F490740

General Info

Members Datasets Scaffolds Average Seq Length
1143 688 2286 230

Family's Representative Sequence

Representative Sequence 3300012505|Ga0157339_1011728|Ga0157339_10117281
Length 229
Sequence VLTVSALNQYYGGSHTLRDVAFEAPSGAVTAILGRNGVGKTTLLRCLAGLLAARSGTIRFEGTDVTRLPPHERARLGLGYVPQGREIFPRLTVLENLRLGLATRPARSAIPDRVFEMFPVLKDMVHRRGGDLSGGQQQQLAIGRALVMRPKLLVLDEPTEGIQPSIIKDIGRAISYLRNLGSIAIVLVEQYLDFACELGDSFAVMDRGAVKSCIPARPPTWTCPRCAAI

Samples

Sample ID Description Type Environment
1 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
94 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
197 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
254 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
255 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
256 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
257 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
260 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
261 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
383 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
390 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
391 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
392 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
393 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
394 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
395 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
396 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
397 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
398 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
399 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
400 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
401 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
402 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
410 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
411 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
412 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
418 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
419 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
422 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
423 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
424 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
425 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
426 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
427 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
428 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
429 2512875024
430 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
431 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
432 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
433 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
434 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
435 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
436 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
437 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
438 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
439 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
440 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
441 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
442 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
443 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
444 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
445 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
446 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
447 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
448 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
449 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
450 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
451 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
452 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
453 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
454 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
455 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
456 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
457 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
458 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
459 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
460 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
461 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
462 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
463 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
464 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
465 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
466 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
467 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
468 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
469 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
470 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
471 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
472 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
473 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
474 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
475 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
476 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
477 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
478 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
479 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
480 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
481 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
482 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
483 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
484 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
485 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
486 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
487 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
488 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
489 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
490 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
491 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
492 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
493 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
494 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
495 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
496 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
497 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
498 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
499 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
500 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
501 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
502 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
503 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
504 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
505 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
506 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
507 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
508 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
509 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
510 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
511 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
512 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
513 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
514 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
515 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
516 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
517 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
518 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
519 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
520 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
521 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
522 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
523 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
524 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
525 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
526 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
527 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
528 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
529 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
530 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
531 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
532 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
533 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
534 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
535 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
536 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
537 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
538 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
539 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
540 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
541 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
542 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
543 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
544 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
545 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
546 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
547 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
548 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
549 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
550 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
551 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
552 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
553 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
554 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
555 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
556 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
557 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
558 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
559 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
560 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
561 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
562 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
563 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
564 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
565 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
566 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
567 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
568 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
569 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
570 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
571 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
572 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
573 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
574 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
575 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
576 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
577 2952252522 Salinicola sp. DM10 Isolate Unclassified
578 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
579 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
580 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
581 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
582 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
583 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
584 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
585 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
586 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
587 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
588 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
589 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
590 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
591 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
592 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
593 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
594 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
595 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
596 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
597 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
598 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
599 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
600 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
601 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
602 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
603 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
604 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
605 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
606 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
607 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
608 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
609 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
610 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
611 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
612 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
613 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
614 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
615 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
616 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
617 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
618 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
619 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
620 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
621 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
622 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
623 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
624 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
625 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
626 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
627 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
628 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
629 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
630 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
631 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
632 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
633 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
634 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
635 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
636 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
637 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
638 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
639 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
640 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
641 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
642 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
643 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
644 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
645 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
646 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
647 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
648 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
649 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
650 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
651 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
652 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
653 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
654 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
655 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
656 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
657 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
658 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
659 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
660 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
661 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
662 3004167301 Mesorhizobium loti 582 Isolate Unclassified
663 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
664 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
665 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
666 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
667 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
668 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
669 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
670 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
671 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
672 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
673 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
674 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
675 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
676 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
677 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
678 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
679 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
680 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
681 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
682 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
683 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
684 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
685 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
686 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
687 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
688 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.47
Metatranscriptomes 0.09
Isolates 23.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.06
Nodule 21.26
Rhizoplane 2.54
Rhizosphere 59.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157339_1011728 3300012505 Bacteria 812
2 JGI24740J21852_10009490 3300001979 Bacteria 3806
3 JGI24751J29686_10029641 3300002459 Bacteria 1136
4 JGI25157J39369_1001294 3300002741 Bacteria 10022
5 JGI25406J46586_10014352 3300003203 Bacteria 3372
6 JGI25153J46596_10017786 3300003215 Bacteria 2786
7 rootH1_10000936 3300003323 Bacteria 32038
8 rootH1_10008698 3300003323 Bacteria 22564
9 JGI25404J52841_10013017 3300003659 Bacteria 1804
10 Ga0055542_1000775 3300003762 Bacteria 24034
11 Ga0055529_1002235 3300003763 Bacteria 3951
12 Ga0065712_10020326 3300005290 Bacteria 2466
13 Ga0065715_10121096 3300005293 Bacteria 2238
14 Ga0065715_10352229 3300005293 Bacteria 949
15 Ga0070658_10088079 3300005327 Bacteria 2556
16 Ga0070658_10133802 3300005327 Bacteria 2067
17 Ga0070658_10249162 3300005327 Bacteria 1507
18 Ga0070676_10116664 3300005328 Bacteria 1670
19 Ga0070676_10334371 3300005328 Bacteria 1037
20 Ga0070683_100059968 3300005329 Bacteria 3535
21 Ga0070670_100542790 3300005331 Bacteria 1037
22 Ga0070677_10026835 3300005333 Bacteria 2163
23 Ga0068869_100003218 3300005334 Bacteria 9982
24 Ga0068869_100439513 3300005334 Bacteria 1079
25 Ga0070680_100048987 3300005336 Bacteria 3443
26 Ga0070680_100318622 3300005336 Bacteria 1320
27 Ga0070680_100451141 3300005336 Bacteria 1098
28 Ga0070680_100494620 3300005336 Bacteria 1046
29 Ga0070682_100023021 3300005337 Bacteria 3697
30 Ga0068868_100656117 3300005338 Bacteria 935
31 Ga0070660_100395616 3300005339 Bacteria 1142
32 Ga0070691_10154219 3300005341 Bacteria 1180
33 Ga0070661_100073843 3300005344 Bacteria 2511
34 Ga0070675_100052858 3300005354 Bacteria 3341
35 Ga0070675_100082169 3300005354 Bacteria 2688
36 Ga0070675_100084106 3300005354 Bacteria 2657
37 Ga0070671_100018362 3300005355 Bacteria 5680
38 Ga0070671_100203660 3300005355 Bacteria 1678
39 Ga0070671_100431752 3300005355 Bacteria 1129
40 Ga0070674_100068091 3300005356 Bacteria 2506
41 Ga0070674_100860703 3300005356 Bacteria 787
42 Ga0070673_100027881 3300005364 Bacteria 4192
43 Ga0070673_100036731 3300005364 Bacteria 3727
44 Ga0070688_100179388 3300005365 Bacteria 1468
45 Ga0070688_100216359 3300005365 Bacteria 1348
46 Ga0070659_100018350 3300005366 Bacteria 5281
47 Ga0070659_100055791 3300005366 Bacteria 3114
48 Ga0070659_100247872 3300005366 Bacteria 1476
49 Ga0070667_100372473 3300005367 Bacteria 1296
50 Ga0070709_10011341 3300005434 Bacteria 4963
51 Ga0070709_10042115 3300005434 Bacteria 2817
52 Ga0070709_10068928 3300005434 Bacteria 2276
53 Ga0070709_10243424 3300005434 Bacteria 1292
54 Ga0070714_100017392 3300005435 Bacteria 5824
55 Ga0070714_100080276 3300005435 Bacteria 2838
56 Ga0070713_100007558 3300005436 Bacteria 7639
57 Ga0070713_100015955 3300005436 Bacteria 5636
58 Ga0070713_100016717 3300005436 Bacteria 5523
59 Ga0070713_100031430 3300005436 Bacteria 4228
60 Ga0070710_10007309 3300005437 Bacteria 5343
61 Ga0070711_100020389 3300005439 Bacteria 4272
62 Ga0070711_100027190 3300005439 Bacteria 3754
63 Ga0070711_100041309 3300005439 Bacteria 3114
64 Ga0070711_100076214 3300005439 Bacteria 2377
65 Ga0070708_100616473 3300005445 Bacteria 1023
66 Ga0070663_100010007 3300005455 Bacteria 5897
67 Ga0070663_100302487 3300005455 Bacteria 1281
68 Ga0070678_100047257 3300005456 Bacteria 3091
69 Ga0070681_10000509 3300005458 Bacteria 31765
70 Ga0070681_10053509 3300005458 Bacteria 4023
71 Ga0070681_10064749 3300005458 Bacteria 3625
72 Ga0070681_10197411 3300005458 Bacteria 1931
73 Ga0070681_10612104 3300005458 Bacteria 1004
74 Ga0070681_10638136 3300005458 Bacteria 980
75 Ga0070681_10930652 3300005458 Bacteria 788
76 Ga0068867_100104271 3300005459 Bacteria 2170
77 Ga0068867_100466695 3300005459 Bacteria 1079
78 Ga0068867_100587420 3300005459 Bacteria 969
79 Ga0070706_100310250 3300005467 Bacteria 1472
80 Ga0070698_100037846 3300005471 Bacteria 4973
81 Ga0070698_100180884 3300005471 Bacteria 2047
82 Ga0070698_100246398 3300005471 Bacteria 1720
83 Ga0070679_100023336 3300005530 Bacteria 6054
84 Ga0070679_100161142 3300005530 Bacteria 2218
85 Ga0070679_100254244 3300005530 Bacteria 1713
86 Ga0070684_100010129 3300005535 Bacteria 7453
87 Ga0070684_100046744 3300005535 Bacteria 3750
88 Ga0070697_100111750 3300005536 Bacteria 2278
89 Ga0070697_100172590 3300005536 Bacteria 1831
90 Ga0068853_100067677 3300005539 Bacteria 3103
91 Ga0068853_100252069 3300005539 Bacteria 1620
92 Ga0068853_100322792 3300005539 Bacteria 1432
93 Ga0068853_100442988 3300005539 Bacteria 1221
94 Ga0068853_100607931 3300005539 Bacteria 1039
95 Ga0068853_100684369 3300005539 Bacteria 978
96 Ga0070672_100080702 3300005543 Bacteria 2606
97 Ga0070672_100274356 3300005543 Bacteria 1424
98 Ga0070686_100244810 3300005544 Bacteria 1307
99 Ga0070686_100512879 3300005544 Bacteria 932
100 Ga0070696_100198074 3300005546 Bacteria 1498
101 Ga0070693_100101637 3300005547 Bacteria 1753
102 Ga0070665_100107922 3300005548 Bacteria 2786
103 Ga0070665_100225890 3300005548 Bacteria 1872
104 Ga0070665_100692068 3300005548 Bacteria 1032
105 Ga0068855_100075791 3300005563 Bacteria 3905
106 Ga0068855_100676345 3300005563 Bacteria 1106
107 Ga0068855_100685653 3300005563 Bacteria 1098
108 Ga0070664_100091744 3300005564 Bacteria 2629
109 Ga0070664_100641202 3300005564 Bacteria 987
110 Ga0068857_100025776 3300005577 Bacteria 5177
111 Ga0068857_100045564 3300005577 Bacteria 3891
112 Ga0068857_100085007 3300005577 Bacteria 2827
113 Ga0068857_100110102 3300005577 Bacteria 2475
114 Ga0068854_100498001 3300005578 Bacteria 1026
115 Ga0068856_100019492 3300005614 Bacteria 6584
116 Ga0068856_100188914 3300005614 Bacteria 2074
117 Ga0068852_100020134 3300005616 Bacteria 5300
118 Ga0068859_100062589 3300005617 Bacteria 3751
119 Ga0068859_100266275 3300005617 Bacteria 1806
120 Ga0068864_100099419 3300005618 Bacteria 2577
121 Ga0068851_10037476 3300005834 Bacteria 2431
122 Ga0068851_10043364 3300005834 Bacteria 2268
123 Ga0068863_100453253 3300005841 Bacteria 1259
124 Ga0068858_100075077 3300005842 Bacteria 3140
125 Ga0068858_100103740 3300005842 Bacteria 2653
126 Ga0068858_100419779 3300005842 Bacteria 1286
127 Ga0068860_100073539 3300005843 Bacteria 3249
128 Ga0068860_100156599 3300005843 Bacteria 2196
129 Ga0068862_100667541 3300005844 Bacteria 1004
130 Ga0081455_10000142 3300005937 Bacteria 84680
131 Ga0081455_10001715 3300005937 Bacteria 26531
132 Ga0081455_10028348 3300005937 Bacteria 5117
133 Ga0081455_10212197 3300005937 Bacteria 1442
134 Ga0081540_1006097 3300005983 Bacteria 8858
135 Ga0081539_10003011 3300005985 Bacteria 21952
136 Ga0081539_10003789 3300005985 Bacteria 17853
137 Ga0081539_10016697 3300005985 Bacteria 5217
138 Ga0081539_10024885 3300005985 Bacteria 3870
139 Ga0081539_10036208 3300005985 Bacteria 2956
140 Ga0070717_10006086 3300006028 Bacteria 8856
141 Ga0070717_10014983 3300006028 Bacteria 5972
142 Ga0070717_10187097 3300006028 Bacteria 1808
143 Ga0070717_10212601 3300006028 Bacteria 1698
144 Ga0075365_10014170 3300006038 Bacteria 4790
145 Ga0075365_10083995 3300006038 Bacteria 2160
146 Ga0075365_10138962 3300006038 Bacteria 1685
147 Ga0075368_10093631 3300006042 Bacteria 1230
148 Ga0075368_10096675 3300006042 Bacteria 1211
149 Ga0075363_100051055 3300006048 Bacteria 2204
150 Ga0075363_100115698 3300006048 Bacteria 1493
151 Ga0075363_100127543 3300006048 Bacteria 1425
152 Ga0075363_100174066 3300006048 Bacteria 1223
153 Ga0075363_100340530 3300006048 Bacteria 874
154 Ga0075364_10032560 3300006051 Bacteria 3352
155 Ga0075364_10039017 3300006051 Bacteria 3077
156 Ga0070715_10001945 3300006163 Bacteria 6220
157 Ga0070716_100003460 3300006173 Bacteria 7432
158 Ga0070716_100100258 3300006173 Bacteria 1774
159 Ga0070712_100294326 3300006175 Bacteria 1312
160 Ga0070712_100406563 3300006175 Bacteria 1125
161 Ga0075362_10031084 3300006177 Bacteria 2309
162 Ga0075362_10148340 3300006177 Bacteria 1124
163 Ga0075367_10020138 3300006178 Bacteria 3710
164 Ga0075367_10104871 3300006178 Bacteria 1731
165 Ga0075367_10123154 3300006178 Bacteria 1599
166 Ga0075367_10259816 3300006178 Bacteria 1090
167 Ga0075367_10294456 3300006178 Bacteria 1021
168 Ga0075369_10002893 3300006186 Bacteria 6191
169 Ga0075366_10056051 3300006195 Bacteria 2340
170 Ga0075366_10179854 3300006195 Bacteria 1284
171 Ga0075366_10318275 3300006195 Bacteria 953
172 Ga0097621_100073805 3300006237 Bacteria 2825
173 Ga0097621_100993647 3300006237 Bacteria 785
174 Ga0075370_10129113 3300006353 Bacteria 1474
175 Ga0075370_10202400 3300006353 Bacteria 1171
176 Ga0068871_100643138 3300006358 Bacteria 968
177 Ga0075428_100010071 3300006844 Bacteria 10503
178 Ga0075428_100621787 3300006844 Bacteria 1153
179 Ga0075428_100700737 3300006844 Bacteria 1079
180 Ga0075430_100000066 3300006846 Bacteria 56729
181 Ga0075431_100455294 3300006847 Bacteria 1275
182 Ga0075433_10130326 3300006852 Bacteria 2234
183 Ga0075434_100025332 3300006871 Bacteria 5804
184 Ga0075429_100204653 3300006880 Bacteria 1729
185 Ga0075429_100369191 3300006880 Bacteria 1256
186 Ga0068865_100081248 3300006881 Bacteria 2327
187 Ga0075436_100069355 3300006914 Bacteria 2436
188 Ga0097620_100062596 3300006931 Bacteria 3751
189 Ga0097620_100266269 3300006931 Bacteria 1806
190 Ga0099824_1020962 3300006942 Bacteria 4670
191 Ga0099822_1011448 3300006943 Bacteria 10808
192 Ga0075435_100109349 3300007076 Bacteria 2298
193 Ga0075435_100696174 3300007076 Bacteria 883
194 Ga0099794_10069546 3300007265 Bacteria 1722
195 Ga0099794_10173713 3300007265 Bacteria 1099
196 Ga0099795_10035212 3300007788 Bacteria 1749
197 Ga0105240_10025071 3300009093 Bacteria 7850
198 Ga0105240_10073053 3300009093 Bacteria 4237
199 Ga0105240_10313661 3300009093 Bacteria 1790
200 Ga0105240_10322294 3300009093 Bacteria 1761
201 Ga0105240_10449290 3300009093 Bacteria 1443
202 Ga0111539_10021821 3300009094 Bacteria 7874
203 Ga0111539_10082461 3300009094 Bacteria 3782
204 Ga0111539_10818960 3300009094 Bacteria 1083
205 Ga0105245_10073316 3300009098 Bacteria 3113
206 Ga0105245_10457520 3300009098 Bacteria 1286
207 Ga0105247_10308056 3300009101 Bacteria 1101
208 Ga0114129_10001651 3300009147 Bacteria 30336
209 Ga0114129_10109125 3300009147 Bacteria 3820
210 Ga0114129_10336055 3300009147 Bacteria 2005
211 Ga0114129_10783343 3300009147 Bacteria 1218
212 Ga0105243_10395666 3300009148 Bacteria 1282
213 Ga0105241_10051648 3300009174 Bacteria 3136
214 Ga0105241_10101531 3300009174 Bacteria 2287
215 Ga0105241_10289506 3300009174 Bacteria 1402
216 Ga0105242_10032744 3300009176 Bacteria 4158
217 Ga0105242_10093354 3300009176 Bacteria 2537
218 Ga0105242_10305092 3300009176 Bacteria 1454
219 Ga0105248_10006018 3300009177 Bacteria 13316
220 Ga0105248_10033707 3300009177 Bacteria 5722
221 Ga0105248_10035084 3300009177 Bacteria 5612
222 Ga0105248_10044373 3300009177 Bacteria 4986
223 Ga0105248_10089880 3300009177 Bacteria 3458
224 Ga0105248_10157928 3300009177 Bacteria 2559
225 Ga0105248_10413806 3300009177 Bacteria 1518
226 Ga0105248_10916811 3300009177 Bacteria 989
227 Ga0105237_10017110 3300009545 Bacteria 7521
228 Ga0105237_10113090 3300009545 Bacteria 2707
229 Ga0105237_10178604 3300009545 Bacteria 2123
230 Ga0105237_10903388 3300009545 Bacteria 890
231 Ga0105238_10075306 3300009551 Bacteria 3367
232 Ga0105238_10143365 3300009551 Bacteria 2365
233 Ga0105238_10166827 3300009551 Bacteria 2178
234 Ga0105238_10195097 3300009551 Bacteria 2001
235 Ga0105238_10291275 3300009551 Bacteria 1615
236 Ga0105238_10346574 3300009551 Bacteria 1474
237 Ga0105238_10348807 3300009551 Bacteria 1469
238 Ga0105238_10467326 3300009551 Bacteria 1260
239 Ga0105238_10647001 3300009551 Bacteria 1067
240 Ga0105249_10000966 3300009553 Bacteria 25437
241 Ga0105249_10297802 3300009553 Bacteria 1617
242 Ga0105239_10059018 3300010375 Bacteria 4211
243 Ga0105239_10106215 3300010375 Bacteria 3110
244 Ga0105239_10229979 3300010375 Bacteria 2080
245 Ga0105246_10011785 3300011119 Bacteria 5433
246 Ga0157371_10113120 3300013102 Bacteria 1927
247 Ga0157371_10614287 3300013102 Bacteria 809
248 Ga0157370_10016717 3300013104 Bacteria 7424
249 Ga0157370_10054269 3300013104 Bacteria 3820
250 Ga0157370_10077887 3300013104 Bacteria 3122
251 Ga0157369_10004452 3300013105 Bacteria 16503
252 Ga0157369_10014713 3300013105 Bacteria 8827
253 Ga0157369_10174636 3300013105 Bacteria 2262
254 Ga0157374_10069050 3300013296 Bacteria 3327
255 Ga0157374_10534305 3300013296 Bacteria 1179
256 Ga0157378_10860871 3300013297 Bacteria 935
257 Ga0163162_10171606 3300013306 Bacteria 2294
258 Ga0163162_10240868 3300013306 Bacteria 1940
259 Ga0163162_10655867 3300013306 Bacteria 1173
260 Ga0157372_10033715 3300013307 Bacteria 5626
261 Ga0157372_10564407 3300013307 Bacteria 1327
262 Ga0157375_10008454 3300013308 Bacteria 9016
263 Ga0157375_10391030 3300013308 Bacteria 1557
264 Ga0157375_11130458 3300013308 Bacteria 917
265 Ga0163163_10178983 3300014325 Bacteria 2167
266 Ga0163163_10527199 3300014325 Bacteria 1244
267 Ga0157380_10000903 3300014326 Bacteria 18696
268 Ga0157380_10015620 3300014326 Bacteria 5582
269 Ga0157380_10083652 3300014326 Bacteria 2615
270 Ga0157377_10311151 3300014745 Bacteria 1043
271 Ga0157379_10038839 3300014968 Bacteria 4246
272 Ga0157379_10997562 3300014968 Bacteria 798
273 Ga0157376_10267225 3300014969 Bacteria 1605
274 Ga0157376_10316652 3300014969 Bacteria 1482
275 Ga0157376_10377734 3300014969 Bacteria 1364
276 Ga0157376_10486339 3300014969 Bacteria 1210
277 Ga0182005_1014368 3300015265 Bacteria 2215
278 Ga0163161_10217294 3300017792 Bacteria 1479
279 Ga0206356_10788712 3300020070 Bacteria 988
280 Ga0213873_10015136 3300021358 Bacteria 1722
281 Ga0213874_10015852 3300021377 Bacteria 1994
282 Ga0213876_10069114 3300021384 Bacteria 1866
283 Ga0213876_10092020 3300021384 Bacteria 1606
284 Ga0213876_10187711 3300021384 Bacteria 1099
285 Ga0213876_10269826 3300021384 Bacteria 904
286 Ga0209026_1000002 3300025250 Bacteria 1136158
287 Ga0209677_103245 3300025253 Bacteria 5419
288 Ga0209148_1000072 3300025254 Bacteria 325292
289 Ga0209759_1000238 3300025256 Bacteria 81844
290 Ga0209233_1001163 3300025261 Bacteria 10659
291 Ga0209233_1003251 3300025261 Bacteria 5762
292 Ga0209455_1000133 3300025272 Bacteria 155670
293 Ga0209455_1007678 3300025272 Bacteria 3012
294 Ga0209676_1000159 3300025292 Bacteria 161731
295 Ga0209025_1075848 3300025294 Bacteria 1168
296 Ga0209758_1002512 3300025297 Bacteria 18622
297 Ga0209758_1011055 3300025297 Bacteria 5285
298 Ga0209758_1013103 3300025297 Bacteria 4558
299 Ga0209050_1019353 3300025298 Bacteria 2590
300 Ga0207682_10018378 3300025893 Bacteria 2733
301 Ga0207692_10042518 3300025898 Bacteria 2256
302 Ga0207692_10062177 3300025898 Bacteria 1937
303 Ga0207692_10064809 3300025898 Bacteria 1904
304 Ga0207692_10103275 3300025898 Bacteria 1569
305 Ga0207710_10075341 3300025900 Bacteria 1555
306 Ga0207688_10221004 3300025901 Bacteria 1141
307 Ga0207680_10069321 3300025903 Bacteria 2179
308 Ga0207647_10028081 3300025904 Bacteria 3660
309 Ga0207685_10022096 3300025905 Bacteria 2144
310 Ga0207699_10029708 3300025906 Bacteria 3050
311 Ga0207699_10042426 3300025906 Bacteria 2635
312 Ga0207699_10060836 3300025906 Bacteria 2270
313 Ga0207699_10080233 3300025906 Bacteria 2021
314 Ga0207699_10223517 3300025906 Bacteria 1286
315 Ga0207645_10022003 3300025907 Bacteria 4152
316 Ga0207645_10089776 3300025907 Bacteria 1976
317 Ga0207705_10099634 3300025909 Bacteria 2136
318 Ga0207705_10102494 3300025909 Bacteria 2107
319 Ga0207705_10542103 3300025909 Bacteria 904
320 Ga0207684_10273670 3300025910 Bacteria 1457
321 Ga0207654_10025069 3300025911 Bacteria 3213
322 Ga0207654_10025705 3300025911 Bacteria 3180
323 Ga0207707_10000706 3300025912 Bacteria 33199
324 Ga0207707_10002136 3300025912 Bacteria 17901
325 Ga0207707_10023258 3300025912 Bacteria 5422
326 Ga0207707_10203073 3300025912 Bacteria 1728
327 Ga0207695_10032870 3300025913 Bacteria 5671
328 Ga0207695_10101196 3300025913 Bacteria 2876
329 Ga0207695_10134404 3300025913 Bacteria 2428
330 Ga0207695_10144924 3300025913 Bacteria 2320
331 Ga0207695_10181939 3300025913 Bacteria 2023
332 Ga0207695_10263494 3300025913 Bacteria 1621
333 Ga0207671_10048021 3300025914 Bacteria 3159
334 Ga0207671_10178522 3300025914 Bacteria 1652
335 Ga0207693_10001853 3300025915 Bacteria 18527
336 Ga0207693_10024596 3300025915 Bacteria 4776
337 Ga0207693_10038993 3300025915 Bacteria 3740
338 Ga0207693_10051541 3300025915 Bacteria 3229
339 Ga0207693_10106698 3300025915 Bacteria 2197
340 Ga0207693_10495385 3300025915 Bacteria 954
341 Ga0207663_10047300 3300025916 Bacteria 2655
342 Ga0207663_10121066 3300025916 Bacteria 1792
343 Ga0207660_10002043 3300025917 Bacteria 13422
344 Ga0207660_10086669 3300025917 Bacteria 2312
345 Ga0207660_10090850 3300025917 Bacteria 2263
346 Ga0207660_10420912 3300025917 Bacteria 1077
347 Ga0207662_10343747 3300025918 Bacteria 1000
348 Ga0207657_10002667 3300025919 Bacteria 19257
349 Ga0207657_10004672 3300025919 Bacteria 14460
350 Ga0207652_10001458 3300025921 Bacteria 20929
351 Ga0207652_10221012 3300025921 Bacteria 1707
352 Ga0207652_10590962 3300025921 Bacteria 996
353 Ga0207646_10151697 3300025922 Bacteria 2090
354 Ga0207694_10000426 3300025924 Bacteria 39173
355 Ga0207694_10034603 3300025924 Bacteria 3874
356 Ga0207694_10181788 3300025924 Bacteria 1705
357 Ga0207694_10387088 3300025924 Bacteria 1161
358 Ga0207650_10014724 3300025925 Bacteria 5436
359 Ga0207650_10266069 3300025925 Bacteria 1392
360 Ga0207650_10413782 3300025925 Bacteria 1118
361 Ga0207650_10698783 3300025925 Bacteria 857
362 Ga0207659_10141312 3300025926 Bacteria 1869
363 Ga0207659_10583129 3300025926 Bacteria 952
364 Ga0207659_10727304 3300025926 Bacteria 851
365 Ga0207687_10002927 3300025927 Bacteria 11596
366 Ga0207700_10023163 3300025928 Bacteria 4276
367 Ga0207700_10059333 3300025928 Bacteria 2893
368 Ga0207700_10136160 3300025928 Bacteria 2012
369 Ga0207700_10334237 3300025928 Bacteria 1316
370 Ga0207664_10036603 3300025929 Bacteria 3794
371 Ga0207664_10173182 3300025929 Bacteria 1848
372 Ga0207664_10269816 3300025929 Bacteria 1490
373 Ga0207664_10418555 3300025929 Bacteria 1193
374 Ga0207644_10141114 3300025931 Bacteria 1855
375 Ga0207644_10695877 3300025931 Bacteria 847
376 Ga0207690_10050630 3300025932 Bacteria 2773
377 Ga0207690_10409491 3300025932 Bacteria 1083
378 Ga0207690_10474259 3300025932 Bacteria 1009
379 Ga0207686_10027871 3300025934 Bacteria 3313
380 Ga0207686_10039863 3300025934 Bacteria 2852
381 Ga0207686_10373399 3300025934 Bacteria 1080
382 Ga0207670_10173218 3300025936 Bacteria 1620
383 Ga0207669_10051994 3300025937 Bacteria 2458
384 Ga0207669_10494405 3300025937 Bacteria 977
385 Ga0207669_10711292 3300025937 Bacteria 826
386 Ga0207665_10001158 3300025939 Bacteria 17723
387 Ga0207665_10194274 3300025939 Bacteria 1476
388 Ga0207665_10215048 3300025939 Bacteria 1406
389 Ga0207691_10013601 3300025940 Bacteria 7779
390 Ga0207691_10296056 3300025940 Bacteria 1391
391 Ga0207711_10026007 3300025941 Bacteria 4909
392 Ga0207711_10045472 3300025941 Bacteria 3752
393 Ga0207711_10627032 3300025941 Bacteria 1003
394 Ga0207689_10044976 3300025942 Bacteria 3651
395 Ga0207689_10054965 3300025942 Bacteria 3278
396 Ga0207661_10001495 3300025944 Bacteria 15826
397 Ga0207661_10354106 3300025944 Bacteria 1325
398 Ga0207667_10007733 3300025949 Bacteria 12851
399 Ga0207667_10075757 3300025949 Bacteria 3493
400 Ga0207667_10137662 3300025949 Bacteria 2514
401 Ga0207651_10353562 3300025960 Bacteria 1238
402 Ga0207712_10001525 3300025961 Bacteria 15681
403 Ga0207712_10062382 3300025961 Bacteria 2649
404 Ga0207668_10152446 3300025972 Bacteria 1791
405 Ga0207658_10390307 3300025986 Bacteria 1221
406 Ga0207658_10639787 3300025986 Bacteria 958
407 Ga0207703_10005220 3300026035 Bacteria 10497
408 Ga0207703_10273626 3300026035 Bacteria 1531
409 Ga0207703_10280570 3300026035 Bacteria 1513
410 Ga0207703_10444813 3300026035 Bacteria 1210
411 Ga0207639_10098359 3300026041 Bacteria 2358
412 Ga0207639_10364706 3300026041 Bacteria 1293
413 Ga0207639_10500078 3300026041 Bacteria 1110
414 Ga0207678_10018939 3300026067 Bacteria 6049
415 Ga0207708_10252605 3300026075 Bacteria 1421
416 Ga0207702_10047548 3300026078 Bacteria 3616
417 Ga0207702_10185517 3300026078 Bacteria 1918
418 Ga0207702_10604158 3300026078 Bacteria 1076
419 Ga0207641_10439960 3300026088 Bacteria 1258
420 Ga0207648_10039754 3300026089 Bacteria 4135
421 Ga0207648_10082512 3300026089 Bacteria 2803
422 Ga0207676_10035526 3300026095 Bacteria 3783
423 Ga0207674_10046693 3300026116 Bacteria 4445
424 Ga0207674_10063123 3300026116 Bacteria 3740
425 Ga0207674_10115730 3300026116 Bacteria 2653
426 Ga0207674_10138200 3300026116 Bacteria 2397
427 Ga0207674_10505399 3300026116 Bacteria 1168
428 Ga0207675_100576205 3300026118 Bacteria 1127
429 Ga0207683_10140063 3300026121 Bacteria 2179
430 Ga0207698_10049902 3300026142 Bacteria 3188
431 Ga0209389_1000034 3300027296 Bacteria 127289
432 Ga0209589_1000038 3300027357 Bacteria 127285
433 Ga0209589_1000055 3300027357 Bacteria 111890
434 Ga0209489_100023 3300027361 Bacteria 198829
435 Ga0209489_100128 3300027361 Bacteria 111890
436 Ga0209700_100137 3300027363 Bacteria 111890
437 Ga0209588_1018216 3300027671 Bacteria 2186
438 Ga0209588_1053981 3300027671 Bacteria 1299
439 Ga0209813_10041459 3300027866 Bacteria 1403
440 Ga0209813_10117252 3300027866 Bacteria 923
441 Ga0207428_10327690 3300027907 Bacteria 1130
442 Ga0268266_10059855 3300028379 Bacteria 3281
443 Ga0268266_10256732 3300028379 Bacteria 1618
444 Ga0268266_10336109 3300028379 Bacteria 1417
445 Ga0268266_10338317 3300028379 Bacteria 1412
446 Ga0268265_11031113 3300028380 Bacteria 814
447 Ga0268264_10044627 3300028381 Bacteria 3677
448 Ga0265318_10046685 3300028577 Bacteria 1634
449 Ga0265338_10078256 3300028800 Bacteria 2790
450 Ga0265325_10005877 3300031241 Bacteria 7519
451 Ga0265325_10140940 3300031241 Bacteria 1147
452 Ga0265325_10145294 3300031241 Bacteria 1125
453 Ga0265329_10054334 3300031242 Bacteria 1272
454 Ga0265340_10001703 3300031247 Bacteria 12620
455 Ga0265340_10031016 3300031247 Bacteria 2676
456 Ga0265339_10000281 3300031249 Bacteria 41044
457 Ga0265316_10002875 3300031344 Bacteria 17630
458 Ga0265316_10143679 3300031344 Bacteria 1791
459 Ga0307408_100000394 3300031548 Bacteria 39710
460 Ga0307408_100005603 3300031548 Bacteria 8394
461 Ga0265313_10024804 3300031595 Bacteria 3193
462 Ga0307508_10109636 3300031616 Bacteria 2360
463 Ga0316575_10184744 3300031665 Bacteria 866
464 Ga0265314_10094954 3300031711 Bacteria 1931
465 Ga0265314_10097023 3300031711 Bacteria 1905
466 Ga0265342_10271966 3300031712 Bacteria 899
467 Ga0316576_10206791 3300031727 Bacteria 1478
468 Ga0316578_10018002 3300031728 Bacteria 3859
469 Ga0316578_10033662 3300031728 Bacteria 2938
470 Ga0316578_10102161 3300031728 Bacteria 1719
471 Ga0307406_10001502 3300031901 Bacteria 12882
472 Ga0307414_10192732 3300032004 Bacteria 1651
473 Ga0307414_10459121 3300032004 Bacteria 1119
474 Ga0307510_10041241 3300033180 Bacteria 5052
475 Ga0316215_1000933 3300033544 Bacteria 2849
476 Ga0373952_0037037 3300035092 Bacteria 1111
477 Ga0373936_0129841 3300035113 Bacteria 1082
478 Ga0373939_0104127 3300035114 Bacteria 979
479 Ga0373953_0034219 3300035117 Bacteria 1991
480 Ga0373953_0074970 3300035117 Bacteria 1400
481 Ga0373954_0078468 3300035118 Bacteria 1575
482 Ga0373955_0023876 3300035172 Bacteria 3120
483 Ga0373955_0045640 3300035172 Bacteria 2365
484 Ga0373924_0179132 3300035410 Bacteria 932
485 Ga0373931_0036143 3300035691 Bacteria 2573
486 Ga0373935_0097602 3300035692 Bacteria 1933
487 Ga0373935_0177872 3300035692 Bacteria 1459
488 Ga0373927_0018419 3300035695 Bacteria 4590
489 Ga0373927_0132297 3300035695 Bacteria 1630
490 Ga0373927_0253162 3300035695 Bacteria 1158
491 Ga0373933_0000105 3300035724 Bacteria 53488
492 Ga0373933_0005822 3300035724 Bacteria 6707
493 Ga0373933_0044569 3300035724 Bacteria 2628
494 Ga0373933_0241193 3300035724 Bacteria 1162
495 Ga0373947_0021248 3300035725 Bacteria 3756
496 Ga0373947_0235245 3300035725 Bacteria 1208
497 Ga0373937_0006367 3300036401 Bacteria 10182
498 Ga0373937_0020230 3300036401 Bacteria 5966
499 Ga0373937_0026584 3300036401 Bacteria 5229
500 Ga0373937_0036084 3300036401 Bacteria 4504
501 Ga0373937_0254810 3300036401 Bacteria 1654
502 Ga0373937_0344661 3300036401 Bacteria 1411
503 Ga0316582_0174477 3300036647 Bacteria 1461
504 Ga0316582_0362958 3300036647 Bacteria 997
505 Ga0316584_0045589 3300036712 Bacteria 3273
506 Ga0373925_0703248 3300037068 Bacteria 833
507 Ga0395899_0161981 3300037312 Bacteria 1580
508 Ga0395900_0036754 3300037418 Bacteria 5048
509 Ga0395898_0012482 3300037466 Bacteria 8784
510 Ga0395898_0437813 3300037466 Bacteria 1245
511 Ga0395905_0222072 3300037471 Bacteria 1768
512 Ga0395905_0258847 3300037471 Bacteria 1625
513 Ga0436364_0257495 3300037853 Bacteria 4176
514 Ga0436364_0356065 3300037853 Bacteria 752
515 Ga0395901_0009035 3300038443 Bacteria 10088
516 Ga0395901_0046917 3300038443 Bacteria 4488
517 Ga0400483_082903 3300039062 Bacteria 3141
518 Ga0436365_0115993 3300039437 Bacteria 1116
519 Ga0436365_0219669 3300039437 Bacteria 2419
520 Ga0436365_0472623 3300039437 Bacteria 785
521 Ga0436365_0507057 3300039437 Bacteria 5857
522 Ga0436365_0621927 3300039437 Bacteria 1798
523 Ga0436365_0699198 3300039437 Bacteria 2999
524 Ga0436365_1885077 3300039437 Bacteria 735
525 Ga0436360_0068302 3300039438 Bacteria 5133
526 Ga0436361_0885416 3300039447 Bacteria 1865
527 Ga0436363_1200244 3300039450 Bacteria 2773
528 Ga0436363_1323175 3300039450 Bacteria 5568
529 Ga0436362_0387585 3300039453 Bacteria 3934
530 Ga0436362_0576405 3300039453 Bacteria 1089
531 Ga0439453_0001364 3300041408 Bacteria 3115
532 Ga0439453_0045008 3300041408 Bacteria 877
533 Ga0439465_0095152 3300041413 Bacteria 1023
534 Ga0439465_0110872 3300041413 Bacteria 955
535 Ga0451845_0689861 3300041501 Bacteria 837
536 Ga0439443_013683 3300042003 Bacteria 1215
537 Ga0450891_003705 3300042129 Bacteria 1459
538 Ga0439435_0005297 3300042436 Bacteria 2832
539 Ga0439435_0006166 3300042436 Bacteria 2683
540 Ga0439460_0034968 3300042461 Bacteria 1451
541 Ga0439460_0139946 3300042461 Bacteria 802
542 Ga0466969_0017044 3300044656 Bacteria 3797
543 Ga0466972_0035561 3300044658 Bacteria 2437
544 Ga0466966_0048180 3300044684 Bacteria 2715
545 Ga0466963_0065235 3300044694 Bacteria 2441
546 Ga0466963_0126272 3300044694 Bacteria 1764
547 Ga0466964_0118568 3300044706 Bacteria 1190
548 Ga0466971_0110697 3300044719 Bacteria 1267
549 Ga0466970_0150007 3300044765 Bacteria 1287
550 Ga0466960_0102594 3300044901 Bacteria 1475
551 Ga0466960_0171288 3300044901 Bacteria 1172
552 Ga0466959_0033654 3300045049 Bacteria 3790
553 Ga0466959_0035729 3300045049 Bacteria 3673
554 Ga0466967_0052523 3300045976 Bacteria 3578
555 Ga0466967_0122587 3300045976 Bacteria 2404
556 Ga0466967_0606946 3300045976 Bacteria 1080
557 Ga0495592_0157182 3300046454 Bacteria 1567
558 Ga0495590_0092510 3300046457 Bacteria 1071
559 Ga0495638_0025833 3300046460 Bacteria 3813
560 Ga0495641_0137318 3300046461 Bacteria 1092
561 Ga0495651_0096787 3300046462 Bacteria 2205
562 Ga0495653_0071960 3300046463 Bacteria 2583
563 Ga0495580_0009473 3300046472 Bacteria 7660
564 Ga0495580_0198447 3300046472 Bacteria 1383
565 Ga0495639_0148919 3300046475 Bacteria 1128
566 Ga0495639_0209217 3300046475 Bacteria 957
567 Ga0495664_0120799 3300046477 Bacteria 1585
568 Ga0495664_0195298 3300046477 Bacteria 1227
569 Ga0495606_0133981 3300046507 Bacteria 1470
570 Ga0495608_0123244 3300046511 Bacteria 1661
571 Ga0495618_0046607 3300046514 Bacteria 2736
572 Ga0495618_0217691 3300046514 Bacteria 1205
573 Ga0495628_0133081 3300046516 Bacteria 1901
574 Ga0495628_0347102 3300046516 Bacteria 1092
575 Ga0495628_0556398 3300046516 Bacteria 823
576 Ga0495628_0601303 3300046516 Bacteria 785
577 Ga0495666_0051861 3300046526 Bacteria 1970
578 Ga0495652_0095736 3300046529 Bacteria 2419
579 Ga0495652_0107274 3300046529 Bacteria 2253
580 Ga0495652_0140888 3300046529 Bacteria 1896
581 Ga0495652_0511413 3300046529 Bacteria 831
582 Ga0495654_0226549 3300046530 Bacteria 788
583 Ga0495665_0103492 3300046531 Bacteria 1494
584 Ga0495640_0131317 3300046533 Bacteria 1621
585 Ga0495640_0317776 3300046533 Bacteria 965
586 Ga0495586_0140476 3300046535 Bacteria 1355
587 Ga0495586_0171847 3300046535 Bacteria 1225
588 Ga0495586_0432528 3300046535 Bacteria 758
589 Ga0495587_0038304 3300046536 Bacteria 2876
590 Ga0495587_0058935 3300046536 Bacteria 2255
591 Ga0495587_0088937 3300046536 Bacteria 1785
592 Ga0495645_0109202 3300046543 Bacteria 1958
593 Ga0495645_0383108 3300046543 Bacteria 899
594 Ga0495667_0062621 3300046559 Bacteria 2437
595 Ga0495667_0067195 3300046559 Bacteria 2343
596 Ga0495667_0153065 3300046559 Bacteria 1484
597 Ga0495634_0068709 3300046642 Bacteria 2339
598 Ga0495634_0423584 3300046642 Bacteria 788
599 Ga0495635_0020974 3300046663 Bacteria 4554
600 Ga0495599_0039931 3300046678 Bacteria 2949
601 Ga0495599_0301832 3300046678 Bacteria 966
602 Ga0495646_0155575 3300046680 Bacteria 1269
603 Ga0495658_0241701 3300046683 Bacteria 1134
604 Ga0495669_0001461 3300046684 Bacteria 9740
605 Ga0495624_0199865 3300046690 Bacteria 1215
606 Ga0495600_0056746 3300046809 Bacteria 2559
607 Ga0495581_0129225 3300047315 Bacteria 1472
608 Ga0495604_0085845 3300047317 Bacteria 2348
609 Ga0495604_0142810 3300047317 Bacteria 1709
610 Ga0495674_0175836 3300047319 Bacteria 1784
611 Ga0495674_0178589 3300047319 Bacteria 1769
612 Ga0495674_0246562 3300047319 Bacteria 1471
613 Ga0495672_0222970 3300047320 Bacteria 930
614 Ga0495676_0111898 3300047321 Bacteria 2002
615 Ga0495680_0033486 3300047322 Bacteria 4159
616 Ga0495680_0095921 3300047322 Bacteria 2216
617 Ga0495680_0242207 3300047322 Bacteria 1280
618 Ga0495683_0047183 3300047323 Bacteria 2162
619 Ga0495675_0033866 3300047444 Bacteria 3261
620 Ga0495673_0017803 3300047469 Bacteria 3596
621 Ga0495673_0158890 3300047469 Bacteria 869
622 Ga0495684_0214045 3300047471 Bacteria 1415
623 Ga0495684_0428192 3300047471 Bacteria 924
624 Ga0495686_0170306 3300047472 Bacteria 1267
625 Ga0495602_0014932 3300048088 Bacteria 7859
626 Ga0495602_0290933 3300048088 Bacteria 1199
627 Ga0496100_0020431 3300048903 Bacteria 3970
628 Ga0496100_0116399 3300048903 Bacteria 1865
629 Ga0496101_0023314 3300048904 Bacteria 4274
630 Ga0496101_0096353 3300048904 Bacteria 2208
631 Ga0496102_0563932 3300048905 Bacteria 1061
632 Ga0496103_0085541 3300048906 Bacteria 1987
633 Ga0496104_0341923 3300048907 Bacteria 1409
634 Ga0496105_0374774 3300048908 Bacteria 1133
635 Ga0496106_0055368 3300048909 Bacteria 2998
636 Ga0496106_0657955 3300048909 Bacteria 837
637 Ga0496107_0331096 3300048910 Bacteria 1133
638 Ga0496108_0005061 3300048911 Bacteria 10650
639 Ga0496108_0903180 3300048911 Bacteria 758
640 Ga0496109_0003617 3300048912 Bacteria 12923
641 Ga0496109_0021676 3300048912 Bacteria 5685
642 Ga0496110_0001002 3300048913 Bacteria 19876
643 Ga0496110_0080492 3300048913 Bacteria 2903
644 Ga0496110_0361839 3300048913 Bacteria 1322
645 Ga0496110_0699405 3300048913 Bacteria 915
646 Ga0496111_0009201 3300048914 Bacteria 6578
647 Ga0496112_0000029 3300048915 Bacteria 122291
648 Ga0496112_0053753 3300048915 Bacteria 3956
649 Ga0496112_0077956 3300048915 Bacteria 3277
650 Ga0496113_0008012 3300048916 Bacteria 6851
651 Ga0496114_0002919 3300048917 Bacteria 13104
652 Ga0496114_0074669 3300048917 Bacteria 2854
653 Ga0496114_0306662 3300048917 Bacteria 1402
654 Ga0496115_0065909 3300048918 Bacteria 2926
655 Ga0496117_0104508 3300048920 Bacteria 1782
656 Ga0496118_0023875 3300048921 Bacteria 5297
657 Ga0496119_0018058 3300048922 Bacteria 5270
658 Ga0496119_0072006 3300048922 Bacteria 2021
659 Ga0496119_0097459 3300048922 Bacteria 1657
660 Ga0496120_0010285 3300048923 Bacteria 6545
661 Ga0496121_0002330 3300048924 Bacteria 29336
662 Ga0496121_0003220 3300048924 Bacteria 23485
663 Ga0496121_0007746 3300048924 Bacteria 12872
664 Ga0496121_0078537 3300048924 Bacteria 2623
665 Ga0496121_0085327 3300048924 Bacteria 2486
666 Ga0496121_0096049 3300048924 Bacteria 2301
667 Ga0496122_0006145 3300048925 Bacteria 13965
668 Ga0496123_0020508 3300048926 Bacteria 5167
669 Ga0496126_0026588 3300048929 Bacteria 5545
670 Ga0496126_0028761 3300048929 Bacteria 5291
671 Ga0496126_0045009 3300048929 Bacteria 4059
672 Ga0496126_0045843 3300048929 Bacteria 4015
673 Ga0496126_0071815 3300048929 Bacteria 3080
674 Ga0496126_0075172 3300048929 Bacteria 2999
675 Ga0496126_0240584 3300048929 Bacteria 1512
676 Ga0496126_0415817 3300048929 Bacteria 1088
677 Ga0501031_0002222 3300049568 Bacteria 12267
678 Ga0501031_0174810 3300049568 Bacteria 1403
679 Ga0501031_0199371 3300049568 Bacteria 1306
680 Ga0501032_0000312 3300049569 Bacteria 40889
681 Ga0501032_0001543 3300049569 Bacteria 18382
682 Ga0501032_0107164 3300049569 Bacteria 1851
683 Ga0501033_0000286 3300049570 Bacteria 48628
684 Ga0501033_0005202 3300049570 Bacteria 10338
685 Ga0501033_0039481 3300049570 Bacteria 3525
686 Ga0501033_0052666 3300049570 Bacteria 3016
687 Ga0501033_0067066 3300049570 Bacteria 2639
688 Ga0501033_0193124 3300049570 Bacteria 1456
689 Ga0501034_0003164 3300049571 Bacteria 18921
690 Ga0501034_0003735 3300049571 Bacteria 17202
691 Ga0501034_0013285 3300049571 Bacteria 8484
692 Ga0501034_0055187 3300049571 Bacteria 3999
693 Ga0501036_0000310 3300049572 Bacteria 33917
694 Ga0501036_0002522 3300049572 Bacteria 14368
695 Ga0501036_0225245 3300049572 Bacteria 1574
696 Ga0501037_0000118 3300049573 Bacteria 73584
697 Ga0501037_0003508 3300049573 Bacteria 11381
698 Ga0501037_0046610 3300049573 Bacteria 3179
699 Ga0501037_0114507 3300049573 Bacteria 1941
700 Ga0501038_0000248 3300049574 Bacteria 45662
701 Ga0501038_0001954 3300049574 Bacteria 19027
702 Ga0501038_0045196 3300049574 Bacteria 3824
703 Ga0501038_0084361 3300049574 Bacteria 2673
704 Ga0501038_0246566 3300049574 Bacteria 1416
705 Ga0501039_0000048 3300049575 Bacteria 102012
706 Ga0501039_0001321 3300049575 Bacteria 18130
707 Ga0501039_0179849 3300049575 Bacteria 1663
708 Ga0501041_0106737 3300049577 Bacteria 1736
709 Ga0501042_0129952 3300049578 Bacteria 1815
710 Ga0501043_0001719 3300049579 Bacteria 18921
711 Ga0501043_0006987 3300049579 Bacteria 8990
712 Ga0501043_0122966 3300049579 Bacteria 2035
713 Ga0501043_0253294 3300049579 Bacteria 1355
714 Ga0501046_0013782 3300049580 Bacteria 6834
715 Ga0501046_0104587 3300049580 Bacteria 2170
716 Ga0501046_0117272 3300049580 Bacteria 2028
717 Ga0501046_0411450 3300049580 Bacteria 976
718 Ga0501047_0003356 3300049581 Bacteria 15165
719 Ga0501047_0007161 3300049581 Bacteria 10480
720 Ga0501047_0058375 3300049581 Bacteria 3728
721 Ga0501047_0063735 3300049581 Bacteria 3555
722 Ga0501047_0088476 3300049581 Bacteria 2974
723 Ga0501047_0205420 3300049581 Bacteria 1829
724 Ga0501067_0172216 3300049583 Bacteria 1206
725 Ga0501068_0018033 3300049584 Bacteria 4087
726 Ga0501068_0063992 3300049584 Bacteria 2238
727 Ga0501069_0204331 3300049585 Bacteria 1145
728 Ga0501070_0003393 3300049586 Bacteria 13825
729 Ga0501070_0010716 3300049586 Bacteria 7748
730 Ga0501070_0028481 3300049586 Bacteria 4685
731 Ga0501070_0035001 3300049586 Bacteria 4197
732 Ga0501070_0078249 3300049586 Bacteria 2737
733 Ga0501070_0109124 3300049586 Bacteria 2286
734 Ga0501071_0053840 3300049587 Bacteria 2903
735 Ga0501071_0375349 3300049587 Bacteria 1084
736 Ga0501073_0066345 3300049589 Bacteria 2516
737 Ga0501073_0137288 3300049589 Bacteria 1694
738 Ga0501073_0186799 3300049589 Bacteria 1434
739 Ga0501074_0074802 3300049590 Bacteria 2432
740 Ga0501074_0149270 3300049590 Bacteria 1671
741 Ga0501075_0012911 3300049591 Bacteria 5950
742 Ga0501076_0042884 3300049592 Bacteria 3564
743 Ga0501076_0381836 3300049592 Bacteria 1158
744 Ga0501079_0156857 3300049741 Bacteria 1774
745 Ga0501079_0495317 3300049741 Bacteria 961
746 Ga0501080_0026461 3300049742 Bacteria 5390
747 Ga0501080_0050954 3300049742 Bacteria 3852
748 Ga0501080_0065807 3300049742 Bacteria 3371
749 Ga0501080_0165418 3300049742 Bacteria 2041
750 Ga0501081_0225242 3300049743 Bacteria 1364
751 Ga0501083_0021184 3300049744 Bacteria 4518
752 Ga0501083_0056277 3300049744 Bacteria 2636
753 Ga0501083_0288329 3300049744 Bacteria 1068
754 Ga0501035_0000118 3300049822 Bacteria 95482
755 Ga0501035_0000516 3300049822 Bacteria 43429
756 Ga0501035_0002724 3300049822 Bacteria 17145
757 Ga0501035_0063754 3300049822 Bacteria 3277
758 Ga0501035_0096310 3300049822 Bacteria 2600
759 Ga0501035_0148828 3300049822 Bacteria 2032
760 Ga0501044_0004188 3300049823 Bacteria 16214
761 Ga0501044_0012550 3300049823 Bacteria 9177
762 Ga0501044_0016160 3300049823 Bacteria 8022
763 Ga0501044_0026844 3300049823 Bacteria 6095
764 Ga0501044_0130412 3300049823 Bacteria 2508
765 Ga0501044_0138273 3300049823 Bacteria 2425
766 Ga0501044_0217450 3300049823 Bacteria 1862
767 Ga0501045_0025321 3300049824 Bacteria 4264
768 nmdc:mga03683_45827_c1 3300050489 Bacteria 1811
769 nmdc:mga03n38_164088_c1 3300050490 Bacteria 1127
770 nmdc:mga03n38_200075_c1 3300050490 Bacteria 1034
771 nmdc:mga00v17_13000_c1 3300050491 Bacteria 4611
772 nmdc:mga0yw44_12835_c1 3300050492 Bacteria 4384
773 nmdc:mga0yw44_205452_c1 3300050492 Bacteria 1302
774 nmdc:mga0yw44_84561_c1 3300050492 Bacteria 1995
775 nmdc:mga0yw44_8644_c1 3300050492 Bacteria 5088
776 nmdc:mga0k408_147178_c1 3300050493 Bacteria 1402
777 nmdc:mga0k408_36688_c1 3300050493 Bacteria 2814
778 nmdc:mga06z11_12988_c1 3300050494 Bacteria 3640
779 nmdc:mga06z11_148777_c1 3300050494 Bacteria 1329
780 nmdc:mga06z11_328747_c1 3300050494 Bacteria 913
781 nmdc:mga06z11_37634_c1 3300050494 Bacteria 2397
782 nmdc:mga06z11_61221_c2 3300050494 Bacteria 1410
783 nmdc:mga06z11_94407_c1 3300050494 Bacteria 1630
784 nmdc:mga07m45_140461_c1 3300050496 Bacteria 1399
785 nmdc:mga07m45_252996_c1 3300050496 Bacteria 1025
786 nmdc:mga05p37_2215_c1 3300050507 Bacteria 22641
787 nmdc:mga05p37_552998_c1 3300050507 Bacteria 1310
788 nmdc:mga05p37_662574_c1 3300050507 Bacteria 1166
789 nmdc:mga09592_261656_c1 3300050508 Bacteria 1500
790 nmdc:mga0qj67_212290_c1 3300050509 Bacteria 1572
791 nmdc:mga0qj67_221_c1 3300050509 Bacteria 38873
792 nmdc:mga0qj67_494106_c1 3300050509 Bacteria 984
793 nmdc:mga06r32_54301_c1 3300050510 Bacteria 3841
794 nmdc:mga06r32_76282_c1 3300050510 Bacteria 3255
795 nmdc:mga0n895_19634_c1 3300050512 Bacteria 6285
796 nmdc:mga0rr50_59329_c1 3300050513 Bacteria 2872
797 nmdc:mga08x19_21652_c1 3300050514 Bacteria 3972
798 nmdc:mga08x19_249883_c1 3300050514 Bacteria 1224
799 nmdc:mga08x19_37584_c1 3300050514 Bacteria 3073
800 nmdc:mga08x19_608564_c1 3300050514 Bacteria 774
801 nmdc:mga0a205_100676_c1 3300050515 Bacteria 2788
802 nmdc:mga0a205_23024_c1 3300050515 Bacteria 5907
803 nmdc:mga0sz30_3779_c1 3300050516 Bacteria 5451
804 Ga0495601_0058391 3300053077 Bacteria 2445
805 Ga0495601_0142710 3300053077 Bacteria 1562
806 Ga0495601_0176034 3300053077 Bacteria 1398
807 Ga0500610_0060134 3300053079 Bacteria 1983
808 Ga0500635_0009468 3300053080 Bacteria 2704
809 Ga0495655_0021216 3300053083 Bacteria 1468
810 Ga0495595_0079907 3300053084 Bacteria 1556
811 Ga0495619_0006785 3300053085 Bacteria 7242
812 Ga0495619_0011552 3300053085 Bacteria 5564
813 Ga0495619_0012982 3300053085 Bacteria 5248
814 Ga0495619_0191913 3300053085 Bacteria 1414
815 Ga0495619_0256127 3300053085 Bacteria 1213
816 Ga0495619_0324181 3300053085 Bacteria 1066
817 Ga0495619_0565934 3300053085 Bacteria 779
818 Ga0500643_010040 3300053087 Bacteria 3562
819 Ga0500643_012614 3300053087 Bacteria 3021
820 Ga0500644_0004361 3300053088 Bacteria 3538
821 Ga0500651_0051806 3300053093 Bacteria 2575
822 Ga0500566_0001659 3300053094 Bacteria 13060
823 Ga0500566_0008714 3300053094 Bacteria 6001
824 Ga0500566_0020899 3300053094 Bacteria 3850
825 Ga0500640_018114 3300053095 Bacteria 2999
826 Ga0500641_0008450 3300053096 Bacteria 3674
827 Ga0500650_0252984 3300053098 Bacteria 790
828 Ga0500554_012174 3300053102 Bacteria 2156
829 Ga0500556_0000956 3300053104 Bacteria 15501
830 Ga0500572_000255 3300053111 Bacteria 19104
831 Ga0500572_001715 3300053111 Bacteria 5691
832 Ga0500594_0023611 3300053118 Bacteria 1561
833 Ga0500595_000029 3300053119 Bacteria 122318
834 Ga0500595_003805 3300053119 Bacteria 6938
835 Ga0500595_011603 3300053119 Bacteria 3439
836 Ga0500595_013783 3300053119 Bacteria 3090
837 Ga0500595_044037 3300053119 Bacteria 1417
838 Ga0500595_059184 3300053119 Bacteria 1162
839 Ga0500608_033992 3300053122 Bacteria 2428
840 Ga0500614_004614 3300053123 Bacteria 2904
841 Ga0500642_0014749 3300053130 Bacteria 2917
842 Ga0500652_005799 3300053131 Bacteria 3924
843 Ga0500652_135207 3300053131 Bacteria 1027
844 Ga0500559_0000299 3300053136 Bacteria 38041
845 Ga0500559_0004223 3300053136 Bacteria 6873
846 Ga0500568_0000035 3300053139 Bacteria 137912
847 Ga0500568_0045993 3300053139 Bacteria 1735
848 Ga0500603_002486 3300053150 Bacteria 4028
849 Ga0500603_007058 3300053150 Bacteria 2457
850 Ga0500603_017879 3300053150 Bacteria 1700
851 Ga0500616_0000006 3300053153 Bacteria 944738
852 Ga0500616_0000038 3300053153 Bacteria 386801
853 Ga0500620_008801 3300053155 Bacteria 2571
854 Ga0500622_0005458 3300053156 Bacteria 7632
855 Ga0500622_0028257 3300053156 Bacteria 2952
856 Ga0500622_0067368 3300053156 Bacteria 1816
857 Ga0500627_0097927 3300053158 Bacteria 1315
858 Ga0500630_008925 3300053159 Bacteria 4923
859 Ga0500638_023336 3300053162 Bacteria 2940
860 Ga0500638_030769 3300053162 Bacteria 2586
861 Ga0500639_000477 3300053163 Bacteria 19965
862 Ga0500636_0263892 3300053177 Bacteria 870
863 Ga0500637_0002325 3300053178 Bacteria 8416
864 Ga0500637_0016108 3300053178 Bacteria 3979
865 Ga0500576_033923 3300053725 Bacteria 2313
866 Ga0500645_000290 3300053730 Bacteria 36019
867 Ga0500645_005569 3300053730 Bacteria 4612
868 Ga0500596_000406 3300053735 Bacteria 7868
869 Ga0501084_0114989 3300054114 Bacteria 2262
870 Ga0500661_003768 3300055283 Bacteria 2846
871 Ga0501082_0087994 3300060353 Bacteria 2680
872 Ga0501082_0185310 3300060353 Bacteria 1811
873 Ga0501082_0212855 3300060353 Bacteria 1681
874 Ga0501082_0339302 3300060353 Bacteria 1309
875 Ga0530510_0144391 3300061734 Bacteria 1755
876 2503202214 2503198000 Bacteria 6884444
877 2509117019 2508501123 Bacteria 6283661
878 2509140637 2508501127 Bacteria 7037543
879 2509370709 2509276018 Bacteria 6910194
880 2509396862 2509276022 Bacteria 6200534
881 2510317500 2510065059 Bacteria 6847884
882 2512930887 2512875016 Bacteria 6529530
883 2512958613 2512875024 Bacteria 7195110
884 2513609925 2513237090 Bacteria 7096802
885 2514034972 2513237164 Bacteria 7563725
886 2514418934 2513237305 Bacteria 7293571
887 2514589371 2513237351 Bacteria 6968952
888 2588516567 2588253730 Bacteria 6881675
889 2597814095 2597489875 Bacteria 7010078
890 2599938077 2599185301 Bacteria 6161860
891 2643989390 2643221595 Bacteria 6565519
892 2644152962 2643221627 Bacteria 6761570
893 2688599424 2687453392 Bacteria 6880454
894 2694632210 2693429783 Bacteria 7019804
895 2694634382 2693429784 Bacteria 7241525
896 2723576384 2721755686 Bacteria 7343952
897 2723842321 2721755755 Bacteria 8322773
898 2738716120 2738541276 Bacteria 4690596
899 2756675899 2756170246 Bacteria 7451806
900 2792748537 2791355123 Bacteria 8049106
901 2841740015 2841734538 Bacteria 6784580
902 2844006439 2844002411 Bacteria 7168230
903 2844014702 2844009547 Bacteria 6728125
904 2847672505 2847670302 Bacteria 6165597
905 2856315520 2856314179 Bacteria 6477897
906 2856325846 2856320880 Bacteria 7263508
907 2856328976 2856328259 Bacteria 6528202
908 2856340026 2856334872 Bacteria 7037011
909 2856343182 2856342000 Bacteria 7176905
910 2856354497 2856349417 Bacteria 6230045
911 2856363299 2856356410 Bacteria 6297484
912 2856368821 2856364286 Bacteria 6939991
913 2857350207 2857349434 Bacteria 7926032
914 2857368576 2857367948 Bacteria 6965560
915 2869165264 2869162929 Bacteria 6399702
916 2869174789 2869169390 Bacteria 6659796
917 2869240792 2869234852 Bacteria 6654993
918 2869249563 2869242130 Bacteria 6609239
919 2869252189 2869249662 Bacteria 6868783
920 2869262533 2869256925 Bacteria 6981691
921 2869268000 2869264136 Bacteria 6880765
922 2869278626 2869278585 Bacteria 7077053
923 2869291316 2869285874 Bacteria 6901219
924 2871433596 2871429161 Bacteria 6547891
925 2871441738 2871435913 Bacteria 6880295
926 2871458147 2871451962 Bacteria 7336357
927 2871466359 2871459585 Bacteria 6866887
928 2871473865 2871466892 Bacteria 6923287
929 2871475309 2871474448 Bacteria 6806570
930 2871484947 2871481445 Bacteria 6700002
931 2871495782 2871488783 Bacteria 6929816
932 2871502990 2871495908 Bacteria 6935695
933 2874103483 2874102143 Bacteria 6342645
934 2874111774 2874109183 Bacteria 6517025
935 2874117825 2874116593 Bacteria 6674494
936 2874125997 2874123672 Bacteria 7238285
937 2874132040 2874131515 Bacteria 6820270
938 2874145212 2874139085 Bacteria 7021506
939 2874153197 2874146452 Bacteria 7533118
940 2874160462 2874155637 Bacteria 6724144
941 2874167276 2874162495 Bacteria 6174670
942 2874176202 2874168670 Bacteria 8062617
943 2874616504 2874612657 Bacteria 8252029
944 2876365441 2876363079 Bacteria 6544991
945 2876386079 2876386047 Bacteria 6698674
946 2876394971 2876392853 Bacteria 6660880
947 2876405863 2876399893 Bacteria 6927900
948 2876407655 2876406927 Bacteria 6191900
949 2876419488 2876413966 Bacteria 6831344
950 2876426508 2876420981 Bacteria 6687741
951 2878037193 2878035449 Bacteria 6555736
952 2878743409 2878738818 Bacteria 7136951
953 2878751207 2878745973 Bacteria 6867388
954 2878753419 2878753008 Bacteria 6922523
955 2878766879 2878760144 Bacteria 6823465
956 2878774077 2878767105 Bacteria 6898628
957 2878774794 2878774303 Bacteria 6108671
958 2878786450 2878781027 Bacteria 6834456
959 2878796839 2878788777 Bacteria 6567085
960 2881152865 2881147464 Bacteria 7779814
961 2881156358 2881155292 Bacteria 6461656
962 2881168310 2881161766 Bacteria 7127907
963 2881860674 2881853255 Bacteria 6698367
964 2881863389 2881861095 Bacteria 7128710
965 2882637878 2882632389 Bacteria 8154593
966 2882918488 2882912400 Bacteria 6801539
967 2885310306 2885305155 Bacteria 7348390
968 2885317118 2885312484 Bacteria 6415165
969 2885319195 2885318864 Bacteria 6729568
970 2885329306 2885326080 Bacteria 7134805
971 2885339137 2885334103 Bacteria 7216818
972 2885350761 2885350715 Bacteria 6787678
973 2885380852 2885374607 Bacteria 8927485
974 2888340142 2888337043 Bacteria 6629336
975 2888347467 2888343758 Bacteria 6611049
976 2888356551 2888350351 Bacteria 7372807
977 2889011458 2889010040 Bacteria 6749192
978 2889016812 2889016732 Bacteria 6700763
979 2903455607 2903448605 Bacteria 7357801
980 2903495274 2903492973 Bacteria 13473544
981 2903501705 2903492973 Bacteria 13473544
982 2903513687 2903513507 Bacteria 6344008
983 2903522797 2903521522 Bacteria 6525694
984 2903532987 2903528002 Bacteria 6586099
985 2903548179 2903540706 Bacteria 7062119
986 2904661602 2904659560 Bacteria 6685615
987 2904692035 2904690495 Bacteria 9412302
988 2906313148 2906308376 Bacteria 6841989
989 2906325859 2906321335 Bacteria 6579571
990 2906331885 2906328253 Bacteria 6585166
991 2906360990 2906354277 Bacteria 6991324
992 2906365864 2906363423 Bacteria 6856682
993 2906370795 2906370794 Bacteria 6881062
994 2906391321 2906386501 Bacteria 5977019
995 2906394524 2906393657 Bacteria 6790866
996 2906402998 2906401398 Bacteria 6693206
997 2906412644 2906408224 Bacteria 6162342
998 2906415657 2906414383 Bacteria 6580790
999 2906429386 2906427513 Bacteria 6375796
1000 2908746533 2908739725 Bacteria 8628932
1001 2908757314 2908756301 Bacteria 8864324
1002 2922134506 2922130491 Bacteria 7173936
1003 2922163040 2922158528 Bacteria 6573167
1004 2922177105 2922172374 Bacteria 6167644
1005 2922181129 2922178524 Bacteria 6025201
1006 2922187576 2922185730 Bacteria 7113964
1007 2924710530 2924710171 Bacteria 6752351
1008 2924732086 2924726620 Bacteria 6271473
1009 2924736249 2924733363 Bacteria 7574837
1010 2924747242 2924741084 Bacteria 6661321
1011 2924750849 2924748358 Bacteria 6154725
1012 2924759740 2924754689 Bacteria 6774424
1013 2924768981 2924762789 Bacteria 6561353
1014 2924781221 2924776078 Bacteria 7492003
1015 2924789666 2924784321 Bacteria 7416538
1016 2935632847 2935630451 Bacteria 8169952
1017 2937820701 2937813078 Bacteria 7783518
1018 2937827301 2937822353 Bacteria 7290551
1019 2937837770 2937836603 Bacteria 6811263
1020 2937849134 2937848649 Bacteria 6983481
1021 2937866851 2937861824 Bacteria 6660327
1022 2937869017 2937868953 Bacteria 6639878
1023 2937878982 2937877337 Bacteria 7246526
1024 2937895569 2937891427 Bacteria 6357007
1025 2937975272 2937972304 Bacteria 7532020
1026 2938002004 2937994558 Bacteria 7036190
1027 2938017392 2938014810 Bacteria 6700592
1028 2939672808 2939669807 Bacteria 5028511
1029 2941508488 2941507105 Bacteria 8166816
1030 2941516319 2941515067 Bacteria 8166720
1031 2941524665 2941523033 Bacteria 8169134
1032 2952254677 2952252522 Bacteria 4171745
1033 2958034742 2958034702 Bacteria 6989922
1034 2958043130 2958041894 Bacteria 13082850
1035 2958066990 2958064165 Bacteria 7158582
1036 2958077509 2958071322 Bacteria 6815895
1037 2958086156 2958084443 Bacteria 7312792
1038 2958092415 2958092219 Bacteria 6861151
1039 2958103053 2958100919 Bacteria 6800575
1040 2958121501 2958115193 Bacteria 6923548
1041 2958123717 2958122699 Bacteria 7280457
1042 2958135716 2958130278 Bacteria 6897202
1043 2958141789 2958137437 Bacteria 6050276
1044 2958145593 2958144490 Bacteria 6677056
1045 2958162603 2958158011 Bacteria 6058449
1046 2958172058 2958165035 Bacteria 6906348
1047 2958177823 2958172287 Bacteria 6716688
1048 2958185207 2958179912 Bacteria 6874908
1049 2961083474 2961077736 Bacteria 7079850
1050 2961116755 2961114664 Bacteria 6680456
1051 2961132800 2961127735 Bacteria 7196641
1052 2961141162 2961136820 Bacteria 6775228
1053 2961170505 2961163497 Bacteria 6901077
1054 2961177863 2961170736 Bacteria 7072258
1055 2961187358 2961183825 Bacteria 6688536
1056 2963648338 2963644680 Bacteria 6530403
1057 2965025252 2965018300 Bacteria 6883036
1058 2965029525 2965025482 Bacteria 6532201
1059 2965037238 2965032056 Bacteria 6887443
1060 2965043381 2965040258 Bacteria 6855979
1061 2965052370 2965047637 Bacteria 6623551
1062 2965065780 2965062239 Bacteria 7412989
1063 2965095798 2965089291 Bacteria 6866420
1064 2965103067 2965102966 Bacteria 6800987
1065 2968003130 2967996073 Bacteria 6787468
1066 2968003956 2968003550 Bacteria 6929263
1067 2968017850 2968016561 Bacteria 7022047
1068 2968084851 2968083720 Bacteria 7351627
1069 2968095321 2968091066 Bacteria 6052692
1070 2968103129 2968097103 Bacteria 6107094
1071 2968112662 2968110612 Bacteria 6814636
1072 2968123104 2968117919 Bacteria 6536078
1073 2968128561 2968128360 Bacteria 6270294
1074 2968144975 2968138860 Bacteria 6605449
1075 2968178891 2968171901 Bacteria 6894245
1076 2970471975 2970469710 Bacteria 6969209
1077 2970495821 2970489779 Bacteria 6517260
1078 2970510539 2970503327 Bacteria 7099517
1079 2970512671 2970510686 Bacteria 7006402
1080 2970531713 2970524798 Bacteria 6840927
1081 2970542133 2970540015 Bacteria 6977556
1082 2970550037 2970547951 Bacteria 6931819
1083 2970561735 2970554993 Bacteria 6814252
1084 2970593222 2970593180 Bacteria 7073582
1085 2970621111 2970619444 Bacteria 6986144
1086 2970632268 2970627176 Bacteria 6680862
1087 2977822641 2977821940 Bacteria 6906439
1088 2977833372 2977828996 Bacteria 7007971
1089 2977848999 2977843712 Bacteria 6753583
1090 2977858093 2977851361 Bacteria 6694324
1091 2977861628 2977858184 Bacteria 6215359
1092 2977872514 2977864932 Bacteria 7534097
1093 2977873520 2977872689 Bacteria 7270173
1094 2977906501 2977898635 Bacteria 6675551
1095 2977914146 2977907340 Bacteria 6577984
1096 2977919572 2977915119 Bacteria 6829656
1097 2977923087 2977922695 Bacteria 6956781
1098 2977941406 2977935797 Bacteria 6252826
1099 2977948247 2977942078 Bacteria 7570577
1100 2977991877 2977986579 Bacteria 6581278
1101 2979713358 2979710463 Bacteria 6785254
1102 2979769314 2979764755 Bacteria 6610066
1103 2979773494 2979772303 Bacteria 6618277
1104 2979784879 2979779861 Bacteria 6219781
1105 2979795513 2979793036 Bacteria 6808957
1106 2979815413 2979808191 Bacteria 7179355
1107 2987637395 2987636660 Bacteria 8088555
1108 2987653983 2987652177 Bacteria 6969023
1109 2987666745 2987659509 Bacteria 6966464
1110 2987670659 2987666974 Bacteria 6509233
1111 2987676196 2987673487 Bacteria 6884027
1112 2996314777 2996310559 Bacteria 6357320
1113 2996345397 2996341866 Bacteria 6643098
1114 2996350908 2996348954 Bacteria 7239054
1115 2996392567 2996386984 Bacteria 6978667
1116 3000138489 3000135777 Bacteria 6891109
1117 3004169588 3004167301 Bacteria 8330599
1118 3004195748 3004188549 Bacteria 6952365
1119 3004197932 3004195979 Bacteria 6776956
1120 3004206208 3004203850 Bacteria 7307914
1121 3004211683 3004211236 Bacteria 7417683
1122 3004218930 3004218560 Bacteria 7421728
1123 3004238893 3004232784 Bacteria 6662140
1124 3004242976 3004239961 Bacteria 6892290
1125 3004254293 3004248173 Bacteria 6563236
1126 3004275201 3004268573 Bacteria 7043476
1127 3004277606 3004275668 Bacteria 7114440
1128 3004341002 3004334049 Bacteria 8449246
1129 637073933 637000159 Bacteria 7596297
1130 649873928 649633066 Bacteria 6690028
1131 8004305512 8004300914 Bacteria 6132239
1132 8004313106 8004312739 Bacteria 7444653
1133 8004363790 8004361976 Bacteria 6858373
1134 8004374991 8004374579 Bacteria 6898112
1135 8004394128 8004387939 Bacteria 7049250
1136 8004449876 8004445564 Bacteria 6322258
1137 8004634074 8004633249 Bacteria 6723080
1138 8004646674 8004640170 Bacteria 6723001
1139 8004713234 8004703790 Bacteria 8006957
1140 8004719405 8004714634 Bacteria 6776161
1141 8004733261 8004727605 Bacteria 6643904
1142 8006996938 8006994254 Bacteria 8309700
1143 8055621529 8055617313 Bacteria 7548464
1144 Ga0157339_1011728
1145 JGI24740J21852_10009490
1146 JGI24751J29686_10029641
1147 JGI25157J39369_1001294
1148 JGI25406J46586_10014352
1149 JGI25153J46596_10017786
1150 rootH1_10000936
1151 rootH1_10008698
1152 JGI25404J52841_10013017
1153 Ga0055542_1000775
1154 Ga0055529_1002235
1155 Ga0065712_10020326
1156 Ga0065715_10121096
1157 Ga0065715_10352229
1158 Ga0070658_10088079
1159 Ga0070658_10133802
1160 Ga0070658_10249162
1161 Ga0070676_10116664
1162 Ga0070676_10334371
1163 Ga0070683_100059968
1164 Ga0070670_100542790
1165 Ga0070677_10026835
1166 Ga0068869_100003218
1167 Ga0068869_100439513
1168 Ga0070680_100048987
1169 Ga0070680_100318622
1170 Ga0070680_100451141
1171 Ga0070680_100494620
1172 Ga0070682_100023021
1173 Ga0068868_100656117
1174 Ga0070660_100395616
1175 Ga0070691_10154219
1176 Ga0070661_100073843
1177 Ga0070675_100052858
1178 Ga0070675_100082169
1179 Ga0070675_100084106
1180 Ga0070671_100018362
1181 Ga0070671_100203660
1182 Ga0070671_100431752
1183 Ga0070674_100068091
1184 Ga0070674_100860703
1185 Ga0070673_100027881
1186 Ga0070673_100036731
1187 Ga0070688_100179388
1188 Ga0070688_100216359
1189 Ga0070659_100018350
1190 Ga0070659_100055791
1191 Ga0070659_100247872
1192 Ga0070667_100372473
1193 Ga0070709_10011341
1194 Ga0070709_10042115
1195 Ga0070709_10068928
1196 Ga0070709_10243424
1197 Ga0070714_100017392
1198 Ga0070714_100080276
1199 Ga0070713_100007558
1200 Ga0070713_100015955
1201 Ga0070713_100016717
1202 Ga0070713_100031430
1203 Ga0070710_10007309
1204 Ga0070711_100020389
1205 Ga0070711_100027190
1206 Ga0070711_100041309
1207 Ga0070711_100076214
1208 Ga0070708_100616473
1209 Ga0070663_100010007
1210 Ga0070663_100302487
1211 Ga0070678_100047257
1212 Ga0070681_10000509
1213 Ga0070681_10053509
1214 Ga0070681_10064749
1215 Ga0070681_10197411
1216 Ga0070681_10612104
1217 Ga0070681_10638136
1218 Ga0070681_10930652
1219 Ga0068867_100104271
1220 Ga0068867_100466695
1221 Ga0068867_100587420
1222 Ga0070706_100310250
1223 Ga0070698_100037846
1224 Ga0070698_100180884
1225 Ga0070698_100246398
1226 Ga0070679_100023336
1227 Ga0070679_100161142
1228 Ga0070679_100254244
1229 Ga0070684_100010129
1230 Ga0070684_100046744
1231 Ga0070697_100111750
1232 Ga0070697_100172590
1233 Ga0068853_100067677
1234 Ga0068853_100252069
1235 Ga0068853_100322792
1236 Ga0068853_100442988
1237 Ga0068853_100607931
1238 Ga0068853_100684369
1239 Ga0070672_100080702
1240 Ga0070672_100274356
1241 Ga0070686_100244810
1242 Ga0070686_100512879
1243 Ga0070696_100198074
1244 Ga0070693_100101637
1245 Ga0070665_100107922
1246 Ga0070665_100225890
1247 Ga0070665_100692068
1248 Ga0068855_100075791
1249 Ga0068855_100676345
1250 Ga0068855_100685653
1251 Ga0070664_100091744
1252 Ga0070664_100641202
1253 Ga0068857_100025776
1254 Ga0068857_100045564
1255 Ga0068857_100085007
1256 Ga0068857_100110102
1257 Ga0068854_100498001
1258 Ga0068856_100019492
1259 Ga0068856_100188914
1260 Ga0068852_100020134
1261 Ga0068859_100062589
1262 Ga0068859_100266275
1263 Ga0068864_100099419
1264 Ga0068851_10037476
1265 Ga0068851_10043364
1266 Ga0068863_100453253
1267 Ga0068858_100075077
1268 Ga0068858_100103740
1269 Ga0068858_100419779
1270 Ga0068860_100073539
1271 Ga0068860_100156599
1272 Ga0068862_100667541
1273 Ga0081455_10000142
1274 Ga0081455_10001715
1275 Ga0081455_10028348
1276 Ga0081455_10212197
1277 Ga0081540_1006097
1278 Ga0081539_10003011
1279 Ga0081539_10003789
1280 Ga0081539_10016697
1281 Ga0081539_10024885
1282 Ga0081539_10036208
1283 Ga0070717_10006086
1284 Ga0070717_10014983
1285 Ga0070717_10187097
1286 Ga0070717_10212601
1287 Ga0075365_10014170
1288 Ga0075365_10083995
1289 Ga0075365_10138962
1290 Ga0075368_10093631
1291 Ga0075368_10096675
1292 Ga0075363_100051055
1293 Ga0075363_100115698
1294 Ga0075363_100127543
1295 Ga0075363_100174066
1296 Ga0075363_100340530
1297 Ga0075364_10032560
1298 Ga0075364_10039017
1299 Ga0070715_10001945
1300 Ga0070716_100003460
1301 Ga0070716_100100258
1302 Ga0070712_100294326
1303 Ga0070712_100406563
1304 Ga0075362_10031084
1305 Ga0075362_10148340
1306 Ga0075367_10020138
1307 Ga0075367_10104871
1308 Ga0075367_10123154
1309 Ga0075367_10259816
1310 Ga0075367_10294456
1311 Ga0075369_10002893
1312 Ga0075366_10056051
1313 Ga0075366_10179854
1314 Ga0075366_10318275
1315 Ga0097621_100073805
1316 Ga0097621_100993647
1317 Ga0075370_10129113
1318 Ga0075370_10202400
1319 Ga0068871_100643138
1320 Ga0075428_100010071
1321 Ga0075428_100621787
1322 Ga0075428_100700737
1323 Ga0075430_100000066
1324 Ga0075431_100455294
1325 Ga0075433_10130326
1326 Ga0075434_100025332
1327 Ga0075429_100204653
1328 Ga0075429_100369191
1329 Ga0068865_100081248
1330 Ga0075436_100069355
1331 Ga0097620_100062596
1332 Ga0097620_100266269
1333 Ga0099824_1020962
1334 Ga0099822_1011448
1335 Ga0075435_100109349
1336 Ga0075435_100696174
1337 Ga0099794_10069546
1338 Ga0099794_10173713
1339 Ga0099795_10035212
1340 Ga0105240_10025071
1341 Ga0105240_10073053
1342 Ga0105240_10313661
1343 Ga0105240_10322294
1344 Ga0105240_10449290
1345 Ga0111539_10021821
1346 Ga0111539_10082461
1347 Ga0111539_10818960
1348 Ga0105245_10073316
1349 Ga0105245_10457520
1350 Ga0105247_10308056
1351 Ga0114129_10001651
1352 Ga0114129_10109125
1353 Ga0114129_10336055
1354 Ga0114129_10783343
1355 Ga0105243_10395666
1356 Ga0105241_10051648
1357 Ga0105241_10101531
1358 Ga0105241_10289506
1359 Ga0105242_10032744
1360 Ga0105242_10093354
1361 Ga0105242_10305092
1362 Ga0105248_10006018
1363 Ga0105248_10033707
1364 Ga0105248_10035084
1365 Ga0105248_10044373
1366 Ga0105248_10089880
1367 Ga0105248_10157928
1368 Ga0105248_10413806
1369 Ga0105248_10916811
1370 Ga0105237_10017110
1371 Ga0105237_10113090
1372 Ga0105237_10178604
1373 Ga0105237_10903388
1374 Ga0105238_10075306
1375 Ga0105238_10143365
1376 Ga0105238_10166827
1377 Ga0105238_10195097
1378 Ga0105238_10291275
1379 Ga0105238_10346574
1380 Ga0105238_10348807
1381 Ga0105238_10467326
1382 Ga0105238_10647001
1383 Ga0105249_10000966
1384 Ga0105249_10297802
1385 Ga0105239_10059018
1386 Ga0105239_10106215
1387 Ga0105239_10229979
1388 Ga0105246_10011785
1389 Ga0157371_10113120
1390 Ga0157371_10614287
1391 Ga0157370_10016717
1392 Ga0157370_10054269
1393 Ga0157370_10077887
1394 Ga0157369_10004452
1395 Ga0157369_10014713
1396 Ga0157369_10174636
1397 Ga0157374_10069050
1398 Ga0157374_10534305
1399 Ga0157378_10860871
1400 Ga0163162_10171606
1401 Ga0163162_10240868
1402 Ga0163162_10655867
1403 Ga0157372_10033715
1404 Ga0157372_10564407
1405 Ga0157375_10008454
1406 Ga0157375_10391030
1407 Ga0157375_11130458
1408 Ga0163163_10178983
1409 Ga0163163_10527199
1410 Ga0157380_10000903
1411 Ga0157380_10015620
1412 Ga0157380_10083652
1413 Ga0157377_10311151
1414 Ga0157379_10038839
1415 Ga0157379_10997562
1416 Ga0157376_10267225
1417 Ga0157376_10316652
1418 Ga0157376_10377734
1419 Ga0157376_10486339
1420 Ga0182005_1014368
1421 Ga0163161_10217294
1422 Ga0206356_10788712
1423 Ga0213873_10015136
1424 Ga0213874_10015852
1425 Ga0213876_10069114
1426 Ga0213876_10092020
1427 Ga0213876_10187711
1428 Ga0213876_10269826
1429 Ga0209026_1000002
1430 Ga0209677_103245
1431 Ga0209148_1000072
1432 Ga0209759_1000238
1433 Ga0209233_1001163
1434 Ga0209233_1003251
1435 Ga0209455_1000133
1436 Ga0209455_1007678
1437 Ga0209676_1000159
1438 Ga0209025_1075848
1439 Ga0209758_1002512
1440 Ga0209758_1011055
1441 Ga0209758_1013103
1442 Ga0209050_1019353
1443 Ga0207682_10018378
1444 Ga0207692_10042518
1445 Ga0207692_10062177
1446 Ga0207692_10064809
1447 Ga0207692_10103275
1448 Ga0207710_10075341
1449 Ga0207688_10221004
1450 Ga0207680_10069321
1451 Ga0207647_10028081
1452 Ga0207685_10022096
1453 Ga0207699_10029708
1454 Ga0207699_10042426
1455 Ga0207699_10060836
1456 Ga0207699_10080233
1457 Ga0207699_10223517
1458 Ga0207645_10022003
1459 Ga0207645_10089776
1460 Ga0207705_10099634
1461 Ga0207705_10102494
1462 Ga0207705_10542103
1463 Ga0207684_10273670
1464 Ga0207654_10025069
1465 Ga0207654_10025705
1466 Ga0207707_10000706
1467 Ga0207707_10002136
1468 Ga0207707_10023258
1469 Ga0207707_10203073
1470 Ga0207695_10032870
1471 Ga0207695_10101196
1472 Ga0207695_10134404
1473 Ga0207695_10144924
1474 Ga0207695_10181939
1475 Ga0207695_10263494
1476 Ga0207671_10048021
1477 Ga0207671_10178522
1478 Ga0207693_10001853
1479 Ga0207693_10024596
1480 Ga0207693_10038993
1481 Ga0207693_10051541
1482 Ga0207693_10106698
1483 Ga0207693_10495385
1484 Ga0207663_10047300
1485 Ga0207663_10121066
1486 Ga0207660_10002043
1487 Ga0207660_10086669
1488 Ga0207660_10090850
1489 Ga0207660_10420912
1490 Ga0207662_10343747
1491 Ga0207657_10002667
1492 Ga0207657_10004672
1493 Ga0207652_10001458
1494 Ga0207652_10221012
1495 Ga0207652_10590962
1496 Ga0207646_10151697
1497 Ga0207694_10000426
1498 Ga0207694_10034603
1499 Ga0207694_10181788
1500 Ga0207694_10387088
1501 Ga0207650_10014724
1502 Ga0207650_10266069
1503 Ga0207650_10413782
1504 Ga0207650_10698783
1505 Ga0207659_10141312
1506 Ga0207659_10583129
1507 Ga0207659_10727304
1508 Ga0207687_10002927
1509 Ga0207700_10023163
1510 Ga0207700_10059333
1511 Ga0207700_10136160
1512 Ga0207700_10334237
1513 Ga0207664_10036603
1514 Ga0207664_10173182
1515 Ga0207664_10269816
1516 Ga0207664_10418555
1517 Ga0207644_10141114
1518 Ga0207644_10695877
1519 Ga0207690_10050630
1520 Ga0207690_10409491
1521 Ga0207690_10474259
1522 Ga0207686_10027871
1523 Ga0207686_10039863
1524 Ga0207686_10373399
1525 Ga0207670_10173218
1526 Ga0207669_10051994
1527 Ga0207669_10494405
1528 Ga0207669_10711292
1529 Ga0207665_10001158
1530 Ga0207665_10194274
1531 Ga0207665_10215048
1532 Ga0207691_10013601
1533 Ga0207691_10296056
1534 Ga0207711_10026007
1535 Ga0207711_10045472
1536 Ga0207711_10627032
1537 Ga0207689_10044976
1538 Ga0207689_10054965
1539 Ga0207661_10001495
1540 Ga0207661_10354106
1541 Ga0207667_10007733
1542 Ga0207667_10075757
1543 Ga0207667_10137662
1544 Ga0207651_10353562
1545 Ga0207712_10001525
1546 Ga0207712_10062382
1547 Ga0207668_10152446
1548 Ga0207658_10390307
1549 Ga0207658_10639787
1550 Ga0207703_10005220
1551 Ga0207703_10273626
1552 Ga0207703_10280570
1553 Ga0207703_10444813
1554 Ga0207639_10098359
1555 Ga0207639_10364706
1556 Ga0207639_10500078
1557 Ga0207678_10018939
1558 Ga0207708_10252605
1559 Ga0207702_10047548
1560 Ga0207702_10185517
1561 Ga0207702_10604158
1562 Ga0207641_10439960
1563 Ga0207648_10039754
1564 Ga0207648_10082512
1565 Ga0207676_10035526
1566 Ga0207674_10046693
1567 Ga0207674_10063123
1568 Ga0207674_10115730
1569 Ga0207674_10138200
1570 Ga0207674_10505399
1571 Ga0207675_100576205
1572 Ga0207683_10140063
1573 Ga0207698_10049902
1574 Ga0209389_1000034
1575 Ga0209589_1000038
1576 Ga0209589_1000055
1577 Ga0209489_100023
1578 Ga0209489_100128
1579 Ga0209700_100137
1580 Ga0209588_1018216
1581 Ga0209588_1053981
1582 Ga0209813_10041459
1583 Ga0209813_10117252
1584 Ga0207428_10327690
1585 Ga0268266_10059855
1586 Ga0268266_10256732
1587 Ga0268266_10336109
1588 Ga0268266_10338317
1589 Ga0268265_11031113
1590 Ga0268264_10044627
1591 Ga0265318_10046685
1592 Ga0265338_10078256
1593 Ga0265325_10005877
1594 Ga0265325_10140940
1595 Ga0265325_10145294
1596 Ga0265329_10054334
1597 Ga0265340_10001703
1598 Ga0265340_10031016
1599 Ga0265339_10000281
1600 Ga0265316_10002875
1601 Ga0265316_10143679
1602 Ga0307408_100000394
1603 Ga0307408_100005603
1604 Ga0265313_10024804
1605 Ga0307508_10109636
1606 Ga0316575_10184744
1607 Ga0265314_10094954
1608 Ga0265314_10097023
1609 Ga0265342_10271966
1610 Ga0316576_10206791
1611 Ga0316578_10018002
1612 Ga0316578_10033662
1613 Ga0316578_10102161
1614 Ga0307406_10001502
1615 Ga0307414_10192732
1616 Ga0307414_10459121
1617 Ga0307510_10041241
1618 Ga0316215_1000933
1619 Ga0373952_0037037
1620 Ga0373936_0129841
1621 Ga0373939_0104127
1622 Ga0373953_0034219
1623 Ga0373953_0074970
1624 Ga0373954_0078468
1625 Ga0373955_0023876
1626 Ga0373955_0045640
1627 Ga0373924_0179132
1628 Ga0373931_0036143
1629 Ga0373935_0097602
1630 Ga0373935_0177872
1631 Ga0373927_0018419
1632 Ga0373927_0132297
1633 Ga0373927_0253162
1634 Ga0373933_0000105
1635 Ga0373933_0005822
1636 Ga0373933_0044569
1637 Ga0373933_0241193
1638 Ga0373947_0021248
1639 Ga0373947_0235245
1640 Ga0373937_0006367
1641 Ga0373937_0020230
1642 Ga0373937_0026584
1643 Ga0373937_0036084
1644 Ga0373937_0254810
1645 Ga0373937_0344661
1646 Ga0316582_0174477
1647 Ga0316582_0362958
1648 Ga0316584_0045589
1649 Ga0373925_0703248
1650 Ga0395899_0161981
1651 Ga0395900_0036754
1652 Ga0395898_0012482
1653 Ga0395898_0437813
1654 Ga0395905_0222072
1655 Ga0395905_0258847
1656 Ga0436364_0257495
1657 Ga0436364_0356065
1658 Ga0395901_0009035
1659 Ga0395901_0046917
1660 Ga0400483_082903
1661 Ga0436365_0115993
1662 Ga0436365_0219669
1663 Ga0436365_0472623
1664 Ga0436365_0507057
1665 Ga0436365_0621927
1666 Ga0436365_0699198
1667 Ga0436365_1885077
1668 Ga0436360_0068302
1669 Ga0436361_0885416
1670 Ga0436363_1200244
1671 Ga0436363_1323175
1672 Ga0436362_0387585
1673 Ga0436362_0576405
1674 Ga0439453_0001364
1675 Ga0439453_0045008
1676 Ga0439465_0095152
1677 Ga0439465_0110872
1678 Ga0451845_0689861
1679 Ga0439443_013683
1680 Ga0450891_003705
1681 Ga0439435_0005297
1682 Ga0439435_0006166
1683 Ga0439460_0034968
1684 Ga0439460_0139946
1685 Ga0466969_0017044
1686 Ga0466972_0035561
1687 Ga0466966_0048180
1688 Ga0466963_0065235
1689 Ga0466963_0126272
1690 Ga0466964_0118568
1691 Ga0466971_0110697
1692 Ga0466970_0150007
1693 Ga0466960_0102594
1694 Ga0466960_0171288
1695 Ga0466959_0033654
1696 Ga0466959_0035729
1697 Ga0466967_0052523
1698 Ga0466967_0122587
1699 Ga0466967_0606946
1700 Ga0495592_0157182
1701 Ga0495590_0092510
1702 Ga0495638_0025833
1703 Ga0495641_0137318
1704 Ga0495651_0096787
1705 Ga0495653_0071960
1706 Ga0495580_0009473
1707 Ga0495580_0198447
1708 Ga0495639_0148919
1709 Ga0495639_0209217
1710 Ga0495664_0120799
1711 Ga0495664_0195298
1712 Ga0495606_0133981
1713 Ga0495608_0123244
1714 Ga0495618_0046607
1715 Ga0495618_0217691
1716 Ga0495628_0133081
1717 Ga0495628_0347102
1718 Ga0495628_0556398
1719 Ga0495628_0601303
1720 Ga0495666_0051861
1721 Ga0495652_0095736
1722 Ga0495652_0107274
1723 Ga0495652_0140888
1724 Ga0495652_0511413
1725 Ga0495654_0226549
1726 Ga0495665_0103492
1727 Ga0495640_0131317
1728 Ga0495640_0317776
1729 Ga0495586_0140476
1730 Ga0495586_0171847
1731 Ga0495586_0432528
1732 Ga0495587_0038304
1733 Ga0495587_0058935
1734 Ga0495587_0088937
1735 Ga0495645_0109202
1736 Ga0495645_0383108
1737 Ga0495667_0062621
1738 Ga0495667_0067195
1739 Ga0495667_0153065
1740 Ga0495634_0068709
1741 Ga0495634_0423584
1742 Ga0495635_0020974
1743 Ga0495599_0039931
1744 Ga0495599_0301832
1745 Ga0495646_0155575
1746 Ga0495658_0241701
1747 Ga0495669_0001461
1748 Ga0495624_0199865
1749 Ga0495600_0056746
1750 Ga0495581_0129225
1751 Ga0495604_0085845
1752 Ga0495604_0142810
1753 Ga0495674_0175836
1754 Ga0495674_0178589
1755 Ga0495674_0246562
1756 Ga0495672_0222970
1757 Ga0495676_0111898
1758 Ga0495680_0033486
1759 Ga0495680_0095921
1760 Ga0495680_0242207
1761 Ga0495683_0047183
1762 Ga0495675_0033866
1763 Ga0495673_0017803
1764 Ga0495673_0158890
1765 Ga0495684_0214045
1766 Ga0495684_0428192
1767 Ga0495686_0170306
1768 Ga0495602_0014932
1769 Ga0495602_0290933
1770 Ga0496100_0020431
1771 Ga0496100_0116399
1772 Ga0496101_0023314
1773 Ga0496101_0096353
1774 Ga0496102_0563932
1775 Ga0496103_0085541
1776 Ga0496104_0341923
1777 Ga0496105_0374774
1778 Ga0496106_0055368
1779 Ga0496106_0657955
1780 Ga0496107_0331096
1781 Ga0496108_0005061
1782 Ga0496108_0903180
1783 Ga0496109_0003617
1784 Ga0496109_0021676
1785 Ga0496110_0001002
1786 Ga0496110_0080492
1787 Ga0496110_0361839
1788 Ga0496110_0699405
1789 Ga0496111_0009201
1790 Ga0496112_0000029
1791 Ga0496112_0053753
1792 Ga0496112_0077956
1793 Ga0496113_0008012
1794 Ga0496114_0002919
1795 Ga0496114_0074669
1796 Ga0496114_0306662
1797 Ga0496115_0065909
1798 Ga0496117_0104508
1799 Ga0496118_0023875
1800 Ga0496119_0018058
1801 Ga0496119_0072006
1802 Ga0496119_0097459
1803 Ga0496120_0010285
1804 Ga0496121_0002330
1805 Ga0496121_0003220
1806 Ga0496121_0007746
1807 Ga0496121_0078537
1808 Ga0496121_0085327
1809 Ga0496121_0096049
1810 Ga0496122_0006145
1811 Ga0496123_0020508
1812 Ga0496126_0026588
1813 Ga0496126_0028761
1814 Ga0496126_0045009
1815 Ga0496126_0045843
1816 Ga0496126_0071815
1817 Ga0496126_0075172
1818 Ga0496126_0240584
1819 Ga0496126_0415817
1820 Ga0501031_0002222
1821 Ga0501031_0174810
1822 Ga0501031_0199371
1823 Ga0501032_0000312
1824 Ga0501032_0001543
1825 Ga0501032_0107164
1826 Ga0501033_0000286
1827 Ga0501033_0005202
1828 Ga0501033_0039481
1829 Ga0501033_0052666
1830 Ga0501033_0067066
1831 Ga0501033_0193124
1832 Ga0501034_0003164
1833 Ga0501034_0003735
1834 Ga0501034_0013285
1835 Ga0501034_0055187
1836 Ga0501036_0000310
1837 Ga0501036_0002522
1838 Ga0501036_0225245
1839 Ga0501037_0000118
1840 Ga0501037_0003508
1841 Ga0501037_0046610
1842 Ga0501037_0114507
1843 Ga0501038_0000248
1844 Ga0501038_0001954
1845 Ga0501038_0045196
1846 Ga0501038_0084361
1847 Ga0501038_0246566
1848 Ga0501039_0000048
1849 Ga0501039_0001321
1850 Ga0501039_0179849
1851 Ga0501041_0106737
1852 Ga0501042_0129952
1853 Ga0501043_0001719
1854 Ga0501043_0006987
1855 Ga0501043_0122966
1856 Ga0501043_0253294
1857 Ga0501046_0013782
1858 Ga0501046_0104587
1859 Ga0501046_0117272
1860 Ga0501046_0411450
1861 Ga0501047_0003356
1862 Ga0501047_0007161
1863 Ga0501047_0058375
1864 Ga0501047_0063735
1865 Ga0501047_0088476
1866 Ga0501047_0205420
1867 Ga0501067_0172216
1868 Ga0501068_0018033
1869 Ga0501068_0063992
1870 Ga0501069_0204331
1871 Ga0501070_0003393
1872 Ga0501070_0010716
1873 Ga0501070_0028481
1874 Ga0501070_0035001
1875 Ga0501070_0078249
1876 Ga0501070_0109124
1877 Ga0501071_0053840
1878 Ga0501071_0375349
1879 Ga0501073_0066345
1880 Ga0501073_0137288
1881 Ga0501073_0186799
1882 Ga0501074_0074802
1883 Ga0501074_0149270
1884 Ga0501075_0012911
1885 Ga0501076_0042884
1886 Ga0501076_0381836
1887 Ga0501079_0156857
1888 Ga0501079_0495317
1889 Ga0501080_0026461
1890 Ga0501080_0050954
1891 Ga0501080_0065807
1892 Ga0501080_0165418
1893 Ga0501081_0225242
1894 Ga0501083_0021184
1895 Ga0501083_0056277
1896 Ga0501083_0288329
1897 Ga0501035_0000118
1898 Ga0501035_0000516
1899 Ga0501035_0002724
1900 Ga0501035_0063754
1901 Ga0501035_0096310
1902 Ga0501035_0148828
1903 Ga0501044_0004188
1904 Ga0501044_0012550
1905 Ga0501044_0016160
1906 Ga0501044_0026844
1907 Ga0501044_0130412
1908 Ga0501044_0138273
1909 Ga0501044_0217450
1910 Ga0501045_0025321
1911 nmdc:mga03683_45827_c1
1912 nmdc:mga03n38_164088_c1
1913 nmdc:mga03n38_200075_c1
1914 nmdc:mga00v17_13000_c1
1915 nmdc:mga0yw44_12835_c1
1916 nmdc:mga0yw44_205452_c1
1917 nmdc:mga0yw44_84561_c1
1918 nmdc:mga0yw44_8644_c1
1919 nmdc:mga0k408_147178_c1
1920 nmdc:mga0k408_36688_c1
1921 nmdc:mga06z11_12988_c1
1922 nmdc:mga06z11_148777_c1
1923 nmdc:mga06z11_328747_c1
1924 nmdc:mga06z11_37634_c1
1925 nmdc:mga06z11_61221_c2
1926 nmdc:mga06z11_94407_c1
1927 nmdc:mga07m45_140461_c1
1928 nmdc:mga07m45_252996_c1
1929 nmdc:mga05p37_2215_c1
1930 nmdc:mga05p37_552998_c1
1931 nmdc:mga05p37_662574_c1
1932 nmdc:mga09592_261656_c1
1933 nmdc:mga0qj67_212290_c1
1934 nmdc:mga0qj67_221_c1
1935 nmdc:mga0qj67_494106_c1
1936 nmdc:mga06r32_54301_c1
1937 nmdc:mga06r32_76282_c1
1938 nmdc:mga0n895_19634_c1
1939 nmdc:mga0rr50_59329_c1
1940 nmdc:mga08x19_21652_c1
1941 nmdc:mga08x19_249883_c1
1942 nmdc:mga08x19_37584_c1
1943 nmdc:mga08x19_608564_c1
1944 nmdc:mga0a205_100676_c1
1945 nmdc:mga0a205_23024_c1
1946 nmdc:mga0sz30_3779_c1
1947 Ga0495601_0058391
1948 Ga0495601_0142710
1949 Ga0495601_0176034
1950 Ga0500610_0060134
1951 Ga0500635_0009468
1952 Ga0495655_0021216
1953 Ga0495595_0079907
1954 Ga0495619_0006785
1955 Ga0495619_0011552
1956 Ga0495619_0012982
1957 Ga0495619_0191913
1958 Ga0495619_0256127
1959 Ga0495619_0324181
1960 Ga0495619_0565934
1961 Ga0500643_010040
1962 Ga0500643_012614
1963 Ga0500644_0004361
1964 Ga0500651_0051806
1965 Ga0500566_0001659
1966 Ga0500566_0008714
1967 Ga0500566_0020899
1968 Ga0500640_018114
1969 Ga0500641_0008450
1970 Ga0500650_0252984
1971 Ga0500554_012174
1972 Ga0500556_0000956
1973 Ga0500572_000255
1974 Ga0500572_001715
1975 Ga0500594_0023611
1976 Ga0500595_000029
1977 Ga0500595_003805
1978 Ga0500595_011603
1979 Ga0500595_013783
1980 Ga0500595_044037
1981 Ga0500595_059184
1982 Ga0500608_033992
1983 Ga0500614_004614
1984 Ga0500642_0014749
1985 Ga0500652_005799
1986 Ga0500652_135207
1987 Ga0500559_0000299
1988 Ga0500559_0004223
1989 Ga0500568_0000035
1990 Ga0500568_0045993
1991 Ga0500603_002486
1992 Ga0500603_007058
1993 Ga0500603_017879
1994 Ga0500616_0000006
1995 Ga0500616_0000038
1996 Ga0500620_008801
1997 Ga0500622_0005458
1998 Ga0500622_0028257
1999 Ga0500622_0067368
2000 Ga0500627_0097927
2001 Ga0500630_008925
2002 Ga0500638_023336
2003 Ga0500638_030769
2004 Ga0500639_000477
2005 Ga0500636_0263892
2006 Ga0500637_0002325
2007 Ga0500637_0016108
2008 Ga0500576_033923
2009 Ga0500645_000290
2010 Ga0500645_005569
2011 Ga0500596_000406
2012 Ga0501084_0114989
2013 Ga0500661_003768
2014 Ga0501082_0087994
2015 Ga0501082_0185310
2016 Ga0501082_0212855
2017 Ga0501082_0339302
2018 Ga0530510_0144391
2019 2503202214
2020 2509117019
2021 2509140637
2022 2509370709
2023 2509396862
2024 2510317500
2025 2512930887
2026 2512958613
2027 2513609925
2028 2514034972
2029 2514418934
2030 2514589371
2031 2588516567
2032 2597814095
2033 2599938077
2034 2643989390
2035 2644152962
2036 2688599424
2037 2694632210
2038 2694634382
2039 2723576384
2040 2723842321
2041 2738716120
2042 2756675899
2043 2792748537
2044 2841740015
2045 2844006439
2046 2844014702
2047 2847672505
2048 2856315520
2049 2856325846
2050 2856328976
2051 2856340026
2052 2856343182
2053 2856354497
2054 2856363299
2055 2856368821
2056 2857350207
2057 2857368576
2058 2869165264
2059 2869174789
2060 2869240792
2061 2869249563
2062 2869252189
2063 2869262533
2064 2869268000
2065 2869278626
2066 2869291316
2067 2871433596
2068 2871441738
2069 2871458147
2070 2871466359
2071 2871473865
2072 2871475309
2073 2871484947
2074 2871495782
2075 2871502990
2076 2874103483
2077 2874111774
2078 2874117825
2079 2874125997
2080 2874132040
2081 2874145212
2082 2874153197
2083 2874160462
2084 2874167276
2085 2874176202
2086 2874616504
2087 2876365441
2088 2876386079
2089 2876394971
2090 2876405863
2091 2876407655
2092 2876419488
2093 2876426508
2094 2878037193
2095 2878743409
2096 2878751207
2097 2878753419
2098 2878766879
2099 2878774077
2100 2878774794
2101 2878786450
2102 2878796839
2103 2881152865
2104 2881156358
2105 2881168310
2106 2881860674
2107 2881863389
2108 2882637878
2109 2882918488
2110 2885310306
2111 2885317118
2112 2885319195
2113 2885329306
2114 2885339137
2115 2885350761
2116 2885380852
2117 2888340142
2118 2888347467
2119 2888356551
2120 2889011458
2121 2889016812
2122 2903455607
2123 2903495274
2124 2903501705
2125 2903513687
2126 2903522797
2127 2903532987
2128 2903548179
2129 2904661602
2130 2904692035
2131 2906313148
2132 2906325859
2133 2906331885
2134 2906360990
2135 2906365864
2136 2906370795
2137 2906391321
2138 2906394524
2139 2906402998
2140 2906412644
2141 2906415657
2142 2906429386
2143 2908746533
2144 2908757314
2145 2922134506
2146 2922163040
2147 2922177105
2148 2922181129
2149 2922187576
2150 2924710530
2151 2924732086
2152 2924736249
2153 2924747242
2154 2924750849
2155 2924759740
2156 2924768981
2157 2924781221
2158 2924789666
2159 2935632847
2160 2937820701
2161 2937827301
2162 2937837770
2163 2937849134
2164 2937866851
2165 2937869017
2166 2937878982
2167 2937895569
2168 2937975272
2169 2938002004
2170 2938017392
2171 2939672808
2172 2941508488
2173 2941516319
2174 2941524665
2175 2952254677
2176 2958034742
2177 2958043130
2178 2958066990
2179 2958077509
2180 2958086156
2181 2958092415
2182 2958103053
2183 2958121501
2184 2958123717
2185 2958135716
2186 2958141789
2187 2958145593
2188 2958162603
2189 2958172058
2190 2958177823
2191 2958185207
2192 2961083474
2193 2961116755
2194 2961132800
2195 2961141162
2196 2961170505
2197 2961177863
2198 2961187358
2199 2963648338
2200 2965025252
2201 2965029525
2202 2965037238
2203 2965043381
2204 2965052370
2205 2965065780
2206 2965095798
2207 2965103067
2208 2968003130
2209 2968003956
2210 2968017850
2211 2968084851
2212 2968095321
2213 2968103129
2214 2968112662
2215 2968123104
2216 2968128561
2217 2968144975
2218 2968178891
2219 2970471975
2220 2970495821
2221 2970510539
2222 2970512671
2223 2970531713
2224 2970542133
2225 2970550037
2226 2970561735
2227 2970593222
2228 2970621111
2229 2970632268
2230 2977822641
2231 2977833372
2232 2977848999
2233 2977858093
2234 2977861628
2235 2977872514
2236 2977873520
2237 2977906501
2238 2977914146
2239 2977919572
2240 2977923087
2241 2977941406
2242 2977948247
2243 2977991877
2244 2979713358
2245 2979769314
2246 2979773494
2247 2979784879
2248 2979795513
2249 2979815413
2250 2987637395
2251 2987653983
2252 2987666745
2253 2987670659
2254 2987676196
2255 2996314777
2256 2996345397
2257 2996350908
2258 2996392567
2259 3000138489
2260 3004169588
2261 3004195748
2262 3004197932
2263 3004206208
2264 3004211683
2265 3004218930
2266 3004238893
2267 3004242976
2268 3004254293
2269 3004275201
2270 3004277606
2271 3004341002
2272 637073933
2273 649873928
2274 8004305512
2275 8004313106
2276 8004363790
2277 8004374991
2278 8004394128
2279 8004449876
2280 8004634074
2281 8004646674
2282 8004713234
2283 8004719405
2284 8004733261
2285 8006996938
2286 8055621529

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

160

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9433 2 220
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9339 2 231
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9263 2 231
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9261 2 231
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9244 2 220
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9542 1 228 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9535 1 231 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9495 1 231 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9441 2 215 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9382 1 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A435BCD9-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 1.002 1 201 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A5B8KZZ6-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 1 1 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A3S2BK75-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 1 30 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7Y2Q5H1-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 0.9997 1 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1H8U584-F1-model_v4 LIV-I protein F 0.9994 1 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map