 | |||
| 2054 | 2856363299 | |||
| 2055 | 2856368821 | |||
| 2056 | 2857350207 | |||
| 2057 | 2857368576 | |||
| 2058 | 2869165264 | |||
| 2059 | 2869174789 | |||
| 2060 | 2869240792 | |||
| 2061 | 2869249563 | |||
| 2062 | 2869252189 | |||
| 2063 | 2869262533 | |||
| 2064 | 2869268000 | |||
| 2065 | 2869278626 | |||
| 2066 | 2869291316 | |||
| 2067 | 2871433596 | |||
| 2068 | 2871441738 | |||
| 2069 | 2871458147 | |||
| 2070 | 2871466359 | |||
| 2071 | 2871473865 | |||
| 2072 | 2871475309 | |||
| 2073 | 2871484947 | |||
| 2074 | 2871495782 | |||
| 2075 | 2871502990 | |||
| 2076 | 2874103483 | |||
| 2077 | 2874111774 | |||
| 2078 | 2874117825 | |||
| 2079 | 2874125997 | |||
| 2080 | 2874132040 | |||
| 2081 | 2874145212 | |||
| 2082 | 2874153197 | |||
| 2083 | 2874160462 | |||
| 2084 | 2874167276 | |||
| 2085 | 2874176202 | |||
| 2086 | 2874616504 | |||
| 2087 | 2876365441 | |||
| 2088 | 2876386079 | |||
| 2089 | 2876394971 | |||
| 2090 | 2876405863 | |||
| 2091 | 2876407655 | |||
| 2092 | 2876419488 | |||
| 2093 | 2876426508 | |||
| 2094 | 2878037193 | |||
| 2095 | 2878743409 | |||
| 2096 | 2878751207 | |||
| 2097 | 2878753419 | |||
| 2098 | 2878766879 | |||
| 2099 | 2878774077 | |||
| 2100 | 2878774794 | |||
| 2101 | 2878786450 | |||
| 2102 | 2878796839 | |||
| 2103 | 2881152865 | |||
| 2104 | 2881156358 | |||
| 2105 | 2881168310 | |||
| 2106 | 2881860674 | |||
| 2107 | 2881863389 | |||
| 2108 | 2882637878 | |||
| 2109 | 2882918488 | |||
| 2110 | 2885310306 | |||
| 2111 | 2885317118 | |||
| 2112 | 2885319195 | |||
| 2113 | 2885329306 | |||
| 2114 | 2885339137 | |||
| 2115 | 2885350761 | |||
| 2116 | 2885380852 | |||
| 2117 | 2888340142 | |||
| 2118 | 2888347467 | |||
| 2119 | 2888356551 | |||
| 2120 | 2889011458 | |||
| 2121 | 2889016812 | |||
| 2122 | 2903455607 | |||
| 2123 | 2903495274 | |||
| 2124 | 2903501705 | |||
| 2125 | 2903513687 | |||
| 2126 | 2903522797 | |||
| 2127 | 2903532987 | |||
| 2128 | 2903548179 | |||
| 2129 | 2904661602 | |||
| 2130 | 2904692035 | |||
| 2131 | 2906313148 | |||
| 2132 | 2906325859 | |||
| 2133 | 2906331885 | |||
| 2134 | 2906360990 | |||
| 2135 | 2906365864 | |||
| 2136 | 2906370795 | |||
| 2137 | 2906391321 | |||
| 2138 | 2906394524 | |||
| 2139 | 2906402998 | |||
| 2140 | 2906412644 | |||
| 2141 | 2906415657 | |||
| 2142 | 2906429386 | |||
| 2143 | 2908746533 | |||
| 2144 | 2908757314 | |||
| 2145 | 2922134506 | |||
| 2146 | 2922163040 | |||
| 2147 | 2922177105 | |||
| 2148 | 2922181129 | |||
| 2149 | 2922187576 | |||
| 2150 | 2924710530 | |||
| 2151 | 2924732086 | |||
| 2152 | 2924736249 | |||
| 2153 | 2924747242 | |||
| 2154 | 2924750849 | |||
| 2155 | 2924759740 | |||
| 2156 | 2924768981 | |||
| 2157 | 2924781221 | |||
| 2158 | 2924789666 | |||
| 2159 | 2935632847 | |||
| 2160 | 2937820701 | |||
| 2161 | 2937827301 | |||
| 2162 | 2937837770 | |||
| 2163 | 2937849134 | |||
| 2164 | 2937866851 | |||
| 2165 | 2937869017 | |||
| 2166 | 2937878982 | |||
| 2167 | 2937895569 | |||
| 2168 | 2937975272 | |||
| 2169 | 2938002004 | |||
| 2170 | 2938017392 | |||
| 2171 | 2939672808 | |||
| 2172 | 2941508488 | |||
| 2173 | 2941516319 | |||
| 2174 | 2941524665 | |||
| 2175 | 2952254677 | |||
| 2176 | 2958034742 | |||
| 2177 | 2958043130 | |||
| 2178 | 2958066990 | |||
| 2179 | 2958077509 | |||
| 2180 | 2958086156 | |||
| 2181 | 2958092415 | |||
| 2182 | 2958103053 | |||
| 2183 | 2958121501 | |||
| 2184 | 2958123717 | |||
| 2185 | 2958135716 | |||
| 2186 | 2958141789 | |||
| 2187 | 2958145593 | |||
| 2188 | 2958162603 | |||
| 2189 | 2958172058 | |||
| 2190 | 2958177823 | |||
| 2191 | 2958185207 | |||
| 2192 | 2961083474 | |||
| 2193 | 2961116755 | |||
| 2194 | 2961132800 | |||
| 2195 | 2961141162 | |||
| 2196 | 2961170505 | |||
| 2197 | 2961177863 | |||
| 2198 | 2961187358 | |||
| 2199 | 2963648338 | |||
| 2200 | 2965025252 | |||
| 2201 | 2965029525 | |||
| 2202 | 2965037238 | |||
| 2203 | 2965043381 | |||
| 2204 | 2965052370 | |||
| 2205 | 2965065780 | |||
| 2206 | 2965095798 | |||
| 2207 | 2965103067 | |||
| 2208 | 2968003130 | |||
| 2209 | 2968003956 | |||
| 2210 | 2968017850 | |||
| 2211 | 2968084851 | |||
| 2212 | 2968095321 | |||
| 2213 | 2968103129 | |||
| 2214 | 2968112662 | |||
| 2215 | 2968123104 | |||
| 2216 | 2968128561 | |||
| 2217 | 2968144975 | |||
| 2218 | 2968178891 | |||
| 2219 | 2970471975 | |||
| 2220 | 2970495821 | |||
| 2221 | 2970510539 | |||
| 2222 | 2970512671 | |||
| 2223 | 2970531713 | |||
| 2224 | 2970542133 | |||
| 2225 | 2970550037 | |||
| 2226 | 2970561735 | |||
| 2227 | 2970593222 | |||
| 2228 | 2970621111 | |||
| 2229 | 2970632268 | |||
| 2230 | 2977822641 | |||
| 2231 | 2977833372 | |||
| 2232 | 2977848999 | |||
| 2233 | 2977858093 | |||
| 2234 | 2977861628 | |||
| 2235 | 2977872514 | |||
| 2236 | 2977873520 | |||
| 2237 | 2977906501 | |||
| 2238 | 2977914146 | |||
| 2239 | 2977919572 | |||
| 2240 | 2977923087 | |||
| 2241 | 2977941406 | |||
| 2242 | 2977948247 | |||
| 2243 | 2977991877 | |||
| 2244 | 2979713358 | |||
| 2245 | 2979769314 | |||
| 2246 | 2979773494 | |||
| 2247 | 2979784879 | |||
| 2248 | 2979795513 | |||
| 2249 | 2979815413 | |||
| 2250 | 2987637395 | |||
| 2251 | 2987653983 | |||
| 2252 | 2987666745 | |||
| 2253 | 2987670659 | |||
| 2254 | 2987676196 | |||
| 2255 | 2996314777 | |||
| 2256 | 2996345397 | |||
| 2257 | 2996350908 | |||
| 2258 | 2996392567 | |||
| 2259 | 3000138489 | |||
| 2260 | 3004169588 | |||
| 2261 | 3004195748 | |||
| 2262 | 3004197932 | |||
| 2263 | 3004206208 | |||
| 2264 | 3004211683 | |||
| 2265 | 3004218930 | |||
| 2266 | 3004238893 | |||
| 2267 | 3004242976 | |||
| 2268 | 3004254293 | |||
| 2269 | 3004275201 | |||
| 2270 | 3004277606 | |||
| 2271 | 3004341002 | |||
| 2272 | 637073933 | |||
| 2273 | 649873928 | |||
| 2274 | 8004305512 | |||
| 2275 | 8004313106 | |||
| 2276 | 8004363790 | |||
| 2277 | 8004374991 | |||
| 2278 | 8004394128 | |||
| 2279 | 8004449876 | |||
| 2280 | 8004634074 | |||
| 2281 | 8004646674 | |||
| 2282 | 8004713234 | |||
| 2283 | 8004719405 | |||
| 2284 | 8004733261 | |||
| 2285 | 8006996938 | |||
| 2286 | 8055621529 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9433 | 2 | 220 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9339 | 2 | 231 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9263 | 2 | 231 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9261 | 2 | 231 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9244 | 2 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9542 | 1 | 228 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9535 | 1 | 231 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9495 | 1 | 231 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9441 | 2 | 215 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9382 | 1 | 228 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435BCD9-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 1.002 | 1 | 201 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A5B8KZZ6-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 1 | 1 | 231 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A3S2BK75-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 1 | 30 | 231 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A7Y2Q5H1-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 0.9997 | 1 | 231 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A1H8U584-F1-model_v4 | LIV-I protein F | 0.9994 | 1 | 231 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |