F490743

General Info

Members Datasets Scaffolds Average Seq Length
1143 505 1073 238

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0562763|Ga0436361_0562763_5553_6395
Length 280
Sequence MRLDPPAGAGRAWPGPARLIIQAGRRQPRRPRCIQEHSSMAGHSKWANIQHRKGRQDEKRGKAWTRVIREIMVAARLGGGDPNANPRLRLAVDKAKAVNLPADTVKRNIDKATGNLEGVTYEEIRYEGYGIAGAAIIVDTMTDNRVRTVAEVRHAFSKYGGNMGTDGSVSFQFKHVGQFVFAPGTSEDKVMEVALEAGAEDVITDDDGAIEVLCTPADFEKVKIALEGAGLTPDIAEVTMRAENTVDLAGEDSARMQKLLDVLEDLDDVQEVYHNAVLAE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2643221570 Acidovorax sp. Root568 Isolate Unclassified
13 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
14 2643221596 Acidovorax sp. Root70 Isolate Unclassified
15 2643221609 Acidovorax sp. Root217 Isolate Unclassified
16 2643221611 Acidovorax sp. Root219 Isolate Unclassified
17 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
18 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
19 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
20 2643221652 Acidovorax sp. Root402 Isolate Unclassified
21 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
22 2643221658 Variovorax sp. Root411 Isolate Unclassified
23 2643221660 Methylibium sp. Root1272 Isolate Unclassified
24 2643221672 Variovorax sp. Root434 Isolate Unclassified
25 2643221683 Variovorax sp. Root473 Isolate Unclassified
26 2643221717 Acidovorax sp. Root267 Isolate Unclassified
27 2738541277 Variovorax sp. GV051 Isolate Unclassified
28 2738541307 Variovorax sp. GV008 Isolate Unclassified
29 2738543012 Acidovorax sp. CF301 Isolate Unclassified
30 2738543013 Variovorax sp. BT01 Isolate Unclassified
31 2738543019 Variovorax sp. GV040 Isolate Unclassified
32 2816332133 Acidovorax radicis 2721A Isolate Unclassified
33 2818991446 Variovorax sp. 1180 Isolate Unclassified
34 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
35 2831864461 Roseateles noduli HZ7 Isolate Nodule
36 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
37 2842677519 Variovorax sp. R-72495 Isolate Unclassified
38 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
39 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
40 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
41 2885198086 Variovorax sp. 679 Isolate Unclassified
42 2885211737 Variovorax sp. 553 Isolate Unclassified
43 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
44 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
45 2899924645 Variovorax sp. 369 Isolate Unclassified
46 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
47 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
48 2904456579 Variovorax sp. 2002 Isolate Unclassified
49 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
50 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
51 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
52 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
53 2928037797 Variovorax sp. 1126 Isolate Unclassified
54 2928044640 Variovorax sp. 1128 Isolate Unclassified
55 2928051484 Variovorax sp. 1133 Isolate Unclassified
56 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
57 2928070936 Variovorax gossypii 1167 Isolate Unclassified
58 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
59 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
60 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
61 2929520902 Variovorax beijingensis 502 Isolate Unclassified
62 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
63 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
64 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
65 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
66 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
67 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
68 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
69 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
70 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
71 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
72 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
75 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
76 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
77 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
83 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
84 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
85 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
94 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
95 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
101 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
105 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
106 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
107 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
108 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
109 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
110 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
114 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
115 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
116 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
117 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
118 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
119 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
120 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
121 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
122 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
123 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
124 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
126 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
130 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
131 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
132 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
135 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
136 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
139 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
140 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
145 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
146 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
147 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
154 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
155 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
156 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
157 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
158 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
159 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
160 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
161 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
162 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
164 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
165 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
166 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
167 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
168 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
169 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
170 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
171 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
172 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
174 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
175 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
176 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
177 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
178 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
179 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
180 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
181 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
182 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
183 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
184 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
185 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
186 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
187 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
188 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
189 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
190 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
191 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
192 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
193 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
194 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
195 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
196 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
197 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
198 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
199 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
200 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
201 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
202 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
203 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
204 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
205 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
208 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
215 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
217 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
218 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
219 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
222 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
223 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
227 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
230 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
289 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
293 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
294 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
296 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
300 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
301 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
302 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
303 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
304 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
305 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
306 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
307 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
308 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
309 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
310 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
311 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
312 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
313 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
314 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
315 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
316 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
317 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
318 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
319 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
320 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
321 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
322 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
323 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
324 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
325 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
326 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
327 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
328 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
329 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
330 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
331 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
332 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
333 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
334 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
335 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
336 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
338 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
339 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
340 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
341 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
342 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
343 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
344 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
345 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
346 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
353 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
356 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
357 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
358 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
359 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
362 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
363 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
364 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
365 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
366 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
367 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
368 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
369 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
370 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
371 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
372 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
373 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
374 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
375 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
376 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
377 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
378 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
379 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
380 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
381 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
382 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
383 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
384 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
385 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
386 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
387 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
388 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
389 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
390 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
391 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
392 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
393 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
396 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
397 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
398 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
399 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
400 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
401 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
402 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
403 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
404 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
405 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
406 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
407 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
408 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
409 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
410 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
411 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
412 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
413 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
418 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
419 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
420 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
421 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
422 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
423 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
424 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
430 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
433 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
434 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
435 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
436 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
437 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
438 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
441 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
442 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
443 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
444 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
445 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
458 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
459 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
460 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
461 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
462 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
463 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
466 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
470 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
471 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
480 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
481 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
482 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
483 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
484 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
485 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
486 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
487 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
488 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
489 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
490 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
491 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
492 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
493 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
497 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
498 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
501 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
502 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
503 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
504 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
505 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.79
Metatranscriptomes 0.09
Isolates 6.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 0.7
Rhizoplane 2.36
Rhizosphere 73.67
Stem 0
Stem Tuber 0
Unclassified 9.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000038 3300002705 Bacteria 108421
2 JGI25154J39366_1003426 3300002738 Bacteria 3336
3 JGI25157J39369_1000127 3300002741 Bacteria 65070
4 JGI25153J46596_10003482 3300003215 Bacteria 8805
5 JGI25153J46596_10005637 3300003215 Bacteria 6540
6 Ga0055538_1000019 3300003751 Bacteria 282365
7 Ga0055539_1000024 3300003752 Bacteria 282365
8 Ga0055533_1000024 3300003756 Bacteria 338067
9 Ga0055533_1000032 3300003756 Bacteria 282365
10 Ga0055525_1000041 3300003759 Bacteria 282365
11 Ga0055535_1000330 3300003761 Bacteria 47889
12 Ga0055535_1021772 3300003761 Bacteria 774
13 Ga0055542_1000039 3300003762 Bacteria 215126
14 Ga0055529_1000091 3300003763 Bacteria 138369
15 Ga0055526_1005273 3300003771 Bacteria 7487
16 Ga0055526_1005340 3300003771 Bacteria 7422
17 Ga0055537_1000079 3300003773 Bacteria 69953
18 Ga0055524_1000012 3300003775 Bacteria 260384
19 Ga0055524_1000906 3300003775 Bacteria 19129
20 Ga0055524_1012257 3300003775 Bacteria 3300
21 Ga0055536_1015001 3300003781 Bacteria 2679
22 Ga0055534_1000092 3300003784 Bacteria 70082
23 Ga0055534_1000506 3300003784 Bacteria 21227
24 Ga0055528_1000190 3300003790 Bacteria 52365
25 Ga0055528_1010252 3300003790 Bacteria 3831
26 Ga0055528_1042405 3300003790 Bacteria 1003
27 Ga0055530_10000793 3300003791 Bacteria 26295
28 Ga0055540_1000012 3300003792 Bacteria 262667
29 Ga0055540_1009352 3300003792 Bacteria 3397
30 Ga0055531_10000612 3300003794 Bacteria 30958
31 Ga0055531_10005878 3300003794 Bacteria 7083
32 Ga0055531_10010964 3300003794 Bacteria 4435
33 Ga0055531_10035313 3300003794 Bacteria 1566
34 Ga0055541_1000018 3300003841 Bacteria 282365
35 Ga0065165_1000518 3300005262 Bacteria 59187
36 Ga0065165_1000980 3300005262 Bacteria 35365
37 Ga0065165_1001409 3300005262 Bacteria 26197
38 Ga0065714_10005383 3300005288 Bacteria 4157
39 Ga0065704_10139087 3300005289 Bacteria 1537
40 Ga0065707_10084409 3300005295 Bacteria 7230
41 Ga0070658_10114258 3300005327 Bacteria 2238
42 Ga0070658_10125625 3300005327 Bacteria 2135
43 Ga0070658_10292834 3300005327 Bacteria 1387
44 Ga0070676_10002016 3300005328 Bacteria 10323
45 Ga0070676_10154024 3300005328 Bacteria 1474
46 Ga0070676_10405141 3300005328 Bacteria 950
47 Ga0070690_100017501 3300005330 Bacteria 4311
48 Ga0070690_100021737 3300005330 Bacteria 3920
49 Ga0070670_100049944 3300005331 Bacteria 3596
50 Ga0070670_100133638 3300005331 Bacteria 2143
51 Ga0070670_100864257 3300005331 Bacteria 819
52 Ga0068869_100009845 3300005334 Bacteria 6207
53 Ga0068869_100049701 3300005334 Bacteria 3037
54 Ga0068869_100099753 3300005334 Bacteria 2195
55 Ga0068869_100133890 3300005334 Bacteria 1908
56 Ga0068869_100232058 3300005334 Bacteria 1467
57 Ga0068869_100635596 3300005334 Bacteria 905
58 Ga0070666_10027703 3300005335 Bacteria 3713
59 Ga0070666_10065827 3300005335 Bacteria 2459
60 Ga0070666_10115059 3300005335 Bacteria 1862
61 Ga0070680_100002933 3300005336 Bacteria 12683
62 Ga0070680_100366898 3300005336 Bacteria 1225
63 Ga0070682_100392009 3300005337 Bacteria 1048
64 Ga0068868_100018848 3300005338 Bacteria 5164
65 Ga0068868_100029892 3300005338 Bacteria 4175
66 Ga0068868_100274579 3300005338 Bacteria 1425
67 Ga0070689_100040247 3300005340 Bacteria 3583
68 Ga0070689_100054502 3300005340 Bacteria 3096
69 Ga0070687_100004765 3300005343 Bacteria 5431
70 Ga0070661_100039421 3300005344 Bacteria 3441
71 Ga0070668_100366599 3300005347 Bacteria 1223
72 Ga0070669_100027387 3300005353 Bacteria 4101
73 Ga0070669_100033268 3300005353 Bacteria 3728
74 Ga0070669_100178152 3300005353 Bacteria 1661
75 Ga0070669_100255320 3300005353 Bacteria 1397
76 Ga0070675_100006945 3300005354 Bacteria 8695
77 Ga0070675_100026797 3300005354 Bacteria 4626
78 Ga0070675_100076526 3300005354 Bacteria 2784
79 Ga0070675_100231758 3300005354 Bacteria 1611
80 Ga0070675_100260126 3300005354 Bacteria 1521
81 Ga0070675_100292535 3300005354 Bacteria 1433
82 Ga0070675_100527759 3300005354 Bacteria 1066
83 Ga0070671_100002690 3300005355 Bacteria 13781
84 Ga0070671_100076175 3300005355 Bacteria 2802
85 Ga0070671_100208978 3300005355 Bacteria 1655
86 Ga0070671_100216489 3300005355 Bacteria 1625
87 Ga0070674_100164780 3300005356 Bacteria 1685
88 Ga0070674_100219904 3300005356 Bacteria 1477
89 Ga0070674_100350757 3300005356 Bacteria 1192
90 Ga0070674_100417774 3300005356 Bacteria 1100
91 Ga0070674_100616422 3300005356 Bacteria 919
92 Ga0070673_100003204 3300005364 Bacteria 10140
93 Ga0070673_100013983 3300005364 Bacteria 5574
94 Ga0070673_100066341 3300005364 Bacteria 2882
95 Ga0070673_100095868 3300005364 Bacteria 2434
96 Ga0070673_100107455 3300005364 Bacteria 2308
97 Ga0070673_100127618 3300005364 Bacteria 2130
98 Ga0070673_100167844 3300005364 Bacteria 1871
99 Ga0070688_100119012 3300005365 Bacteria 1766
100 Ga0070659_100355020 3300005366 Bacteria 1230
101 Ga0070659_100468659 3300005366 Bacteria 1070
102 Ga0070667_100000848 3300005367 Bacteria 28390
103 Ga0070667_100003701 3300005367 Bacteria 13007
104 Ga0070667_100003920 3300005367 Bacteria 12640
105 Ga0070667_100062101 3300005367 Bacteria 3164
106 Ga0070667_100244065 3300005367 Bacteria 1604
107 Ga0070667_100278178 3300005367 Bacteria 1502
108 Ga0070700_100189567 3300005441 Bacteria 1437
109 Ga0070663_100001730 3300005455 Bacteria 12119
110 Ga0070663_100016702 3300005455 Bacteria 4775
111 Ga0070663_100237767 3300005455 Bacteria 1437
112 Ga0070678_100005274 3300005456 Bacteria 7448
113 Ga0070678_100156597 3300005456 Bacteria 1841
114 Ga0070678_100182672 3300005456 Bacteria 1718
115 Ga0070678_100298762 3300005456 Bacteria 1368
116 Ga0070678_100564619 3300005456 Bacteria 1012
117 Ga0070662_100019041 3300005457 Bacteria 4654
118 Ga0070662_100044679 3300005457 Bacteria 3174
119 Ga0068867_100000005 3300005459 Bacteria 174097
120 Ga0068867_100000501 3300005459 Bacteria 26078
121 Ga0068867_100012878 3300005459 Bacteria 5917
122 Ga0068867_100028338 3300005459 Bacteria 4032
123 Ga0068867_100058410 3300005459 Bacteria 2858
124 Ga0068867_100279741 3300005459 Bacteria 1368
125 Ga0068867_100341008 3300005459 Bacteria 1248
126 Ga0070685_10158437 3300005466 Bacteria 1441
127 Ga0070707_100176922 3300005468 Bacteria 2080
128 Ga0070699_100089836 3300005518 Bacteria 2684
129 Ga0070679_100007594 3300005530 Bacteria 10146
130 Ga0070679_100263171 3300005530 Bacteria 1680
131 Ga0070679_100387773 3300005530 Bacteria 1343
132 Ga0070684_100015427 3300005535 Bacteria 6221
133 Ga0070697_100055465 3300005536 Bacteria 3222
134 Ga0070697_100301525 3300005536 Bacteria 1377
135 Ga0068853_100005984 3300005539 Bacteria 9616
136 Ga0068853_100009827 3300005539 Bacteria 7721
137 Ga0068853_100061217 3300005539 Bacteria 3255
138 Ga0068853_100062690 3300005539 Bacteria 3218
139 Ga0068853_100065796 3300005539 Bacteria 3146
140 Ga0068853_100114341 3300005539 Bacteria 2400
141 Ga0068853_100195489 3300005539 Bacteria 1839
142 Ga0068853_100389654 3300005539 Bacteria 1302
143 Ga0068853_100523955 3300005539 Bacteria 1121
144 Ga0070672_100004378 3300005543 Bacteria 9247
145 Ga0070672_100010304 3300005543 Bacteria 6479
146 Ga0070672_100017855 3300005543 Bacteria 5115
147 Ga0070672_100019023 3300005543 Bacteria 4977
148 Ga0070672_100026297 3300005543 Bacteria 4328
149 Ga0070672_100194320 3300005543 Bacteria 1695
150 Ga0070672_100341106 3300005543 Bacteria 1276
151 Ga0070672_100352658 3300005543 Bacteria 1254
152 Ga0070686_100044033 3300005544 Bacteria 2803
153 Ga0070686_100232689 3300005544 Bacteria 1338
154 Ga0070695_100125133 3300005545 Bacteria 1764
155 Ga0070696_100008093 3300005546 Bacteria 7027
156 Ga0070693_100106067 3300005547 Bacteria 1720
157 Ga0070665_100033531 3300005548 Bacteria 5166
158 Ga0070665_100053806 3300005548 Bacteria 4037
159 Ga0070665_100087815 3300005548 Bacteria 3115
160 Ga0070665_100088866 3300005548 Bacteria 3095
161 Ga0070665_100146971 3300005548 Bacteria 2360
162 Ga0068855_100007881 3300005563 Bacteria 12864
163 Ga0068855_100025134 3300005563 Bacteria 7130
164 Ga0068855_100066947 3300005563 Bacteria 4187
165 Ga0068855_100229921 3300005563 Bacteria 2077
166 Ga0068855_100391310 3300005563 Bacteria 1525
167 Ga0068855_100747008 3300005563 Bacteria 1043
168 Ga0068855_101260903 3300005563 Bacteria 766
169 Ga0068857_100089574 3300005577 Bacteria 2753
170 Ga0068857_100247155 3300005577 Bacteria 1634
171 Ga0068854_100004342 3300005578 Bacteria 8937
172 Ga0068854_100006043 3300005578 Bacteria 7672
173 Ga0068854_100101566 3300005578 Bacteria 2157
174 Ga0068856_100002740 3300005614 Bacteria 18046
175 Ga0068856_100059619 3300005614 Bacteria 3770
176 Ga0068856_100281003 3300005614 Bacteria 1681
177 Ga0068856_100299357 3300005614 Bacteria 1626
178 Ga0070702_100419691 3300005615 Bacteria 962
179 Ga0068852_100053344 3300005616 Bacteria 3480
180 Ga0068852_100392534 3300005616 Bacteria 1363
181 Ga0068852_100485267 3300005616 Bacteria 1229
182 Ga0068852_100522354 3300005616 Bacteria 1185
183 Ga0068852_100646508 3300005616 Bacteria 1065
184 Ga0068859_100010093 3300005617 Bacteria 9518
185 Ga0068859_100031472 3300005617 Bacteria 5328
186 Ga0068859_100089172 3300005617 Bacteria 3134
187 Ga0068859_100257130 3300005617 Bacteria 1837
188 Ga0068859_100667959 3300005617 Bacteria 1131
189 Ga0068864_100000511 3300005618 Bacteria 33486
190 Ga0068864_100007732 3300005618 Bacteria 8858
191 Ga0068864_100070344 3300005618 Bacteria 3044
192 Ga0068864_100310035 3300005618 Bacteria 1479
193 Ga0068864_100468345 3300005618 Bacteria 1207
194 Ga0068866_10021140 3300005718 Bacteria 2993
195 Ga0068866_10350627 3300005718 Bacteria 938
196 Ga0068861_100014651 3300005719 Bacteria 5506
197 Ga0068861_100021631 3300005719 Bacteria 4625
198 Ga0068861_100033936 3300005719 Bacteria 3769
199 Ga0068851_10003542 3300005834 Bacteria 6948
200 Ga0068870_10010438 3300005840 Bacteria 4270
201 Ga0068870_10013784 3300005840 Bacteria 3806
202 Ga0068863_100023710 3300005841 Bacteria 5856
203 Ga0068863_100052686 3300005841 Bacteria 3856
204 Ga0068863_100112251 3300005841 Bacteria 2596
205 Ga0068863_100248906 3300005841 Bacteria 1716
206 Ga0068863_100301890 3300005841 Bacteria 1553
207 Ga0068863_100379266 3300005841 Bacteria 1380
208 Ga0068863_100640784 3300005841 Bacteria 1053
209 Ga0068858_100000359 3300005842 Bacteria 48114
210 Ga0068858_100012197 3300005842 Bacteria 8103
211 Ga0068858_100252078 3300005842 Bacteria 1677
212 Ga0068860_100005022 3300005843 Bacteria 13465
213 Ga0068860_100017155 3300005843 Bacteria 7058
214 Ga0068860_100176967 3300005843 Bacteria 2062
215 Ga0068860_100570768 3300005843 Bacteria 1135
216 Ga0068862_100002767 3300005844 Bacteria 15368
217 Ga0068862_100017960 3300005844 Bacteria 5892
218 Ga0068862_100046445 3300005844 Bacteria 3705
219 Ga0068862_100062862 3300005844 Bacteria 3193
220 Ga0081540_1010828 3300005983 Bacteria 6129
221 Ga0075365_10005796 3300006038 Bacteria 6710
222 Ga0075368_10056248 3300006042 Bacteria 1569
223 Ga0075368_10090039 3300006042 Bacteria 1254
224 Ga0075363_100012260 3300006048 Bacteria 4127
225 Ga0075363_100175349 3300006048 Bacteria 1218
226 Ga0075364_10057248 3300006051 Bacteria 2553
227 Ga0075432_10017514 3300006058 Bacteria 2443
228 Ga0075432_10022694 3300006058 Bacteria 2147
229 Ga0070715_10246192 3300006163 Bacteria 932
230 Ga0070716_100202949 3300006173 Bacteria 1319
231 Ga0075362_10003415 3300006177 Bacteria 5546
232 Ga0075362_10003584 3300006177 Bacteria 5455
233 Ga0075362_10051082 3300006177 Bacteria 1850
234 Ga0075362_10127700 3300006177 Bacteria 1207
235 Ga0075367_10066842 3300006178 Bacteria 2155
236 Ga0075367_10108032 3300006178 Bacteria 1705
237 Ga0075367_10301603 3300006178 Bacteria 1008
238 Ga0075369_10060814 3300006186 Bacteria 1648
239 Ga0075366_10001513 3300006195 Bacteria 11602
240 Ga0075366_10002649 3300006195 Bacteria 9220
241 Ga0075366_10004469 3300006195 Bacteria 7503
242 Ga0075366_10020423 3300006195 Bacteria 3844
243 Ga0075366_10034277 3300006195 Bacteria 2989
244 Ga0075366_10037035 3300006195 Bacteria 2878
245 Ga0075366_10089177 3300006195 Bacteria 1847
246 Ga0075366_10141351 3300006195 Bacteria 1455
247 Ga0075366_10146550 3300006195 Bacteria 1429
248 Ga0097621_100025265 3300006237 Bacteria 4645
249 Ga0097621_100038943 3300006237 Bacteria 3816
250 Ga0097621_100055961 3300006237 Bacteria 3222
251 Ga0097621_100083278 3300006237 Bacteria 2665
252 Ga0097621_100125218 3300006237 Bacteria 2183
253 Ga0097621_100245097 3300006237 Bacteria 1568
254 Ga0097621_100250124 3300006237 Bacteria 1552
255 Ga0097621_100645787 3300006237 Bacteria 971
256 Ga0075370_10005799 3300006353 Bacteria 6172
257 Ga0075370_10006317 3300006353 Bacteria 5951
258 Ga0075370_10019233 3300006353 Bacteria 3717
259 Ga0075370_10020703 3300006353 Bacteria 3598
260 Ga0075370_10038798 3300006353 Bacteria 2681
261 Ga0068871_100012114 3300006358 Bacteria 6347
262 Ga0068871_100012912 3300006358 Bacteria 6184
263 Ga0068871_100033647 3300006358 Bacteria 4061
264 Ga0068871_100063242 3300006358 Bacteria 3026
265 Ga0068871_100534157 3300006358 Bacteria 1060
266 Ga0075428_100081287 3300006844 Bacteria 3536
267 Ga0075431_100091572 3300006847 Bacteria 3138
268 Ga0075433_10734731 3300006852 Bacteria 864
269 Ga0075434_100154648 3300006871 Bacteria 2313
270 Ga0075429_100003851 3300006880 Bacteria 12815
271 Ga0075429_100024307 3300006880 Bacteria 5257
272 Ga0075429_100083054 3300006880 Bacteria 2793
273 Ga0068865_100010706 3300006881 Bacteria 5715
274 Ga0068865_100012581 3300006881 Bacteria 5331
275 Ga0068865_100028443 3300006881 Bacteria 3701
276 Ga0068865_100301093 3300006881 Bacteria 1283
277 Ga0075436_100027180 3300006914 Bacteria 3938
278 Ga0075436_100028281 3300006914 Bacteria 3856
279 Ga0075436_100035766 3300006914 Bacteria 3425
280 Ga0097620_100010093 3300006931 Bacteria 9518
281 Ga0097620_100031472 3300006931 Bacteria 5328
282 Ga0097620_100089166 3300006931 Bacteria 3134
283 Ga0097620_100257118 3300006931 Bacteria 1837
284 Ga0097620_100667929 3300006931 Bacteria 1131
285 Ga0099823_1000164 3300006944 Bacteria 35666
286 Ga0099826_10000115 3300006948 Bacteria 36769
287 Ga0099826_10072191 3300006948 Bacteria 2186
288 Ga0075435_100008513 3300007076 Bacteria 7367
289 Ga0075435_100248659 3300007076 Bacteria 1513
290 Ga0105240_10003642 3300009093 Bacteria 23871
291 Ga0105240_10013081 3300009093 Bacteria 11422
292 Ga0105240_10061931 3300009093 Bacteria 4660
293 Ga0105240_10102953 3300009093 Bacteria 3469
294 Ga0111539_10017849 3300009094 Bacteria 8786
295 Ga0111539_10312175 3300009094 Bacteria 1830
296 Ga0111539_10503376 3300009094 Bacteria 1411
297 Ga0105245_10046664 3300009098 Bacteria 3871
298 Ga0105245_10087430 3300009098 Bacteria 2861
299 Ga0105245_10126766 3300009098 Bacteria 2390
300 Ga0105245_10179212 3300009098 Bacteria 2023
301 Ga0105245_10211209 3300009098 Bacteria 1868
302 Ga0114129_10014471 3300009147 Bacteria 11241
303 Ga0114129_10297841 3300009147 Bacteria 2151
304 Ga0105243_10000515 3300009148 Bacteria 39435
305 Ga0105243_10011438 3300009148 Bacteria 6715
306 Ga0105243_10045138 3300009148 Bacteria 3461
307 Ga0105243_10161481 3300009148 Bacteria 1932
308 Ga0105243_10269901 3300009148 Bacteria 1527
309 Ga0105243_10272668 3300009148 Bacteria 1520
310 Ga0105243_10796596 3300009148 Bacteria 931
311 Ga0105241_10009853 3300009174 Bacteria 7022
312 Ga0105241_10056280 3300009174 Bacteria 3015
313 Ga0105241_10095833 3300009174 Bacteria 2350
314 Ga0105241_10526652 3300009174 Bacteria 1058
315 Ga0105242_10000382 3300009176 Bacteria 35202
316 Ga0105242_10004129 3300009176 Bacteria 11304
317 Ga0105242_10121670 3300009176 Bacteria 2241
318 Ga0105242_10207852 3300009176 Bacteria 1742
319 Ga0105242_10246119 3300009176 Bacteria 1609
320 Ga0105248_10001109 3300009177 Bacteria 29881
321 Ga0105248_10001415 3300009177 Bacteria 26820
322 Ga0105248_10263516 3300009177 Bacteria 1940
323 Ga0105248_10736134 3300009177 Bacteria 1113
324 Ga0105237_10002223 3300009545 Bacteria 24276
325 Ga0105237_10003141 3300009545 Bacteria 19871
326 Ga0105237_10014808 3300009545 Bacteria 8139
327 Ga0105237_10054485 3300009545 Bacteria 4007
328 Ga0105237_10245328 3300009545 Bacteria 1793
329 Ga0105238_10000128 3300009551 Bacteria 83216
330 Ga0105238_10006811 3300009551 Bacteria 11412
331 Ga0105238_10027040 3300009551 Bacteria 5847
332 Ga0105238_10230868 3300009551 Bacteria 1827
333 Ga0105238_10246774 3300009551 Bacteria 1763
334 Ga0105238_10542154 3300009551 Bacteria 1167
335 Ga0105249_10003146 3300009553 Bacteria 14279
336 Ga0105249_10040918 3300009553 Bacteria 4211
337 Ga0105249_10045561 3300009553 Bacteria 3989
338 Ga0105249_10084089 3300009553 Bacteria 2963
339 Ga0105249_10086584 3300009553 Bacteria 2922
340 Ga0105249_10367690 3300009553 Bacteria 1461
341 Ga0105239_10000470 3300010375 Bacteria 59011
342 Ga0105239_10016362 3300010375 Bacteria 8203
343 Ga0105239_10019647 3300010375 Bacteria 7457
344 Ga0105239_10023748 3300010375 Bacteria 6752
345 Ga0105239_10117267 3300010375 Bacteria 2955
346 Ga0105239_10131049 3300010375 Bacteria 2789
347 Ga0105239_10687542 3300010375 Bacteria 1169
348 Ga0105246_10145831 3300011119 Bacteria 1786
349 Ga0105246_10159810 3300011119 Bacteria 1715
350 Ga0157319_1000017 3300012497 Bacteria 110340
351 Ga0157347_1005390 3300012502 Bacteria 1221
352 Ga0157370_10165877 3300013104 Bacteria 2054
353 Ga0157369_10000172 3300013105 Bacteria 90979
354 Ga0157369_10039971 3300013105 Bacteria 5123
355 Ga0157369_10358386 3300013105 Bacteria 1514
356 Ga0157369_10728207 3300013105 Bacteria 1021
357 Ga0157374_10040292 3300013296 Bacteria 4301
358 Ga0157374_10174012 3300013296 Bacteria 2101
359 Ga0157378_10000016 3300013297 Bacteria 142649
360 Ga0157378_10005086 3300013297 Bacteria 11555
361 Ga0157378_10351365 3300013297 Bacteria 1440
362 Ga0163162_10003443 3300013306 Bacteria 15110
363 Ga0163162_10005037 3300013306 Bacteria 12732
364 Ga0163162_10081316 3300013306 Bacteria 3310
365 Ga0163162_10156745 3300013306 Bacteria 2397
366 Ga0163162_10189925 3300013306 Bacteria 2181
367 Ga0163162_10331903 3300013306 Bacteria 1653
368 Ga0157372_10077581 3300013307 Bacteria 3753
369 Ga0157372_10140502 3300013307 Bacteria 2782
370 Ga0157372_10370304 3300013307 Bacteria 1669
371 Ga0157372_10575252 3300013307 Bacteria 1313
372 Ga0157375_10003836 3300013308 Bacteria 13038
373 Ga0157375_10012374 3300013308 Bacteria 7566
374 Ga0157375_10029286 3300013308 Bacteria 5176
375 Ga0157375_10073195 3300013308 Bacteria 3445
376 Ga0157375_10110281 3300013308 Bacteria 2849
377 Ga0157375_10119885 3300013308 Bacteria 2739
378 Ga0157375_10225306 3300013308 Bacteria 2034
379 Ga0157375_10498754 3300013308 Bacteria 1382
380 Ga0163163_10010941 3300014325 Bacteria 8198
381 Ga0157380_10417405 3300014326 Bacteria 1279
382 Ga0182008_10005557 3300014497 Bacteria 7157
383 Ga0157377_10000022 3300014745 Bacteria 146702
384 Ga0157377_10075116 3300014745 Bacteria 1962
385 Ga0157379_10159004 3300014968 Bacteria 2039
386 Ga0157379_10184475 3300014968 Bacteria 1885
387 Ga0157379_10267566 3300014968 Bacteria 1554
388 Ga0157376_10001097 3300014969 Bacteria 17761
389 Ga0157376_10002980 3300014969 Bacteria 11610
390 Ga0157376_10027826 3300014969 Bacteria 4487
391 Ga0157376_10077529 3300014969 Bacteria 2843
392 Ga0157376_10096398 3300014969 Bacteria 2574
393 Ga0157376_10106684 3300014969 Bacteria 2458
394 Ga0157376_10131874 3300014969 Bacteria 2231
395 Ga0157376_10233591 3300014969 Bacteria 1709
396 Ga0182007_10000472 3300015262 Bacteria 24301
397 Ga0182007_10000653 3300015262 Bacteria 19886
398 Ga0183362_10001 3300015683 Bacteria 2046624
399 Ga0163161_10000092 3300017792 Bacteria 90636
400 Ga0163161_10001617 3300017792 Bacteria 16589
401 Ga0163161_10044124 3300017792 Bacteria 3211
402 Ga0163161_10064992 3300017792 Bacteria 2662
403 Ga0163161_10072407 3300017792 Bacteria 2523
404 Ga0213872_10000008 3300021361 Bacteria 226283
405 Ga0213872_10000058 3300021361 Bacteria 100531
406 Ga0213872_10000070 3300021361 Bacteria 91519
407 Ga0213872_10004816 3300021361 Bacteria 7046
408 Ga0213872_10009068 3300021361 Bacteria 4784
409 Ga0213872_10055839 3300021361 Bacteria 1789
410 Ga0213872_10122518 3300021361 Bacteria 1149
411 Ga0209784_100009 3300025224 Bacteria 688031
412 Ga0209566_100007 3300025225 Bacteria 688031
413 Ga0209674_100007 3300025226 Bacteria 1077082
414 Ga0209674_100018 3300025226 Bacteria 688031
415 Ga0209672_100647 3300025228 Bacteria 17930
416 Ga0209672_109733 3300025228 Bacteria 1337
417 Ga0209147_101771 3300025229 Bacteria 6842
418 Ga0209563_100013 3300025230 Bacteria 941463
419 Ga0209563_100020 3300025230 Bacteria 688031
420 Ga0209563_100052 3300025230 Bacteria 334307
421 Ga0207427_100859 3300025231 Bacteria 13492
422 Ga0209258_100099 3300025242 Bacteria 214924
423 Ga0209258_100177 3300025242 Bacteria 140714
424 Ga0209258_100534 3300025242 Bacteria 36052
425 Ga0207425_1000654 3300025245 Bacteria 19096
426 Ga0209646_1000094 3300025246 Bacteria 182874
427 Ga0209026_1000009 3300025250 Bacteria 531812
428 Ga0209677_100010 3300025253 Bacteria 688031
429 Ga0209677_100015 3300025253 Bacteria 532137
430 Ga0209677_100097 3300025253 Bacteria 97418
431 Ga0209148_1000103 3300025254 Bacteria 215356
432 Ga0209148_1002932 3300025254 Bacteria 5175
433 Ga0209759_1000065 3300025256 Bacteria 187612
434 Ga0209759_1000399 3300025256 Bacteria 53437
435 Ga0209129_1000144 3300025258 Bacteria 115999
436 Ga0209565_1000073 3300025263 Bacteria 164695
437 Ga0209455_1000108 3300025272 Bacteria 193021
438 Ga0209455_1030565 3300025272 Bacteria 916
439 Ga0209673_1000127 3300025273 Bacteria 164695
440 Ga0209673_1001619 3300025273 Bacteria 19616
441 Ga0209673_1003739 3300025273 Bacteria 8682
442 Ga0209673_1004525 3300025273 Bacteria 7401
443 Ga0209673_1035444 3300025273 Bacteria 1493
444 Ga0209130_1002188 3300025284 Bacteria 10305
445 Ga0209675_1000029 3300025291 Bacteria 281053
446 Ga0209675_1022498 3300025291 Bacteria 1654
447 Ga0209564_1000003 3300025295 Bacteria 1585848
448 Ga0209564_1000029 3300025295 Bacteria 505995
449 Ga0209758_1000043 3300025297 Bacteria 402310
450 Ga0209758_1000434 3300025297 Bacteria 70561
451 Ga0209050_1000197 3300025298 Bacteria 135303
452 Ga0209050_1001620 3300025298 Bacteria 23116
453 Ga0209050_1009006 3300025298 Bacteria 5199
454 Ga0209256_1000249 3300025299 Bacteria 95279
455 Ga0209256_1000826 3300025299 Bacteria 39205
456 Ga0209256_1008621 3300025299 Bacteria 4677
457 Ga0209051_1001020 3300025303 Bacteria 26785
458 Ga0209051_1001309 3300025303 Bacteria 21862
459 Ga0209051_1003300 3300025303 Bacteria 10694
460 Ga0209051_1003649 3300025303 Bacteria 9969
461 Ga0209051_1007414 3300025303 Bacteria 5995
462 Ga0209051_1059008 3300025303 Bacteria 1219
463 Ga0209257_1000967 3300025304 Bacteria 39365
464 Ga0209257_1001007 3300025304 Bacteria 38067
465 Ga0209257_1001138 3300025304 Bacteria 34042
466 Ga0209257_1033542 3300025304 Bacteria 1613
467 Ga0207656_10003873 3300025321 Bacteria 5188
468 Ga0207655_1001248 3300025728 Bacteria 24268
469 Ga0207682_10051234 3300025893 Bacteria 1709
470 Ga0207682_10189216 3300025893 Bacteria 943
471 Ga0207642_10005047 3300025899 Bacteria 4285
472 Ga0207680_10005639 3300025903 Bacteria 5989
473 Ga0207680_10115092 3300025903 Bacteria 1751
474 Ga0207645_10001387 3300025907 Bacteria 19872
475 Ga0207645_10019484 3300025907 Bacteria 4447
476 Ga0207645_10029556 3300025907 Bacteria 3532
477 Ga0207645_10523130 3300025907 Bacteria 804
478 Ga0207643_10022995 3300025908 Bacteria 3436
479 Ga0207684_10341424 3300025910 Bacteria 1290
480 Ga0207654_10048107 3300025911 Bacteria 2439
481 Ga0207654_10058662 3300025911 Bacteria 2242
482 Ga0207654_10145045 3300025911 Bacteria 1518
483 Ga0207654_10233033 3300025911 Bacteria 1227
484 Ga0207695_10002390 3300025913 Bacteria 27827
485 Ga0207695_10012192 3300025913 Bacteria 10329
486 Ga0207695_10013685 3300025913 Bacteria 9657
487 Ga0207695_10014882 3300025913 Bacteria 9183
488 Ga0207695_10471322 3300025913 Bacteria 1138
489 Ga0207695_10580776 3300025913 Bacteria 1002
490 Ga0207695_10881394 3300025913 Bacteria 775
491 Ga0207671_10000614 3300025914 Bacteria 47019
492 Ga0207671_10002553 3300025914 Bacteria 19340
493 Ga0207671_10015484 3300025914 Bacteria 5967
494 Ga0207671_10041244 3300025914 Bacteria 3416
495 Ga0207671_10047263 3300025914 Bacteria 3185
496 Ga0207693_10224222 3300025915 Bacteria 1476
497 Ga0207663_10105378 3300025916 Bacteria 1903
498 Ga0207662_10009848 3300025918 Bacteria 5273
499 Ga0207662_10318155 3300025918 Bacteria 1038
500 Ga0207649_10110051 3300025920 Bacteria 1839
501 Ga0207652_10057317 3300025921 Bacteria 3355
502 Ga0207652_10261987 3300025921 Bacteria 1559
503 Ga0207681_10026326 3300025923 Bacteria 3750
504 Ga0207681_10091583 3300025923 Bacteria 2172
505 Ga0207681_10204214 3300025923 Bacteria 1519
506 Ga0207694_10000845 3300025924 Bacteria 27248
507 Ga0207694_10006267 3300025924 Bacteria 9085
508 Ga0207694_10015716 3300025924 Bacteria 5709
509 Ga0207694_10063519 3300025924 Bacteria 2876
510 Ga0207694_10100564 3300025924 Bacteria 2291
511 Ga0207694_10356833 3300025924 Bacteria 1211
512 Ga0207650_10001201 3300025925 Bacteria 19013
513 Ga0207650_10378684 3300025925 Bacteria 1168
514 Ga0207659_10004014 3300025926 Bacteria 8877
515 Ga0207659_10051134 3300025926 Bacteria 2938
516 Ga0207659_10177094 3300025926 Bacteria 1687
517 Ga0207659_10484340 3300025926 Bacteria 1045
518 Ga0207659_10769089 3300025926 Bacteria 827
519 Ga0207687_10083859 3300025927 Bacteria 2308
520 Ga0207687_10090142 3300025927 Bacteria 2234
521 Ga0207687_10181807 3300025927 Bacteria 1630
522 Ga0207687_10239966 3300025927 Bacteria 1436
523 Ga0207644_10030413 3300025931 Bacteria 3755
524 Ga0207644_10042292 3300025931 Bacteria 3228
525 Ga0207644_10067092 3300025931 Bacteria 2614
526 Ga0207644_10178257 3300025931 Bacteria 1664
527 Ga0207644_10557922 3300025931 Bacteria 948
528 Ga0207706_10023128 3300025933 Bacteria 5581
529 Ga0207706_10023813 3300025933 Bacteria 5492
530 Ga0207706_10045929 3300025933 Bacteria 3868
531 Ga0207706_10164206 3300025933 Bacteria 1952
532 Ga0207706_10177181 3300025933 Bacteria 1873
533 Ga0207686_10003079 3300025934 Bacteria 8979
534 Ga0207686_10007355 3300025934 Bacteria 5927
535 Ga0207686_10052497 3300025934 Bacteria 2545
536 Ga0207686_10213733 3300025934 Bacteria 1388
537 Ga0207709_10000522 3300025935 Bacteria 33464
538 Ga0207709_10021187 3300025935 Bacteria 3677
539 Ga0207670_10132842 3300025936 Bacteria 1826
540 Ga0207669_10063670 3300025937 Bacteria 2278
541 Ga0207669_10538162 3300025937 Bacteria 940
542 Ga0207704_10005184 3300025938 Bacteria 5999
543 Ga0207704_10020136 3300025938 Bacteria 3522
544 Ga0207704_10031520 3300025938 Bacteria 2988
545 Ga0207704_10052210 3300025938 Bacteria 2477
546 Ga0207704_10610881 3300025938 Bacteria 894
547 Ga0207665_10108110 3300025939 Bacteria 1951
548 Ga0207665_10151578 3300025939 Bacteria 1661
549 Ga0207691_10010208 3300025940 Bacteria 9008
550 Ga0207691_10010671 3300025940 Bacteria 8818
551 Ga0207691_10017244 3300025940 Bacteria 6849
552 Ga0207691_10022031 3300025940 Bacteria 6012
553 Ga0207691_10027731 3300025940 Bacteria 5308
554 Ga0207691_10030243 3300025940 Bacteria 5062
555 Ga0207691_10232108 3300025940 Bacteria 1597
556 Ga0207691_10392418 3300025940 Bacteria 1184
557 Ga0207711_10009476 3300025941 Bacteria 8125
558 Ga0207711_10102212 3300025941 Bacteria 2537
559 Ga0207711_10517025 3300025941 Bacteria 1113
560 Ga0207689_10031723 3300025942 Bacteria 4396
561 Ga0207689_10091430 3300025942 Bacteria 2500
562 Ga0207689_10119625 3300025942 Bacteria 2167
563 Ga0207689_10140031 3300025942 Bacteria 1993
564 Ga0207689_10331869 3300025942 Bacteria 1263
565 Ga0207661_10031100 3300025944 Bacteria 4119
566 Ga0207679_10127792 3300025945 Bacteria 2034
567 Ga0207679_10195037 3300025945 Bacteria 1687
568 Ga0207679_10210005 3300025945 Bacteria 1632
569 Ga0207667_10000115 3300025949 Bacteria 128732
570 Ga0207667_10003604 3300025949 Bacteria 19109
571 Ga0207667_10021146 3300025949 Bacteria 7215
572 Ga0207667_10054967 3300025949 Bacteria 4187
573 Ga0207667_10857480 3300025949 Bacteria 902
574 Ga0207651_10001269 3300025960 Bacteria 11360
575 Ga0207651_10041063 3300025960 Bacteria 3067
576 Ga0207651_10058883 3300025960 Bacteria 2657
577 Ga0207651_10060444 3300025960 Bacteria 2630
578 Ga0207651_10078209 3300025960 Bacteria 2372
579 Ga0207651_10091726 3300025960 Bacteria 2225
580 Ga0207651_10586467 3300025960 Bacteria 973
581 Ga0207712_10001789 3300025961 Bacteria 14257
582 Ga0207712_10028770 3300025961 Bacteria 3720
583 Ga0207712_10112224 3300025961 Bacteria 2047
584 Ga0207712_10112384 3300025961 Bacteria 2045
585 Ga0207712_10127602 3300025961 Bacteria 1934
586 Ga0207712_10142490 3300025961 Bacteria 1841
587 Ga0207712_10201585 3300025961 Bacteria 1578
588 Ga0207668_10129222 3300025972 Bacteria 1926
589 Ga0207668_10357232 3300025972 Bacteria 1223
590 Ga0207668_10501902 3300025972 Bacteria 1044
591 Ga0207640_10004685 3300025981 Bacteria 7424
592 Ga0207640_10031818 3300025981 Bacteria 3265
593 Ga0207640_10099550 3300025981 Bacteria 2035
594 Ga0207658_10001603 3300025986 Bacteria 17420
595 Ga0207658_10036650 3300025986 Bacteria 3518
596 Ga0207658_10080039 3300025986 Bacteria 2501
597 Ga0207658_10112044 3300025986 Bacteria 2159
598 Ga0207658_10113311 3300025986 Bacteria 2148
599 Ga0207658_10337974 3300025986 Bacteria 1308
600 Ga0207658_10765596 3300025986 Bacteria 875
601 Ga0207677_10149004 3300026023 Bacteria 1802
602 Ga0207677_10249226 3300026023 Bacteria 1441
603 Ga0207703_10001821 3300026035 Bacteria 19010
604 Ga0207703_10811799 3300026035 Bacteria 893
605 Ga0207639_10000158 3300026041 Bacteria 51667
606 Ga0207639_10012567 3300026041 Bacteria 5900
607 Ga0207639_10100782 3300026041 Bacteria 2333
608 Ga0207639_10287590 3300026041 Bacteria 1448
609 Ga0207639_10565443 3300026041 Bacteria 1045
610 Ga0207639_10698061 3300026041 Bacteria 941
611 Ga0207678_10000915 3300026067 Bacteria 27002
612 Ga0207678_10034941 3300026067 Bacteria 4377
613 Ga0207678_10151115 3300026067 Bacteria 1983
614 Ga0207678_10258477 3300026067 Bacteria 1492
615 Ga0207678_10286989 3300026067 Bacteria 1413
616 Ga0207708_10025243 3300026075 Bacteria 4494
617 Ga0207702_10000610 3300026078 Bacteria 39489
618 Ga0207702_10222666 3300026078 Bacteria 1759
619 Ga0207641_10001726 3300026088 Bacteria 21102
620 Ga0207641_10007613 3300026088 Bacteria 9004
621 Ga0207641_10146922 3300026088 Bacteria 2132
622 Ga0207641_10212881 3300026088 Bacteria 1788
623 Ga0207641_10286134 3300026088 Bacteria 1552
624 Ga0207641_10333729 3300026088 Bacteria 1441
625 Ga0207641_10480680 3300026088 Bacteria 1204
626 Ga0207648_10000032 3300026089 Bacteria 128009
627 Ga0207648_10004276 3300026089 Bacteria 14725
628 Ga0207648_10024643 3300026089 Bacteria 5367
629 Ga0207648_10307960 3300026089 Bacteria 1421
630 Ga0207676_10003149 3300026095 Bacteria 11781
631 Ga0207676_10016394 3300026095 Bacteria 5364
632 Ga0207676_10038548 3300026095 Bacteria 3649
633 Ga0207676_10176613 3300026095 Bacteria 1866
634 Ga0207676_10293877 3300026095 Bacteria 1481
635 Ga0207676_10365056 3300026095 Bacteria 1339
636 Ga0207676_10607769 3300026095 Bacteria 1051
637 Ga0207674_10028246 3300026116 Bacteria 5923
638 Ga0207674_10031491 3300026116 Bacteria 5572
639 Ga0207674_10320474 3300026116 Bacteria 1499
640 Ga0207674_10610662 3300026116 Bacteria 1053
641 Ga0207675_100010693 3300026118 Bacteria 8597
642 Ga0207675_100052369 3300026118 Bacteria 3809
643 Ga0207675_100491553 3300026118 Bacteria 1221
644 Ga0207683_10008536 3300026121 Bacteria 8766
645 Ga0207683_10010783 3300026121 Bacteria 7793
646 Ga0207683_10025950 3300026121 Bacteria 5057
647 Ga0207683_10046957 3300026121 Bacteria 3781
648 Ga0207683_10158482 3300026121 Bacteria 2045
649 Ga0207683_10257335 3300026121 Bacteria 1594
650 Ga0207683_10304958 3300026121 Bacteria 1457
651 Ga0207683_10334022 3300026121 Bacteria 1389
652 Ga0207683_10346703 3300026121 Bacteria 1363
653 Ga0207683_10459027 3300026121 Bacteria 1175
654 Ga0207698_10004168 3300026142 Bacteria 8790
655 Ga0207698_10005832 3300026142 Bacteria 7649
656 Ga0207698_11045285 3300026142 Bacteria 828
657 Ga0209973_1000882 3300027252 Bacteria 2433
658 Ga0209389_1013653 3300027296 Bacteria 7387
659 Ga0209371_1013896 3300027312 Bacteria 2234
660 Ga0209970_1000515 3300027614 Bacteria 6660
661 Ga0209983_1006568 3300027665 Bacteria 2386
662 Ga0209983_1063511 3300027665 Bacteria 818
663 Ga0209282_1000109 3300027666 Bacteria 53813
664 Ga0209813_10024848 3300027866 Bacteria 1717
665 Ga0209974_10016800 3300027876 Bacteria 2429
666 Ga0209974_10026849 3300027876 Bacteria 1904
667 Ga0207428_10059781 3300027907 Bacteria 3021
668 Ga0207428_10164516 3300027907 Bacteria 1683
669 Ga0207428_10487575 3300027907 Bacteria 896
670 Ga0268266_10090792 3300028379 Bacteria 2677
671 Ga0268266_10111418 3300028379 Bacteria 2425
672 Ga0268266_10125043 3300028379 Bacteria 2293
673 Ga0268266_10152949 3300028379 Bacteria 2081
674 Ga0268266_10259614 3300028379 Bacteria 1610
675 Ga0268265_10022791 3300028380 Bacteria 4405
676 Ga0268265_10026796 3300028380 Bacteria 4104
677 Ga0268265_10048187 3300028380 Bacteria 3197
678 Ga0268265_10052565 3300028380 Bacteria 3082
679 Ga0268265_10073151 3300028380 Bacteria 2676
680 Ga0268265_10434984 3300028380 Bacteria 1221
681 Ga0268264_10007099 3300028381 Bacteria 9387
682 Ga0268264_10019582 3300028381 Bacteria 5528
683 Ga0268264_10175698 3300028381 Bacteria 1941
684 Ga0268264_10838651 3300028381 Bacteria 920
685 Ga0268264_10902713 3300028381 Bacteria 887
686 Ga0265334_10018680 3300028573 Bacteria 2859
687 Ga0307517_10008692 3300028786 Bacteria 14532
688 Ga0307517_10123385 3300028786 Bacteria 1903
689 Ga0307517_10161501 3300028786 Bacteria 1502
690 Ga0307515_10000049 3300028794 Bacteria 278611
691 Ga0307515_10000066 3300028794 Bacteria 244076
692 Ga0307515_10000267 3300028794 Bacteria 128554
693 Ga0307515_10000842 3300028794 Bacteria 70481
694 Ga0307515_10001088 3300028794 Bacteria 62228
695 Ga0307515_10001640 3300028794 Bacteria 49762
696 Ga0307515_10020605 3300028794 Bacteria 11749
697 Ga0307515_10031977 3300028794 Bacteria 8740
698 Ga0307515_10054917 3300028794 Bacteria 5834
699 Ga0307515_10066935 3300028794 Bacteria 4965
700 Ga0307515_10111538 3300028794 Bacteria 3190
701 Ga0307515_10131211 3300028794 Bacteria 2758
702 Ga0307515_10157014 3300028794 Bacteria 2342
703 Ga0268256_1015399 3300030500 Bacteria 2234
704 Ga0307512_10035373 3300030522 Bacteria 4258
705 Ga0307512_10045448 3300030522 Bacteria 3596
706 Ga0316181_1119047 3300030744 Bacteria 1771
707 Ga0316182_1368921 3300030745 Bacteria 6780
708 Ga0265332_10000002 3300031238 Bacteria 709510
709 Ga0265332_10000525 3300031238 Bacteria 26033
710 Ga0265340_10006590 3300031247 Bacteria 6378
711 Ga0265331_10001109 3300031250 Bacteria 20715
712 Ga0265327_10000120 3300031251 Bacteria 171108
713 Ga0265327_10006291 3300031251 Bacteria 9563
714 Ga0265316_10000129 3300031344 Bacteria 82815
715 Ga0307513_10003449 3300031456 Bacteria 21402
716 Ga0307513_10026272 3300031456 Bacteria 6719
717 Ga0307513_10040446 3300031456 Bacteria 5155
718 Ga0307513_10069344 3300031456 Bacteria 3690
719 Ga0307509_10006861 3300031507 Bacteria 15150
720 Ga0307509_10010424 3300031507 Bacteria 11393
721 Ga0307509_10019730 3300031507 Bacteria 7676
722 Ga0307509_10111462 3300031507 Bacteria 2739
723 Ga0307509_10111577 3300031507 Bacteria 2737
724 Ga0307408_100000193 3300031548 Bacteria 65882
725 Ga0307408_100087592 3300031548 Bacteria 2343
726 Ga0307408_100308956 3300031548 Bacteria 1327
727 Ga0307408_100508123 3300031548 Bacteria 1056
728 Ga0307508_10000097 3300031616 Bacteria 103662
729 Ga0307508_10002774 3300031616 Bacteria 18247
730 Ga0307508_10049288 3300031616 Bacteria 3750
731 Ga0307508_10088971 3300031616 Bacteria 2673
732 Ga0307514_10000806 3300031649 Bacteria 51095
733 Ga0307514_10001372 3300031649 Bacteria 30729
734 Ga0307514_10002956 3300031649 Bacteria 16887
735 Ga0307514_10197345 3300031649 Bacteria 1271
736 Ga0265314_10000089 3300031711 Bacteria 138050
737 Ga0265314_10089035 3300031711 Bacteria 2014
738 Ga0265342_10134325 3300031712 Bacteria 1384
739 Ga0265342_10208227 3300031712 Bacteria 1059
740 Ga0316576_10001183 3300031727 Bacteria 13724
741 Ga0316576_10070664 3300031727 Bacteria 2575
742 Ga0316576_10450687 3300031727 Bacteria 950
743 Ga0316578_10029623 3300031728 Bacteria 3107
744 Ga0307516_10002245 3300031730 Bacteria 26096
745 Ga0307516_10006152 3300031730 Bacteria 14142
746 Ga0307516_10052707 3300031730 Bacteria 3981
747 Ga0307516_10141051 3300031730 Bacteria 2180
748 Ga0307516_10195284 3300031730 Bacteria 1747
749 Ga0307516_10273936 3300031730 Bacteria 1372
750 Ga0307405_10049105 3300031731 Bacteria 2606
751 Ga0307405_10137989 3300031731 Bacteria 1696
752 Ga0307405_10195011 3300031731 Bacteria 1466
753 Ga0307405_10401191 3300031731 Bacteria 1073
754 Ga0316577_10003998 3300031733 Bacteria 7546
755 Ga0307413_10468300 3300031824 Bacteria 1004
756 Ga0307518_10190276 3300031838 Bacteria 1376
757 Ga0307410_10169160 3300031852 Bacteria 1645
758 Ga0307410_10266690 3300031852 Bacteria 1338
759 Ga0307407_10025101 3300031903 Bacteria 3137
760 Ga0307412_10224187 3300031911 Bacteria 1443
761 Ga0307412_10226921 3300031911 Bacteria 1435
762 Ga0307412_10459704 3300031911 Bacteria 1051
763 Ga0307409_100276739 3300031995 Bacteria 1549
764 Ga0307416_100010663 3300032002 Bacteria 6086
765 Ga0307416_100220902 3300032002 Bacteria 1817
766 Ga0307416_100230428 3300032002 Bacteria 1785
767 Ga0307416_100263350 3300032002 Bacteria 1687
768 Ga0307416_100791153 3300032002 Bacteria 1044
769 Ga0307414_10385744 3300032004 Bacteria 1213
770 Ga0307414_10873422 3300032004 Bacteria 823
771 Ga0307411_10010818 3300032005 Bacteria 4887
772 Ga0307411_10124552 3300032005 Bacteria 1871
773 Ga0307411_10401201 3300032005 Bacteria 1134
774 Ga0307415_100001705 3300032126 Bacteria 10681
775 Ga0316585_10011773 3300032137 Bacteria 2583
776 Ga0307507_10063271 3300033179 Bacteria 3427
777 Ga0307510_10000311 3300033180 Bacteria 44908
778 Ga0316596_1007375 3300033541 Bacteria 2598
779 Ga0373944_0014357 3300035089 Bacteria 2210
780 Ga0373932_0136663 3300035112 Bacteria 830
781 Ga0373946_0142311 3300035171 Bacteria 1113
782 Ga0373942_0012519 3300035207 Bacteria 2028
783 Ga0373942_0022205 3300035207 Bacteria 1608
784 Ga0316574_0008856 3300035398 Bacteria 5611
785 Ga0373931_0002407 3300035691 Bacteria 8277
786 Ga0373931_0004639 3300035691 Bacteria 6284
787 Ga0373931_0006945 3300035691 Bacteria 5326
788 Ga0373927_0318303 3300035695 Bacteria 1024
789 Ga0373937_0199334 3300036401 Bacteria 1882
790 Ga0373937_0280495 3300036401 Bacteria 1573
791 Ga0316582_0075295 3300036647 Bacteria 2193
792 Ga0373925_0009207 3300037068 Bacteria 7187
793 Ga0395899_0003079 3300037312 Bacteria 13283
794 Ga0395900_0000054 3300037418 Bacteria 220487
795 Ga0395900_0013211 3300037418 Bacteria 8441
796 Ga0395900_0113192 3300037418 Bacteria 2785
797 Ga0395900_0149640 3300037418 Bacteria 2385
798 Ga0395900_0262176 3300037418 Bacteria 1725
799 Ga0395898_0000798 3300037466 Bacteria 53358
800 Ga0395898_0098190 3300037466 Bacteria 2812
801 Ga0395905_0000148 3300037471 Bacteria 116301
802 Ga0395905_0002549 3300037471 Bacteria 20091
803 Ga0395905_0003187 3300037471 Bacteria 17661
804 Ga0395905_0005238 3300037471 Bacteria 13272
805 Ga0395905_0018699 3300037471 Bacteria 6572
806 Ga0395905_0019557 3300037471 Bacteria 6418
807 Ga0395905_0087754 3300037471 Bacteria 2916
808 Ga0395905_0116877 3300037471 Bacteria 2506
809 Ga0395905_0162368 3300037471 Bacteria 2099
810 Ga0395905_0233286 3300037471 Bacteria 1720
811 Ga0395905_0264387 3300037471 Bacteria 1606
812 Ga0395905_0317449 3300037471 Bacteria 1447
813 Ga0395905_0393397 3300037471 Bacteria 1280
814 Ga0395901_0001849 3300038443 Bacteria 21886
815 Ga0395901_0012708 3300038443 Bacteria 8540
816 Ga0395901_0146215 3300038443 Bacteria 2484
817 Ga0436361_0068556 3300039447 Bacteria 100895
818 Ga0436361_0071320 3300039447 Bacteria 6752
819 Ga0436361_0084014 3300039447 Bacteria 1321
820 Ga0436361_0332176 3300039447 Bacteria 56332
821 Ga0436361_0429906 3300039447 Bacteria 27265
822 Ga0436361_0562763 3300039447 Bacteria 6798
823 Ga0436361_0704832 3300039447 Bacteria 27869
824 Ga0436361_0900991 3300039447 Bacteria 50083
825 Ga0436361_1145133 3300039447 Bacteria 2723
826 Ga0439466_0001803 3300041411 Bacteria 8374
827 Ga0439466_0084144 3300041411 Bacteria 1001
828 Ga0439465_0003008 3300041413 Bacteria 5510
829 Ga0451791_0184948 3300041451 Bacteria 1496
830 Ga0451791_0611886 3300041451 Bacteria 1252
831 Ga0451797_0922191 3300041453 Bacteria 2632
832 Ga0451802_0254447 3300041460 Bacteria 1407
833 Ga0451804_0366282 3300041463 Bacteria 1982
834 Ga0451807_0264544 3300041486 Bacteria 3369
835 Ga0451807_1301096 3300041486 Bacteria 1234
836 Ga0451837_0356103 3300041494 Bacteria 1062
837 Ga0439431_0005725 3300041997 Bacteria 2742
838 Ga0439433_0000991 3300041999 Bacteria 5727
839 Ga0439442_003824 3300042002 Bacteria 2981
840 Ga0439432_002602 3300042006 Bacteria 6790
841 Ga0439449_0002379 3300042007 Bacteria 7363
842 Ga0439449_0031483 3300042007 Bacteria 1977
843 Ga0439452_000611 3300042010 Bacteria 18092
844 Ga0450898_013674 3300042134 Bacteria 1356
845 Ga0450906_013768 3300042145 Bacteria 1486
846 Ga0450910_008596 3300042147 Bacteria 1438
847 Ga0439446_0089340 3300042156 Bacteria 963
848 Ga0450908_002473 3300042184 Bacteria 3614
849 Ga0450918_000264 3300042531 Bacteria 11804
850 Ga0451577_0031506 3300042876 Bacteria 4783
851 Ga0451577_0262733 3300042876 Bacteria 1563
852 Ga0466969_0000054 3300044656 Bacteria 59867
853 Ga0466969_0006079 3300044656 Bacteria 6422
854 Ga0466969_0073994 3300044656 Bacteria 1634
855 Ga0466969_0139314 3300044656 Bacteria 1121
856 Ga0466972_0001650 3300044658 Bacteria 10913
857 Ga0466972_0018196 3300044658 Bacteria 3515
858 Ga0453683_0001307 3300044673 Bacteria 21969
859 Ga0466965_0001429 3300044683 Bacteria 9643
860 Ga0466965_0040577 3300044683 Bacteria 2291
861 Ga0466966_0003229 3300044684 Bacteria 10743
862 Ga0466966_0010728 3300044684 Bacteria 6091
863 Ga0466961_0023517 3300044693 Bacteria 3964
864 Ga0466961_0039938 3300044693 Bacteria 3007
865 Ga0466961_0054954 3300044693 Bacteria 2539
866 Ga0466964_0006188 3300044706 Bacteria 4459
867 Ga0466964_0008063 3300044706 Bacteria 3949
868 Ga0453684_0311720 3300044712 Bacteria 1785
869 Ga0466971_0016848 3300044719 Bacteria 3228
870 Ga0466971_0020521 3300044719 Bacteria 2937
871 Ga0466970_0008282 3300044765 Bacteria 5228
872 Ga0466957_0009701 3300044842 Bacteria 5497
873 Ga0466957_0030253 3300044842 Bacteria 3232
874 Ga0466959_0003173 3300045049 Bacteria 10670
875 Ga0466959_0010587 3300045049 Bacteria 6601
876 Ga0466959_0268752 3300045049 Bacteria 1172
877 Ga0466958_0056227 3300045836 Bacteria 2389
878 Ga0495592_0000113 3300046454 Bacteria 71049
879 Ga0495580_0115156 3300046472 Bacteria 1867
880 Ga0495582_0079149 3300046473 Bacteria 1824
881 Ga0495639_0022639 3300046475 Bacteria 2757
882 Ga0495664_0209872 3300046477 Bacteria 1179
883 Ga0495664_0280545 3300046477 Bacteria 1007
884 Ga0495584_0194965 3300046491 Bacteria 1030
885 Ga0495585_0014379 3300046492 Bacteria 4612
886 Ga0495610_0045202 3300046512 Bacteria 2180
887 Ga0495630_0330850 3300046517 Bacteria 1165
888 Ga0495630_0656223 3300046517 Bacteria 803
889 Ga0495632_0039270 3300046519 Bacteria 2390
890 Ga0495632_0051289 3300046519 Bacteria 2031
891 Ga0495632_0174863 3300046519 Bacteria 985
892 Ga0495643_0078342 3300046522 Bacteria 1725
893 Ga0495643_0110307 3300046522 Bacteria 1399
894 Ga0495642_0128971 3300046528 Bacteria 1088
895 Ga0495654_0009292 3300046530 Bacteria 5390
896 Ga0495665_0176435 3300046531 Bacteria 1111
897 Ga0495586_0122829 3300046535 Bacteria 1451
898 Ga0495598_0009545 3300046537 Bacteria 2299
899 Ga0495598_0037659 3300046537 Bacteria 1396
900 Ga0495621_0005434 3300046539 Bacteria 3664
901 Ga0495621_0029195 3300046539 Bacteria 1879
902 Ga0495597_0000063 3300046542 Bacteria 91471
903 Ga0495645_0322224 3300046543 Bacteria 1003
904 Ga0495622_0014795 3300046557 Bacteria 3626
905 Ga0495667_0311499 3300046559 Bacteria 997
906 Ga0495656_0001008 3300046615 Bacteria 9110
907 Ga0495656_0053670 3300046615 Bacteria 1732
908 Ga0495656_0125340 3300046615 Bacteria 1217
909 Ga0495625_0000396 3300046660 Bacteria 66627
910 Ga0495625_0015173 3300046660 Bacteria 6114
911 Ga0495625_0279030 3300046660 Bacteria 1076
912 Ga0495657_0200118 3300046675 Bacteria 1218
913 Ga0495646_0057785 3300046680 Bacteria 2320
914 Ga0495613_0376735 3300046689 Bacteria 971
915 Ga0495624_0034278 3300046690 Bacteria 3284
916 Ga0495649_0003001 3300046694 Bacteria 11583
917 Ga0495589_0002663 3300046794 Bacteria 9873
918 Ga0495660_0028467 3300046810 Bacteria 3157
919 Ga0495604_0142817 3300047317 Bacteria 1709
920 Ga0495604_0375593 3300047317 Bacteria 940
921 Ga0495676_0290931 3300047321 Bacteria 1104
922 Ga0495687_000596 3300047443 Bacteria 42162
923 Ga0495684_0387765 3300047471 Bacteria 984
924 Ga0495686_0061086 3300047472 Bacteria 2341
925 Ga0495593_0026312 3300047673 Bacteria 3213
926 Ga0495602_0151146 3300048088 Bacteria 1825
927 Ga0496100_0002149 3300048903 Bacteria 9914
928 Ga0496103_0020828 3300048906 Bacteria 3943
929 Ga0496104_0000038 3300048907 Bacteria 178150
930 Ga0496104_0067278 3300048907 Bacteria 3403
931 Ga0496105_0000038 3300048908 Bacteria 118666
932 Ga0496105_0012226 3300048908 Bacteria 6796
933 Ga0496106_0388903 3300048909 Bacteria 1121
934 Ga0496108_0408956 3300048911 Bacteria 1185
935 Ga0496108_0437113 3300048911 Bacteria 1143
936 Ga0496109_0512657 3300048912 Bacteria 1132
937 Ga0496110_0021889 3300048913 Bacteria 5421
938 Ga0496111_0083344 3300048914 Bacteria 2336
939 Ga0496111_0148645 3300048914 Bacteria 1737
940 Ga0496112_0109579 3300048915 Bacteria 2731
941 Ga0496113_0035188 3300048916 Bacteria 3662
942 Ga0496113_0213444 3300048916 Bacteria 1537
943 Ga0496115_0442919 3300048918 Bacteria 1050
944 Ga0496116_0016280 3300048919 Bacteria 5826
945 Ga0496117_0016264 3300048920 Bacteria 6286
946 Ga0496117_0036893 3300048920 Bacteria 3650
947 Ga0496117_0063606 3300048920 Bacteria 2521
948 Ga0496118_0000520 3300048921 Bacteria 63206
949 Ga0496118_0006635 3300048921 Bacteria 12635
950 Ga0496118_0009301 3300048921 Bacteria 9959
951 Ga0496121_0005276 3300048924 Bacteria 16661
952 Ga0496122_0002256 3300048925 Bacteria 27891
953 Ga0496123_0001158 3300048926 Bacteria 39125
954 Ga0496123_0002984 3300048926 Bacteria 19647
955 Ga0496124_0000125 3300048927 Bacteria 159942
956 Ga0496124_0183348 3300048927 Bacteria 1609
957 Ga0496124_0495944 3300048927 Bacteria 820
958 Ga0496125_0372995 3300048928 Bacteria 844
959 Ga0495682_0091568 3300049460 Bacteria 1092
960 Ga0501032_0005261 3300049569 Bacteria 9626
961 Ga0501032_0354473 3300049569 Bacteria 945
962 Ga0501033_0000720 3300049570 Bacteria 30337
963 Ga0501034_0004188 3300049571 Bacteria 16100
964 Ga0501034_0007701 3300049571 Bacteria 11459
965 Ga0501034_0063996 3300049571 Bacteria 3691
966 Ga0501036_0007930 3300049572 Bacteria 8687
967 Ga0501037_0033753 3300049573 Bacteria 3778
968 Ga0501037_0051682 3300049573 Bacteria 3006
969 Ga0501037_0103840 3300049573 Bacteria 2049
970 Ga0501038_0004437 3300049574 Bacteria 13039
971 Ga0501038_0062118 3300049574 Bacteria 3192
972 Ga0501038_0074322 3300049574 Bacteria 2876
973 Ga0501038_0428594 3300049574 Bacteria 1019
974 Ga0501039_0002430 3300049575 Bacteria 13866
975 Ga0501043_0028941 3300049579 Bacteria 4349
976 Ga0501043_0061653 3300049579 Bacteria 2945
977 Ga0501043_0085234 3300049579 Bacteria 2482
978 Ga0501046_0002962 3300049580 Bacteria 15706
979 Ga0501046_0013611 3300049580 Bacteria 6880
980 Ga0501048_0191161 3300049582 Bacteria 1450
981 Ga0501067_0125501 3300049583 Bacteria 1428
982 Ga0501067_0147991 3300049583 Bacteria 1308
983 Ga0501068_0064836 3300049584 Bacteria 2223
984 Ga0501070_0033046 3300049586 Bacteria 4327
985 Ga0501071_0046458 3300049587 Bacteria 3118
986 Ga0501073_0003125 3300049589 Bacteria 12413
987 Ga0501073_0225466 3300049589 Bacteria 1295
988 Ga0501074_0086312 3300049590 Bacteria 2248
989 Ga0501074_0130703 3300049590 Bacteria 1796
990 Ga0501079_0102597 3300049741 Bacteria 2218
991 Ga0501079_0635280 3300049741 Bacteria 840
992 Ga0501080_0002682 3300049742 Bacteria 15585
993 Ga0501080_0081487 3300049742 Bacteria 3006
994 Ga0501080_0123913 3300049742 Bacteria 2394
995 Ga0501080_0191599 3300049742 Bacteria 1879
996 Ga0501081_0150755 3300049743 Bacteria 1670
997 Ga0501083_0023802 3300049744 Bacteria 4247
998 Ga0501262_012938 3300049759 Bacteria 1071
999 Ga0501265_000359 3300049762 Bacteria 4739
1000 Ga0501035_0021681 3300049822 Bacteria 5907
1001 Ga0501035_0071298 3300049822 Bacteria 3077
1002 Ga0501035_0104116 3300049822 Bacteria 2489
1003 Ga0501044_0004235 3300049823 Bacteria 16109
1004 Ga0501044_0016545 3300049823 Bacteria 7916
1005 Ga0501044_0053233 3300049823 Bacteria 4165
1006 Ga0501044_0428964 3300049823 Bacteria 1231
1007 Ga0501044_0569944 3300049823 Bacteria 1027
1008 Ga0501045_0208014 3300049824 Bacteria 1457
1009 nmdc:mga03683_115249_c1 3300050489 Bacteria 1191
1010 nmdc:mga03683_1184_c1 3300050489 Bacteria 7682
1011 nmdc:mga03683_207506_c1 3300050489 Bacteria 901
1012 nmdc:mga03683_29407_c1 3300050489 Bacteria 2191
1013 nmdc:mga03n38_121729_c1 3300050490 Bacteria 1283
1014 nmdc:mga00v17_113669_c1 3300050491 Bacteria 1719
1015 nmdc:mga0yw44_1882_c1 3300050492 Bacteria 8638
1016 nmdc:mga0k408_107290_c1 3300050493 Bacteria 1650
1017 nmdc:mga0k408_113841_c1 3300050493 Bacteria 1600
1018 nmdc:mga0k408_124761_c1 3300050493 Bacteria 1527
1019 nmdc:mga0k408_19860_c1 3300050493 Bacteria 3760
1020 nmdc:mga0k408_21606_c1 3300050493 Bacteria 3617
1021 nmdc:mga0k408_320005_c1 3300050493 Bacteria 926
1022 nmdc:mga0k408_47482_c1 3300050493 Bacteria 2482
1023 nmdc:mga0k408_76211_c1 3300050493 Bacteria 1960
1024 nmdc:mga0k408_78197_c1 3300050493 Bacteria 1935
1025 nmdc:mga06z11_32826_c1 3300050494 Bacteria 2534
1026 nmdc:mga06z11_335122_c1 3300050494 Bacteria 904
1027 nmdc:mga04h51_18261_c1 3300050495 Bacteria 2063
1028 nmdc:mga07m45_178027_c1 3300050496 Bacteria 1237
1029 nmdc:mga07m45_19965_c1 3300050496 Bacteria 3636
1030 nmdc:mga07m45_2487_c1 3300050496 Bacteria 8640
1031 nmdc:mga07m45_43207_c1 3300050496 Bacteria 2527
1032 nmdc:mga07m45_7058_c2 3300050496 Bacteria 4088
1033 nmdc:mga07m45_9482_c1 3300050496 Bacteria 5052
1034 nmdc:mga05p37_67216_c1 3300050507 Bacteria 4409
1035 nmdc:mga09592_44330_c1 3300050508 Bacteria 3744
1036 nmdc:mga0qj67_301007_c1 3300050509 Bacteria 1299
1037 nmdc:mga06r32_35879_c1 3300050510 Bacteria 4680
1038 nmdc:mga08y16_6614_c1 3300050511 Bacteria 12156
1039 nmdc:mga0n895_282394_c1 3300050512 Bacteria 1683
1040 nmdc:mga0n895_6398_c1 3300050512 Bacteria 9997
1041 nmdc:mga0n895_836151_c1 3300050512 Bacteria 909
1042 nmdc:mga0rr50_6385_c1 3300050513 Bacteria 7170
1043 nmdc:mga0rr50_676651_c1 3300050513 Bacteria 881
1044 nmdc:mga08x19_32951_c1 3300050514 Bacteria 3268
1045 nmdc:mga08x19_51210_c1 3300050514 Bacteria 2652
1046 nmdc:mga08x19_55184_c1 3300050514 Bacteria 2560
1047 nmdc:mga0a205_190348_c1 3300050515 Bacteria 1944
1048 nmdc:mga0a205_355291_c1 3300050515 Bacteria 1332
1049 Ga0500635_0000026 3300053080 Bacteria 104983
1050 Ga0500578_0000926 3300053086 Bacteria 32927
1051 Ga0500578_0086543 3300053086 Bacteria 1991
1052 Ga0500651_0002343 3300053093 Bacteria 9953
1053 Ga0500651_0015061 3300053093 Bacteria 4741
1054 Ga0500651_0037658 3300053093 Bacteria 3048
1055 Ga0500651_0121288 3300053093 Bacteria 1587
1056 Ga0500594_0000905 3300053118 Bacteria 6359
1057 Ga0500597_011262 3300053120 Bacteria 3228
1058 Ga0500623_103280 3300053127 Bacteria 1296
1059 Ga0500652_009409 3300053131 Bacteria 3303
1060 Ga0500559_0000260 3300053136 Bacteria 41596
1061 Ga0500568_0017724 3300053139 Bacteria 3136
1062 Ga0500616_0097632 3300053153 Bacteria 1442
1063 Ga0500619_000059 3300053154 Bacteria 33814
1064 Ga0500622_0001479 3300053156 Bacteria 18702
1065 Ga0500622_0001878 3300053156 Bacteria 15867
1066 Ga0501084_0279667 3300054114 Bacteria 1409
1067 Ga0500661_012541 3300055283 Bacteria 1530
1068 Ga0590071_001283 3300059421 Bacteria 6744
1069 Ga0501082_0068584 3300060353 Bacteria 3053
1070 Ga0501082_0687342 3300060353 Bacteria 895
1071 Ga0466962_0002298 3300061719 Bacteria 9060
1072 Ga0466962_0088000 3300061719 Bacteria 1487
1073 Ga0530510_0186491 3300061734 Bacteria 1539

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10017849 Ga0111539_1001784910 193
2 3300005338 Ga0068868_100274579 Ga0068868_1002745792 215
3 3300005617 Ga0068859_100257130 Ga0068859_1002571302 215
4 3300005841 Ga0068863_100052686 Ga0068863_1000526863 215
5 3300006237 Ga0097621_100055961 Ga0097621_1000559613 215
6 3300006931 Ga0097620_100257118 Ga0097620_1002571182 215
7 3300013297 Ga0157378_10000016 Ga0157378_10000016104 215
8 3300025924 Ga0207694_10015716 Ga0207694_100157162 215
9 3300026088 Ga0207641_10333729 Ga0207641_103337292 215
10 3300026095 Ga0207676_10607769 Ga0207676_106077691 215
11 3300005539 Ga0068853_100523955 Ga0068853_1005239551 216
12 3300049569 Ga0501032_0354473 Ga0501032_0354473_67_783 217
13 3300049571 Ga0501034_0007701 Ga0501034_0007701_7202_7918 217
14 3300049579 Ga0501043_0028941 Ga0501043_0028941_381_1097 217
15 3300049586 Ga0501070_0033046 Ga0501070_0033046_578_1294 217
16 3300049590 Ga0501074_0086312 Ga0501074_0086312_1023_1739 217
17 3300005354 Ga0070675_100292535 Ga0070675_1002925352 218
18 3300005367 Ga0070667_100000848 Ga0070667_1000008486 218
19 3300005455 Ga0070663_100001730 Ga0070663_1000017304 218
20 3300005459 Ga0068867_100012878 Ga0068867_1000128785 218
21 3300005539 Ga0068853_100061217 Ga0068853_1000612172 218
22 3300005543 Ga0070672_100010304 Ga0070672_1000103044 218
23 3300005548 Ga0070665_100088866 Ga0070665_1000888662 218
24 3300005618 Ga0068864_100468345 Ga0068864_1004683451 218
25 3300006881 Ga0068865_100010706 Ga0068865_1000107065 218
26 3300009176 Ga0105242_10207852 Ga0105242_102078522 218
27 3300009177 Ga0105248_10001415 Ga0105248_1000141520 218
28 3300009177 Ga0105248_10263516 Ga0105248_102635162 218
29 3300009545 Ga0105237_10003141 Ga0105237_1000314113 218
30 3300009553 Ga0105249_10003146 Ga0105249_1000314610 218
31 3300013296 Ga0157374_10174012 Ga0157374_101740121 218
32 3300013308 Ga0157375_10012374 Ga0157375_100123744 218
33 3300025913 Ga0207695_10471322 Ga0207695_104713221 218
34 3300025914 Ga0207671_10041244 Ga0207671_100412442 218
35 3300025938 Ga0207704_10031520 Ga0207704_100315203 218
36 3300025940 Ga0207691_10017244 Ga0207691_100172445 218
37 3300025941 Ga0207711_10009476 Ga0207711_100094767 218
38 3300025961 Ga0207712_10001789 Ga0207712_100017894 218
39 3300025961 Ga0207712_10112384 Ga0207712_101123841 218
40 3300025986 Ga0207658_10001603 Ga0207658_100016037 218
41 3300026041 Ga0207639_10012567 Ga0207639_100125672 218
42 3300026041 Ga0207639_10100782 Ga0207639_101007824 218
43 3300026067 Ga0207678_10000915 Ga0207678_100009154 218
44 3300026089 Ga0207648_10024643 Ga0207648_100246434 218
45 3300028379 Ga0268266_10111418 Ga0268266_101114183 218
46 3300047472 Ga0495686_0061086 Ga0495686_0061086_1491_2207 218
47 3300048925 Ga0496122_0002256 Ga0496122_0002256_21933_22649 218
48 3300048926 Ga0496123_0002984 Ga0496123_0002984_6543_7259 218
49 3300048927 Ga0496124_0495944 Ga0496124_0495944_58_774 218
50 3300053120 Ga0500597_011262 Ga0500597_011262_2159_2875 218
51 3300005335 Ga0070666_10115059 Ga0070666_101150593 219
52 3300005338 Ga0068868_100018848 Ga0068868_1000188482 219
53 3300005367 Ga0070667_100278178 Ga0070667_1002781781 219
54 3300005539 Ga0068853_100005984 Ga0068853_1000059842 219
55 3300005539 Ga0068853_100195489 Ga0068853_1001954892 219
56 3300005548 Ga0070665_100033531 Ga0070665_1000335313 219
57 3300005563 Ga0068855_100007881 Ga0068855_10000788112 219
58 3300005577 Ga0068857_100089574 Ga0068857_1000895742 219
59 3300005614 Ga0068856_100281003 Ga0068856_1002810032 219
60 3300005841 Ga0068863_100301890 Ga0068863_1003018902 219
61 3300005841 Ga0068863_100379266 Ga0068863_1003792662 219
62 3300006358 Ga0068871_100534157 Ga0068871_1005341571 219
63 3300009553 Ga0105249_10086584 Ga0105249_100865842 219
64 3300010375 Ga0105239_10019647 Ga0105239_100196473 219
65 3300013308 Ga0157375_10225306 Ga0157375_102253063 219
66 3300025914 Ga0207671_10047263 Ga0207671_100472633 219
67 3300025949 Ga0207667_10003604 Ga0207667_100036047 219
68 3300025960 Ga0207651_10078209 Ga0207651_100782092 219
69 3300025961 Ga0207712_10127602 Ga0207712_101276022 219
70 3300026041 Ga0207639_10000158 Ga0207639_1000015818 219
71 3300026067 Ga0207678_10286989 Ga0207678_102869892 219
72 3300026088 Ga0207641_10007613 Ga0207641_100076133 219
73 3300028379 Ga0268266_10090792 Ga0268266_100907922 219
74 3300049573 Ga0501037_0051682 Ga0501037_0051682_2036_2752 219
75 3300049590 Ga0501074_0130703 Ga0501074_0130703_1019_1735 219
76 3300049742 Ga0501080_0081487 Ga0501080_0081487_255_971 219
77 3300049822 Ga0501035_0104116 Ga0501035_0104116_841_1557 219
78 3300049823 Ga0501044_0053233 Ga0501044_0053233_2769_3485 219
79 3300005563 Ga0068855_100229921 Ga0068855_1002299212 220
80 3300006881 Ga0068865_100301093 Ga0068865_1003010932 220
81 3300010375 Ga0105239_10117267 Ga0105239_101172673 220
82 3300025938 Ga0207704_10052210 Ga0207704_100522103 220
83 3300025981 Ga0207640_10099550 Ga0207640_100995503 220
84 3300026095 Ga0207676_10293877 Ga0207676_102938772 220
85 3300035398 Ga0316574_0008856 Ga0316574_0008856_2115_2855 220
86 3300048928 Ga0496125_0372995 Ga0496125_0372995_26_745 220
87 3300048920 Ga0496117_0036893 Ga0496117_0036893_1469_2185 221
88 3300048921 Ga0496118_0000520 Ga0496118_0000520_21832_22548 221
89 3300055283 Ga0500661_012541 Ga0500661_012541_529_1449 222
90 3300003794 Ga0055531_10000612 Ga0055531_1000061227 223
91 3300037312 Ga0395899_0003079 Ga0395899_0003079_8062_8790 223
92 3300037418 Ga0395900_0149640 Ga0395900_0149640_135_863 223
93 3300037471 Ga0395905_0116877 Ga0395905_0116877_1467_2195 223
94 3300038443 Ga0395901_0012708 Ga0395901_0012708_6687_7415 223
95 3300006163 Ga0070715_10246192 Ga0070715_102461921 224
96 3300006852 Ga0075433_10734731 Ga0075433_107347311 224
97 3300025915 Ga0207693_10224222 Ga0207693_102242222 224
98 3300031727 Ga0316576_10450687 Ga0316576_104506871 224
99 3300032002 Ga0307416_100791153 Ga0307416_1007911531 224
100 3300037471 Ga0395905_0000148 Ga0395905_0000148_13435_14160 224
101 3300037471 Ga0395905_0003187 Ga0395905_0003187_3867_4592 224
102 3300048927 Ga0496124_0183348 Ga0496124_0183348_532_1263 224
103 3300050511 nmdc:mga08y16_6614_c1 nmdc:mga08y16_6614_c1_1490_2245 224
104 3300005459 Ga0068867_100000005 Ga0068867_10000000592 225
105 3300006880 Ga0075429_100003851 Ga0075429_1000038512 225
106 3300009148 Ga0105243_10000515 Ga0105243_1000051524 225
107 3300014745 Ga0157377_10000022 Ga0157377_1000002282 225
108 3300025935 Ga0207709_10000522 Ga0207709_1000052216 225
109 3300026089 Ga0207648_10000032 Ga0207648_1000003252 225
110 3300026142 Ga0207698_10005832 Ga0207698_100058325 225
111 3300031730 Ga0307516_10195284 Ga0307516_101952841 225
112 3300032002 Ga0307416_100230428 Ga0307416_1002304282 225
113 3300037471 Ga0395905_0019557 Ga0395905_0019557_3466_4194 225
114 3300037471 Ga0395905_0162368 Ga0395905_0162368_141_866 225
115 3300041997 Ga0439431_0005725 Ga0439431_0005725_987_1724 225
116 3300042007 Ga0439449_0031483 Ga0439449_0031483_316_1041 225
117 3300042134 Ga0450898_013674 Ga0450898_013674_86_823 225
118 3300044656 Ga0466969_0006079 Ga0466969_0006079_5376_6101 225
119 3300044656 Ga0466969_0073994 Ga0466969_0073994_242_967 225
120 3300044683 Ga0466965_0040577 Ga0466965_0040577_1469_2194 225
121 3300044684 Ga0466966_0003229 Ga0466966_0003229_2328_3053 225
122 3300044693 Ga0466961_0023517 Ga0466961_0023517_2434_3159 225
123 3300044693 Ga0466961_0054954 Ga0466961_0054954_639_1364 225
124 3300044706 Ga0466964_0006188 Ga0466964_0006188_1453_2178 225
125 3300044719 Ga0466971_0020521 Ga0466971_0020521_1152_1877 225
126 3300044765 Ga0466970_0008282 Ga0466970_0008282_1902_2627 225
127 3300044842 Ga0466957_0009701 Ga0466957_0009701_767_1492 225
128 3300045049 Ga0466959_0003173 Ga0466959_0003173_991_1716 225
129 3300045049 Ga0466959_0268752 Ga0466959_0268752_417_1142 225
130 3300049759 Ga0501262_012938 Ga0501262_012938_265_990 225
131 3300049762 Ga0501265_000359 Ga0501265_000359_332_1057 225
132 3300050508 nmdc:mga09592_44330_c1 nmdc:mga09592_44330_c1_1064_1789 225
133 3300050509 nmdc:mga0qj67_301007_c1 nmdc:mga0qj67_301007_c1_538_1263 225
134 3300061719 Ga0466962_0088000 Ga0466962_0088000_593_1318 225
135 3300005577 Ga0068857_100247155 Ga0068857_1002471552 226
136 3300006177 Ga0075362_10003415 Ga0075362_100034152 226
137 3300009147 Ga0114129_10297841 Ga0114129_102978411 226
138 3300014969 Ga0157376_10233591 Ga0157376_102335912 226
139 3300015683 Ga0183362_10001 Ga0183362_100011328 226
140 3300026116 Ga0207674_10320474 Ga0207674_103204742 226
141 3300031616 Ga0307508_10088971 Ga0307508_100889714 226
142 3300037418 Ga0395900_0013211 Ga0395900_0013211_7529_8245 226
143 3300041411 Ga0439466_0001803 Ga0439466_0001803_4225_4950 226
144 3300041413 Ga0439465_0003008 Ga0439465_0003008_4294_5019 226
145 3300041999 Ga0439433_0000991 Ga0439433_0000991_756_1481 226
146 3300042006 Ga0439432_002602 Ga0439432_002602_5262_5987 226
147 3300042007 Ga0439449_0002379 Ga0439449_0002379_1149_1874 226
148 3300042010 Ga0439452_000611 Ga0439452_000611_7164_7889 226
149 3300042876 Ga0451577_0262733 Ga0451577_0262733_278_958 226
150 3300048924 Ga0496121_0005276 Ga0496121_0005276_233_958 226
151 3300048926 Ga0496123_0001158 Ga0496123_0001158_30303_31028 226
152 3300050489 nmdc:mga03683_29407_c1 nmdc:mga03683_29407_c1_883_1608 226
153 3300005353 Ga0070669_100255320 Ga0070669_1002553202 227
154 3300006195 Ga0075366_10141351 Ga0075366_101413512 227
155 3300006844 Ga0075428_100081287 Ga0075428_1000812873 227
156 3300006847 Ga0075431_100091572 Ga0075431_1000915722 227
157 3300006880 Ga0075429_100024307 Ga0075429_1000243075 227
158 3300009147 Ga0114129_10014471 Ga0114129_1001447114 227
159 3300009148 Ga0105243_10161481 Ga0105243_101614812 227
160 3300025923 Ga0207681_10204214 Ga0207681_102042142 227
161 3300041463 Ga0451804_0366282 Ga0451804_0366282_161_889 227
162 3300044712 Ga0453684_0311720 Ga0453684_0311720_200_928 227
163 3300050493 nmdc:mga0k408_113841_c1 nmdc:mga0k408_113841_c1_415_1140 227
164 3300050507 nmdc:mga05p37_67216_c1 nmdc:mga05p37_67216_c1_2413_3135 227
165 3300050510 nmdc:mga06r32_35879_c1 nmdc:mga06r32_35879_c1_378_1100 227
166 3300003784 Ga0055534_1000506 Ga0055534_100050610 228
167 3300006195 Ga0075366_10034277 Ga0075366_100342772 228
168 3300025284 Ga0209130_1002188 Ga0209130_10021883 228
169 3300025291 Ga0209675_1022498 Ga0209675_10224982 228
170 3300025303 Ga0209051_1003300 Ga0209051_10033006 228
171 3300027907 Ga0207428_10487575 Ga0207428_104875751 228
172 3300032004 Ga0307414_10873422 Ga0307414_108734221 228
173 3300037471 Ga0395905_0317449 Ga0395905_0317449_370_1089 228
174 3300046542 Ga0495597_0000063 Ga0495597_0000063_16886_17611 228
175 3300046794 Ga0495589_0002663 Ga0495589_0002663_5370_6095 228
176 3300050493 nmdc:mga0k408_47482_c1 nmdc:mga0k408_47482_c1_977_1699 228
177 3300006195 Ga0075366_10002649 Ga0075366_100026499 229
178 3300026121 Ga0207683_10346703 Ga0207683_103467032 229
179 3300044656 Ga0466969_0139314 Ga0466969_0139314_341_1063 229
180 3300044683 Ga0466965_0001429 Ga0466965_0001429_6512_7234 229
181 3300044684 Ga0466966_0010728 Ga0466966_0010728_4283_5005 229
182 3300044693 Ga0466961_0039938 Ga0466961_0039938_335_1057 229
183 3300044706 Ga0466964_0008063 Ga0466964_0008063_2976_3698 229
184 3300044719 Ga0466971_0016848 Ga0466971_0016848_571_1293 229
185 3300044842 Ga0466957_0030253 Ga0466957_0030253_638_1360 229
186 3300045049 Ga0466959_0010587 Ga0466959_0010587_5365_6087 229
187 3300045836 Ga0466958_0056227 Ga0466958_0056227_1493_2215 229
188 3300046615 Ga0495656_0001008 Ga0495656_0001008_3120_3845 229
189 3300061719 Ga0466962_0002298 Ga0466962_0002298_7037_7759 229
190 3300003761 Ga0055535_1000330 Ga0055535_100033046 230
191 3300003762 Ga0055542_1000039 Ga0055542_100003982 230
192 3300005335 Ga0070666_10065827 Ga0070666_100658272 230
193 3300005344 Ga0070661_100039421 Ga0070661_1000394214 230
194 3300005354 Ga0070675_100527759 Ga0070675_1005277591 230
195 3300005456 Ga0070678_100298762 Ga0070678_1002987621 230
196 3300005457 Ga0070662_100019041 Ga0070662_1000190415 230
197 3300005578 Ga0068854_100101566 Ga0068854_1001015662 230
198 3300005616 Ga0068852_100053344 Ga0068852_1000533443 230
199 3300005834 Ga0068851_10003542 Ga0068851_100035423 230
200 3300006353 Ga0075370_10038798 Ga0075370_100387982 230
201 3300009551 Ga0105238_10246774 Ga0105238_102467742 230
202 3300009551 Ga0105238_10542154 Ga0105238_105421542 230
203 3300013306 Ga0163162_10331903 Ga0163162_103319032 230
204 3300013307 Ga0157372_10370304 Ga0157372_103703042 230
205 3300014497 Ga0182008_10005557 Ga0182008_100055574 230
206 3300014969 Ga0157376_10096398 Ga0157376_100963982 230
207 3300015262 Ga0182007_10000472 Ga0182007_1000047223 230
208 3300015262 Ga0182007_10000653 Ga0182007_100006537 230
209 3300025228 Ga0209672_100647 Ga0209672_10064718 230
210 3300025229 Ga0209147_101771 Ga0209147_1017712 230
211 3300025242 Ga0209258_100099 Ga0209258_100099131 230
212 3300025254 Ga0209148_1000103 Ga0209148_1000103131 230
213 3300025298 Ga0209050_1001620 Ga0209050_100162013 230
214 3300025303 Ga0209051_1001020 Ga0209051_100102020 230
215 3300025304 Ga0209257_1001138 Ga0209257_100113814 230
216 3300025321 Ga0207656_10003873 Ga0207656_100038735 230
217 3300025728 Ga0207655_1001248 Ga0207655_100124820 230
218 3300025903 Ga0207680_10115092 Ga0207680_101150922 230
219 3300025921 Ga0207652_10057317 Ga0207652_100573172 230
220 3300025924 Ga0207694_10063519 Ga0207694_100635192 230
221 3300025926 Ga0207659_10769089 Ga0207659_107690891 230
222 3300025933 Ga0207706_10023813 Ga0207706_100238134 230
223 3300025940 Ga0207691_10232108 Ga0207691_102321082 230
224 3300025940 Ga0207691_10392418 Ga0207691_103924182 230
225 3300025960 Ga0207651_10058883 Ga0207651_100588832 230
226 3300025972 Ga0207668_10501902 Ga0207668_105019021 230
227 3300026116 Ga0207674_10028246 Ga0207674_100282464 230
228 3300026121 Ga0207683_10025950 Ga0207683_100259504 230
229 3300028794 Ga0307515_10001088 Ga0307515_1000108833 230
230 3300031251 Ga0265327_10006291 Ga0265327_100062912 230
231 3300031548 Ga0307408_100087592 Ga0307408_1000875923 230
232 3300046475 Ga0495639_0022639 Ga0495639_0022639_1550_2275 230
233 3300046477 Ga0495664_0280545 Ga0495664_0280545_117_842 230
234 3300046615 Ga0495656_0125340 Ga0495656_0125340_470_1195 230
235 3300046675 Ga0495657_0200118 Ga0495657_0200118_210_935 230
236 3300047321 Ga0495676_0290931 Ga0495676_0290931_70_795 230
237 3300048903 Ga0496100_0002149 Ga0496100_0002149_8674_9399 230
238 3300048906 Ga0496103_0020828 Ga0496103_0020828_468_1193 230
239 3300048908 Ga0496105_0012226 Ga0496105_0012226_416_1141 230
240 3300048912 Ga0496109_0512657 Ga0496109_0512657_26_751 230
241 3300048916 Ga0496113_0213444 Ga0496113_0213444_519_1244 230
242 3300048919 Ga0496116_0016280 Ga0496116_0016280_1507_2232 230
243 3300048920 Ga0496117_0016264 Ga0496117_0016264_839_1564 230
244 3300048921 Ga0496118_0009301 Ga0496118_0009301_7464_8189 230
245 3300050496 nmdc:mga07m45_2487_c1 nmdc:mga07m45_2487_c1_4760_5485 230
246 3300005536 Ga0070697_100055465 Ga0070697_1000554655 231
247 3300006173 Ga0070716_100202949 Ga0070716_1002029492 231
248 3300025910 Ga0207684_10341424 Ga0207684_103414242 231
249 3300025939 Ga0207665_10151578 Ga0207665_101515783 231
250 3300031731 Ga0307405_10049105 Ga0307405_100491052 231
251 3300005364 Ga0070673_100095868 Ga0070673_1000958682 232
252 3300031852 Ga0307410_10266690 Ga0307410_102666902 232
253 3300031911 Ga0307412_10459704 Ga0307412_104597042 232
254 3300032005 Ga0307411_10401201 Ga0307411_104012012 232
255 3300037471 Ga0395905_0018699 Ga0395905_0018699_3006_3977 232
256 3300053154 Ga0500619_000059 Ga0500619_000059_32660_33385 232
257 3300005331 Ga0070670_100864257 Ga0070670_1008642571 233
258 3300005336 Ga0070680_100366898 Ga0070680_1003668981 233
259 3300005337 Ga0070682_100392009 Ga0070682_1003920091 233
260 3300005354 Ga0070675_100231758 Ga0070675_1002317582 233
261 3300005356 Ga0070674_100417774 Ga0070674_1004177742 233
262 3300005456 Ga0070678_100005274 Ga0070678_1000052744 233
263 3300005530 Ga0070679_100263171 Ga0070679_1002631711 233
264 3300005539 Ga0068853_100065796 Ga0068853_1000657963 233
265 3300005547 Ga0070693_100106067 Ga0070693_1001060672 233
266 3300005614 Ga0068856_100059619 Ga0068856_1000596193 233
267 3300005615 Ga0070702_100419691 Ga0070702_1004196911 233
268 3300005616 Ga0068852_100646508 Ga0068852_1006465081 233
269 3300005841 Ga0068863_100112251 Ga0068863_1001122512 233
270 3300006237 Ga0097621_100025265 Ga0097621_1000252655 233
271 3300006358 Ga0068871_100012912 Ga0068871_1000129124 233
272 3300006871 Ga0075434_100154648 Ga0075434_1001546483 233
273 3300009174 Ga0105241_10095833 Ga0105241_100958332 233
274 3300009551 Ga0105238_10230868 Ga0105238_102308683 233
275 3300009553 Ga0105249_10045561 Ga0105249_100455614 233
276 3300013105 Ga0157369_10358386 Ga0157369_103583861 233
277 3300013306 Ga0163162_10081316 Ga0163162_100813164 233
278 3300013306 Ga0163162_10156745 Ga0163162_101567452 233
279 3300013306 Ga0163162_10189925 Ga0163162_101899251 233
280 3300013307 Ga0157372_10575252 Ga0157372_105752522 233
281 3300013308 Ga0157375_10119885 Ga0157375_101198851 233
282 3300014968 Ga0157379_10267566 Ga0157379_102675662 233
283 3300014969 Ga0157376_10001097 Ga0157376_100010973 233
284 3300017792 Ga0163161_10064992 Ga0163161_100649923 233
285 3300025907 Ga0207645_10523130 Ga0207645_105231301 233
286 3300025911 Ga0207654_10233033 Ga0207654_102330331 233
287 3300025926 Ga0207659_10177094 Ga0207659_101770942 233
288 3300025931 Ga0207644_10178257 Ga0207644_101782572 233
289 3300025939 Ga0207665_10108110 Ga0207665_101081103 233
290 3300026088 Ga0207641_10212881 Ga0207641_102128812 233
291 3300026121 Ga0207683_10008536 Ga0207683_100085364 233
292 3300026121 Ga0207683_10257335 Ga0207683_102573351 233
293 3300031911 Ga0307412_10224187 Ga0307412_102241871 233
294 3300005539 Ga0068853_100009827 Ga0068853_1000098276 234
295 3300005983 Ga0081540_1010828 Ga0081540_10108285 234
296 3300006195 Ga0075366_10001513 Ga0075366_100015136 234
297 3300046517 Ga0495630_0656223 Ga0495630_0656223_35_748 234
298 3300048920 Ga0496117_0063606 Ga0496117_0063606_996_1709 234
299 3300048921 Ga0496118_0006635 Ga0496118_0006635_2569_3282 234
300 3300050493 nmdc:mga0k408_320005_c1 nmdc:mga0k408_320005_c1_51_776 234
301 3300005328 Ga0070676_10154024 Ga0070676_101540242 235
302 3300005334 Ga0068869_100232058 Ga0068869_1002320582 235
303 3300005334 Ga0068869_100635596 Ga0068869_1006355961 235
304 3300005340 Ga0070689_100040247 Ga0070689_1000402472 235
305 3300005356 Ga0070674_100616422 Ga0070674_1006164221 235
306 3300005364 Ga0070673_100107455 Ga0070673_1001074552 235
307 3300005365 Ga0070688_100119012 Ga0070688_1001190122 235
308 3300005455 Ga0070663_100016702 Ga0070663_1000167024 235
309 3300005459 Ga0068867_100058410 Ga0068867_1000584101 235
310 3300005543 Ga0070672_100341106 Ga0070672_1003411062 235
311 3300005548 Ga0070665_100146971 Ga0070665_1001469712 235
312 3300005843 Ga0068860_100570768 Ga0068860_1005707682 235
313 3300005844 Ga0068862_100046445 Ga0068862_1000464453 235
314 3300006237 Ga0097621_100250124 Ga0097621_1002501242 235
315 3300006358 Ga0068871_100033647 Ga0068871_1000336473 235
316 3300009174 Ga0105241_10009853 Ga0105241_100098534 235
317 3300009176 Ga0105242_10000382 Ga0105242_1000038211 235
318 3300009176 Ga0105242_10246119 Ga0105242_102461191 235
319 3300010375 Ga0105239_10016362 Ga0105239_100163622 235
320 3300013105 Ga0157369_10000172 Ga0157369_1000017244 235
321 3300013105 Ga0157369_10728207 Ga0157369_107282072 235
322 3300013306 Ga0163162_10005037 Ga0163162_1000503714 235
323 3300013307 Ga0157372_10077581 Ga0157372_100775814 235
324 3300013308 Ga0157375_10003836 Ga0157375_1000383614 235
325 3300014969 Ga0157376_10077529 Ga0157376_100775292 235
326 3300014969 Ga0157376_10131874 Ga0157376_101318742 235
327 3300025907 Ga0207645_10019484 Ga0207645_100194843 235
328 3300025911 Ga0207654_10048107 Ga0207654_100481071 235
329 3300025913 Ga0207695_10014882 Ga0207695_100148829 235
330 3300025914 Ga0207671_10000614 Ga0207671_1000061444 235
331 3300025916 Ga0207663_10105378 Ga0207663_101053783 235
332 3300025924 Ga0207694_10006267 Ga0207694_100062677 235
333 3300025934 Ga0207686_10003079 Ga0207686_1000307910 235
334 3300025934 Ga0207686_10213733 Ga0207686_102137331 235
335 3300025937 Ga0207669_10063670 Ga0207669_100636703 235
336 3300025938 Ga0207704_10005184 Ga0207704_100051843 235
337 3300025940 Ga0207691_10027731 Ga0207691_100277314 235
338 3300025942 Ga0207689_10031723 Ga0207689_100317237 235
339 3300025961 Ga0207712_10201585 Ga0207712_102015852 235
340 3300025986 Ga0207658_10765596 Ga0207658_107655961 235
341 3300026041 Ga0207639_10565443 Ga0207639_105654431 235
342 3300026067 Ga0207678_10034941 Ga0207678_100349412 235
343 3300026121 Ga0207683_10459027 Ga0207683_104590271 235
344 3300028379 Ga0268266_10152949 Ga0268266_101529491 235
345 3300028380 Ga0268265_10022791 Ga0268265_100227912 235
346 3300035171 Ga0373946_0142311 Ga0373946_0142311_11_733 235
347 3300036401 Ga0373937_0280495 Ga0373937_0280495_542_1264 235
348 3300041451 Ga0451791_0611886 Ga0451791_0611886_428_1144 235
349 3300041453 Ga0451797_0922191 Ga0451797_0922191_1658_2374 235
350 3300041486 Ga0451807_0264544 Ga0451807_0264544_2525_3241 235
351 3300046473 Ga0495582_0079149 Ga0495582_0079149_625_1347 235
352 3300046531 Ga0495665_0176435 Ga0495665_0176435_337_1059 235
353 3300046559 Ga0495667_0311499 Ga0495667_0311499_49_771 235
354 3300047317 Ga0495604_0142817 Ga0495604_0142817_331_1053 235
355 3300047471 Ga0495684_0387765 Ga0495684_0387765_206_928 235
356 3300048907 Ga0496104_0000038 Ga0496104_0000038_97872_98594 235
357 3300048907 Ga0496104_0067278 Ga0496104_0067278_612_1337 235
358 3300048908 Ga0496105_0000038 Ga0496105_0000038_79517_80239 235
359 3300048918 Ga0496115_0442919 Ga0496115_0442919_313_1032 235
360 3300049571 Ga0501034_0063996 Ga0501034_0063996_2857_3573 235
361 3300049573 Ga0501037_0103840 Ga0501037_0103840_427_1143 235
362 3300049574 Ga0501038_0062118 Ga0501038_0062118_2273_2989 235
363 3300049574 Ga0501038_0428594 Ga0501038_0428594_153_869 235
364 3300049579 Ga0501043_0061653 Ga0501043_0061653_36_752 235
365 3300049580 Ga0501046_0013611 Ga0501046_0013611_85_801 235
366 3300049582 Ga0501048_0191161 Ga0501048_0191161_441_1157 235
367 3300049583 Ga0501067_0125501 Ga0501067_0125501_560_1276 235
368 3300049587 Ga0501071_0046458 Ga0501071_0046458_304_1020 235
369 3300049589 Ga0501073_0225466 Ga0501073_0225466_287_1006 235
370 3300049741 Ga0501079_0635280 Ga0501079_0635280_70_786 235
371 3300049742 Ga0501080_0123913 Ga0501080_0123913_881_1597 235
372 3300049742 Ga0501080_0191599 Ga0501080_0191599_1039_1758 235
373 3300049743 Ga0501081_0150755 Ga0501081_0150755_918_1634 235
374 3300049822 Ga0501035_0021681 Ga0501035_0021681_1017_1733 235
375 3300049822 Ga0501035_0071298 Ga0501035_0071298_642_1358 235
376 3300049823 Ga0501044_0428964 Ga0501044_0428964_466_1185 235
377 3300049823 Ga0501044_0569944 Ga0501044_0569944_13_729 235
378 3300049824 Ga0501045_0208014 Ga0501045_0208014_349_1065 235
379 3300053093 Ga0500651_0002343 Ga0500651_0002343_172_888 235
380 3300060353 Ga0501082_0687342 Ga0501082_0687342_125_841 235
381 iso_pu_bacteria 2547132374 2548497411 235
382 iso_pu_bacteria 2643221570 2643866555 235
383 iso_pu_bacteria 2643221596 2643993307 235
384 iso_pu_bacteria 2643221609 2644060672 235
385 iso_pu_bacteria 2643221611 2644073993 235
386 iso_pu_bacteria 2643221652 2644294088 235
387 iso_pu_bacteria 2643221717 2644646091 235
388 iso_pu_bacteria 2738543012 2739242697 235
389 iso_pu_bacteria 2816332133 2816472986 235
390 iso_pu_bacteria 2842718218 2842719557 235
391 iso_pu_bacteria 2894023352 2894025498 235
392 iso_pu_bacteria 2919704043 2919704595 235
393 iso_pu_bacteria 2974320154 2974323383 235
394 iso_pu_bacteria 2990710928 2990712259 235
395 iso_pu_bacteria 2588253510 2588293860 236
396 3300025920 Ga0207649_10110051 Ga0207649_101100512 237
397 3300050512 nmdc:mga0n895_282394_c1 nmdc:mga0n895_282394_c1_149_871 237
398 iso_pu_bacteria 2513020051 2513227112 237
399 iso_pu_bacteria 2521172590 2521559459 237
400 iso_pu_bacteria 2585428057 2587726262 237
401 iso_pu_bacteria 2585428058 2587734433 237
402 iso_pu_bacteria 2585428062 2587756321 237
403 iso_pu_bacteria 2599185214 2599623669 237
404 iso_pu_bacteria 2599185226 2599671712 237
405 iso_pu_bacteria 2599185227 2599681275 237
406 iso_pu_bacteria 2599185229 2599693322 237
407 iso_pu_bacteria 2643221592 2643970947 237
408 iso_pu_bacteria 2643221625 2644138798 237
409 iso_pu_bacteria 2643221628 2644159603 237
410 iso_pu_bacteria 2643221648 2644273966 237
411 iso_pu_bacteria 2643221654 2644302385 237
412 iso_pu_bacteria 2643221658 2644327626 237
413 iso_pu_bacteria 2643221660 2644340208 237
414 iso_pu_bacteria 2643221672 2644401470 237
415 iso_pu_bacteria 2643221683 2644468171 237
416 iso_pu_bacteria 2738541277 2738717738 237
417 iso_pu_bacteria 2738541307 2738879349 237
418 iso_pu_bacteria 2738543013 2739250715 237
419 iso_pu_bacteria 2738543019 2739278424 237
420 iso_pu_bacteria 2818991446 2819597222 237
421 iso_pu_bacteria 2831265667 2831266347 237
422 iso_pu_bacteria 2831864461 2831865697 237
423 iso_pu_bacteria 2838054893 2838057541 237
424 iso_pu_bacteria 2842677519 2842679860 237
425 iso_pu_bacteria 2881101125 2881101839 237
426 iso_pu_bacteria 2885192300 2885192692 237
427 iso_pu_bacteria 2885198086 2885204471 237
428 iso_pu_bacteria 2885211737 2885218124 237
429 iso_pu_bacteria 2886848708 2886853673 237
430 iso_pu_bacteria 2899924645 2899924726 237
431 iso_pu_bacteria 2904434214 2904435676 237
432 iso_pu_bacteria 2904449895 2904454425 237
433 iso_pu_bacteria 2904456579 2904461132 237
434 iso_pu_bacteria 2919046199 2919047891 237
435 iso_pu_bacteria 2919462493 2919466009 237
436 iso_pu_bacteria 2923510766 2923513200 237
437 iso_pu_bacteria 2928037797 2928039147 237
438 iso_pu_bacteria 2928044640 2928045248 237
439 iso_pu_bacteria 2928051484 2928053053 237
440 iso_pu_bacteria 2928064002 2928064275 237
441 iso_pu_bacteria 2928070936 2928071712 237
442 iso_pu_bacteria 2928084124 2928084343 237
443 iso_pu_bacteria 2928115317 2928118549 237
444 iso_pu_bacteria 2928130867 2928134948 237
445 iso_pu_bacteria 2929520902 2929527014 237
446 iso_pu_bacteria 2939631187 2939632057 237
447 iso_pu_bacteria 2945909444 2945911610 237
448 iso_pu_bacteria 2945945610 2945948182 237
449 iso_pu_bacteria 2945972063 2945977173 237
450 iso_pu_bacteria 2945984333 2945986048 237
451 iso_pu_bacteria 2954767861 2954772300 237
452 iso_pu_bacteria 639633007 639785686 237
453 3300026089 Ga0207648_10307960 Ga0207648_103079603 238
454 3300049569 Ga0501032_0005261 Ga0501032_0005261_6721_7542 238
455 3300049570 Ga0501033_0000720 Ga0501033_0000720_5116_5937 238
456 3300049571 Ga0501034_0004188 Ga0501034_0004188_5244_6065 238
457 3300049572 Ga0501036_0007930 Ga0501036_0007930_2623_3444 238
458 3300049573 Ga0501037_0033753 Ga0501037_0033753_1176_1997 238
459 3300049574 Ga0501038_0004437 Ga0501038_0004437_2992_3813 238
460 3300049575 Ga0501039_0002430 Ga0501039_0002430_7359_8180 238
461 3300049579 Ga0501043_0085234 Ga0501043_0085234_1407_2228 238
462 3300049580 Ga0501046_0002962 Ga0501046_0002962_9800_10621 238
463 3300049584 Ga0501068_0064836 Ga0501068_0064836_370_1191 238
464 3300049589 Ga0501073_0003125 Ga0501073_0003125_10374_11195 238
465 3300049741 Ga0501079_0102597 Ga0501079_0102597_721_1542 238
466 3300049742 Ga0501080_0002682 Ga0501080_0002682_12575_13396 238
467 3300049744 Ga0501083_0023802 Ga0501083_0023802_1167_1988 238
468 3300049823 Ga0501044_0004235 Ga0501044_0004235_15202_16032 238
469 3300049823 Ga0501044_0016545 Ga0501044_0016545_5244_6065 238
470 3300054114 Ga0501084_0279667 Ga0501084_0279667_204_1025 238
471 3300060353 Ga0501082_0068584 Ga0501082_0068584_14_835 238
472 3300005353 Ga0070669_100027387 Ga0070669_1000273873 239
473 3300005354 Ga0070675_100076526 Ga0070675_1000765263 239
474 3300005364 Ga0070673_100127618 Ga0070673_1001276183 239
475 3300006051 Ga0075364_10057248 Ga0075364_100572483 239
476 3300009094 Ga0111539_10503376 Ga0111539_105033763 239
477 3300009176 Ga0105242_10004129 Ga0105242_100041297 239
478 3300021361 Ga0213872_10009068 Ga0213872_100090683 239
479 3300025893 Ga0207682_10189216 Ga0207682_101892161 239
480 3300025923 Ga0207681_10091583 Ga0207681_100915833 239
481 3300025926 Ga0207659_10051134 Ga0207659_100511343 239
482 3300025934 Ga0207686_10007355 Ga0207686_100073557 239
483 3300025961 Ga0207712_10142490 Ga0207712_101424902 239
484 3300026121 Ga0207683_10334022 Ga0207683_103340222 239
485 3300027252 Ga0209973_1000882 Ga0209973_10008822 239
486 3300027665 Ga0209983_1006568 Ga0209983_10065682 239
487 3300027876 Ga0209974_10016800 Ga0209974_100168002 239
488 3300028379 Ga0268266_10259614 Ga0268266_102596142 239
489 3300028381 Ga0268264_10902713 Ga0268264_109027131 239
490 3300028794 Ga0307515_10000267 Ga0307515_1000026734 239
491 3300028794 Ga0307515_10111538 Ga0307515_101115382 239
492 3300031238 Ga0265332_10000002 Ga0265332_10000002583 239
493 3300031238 Ga0265332_10000525 Ga0265332_1000052524 239
494 3300031247 Ga0265340_10006590 Ga0265340_100065905 239
495 3300031456 Ga0307513_10026272 Ga0307513_100262723 239
496 3300031548 Ga0307408_100000193 Ga0307408_10000019343 239
497 3300031649 Ga0307514_10000806 Ga0307514_1000080616 239
498 3300031711 Ga0265314_10000089 Ga0265314_1000008975 239
499 3300032004 Ga0307414_10385744 Ga0307414_103857441 239
500 3300037471 Ga0395905_0233286 Ga0395905_0233286_642_1361 239
501 3300039447 Ga0436361_0704832 Ga0436361_0704832_9603_10322 239
502 3300046528 Ga0495642_0128971 Ga0495642_0128971_24_743 239
503 3300046537 Ga0495598_0009545 Ga0495598_0009545_1211_1930 239
504 3300046539 Ga0495621_0005434 Ga0495621_0005434_680_1399 239
505 3300046615 Ga0495656_0053670 Ga0495656_0053670_461_1180 239
506 3300050491 nmdc:mga00v17_113669_c1 nmdc:mga00v17_113669_c1_621_1340 239
507 3300053153 Ga0500616_0097632 Ga0500616_0097632_458_1177 239
508 3300059421 Ga0590071_001283 Ga0590071_001283_1011_1730 239
509 3300003215 JGI25153J46596_10005637 JGI25153J46596_100056375 240
510 3300003771 Ga0055526_1005340 Ga0055526_10053409 240
511 3300005295 Ga0065707_10084409 Ga0065707_100844092 240
512 3300005330 Ga0070690_100017501 Ga0070690_1000175013 240
513 3300005334 Ga0068869_100049701 Ga0068869_1000497014 240
514 3300005334 Ga0068869_100133890 Ga0068869_1001338902 240
515 3300005343 Ga0070687_100004765 Ga0070687_1000047652 240
516 3300005347 Ga0070668_100366599 Ga0070668_1003665992 240
517 3300005353 Ga0070669_100033268 Ga0070669_1000332684 240
518 3300005355 Ga0070671_100216489 Ga0070671_1002164892 240
519 3300005356 Ga0070674_100164780 Ga0070674_1001647802 240
520 3300005456 Ga0070678_100156597 Ga0070678_1001565973 240
521 3300005459 Ga0068867_100000501 Ga0068867_10000050111 240
522 3300005459 Ga0068867_100028338 Ga0068867_1000283382 240
523 3300005518 Ga0070699_100089836 Ga0070699_1000898363 240
524 3300005535 Ga0070684_100015427 Ga0070684_1000154276 240
525 3300005536 Ga0070697_100301525 Ga0070697_1003015252 240
526 3300005539 Ga0068853_100389654 Ga0068853_1003896542 240
527 3300005543 Ga0070672_100004378 Ga0070672_1000043788 240
528 3300005544 Ga0070686_100044033 Ga0070686_1000440334 240
529 3300005545 Ga0070695_100125133 Ga0070695_1001251332 240
530 3300005546 Ga0070696_100008093 Ga0070696_1000080934 240
531 3300005616 Ga0068852_100522354 Ga0068852_1005223541 240
532 3300005617 Ga0068859_100089172 Ga0068859_1000891723 240
533 3300005617 Ga0068859_100667959 Ga0068859_1006679591 240
534 3300005718 Ga0068866_10021140 Ga0068866_100211404 240
535 3300005718 Ga0068866_10350627 Ga0068866_103506271 240
536 3300005719 Ga0068861_100021631 Ga0068861_1000216316 240
537 3300005842 Ga0068858_100252078 Ga0068858_1002520782 240
538 3300005843 Ga0068860_100017155 Ga0068860_1000171552 240
539 3300005844 Ga0068862_100002767 Ga0068862_10000276713 240
540 3300005844 Ga0068862_100017960 Ga0068862_1000179605 240
541 3300006237 Ga0097621_100245097 Ga0097621_1002450973 240
542 3300006358 Ga0068871_100012114 Ga0068871_1000121144 240
543 3300006881 Ga0068865_100012581 Ga0068865_1000125816 240
544 3300006914 Ga0075436_100027180 Ga0075436_1000271802 240
545 3300006914 Ga0075436_100028281 Ga0075436_1000282813 240
546 3300006914 Ga0075436_100035766 Ga0075436_1000357667 240
547 3300006931 Ga0097620_100089166 Ga0097620_1000891663 240
548 3300006931 Ga0097620_100667929 Ga0097620_1006679291 240
549 3300007076 Ga0075435_100008513 Ga0075435_1000085132 240
550 3300007076 Ga0075435_100248659 Ga0075435_1002486592 240
551 3300009098 Ga0105245_10087430 Ga0105245_100874302 240
552 3300009148 Ga0105243_10011438 Ga0105243_100114382 240
553 3300009148 Ga0105243_10269901 Ga0105243_102699013 240
554 3300009553 Ga0105249_10040918 Ga0105249_100409183 240
555 3300009553 Ga0105249_10367690 Ga0105249_103676901 240
556 3300013297 Ga0157378_10005086 Ga0157378_100050868 240
557 3300013306 Ga0163162_10003443 Ga0163162_100034437 240
558 3300013308 Ga0157375_10073195 Ga0157375_100731954 240
559 3300014968 Ga0157379_10184475 Ga0157379_101844753 240
560 3300017792 Ga0163161_10072407 Ga0163161_100724072 240
561 3300021361 Ga0213872_10000070 Ga0213872_1000007088 240
562 3300025245 Ga0207425_1000654 Ga0207425_10006542 240
563 3300025258 Ga0209129_1000144 Ga0209129_100014455 240
564 3300025295 Ga0209564_1000029 Ga0209564_100002999 240
565 3300025297 Ga0209758_1000043 Ga0209758_1000043341 240
566 3300025299 Ga0209256_1008621 Ga0209256_10086213 240
567 3300025899 Ga0207642_10005047 Ga0207642_100050475 240
568 3300025918 Ga0207662_10009848 Ga0207662_100098482 240
569 3300025935 Ga0207709_10021187 Ga0207709_100211872 240
570 3300025937 Ga0207669_10538162 Ga0207669_105381621 240
571 3300025938 Ga0207704_10020136 Ga0207704_100201365 240
572 3300025940 Ga0207691_10022031 Ga0207691_100220315 240
573 3300025942 Ga0207689_10331869 Ga0207689_103318692 240
574 3300025944 Ga0207661_10031100 Ga0207661_100311002 240
575 3300025961 Ga0207712_10028770 Ga0207712_100287703 240
576 3300025972 Ga0207668_10357232 Ga0207668_103572322 240
577 3300026075 Ga0207708_10025243 Ga0207708_100252435 240
578 3300026089 Ga0207648_10004276 Ga0207648_1000427611 240
579 3300026118 Ga0207675_100010693 Ga0207675_10001069312 240
580 3300026121 Ga0207683_10304958 Ga0207683_103049583 240
581 3300026142 Ga0207698_11045285 Ga0207698_110452851 240
582 3300028380 Ga0268265_10026796 Ga0268265_100267963 240
583 3300028380 Ga0268265_10048187 Ga0268265_100481872 240
584 3300028380 Ga0268265_10052565 Ga0268265_100525653 240
585 3300028381 Ga0268264_10019582 Ga0268264_100195825 240
586 3300031344 Ga0265316_10000129 Ga0265316_1000012933 240
587 3300031824 Ga0307413_10468300 Ga0307413_104683002 240
588 3300035112 Ga0373932_0136663 Ga0373932_0136663_30_752 240
589 3300035207 Ga0373942_0012519 Ga0373942_0012519_115_837 240
590 3300035207 Ga0373942_0022205 Ga0373942_0022205_39_761 240
591 3300035691 Ga0373931_0002407 Ga0373931_0002407_6631_7353 240
592 3300035695 Ga0373927_0318303 Ga0373927_0318303_244_966 240
593 3300036401 Ga0373937_0199334 Ga0373937_0199334_1056_1778 240
594 3300036647 Ga0316582_0075295 Ga0316582_0075295_259_1011 240
595 3300037068 Ga0373925_0009207 Ga0373925_0009207_5298_6020 240
596 3300039447 Ga0436361_0332176 Ga0436361_0332176_43877_44599 240
597 3300041486 Ga0451807_1301096 Ga0451807_1301096_305_1027 240
598 3300041494 Ga0451837_0356103 Ga0451837_0356103_104_841 240
599 3300046477 Ga0495664_0209872 Ga0495664_0209872_130_852 240
600 3300046517 Ga0495630_0330850 Ga0495630_0330850_348_1070 240
601 3300046535 Ga0495586_0122829 Ga0495586_0122829_229_951 240
602 3300047317 Ga0495604_0375593 Ga0495604_0375593_137_859 240
603 3300047443 Ga0495687_000596 Ga0495687_000596_39269_39991 240
604 3300049574 Ga0501038_0074322 Ga0501038_0074322_1873_2595 240
605 3300049583 Ga0501067_0147991 Ga0501067_0147991_221_943 240
606 3300050496 nmdc:mga07m45_19965_c1 nmdc:mga07m45_19965_c1_618_1340 240
607 3300050512 nmdc:mga0n895_6398_c1 nmdc:mga0n895_6398_c1_5507_6229 240
608 3300050512 nmdc:mga0n895_836151_c1 nmdc:mga0n895_836151_c1_100_822 240
609 3300050513 nmdc:mga0rr50_6385_c1 nmdc:mga0rr50_6385_c1_461_1183 240
610 3300050513 nmdc:mga0rr50_676651_c1 nmdc:mga0rr50_676651_c1_19_741 240
611 3300050514 nmdc:mga08x19_32951_c1 nmdc:mga08x19_32951_c1_1264_1986 240
612 3300050514 nmdc:mga08x19_51210_c1 nmdc:mga08x19_51210_c1_65_787 240
613 3300050514 nmdc:mga08x19_55184_c1 nmdc:mga08x19_55184_c1_315_1037 240
614 3300050515 nmdc:mga0a205_190348_c1 nmdc:mga0a205_190348_c1_1102_1824 240
615 3300050515 nmdc:mga0a205_355291_c1 nmdc:mga0a205_355291_c1_271_993 240
616 3300002705 JGI25156J39149_1000038 JGI25156J39149_1000038105 241
617 3300002738 JGI25154J39366_1003426 JGI25154J39366_10034262 241
618 3300002741 JGI25157J39369_1000127 JGI25157J39369_10001276 241
619 3300003215 JGI25153J46596_10003482 JGI25153J46596_100034826 241
620 3300003751 Ga0055538_1000019 Ga0055538_1000019126 241
621 3300003752 Ga0055539_1000024 Ga0055539_1000024165 241
622 3300003756 Ga0055533_1000024 Ga0055533_1000024242 241
623 3300003756 Ga0055533_1000032 Ga0055533_1000032126 241
624 3300003759 Ga0055525_1000041 Ga0055525_1000041126 241
625 3300003761 Ga0055535_1021772 Ga0055535_10217721 241
626 3300003763 Ga0055529_1000091 Ga0055529_100009144 241
627 3300003771 Ga0055526_1005273 Ga0055526_10052735 241
628 3300003773 Ga0055537_1000079 Ga0055537_100007948 241
629 3300003775 Ga0055524_1000012 Ga0055524_100001263 241
630 3300003775 Ga0055524_1000906 Ga0055524_10009061 241
631 3300003775 Ga0055524_1012257 Ga0055524_10122571 241
632 3300003781 Ga0055536_1015001 Ga0055536_10150012 241
633 3300003784 Ga0055534_1000092 Ga0055534_100009233 241
634 3300003790 Ga0055528_1000190 Ga0055528_100019031 241
635 3300003790 Ga0055528_1010252 Ga0055528_10102522 241
636 3300003790 Ga0055528_1042405 Ga0055528_10424051 241
637 3300003791 Ga0055530_10000793 Ga0055530_100007934 241
638 3300003792 Ga0055540_1000012 Ga0055540_1000012182 241
639 3300003792 Ga0055540_1009352 Ga0055540_10093523 241
640 3300003794 Ga0055531_10005878 Ga0055531_100058782 241
641 3300003794 Ga0055531_10010964 Ga0055531_100109644 241
642 3300003794 Ga0055531_10035313 Ga0055531_100353131 241
643 3300003841 Ga0055541_1000018 Ga0055541_1000018165 241
644 3300005262 Ga0065165_1000518 Ga0065165_10005188 241
645 3300005262 Ga0065165_1000980 Ga0065165_100098018 241
646 3300005262 Ga0065165_1001409 Ga0065165_100140920 241
647 3300005288 Ga0065714_10005383 Ga0065714_100053833 241
648 3300005289 Ga0065704_10139087 Ga0065704_101390872 241
649 3300005327 Ga0070658_10114258 Ga0070658_101142583 241
650 3300005327 Ga0070658_10125625 Ga0070658_101256252 241
651 3300005327 Ga0070658_10292834 Ga0070658_102928341 241
652 3300005328 Ga0070676_10002016 Ga0070676_100020165 241
653 3300005328 Ga0070676_10405141 Ga0070676_104051411 241
654 3300005330 Ga0070690_100021737 Ga0070690_1000217372 241
655 3300005331 Ga0070670_100049944 Ga0070670_1000499443 241
656 3300005331 Ga0070670_100133638 Ga0070670_1001336382 241
657 3300005334 Ga0068869_100009845 Ga0068869_1000098456 241
658 3300005334 Ga0068869_100099753 Ga0068869_1000997532 241
659 3300005335 Ga0070666_10027703 Ga0070666_100277034 241
660 3300005336 Ga0070680_100002933 Ga0070680_1000029339 241
661 3300005338 Ga0068868_100029892 Ga0068868_1000298922 241
662 3300005340 Ga0070689_100054502 Ga0070689_1000545022 241
663 3300005353 Ga0070669_100178152 Ga0070669_1001781521 241
664 3300005354 Ga0070675_100006945 Ga0070675_1000069453 241
665 3300005354 Ga0070675_100026797 Ga0070675_1000267974 241
666 3300005354 Ga0070675_100260126 Ga0070675_1002601262 241
667 3300005355 Ga0070671_100002690 Ga0070671_10000269011 241
668 3300005355 Ga0070671_100076175 Ga0070671_1000761752 241
669 3300005355 Ga0070671_100208978 Ga0070671_1002089781 241
670 3300005356 Ga0070674_100219904 Ga0070674_1002199042 241
671 3300005356 Ga0070674_100350757 Ga0070674_1003507572 241
672 3300005364 Ga0070673_100003204 Ga0070673_1000032044 241
673 3300005364 Ga0070673_100013983 Ga0070673_1000139832 241
674 3300005364 Ga0070673_100066341 Ga0070673_1000663412 241
675 3300005364 Ga0070673_100167844 Ga0070673_1001678441 241
676 3300005366 Ga0070659_100355020 Ga0070659_1003550202 241
677 3300005366 Ga0070659_100468659 Ga0070659_1004686591 241
678 3300005367 Ga0070667_100003701 Ga0070667_1000037019 241
679 3300005367 Ga0070667_100003920 Ga0070667_10000392013 241
680 3300005367 Ga0070667_100062101 Ga0070667_1000621011 241
681 3300005367 Ga0070667_100244065 Ga0070667_1002440652 241
682 3300005441 Ga0070700_100189567 Ga0070700_1001895672 241
683 3300005455 Ga0070663_100237767 Ga0070663_1002377672 241
684 3300005456 Ga0070678_100182672 Ga0070678_1001826722 241
685 3300005456 Ga0070678_100564619 Ga0070678_1005646192 241
686 3300005457 Ga0070662_100044679 Ga0070662_1000446792 241
687 3300005459 Ga0068867_100279741 Ga0068867_1002797411 241
688 3300005459 Ga0068867_100341008 Ga0068867_1003410082 241
689 3300005466 Ga0070685_10158437 Ga0070685_101584372 241
690 3300005468 Ga0070707_100176922 Ga0070707_1001769223 241
691 3300005530 Ga0070679_100007594 Ga0070679_1000075949 241
692 3300005530 Ga0070679_100387773 Ga0070679_1003877732 241
693 3300005539 Ga0068853_100062690 Ga0068853_1000626902 241
694 3300005539 Ga0068853_100114341 Ga0068853_1001143412 241
695 3300005543 Ga0070672_100017855 Ga0070672_1000178552 241
696 3300005543 Ga0070672_100019023 Ga0070672_1000190232 241
697 3300005543 Ga0070672_100026297 Ga0070672_1000262973 241
698 3300005543 Ga0070672_100194320 Ga0070672_1001943202 241
699 3300005543 Ga0070672_100352658 Ga0070672_1003526582 241
700 3300005544 Ga0070686_100232689 Ga0070686_1002326892 241
701 3300005548 Ga0070665_100053806 Ga0070665_1000538063 241
702 3300005548 Ga0070665_100087815 Ga0070665_1000878152 241
703 3300005563 Ga0068855_100025134 Ga0068855_1000251347 241
704 3300005563 Ga0068855_100066947 Ga0068855_1000669475 241
705 3300005563 Ga0068855_100391310 Ga0068855_1003913102 241
706 3300005563 Ga0068855_100747008 Ga0068855_1007470081 241
707 3300005563 Ga0068855_101260903 Ga0068855_1012609031 241
708 3300005578 Ga0068854_100004342 Ga0068854_10000434212 241
709 3300005578 Ga0068854_100006043 Ga0068854_1000060437 241
710 3300005614 Ga0068856_100002740 Ga0068856_10000274014 241
711 3300005614 Ga0068856_100299357 Ga0068856_1002993571 241
712 3300005616 Ga0068852_100392534 Ga0068852_1003925342 241
713 3300005616 Ga0068852_100485267 Ga0068852_1004852672 241
714 3300005617 Ga0068859_100010093 Ga0068859_1000100933 241
715 3300005617 Ga0068859_100031472 Ga0068859_1000314722 241
716 3300005618 Ga0068864_100000511 Ga0068864_10000051126 241
717 3300005618 Ga0068864_100007732 Ga0068864_1000077325 241
718 3300005618 Ga0068864_100070344 Ga0068864_1000703442 241
719 3300005618 Ga0068864_100310035 Ga0068864_1003100351 241
720 3300005719 Ga0068861_100014651 Ga0068861_1000146513 241
721 3300005719 Ga0068861_100033936 Ga0068861_1000339362 241
722 3300005840 Ga0068870_10010438 Ga0068870_100104382 241
723 3300005840 Ga0068870_10013784 Ga0068870_100137843 241
724 3300005841 Ga0068863_100023710 Ga0068863_1000237104 241
725 3300005841 Ga0068863_100248906 Ga0068863_1002489062 241
726 3300005841 Ga0068863_100640784 Ga0068863_1006407842 241
727 3300005842 Ga0068858_100000359 Ga0068858_10000035928 241
728 3300005842 Ga0068858_100012197 Ga0068858_1000121972 241
729 3300005843 Ga0068860_100005022 Ga0068860_1000050228 241
730 3300005843 Ga0068860_100176967 Ga0068860_1001769672 241
731 3300005844 Ga0068862_100062862 Ga0068862_1000628622 241
732 3300006038 Ga0075365_10005796 Ga0075365_100057969 241
733 3300006042 Ga0075368_10056248 Ga0075368_100562482 241
734 3300006042 Ga0075368_10090039 Ga0075368_100900393 241
735 3300006048 Ga0075363_100012260 Ga0075363_1000122603 241
736 3300006048 Ga0075363_100175349 Ga0075363_1001753491 241
737 3300006058 Ga0075432_10017514 Ga0075432_100175142 241
738 3300006058 Ga0075432_10022694 Ga0075432_100226942 241
739 3300006177 Ga0075362_10003584 Ga0075362_100035847 241
740 3300006177 Ga0075362_10051082 Ga0075362_100510822 241
741 3300006177 Ga0075362_10127700 Ga0075362_101277002 241
742 3300006178 Ga0075367_10066842 Ga0075367_100668422 241
743 3300006178 Ga0075367_10108032 Ga0075367_101080323 241
744 3300006178 Ga0075367_10301603 Ga0075367_103016032 241
745 3300006186 Ga0075369_10060814 Ga0075369_100608142 241
746 3300006195 Ga0075366_10004469 Ga0075366_100044692 241
747 3300006195 Ga0075366_10020423 Ga0075366_100204232 241
748 3300006195 Ga0075366_10037035 Ga0075366_100370352 241
749 3300006195 Ga0075366_10089177 Ga0075366_100891772 241
750 3300006195 Ga0075366_10146550 Ga0075366_101465501 241
751 3300006237 Ga0097621_100038943 Ga0097621_1000389433 241
752 3300006237 Ga0097621_100083278 Ga0097621_1000832782 241
753 3300006237 Ga0097621_100125218 Ga0097621_1001252182 241
754 3300006237 Ga0097621_100645787 Ga0097621_1006457872 241
755 3300006353 Ga0075370_10005799 Ga0075370_100057999 241
756 3300006353 Ga0075370_10006317 Ga0075370_100063174 241
757 3300006353 Ga0075370_10019233 Ga0075370_100192334 241
758 3300006353 Ga0075370_10020703 Ga0075370_100207034 241
759 3300006358 Ga0068871_100063242 Ga0068871_1000632422 241
760 3300006880 Ga0075429_100083054 Ga0075429_1000830542 241
761 3300006881 Ga0068865_100028443 Ga0068865_1000284432 241
762 3300006931 Ga0097620_100010093 Ga0097620_1000100933 241
763 3300006931 Ga0097620_100031472 Ga0097620_1000314722 241
764 3300006944 Ga0099823_1000164 Ga0099823_100016419 241
765 3300006948 Ga0099826_10000115 Ga0099826_1000011527 241
766 3300006948 Ga0099826_10072191 Ga0099826_100721913 241
767 3300009093 Ga0105240_10003642 Ga0105240_1000364217 241
768 3300009093 Ga0105240_10013081 Ga0105240_1001308111 241
769 3300009093 Ga0105240_10061931 Ga0105240_100619315 241
770 3300009093 Ga0105240_10102953 Ga0105240_101029532 241
771 3300009094 Ga0111539_10312175 Ga0111539_103121753 241
772 3300009098 Ga0105245_10046664 Ga0105245_100466644 241
773 3300009098 Ga0105245_10126766 Ga0105245_101267662 241
774 3300009098 Ga0105245_10179212 Ga0105245_101792122 241
775 3300009098 Ga0105245_10211209 Ga0105245_102112092 241
776 3300009148 Ga0105243_10045138 Ga0105243_100451382 241
777 3300009148 Ga0105243_10272668 Ga0105243_102726682 241
778 3300009148 Ga0105243_10796596 Ga0105243_107965962 241
779 3300009174 Ga0105241_10056280 Ga0105241_100562802 241
780 3300009174 Ga0105241_10526652 Ga0105241_105266522 241
781 3300009176 Ga0105242_10121670 Ga0105242_101216702 241
782 3300009177 Ga0105248_10001109 Ga0105248_1000110929 241
783 3300009177 Ga0105248_10736134 Ga0105248_107361342 241
784 3300009545 Ga0105237_10002223 Ga0105237_100022239 241
785 3300009545 Ga0105237_10014808 Ga0105237_100148082 241
786 3300009545 Ga0105237_10054485 Ga0105237_100544853 241
787 3300009545 Ga0105237_10245328 Ga0105237_102453282 241
788 3300009551 Ga0105238_10000128 Ga0105238_1000012849 241
789 3300009551 Ga0105238_10006811 Ga0105238_1000681114 241
790 3300009551 Ga0105238_10027040 Ga0105238_100270402 241
791 3300009553 Ga0105249_10084089 Ga0105249_100840894 241
792 3300010375 Ga0105239_10000470 Ga0105239_1000047046 241
793 3300010375 Ga0105239_10023748 Ga0105239_100237486 241
794 3300010375 Ga0105239_10131049 Ga0105239_101310492 241
795 3300010375 Ga0105239_10687542 Ga0105239_106875422 241
796 3300011119 Ga0105246_10145831 Ga0105246_101458313 241
797 3300011119 Ga0105246_10159810 Ga0105246_101598101 241
798 3300012497 Ga0157319_1000017 Ga0157319_100001790 241
799 3300012502 Ga0157347_1005390 Ga0157347_10053902 241
800 3300013104 Ga0157370_10165877 Ga0157370_101658772 241
801 3300013105 Ga0157369_10039971 Ga0157369_100399715 241
802 3300013296 Ga0157374_10040292 Ga0157374_100402923 241
803 3300013297 Ga0157378_10351365 Ga0157378_103513651 241
804 3300013307 Ga0157372_10140502 Ga0157372_101405023 241
805 3300013308 Ga0157375_10029286 Ga0157375_100292863 241
806 3300013308 Ga0157375_10110281 Ga0157375_101102812 241
807 3300013308 Ga0157375_10498754 Ga0157375_104987541 241
808 3300014325 Ga0163163_10010941 Ga0163163_100109418 241
809 3300014326 Ga0157380_10417405 Ga0157380_104174051 241
810 3300014745 Ga0157377_10075116 Ga0157377_100751162 241
811 3300014968 Ga0157379_10159004 Ga0157379_101590042 241
812 3300014969 Ga0157376_10002980 Ga0157376_100029809 241
813 3300014969 Ga0157376_10027826 Ga0157376_100278262 241
814 3300014969 Ga0157376_10106684 Ga0157376_101066842 241
815 3300017792 Ga0163161_10000092 Ga0163161_1000009286 241
816 3300017792 Ga0163161_10001617 Ga0163161_1000161717 241
817 3300017792 Ga0163161_10044124 Ga0163161_100441244 241
818 3300021361 Ga0213872_10000008 Ga0213872_1000000897 241
819 3300021361 Ga0213872_10000058 Ga0213872_1000005842 241
820 3300021361 Ga0213872_10004816 Ga0213872_100048167 241
821 3300021361 Ga0213872_10055839 Ga0213872_100558391 241
822 3300021361 Ga0213872_10122518 Ga0213872_101225181 241
823 3300025224 Ga0209784_100009 Ga0209784_100009233 241
824 3300025225 Ga0209566_100007 Ga0209566_100007233 241
825 3300025226 Ga0209674_100007 Ga0209674_100007283 241
826 3300025226 Ga0209674_100018 Ga0209674_100018233 241
827 3300025228 Ga0209672_109733 Ga0209672_1097332 241
828 3300025230 Ga0209563_100013 Ga0209563_100013699 241
829 3300025230 Ga0209563_100020 Ga0209563_100020233 241
830 3300025230 Ga0209563_100052 Ga0209563_100052327 241
831 3300025231 Ga0207427_100859 Ga0207427_1008595 241
832 3300025242 Ga0209258_100177 Ga0209258_10017788 241
833 3300025242 Ga0209258_100534 Ga0209258_10053427 241
834 3300025246 Ga0209646_1000094 Ga0209646_100009465 241
835 3300025250 Ga0209026_1000009 Ga0209026_1000009136 241
836 3300025253 Ga0209677_100010 Ga0209677_100010233 241
837 3300025253 Ga0209677_100015 Ga0209677_100015507 241
838 3300025253 Ga0209677_100097 Ga0209677_10009777 241
839 3300025254 Ga0209148_1002932 Ga0209148_10029326 241
840 3300025256 Ga0209759_1000065 Ga0209759_1000065136 241
841 3300025256 Ga0209759_1000399 Ga0209759_100039944 241
842 3300025263 Ga0209565_1000073 Ga0209565_100007339 241
843 3300025272 Ga0209455_1000108 Ga0209455_100010844 241
844 3300025272 Ga0209455_1030565 Ga0209455_10305652 241
845 3300025273 Ga0209673_1000127 Ga0209673_1000127128 241
846 3300025273 Ga0209673_1001619 Ga0209673_10016197 241
847 3300025273 Ga0209673_1003739 Ga0209673_10037392 241
848 3300025273 Ga0209673_1004525 Ga0209673_10045257 241
849 3300025273 Ga0209673_1035444 Ga0209673_10354441 241
850 3300025291 Ga0209675_1000029 Ga0209675_1000029128 241
851 3300025295 Ga0209564_1000003 Ga0209564_1000003216 241
852 3300025297 Ga0209758_1000434 Ga0209758_10004349 241
853 3300025298 Ga0209050_1000197 Ga0209050_100019791 241
854 3300025298 Ga0209050_1009006 Ga0209050_10090062 241
855 3300025299 Ga0209256_1000249 Ga0209256_100024985 241
856 3300025299 Ga0209256_1000826 Ga0209256_100082633 241
857 3300025303 Ga0209051_1001309 Ga0209051_10013097 241
858 3300025303 Ga0209051_1003649 Ga0209051_100364910 241
859 3300025303 Ga0209051_1007414 Ga0209051_10074142 241
860 3300025303 Ga0209051_1059008 Ga0209051_10590082 241
861 3300025304 Ga0209257_1000967 Ga0209257_10009673 241
862 3300025304 Ga0209257_1001007 Ga0209257_10010071 241
863 3300025304 Ga0209257_1033542 Ga0209257_10335422 241
864 3300025893 Ga0207682_10051234 Ga0207682_100512341 241
865 3300025903 Ga0207680_10005639 Ga0207680_100056398 241
866 3300025907 Ga0207645_10001387 Ga0207645_1000138717 241
867 3300025907 Ga0207645_10029556 Ga0207645_100295562 241
868 3300025908 Ga0207643_10022995 Ga0207643_100229952 241
869 3300025911 Ga0207654_10058662 Ga0207654_100586622 241
870 3300025911 Ga0207654_10145045 Ga0207654_101450452 241
871 3300025913 Ga0207695_10002390 Ga0207695_1000239016 241
872 3300025913 Ga0207695_10012192 Ga0207695_100121925 241
873 3300025913 Ga0207695_10013685 Ga0207695_100136858 241
874 3300025913 Ga0207695_10580776 Ga0207695_105807761 241
875 3300025913 Ga0207695_10881394 Ga0207695_108813941 241
876 3300025914 Ga0207671_10002553 Ga0207671_100025538 241
877 3300025914 Ga0207671_10015484 Ga0207671_100154844 241
878 3300025918 Ga0207662_10318155 Ga0207662_103181551 241
879 3300025921 Ga0207652_10261987 Ga0207652_102619872 241
880 3300025923 Ga0207681_10026326 Ga0207681_100263264 241
881 3300025924 Ga0207694_10000845 Ga0207694_100008452 241
882 3300025924 Ga0207694_10100564 Ga0207694_101005642 241
883 3300025924 Ga0207694_10356833 Ga0207694_103568331 241
884 3300025925 Ga0207650_10001201 Ga0207650_100012012 241
885 3300025925 Ga0207650_10378684 Ga0207650_103786842 241
886 3300025926 Ga0207659_10004014 Ga0207659_100040146 241
887 3300025926 Ga0207659_10484340 Ga0207659_104843401 241
888 3300025927 Ga0207687_10083859 Ga0207687_100838593 241
889 3300025927 Ga0207687_10090142 Ga0207687_100901422 241
890 3300025927 Ga0207687_10181807 Ga0207687_101818072 241
891 3300025927 Ga0207687_10239966 Ga0207687_102399662 241
892 3300025931 Ga0207644_10030413 Ga0207644_100304134 241
893 3300025931 Ga0207644_10042292 Ga0207644_100422923 241
894 3300025931 Ga0207644_10067092 Ga0207644_100670922 241
895 3300025931 Ga0207644_10557922 Ga0207644_105579221 241
896 3300025933 Ga0207706_10023128 Ga0207706_100231282 241
897 3300025933 Ga0207706_10045929 Ga0207706_100459292 241
898 3300025933 Ga0207706_10164206 Ga0207706_101642062 241
899 3300025933 Ga0207706_10177181 Ga0207706_101771812 241
900 3300025934 Ga0207686_10052497 Ga0207686_100524972 241
901 3300025936 Ga0207670_10132842 Ga0207670_101328422 241
902 3300025938 Ga0207704_10610881 Ga0207704_106108812 241
903 3300025940 Ga0207691_10010208 Ga0207691_100102083 241
904 3300025940 Ga0207691_10010671 Ga0207691_100106718 241
905 3300025940 Ga0207691_10030243 Ga0207691_100302432 241
906 3300025941 Ga0207711_10102212 Ga0207711_101022122 241
907 3300025941 Ga0207711_10517025 Ga0207711_105170251 241
908 3300025942 Ga0207689_10091430 Ga0207689_100914302 241
909 3300025942 Ga0207689_10119625 Ga0207689_101196252 241
910 3300025942 Ga0207689_10140031 Ga0207689_101400312 241
911 3300025945 Ga0207679_10127792 Ga0207679_101277922 241
912 3300025945 Ga0207679_10195037 Ga0207679_101950372 241
913 3300025945 Ga0207679_10210005 Ga0207679_102100051 241
914 3300025949 Ga0207667_10000115 Ga0207667_1000011583 241
915 3300025949 Ga0207667_10021146 Ga0207667_100211465 241
916 3300025949 Ga0207667_10054967 Ga0207667_100549671 241
917 3300025949 Ga0207667_10857480 Ga0207667_108574801 241
918 3300025960 Ga0207651_10001269 Ga0207651_1000126911 241
919 3300025960 Ga0207651_10041063 Ga0207651_100410633 241
920 3300025960 Ga0207651_10060444 Ga0207651_100604442 241
921 3300025960 Ga0207651_10091726 Ga0207651_100917262 241
922 3300025960 Ga0207651_10586467 Ga0207651_105864672 241
923 3300025961 Ga0207712_10112224 Ga0207712_101122242 241
924 3300025972 Ga0207668_10129222 Ga0207668_101292222 241
925 3300025981 Ga0207640_10004685 Ga0207640_100046859 241
926 3300025981 Ga0207640_10031818 Ga0207640_100318182 241
927 3300025986 Ga0207658_10036650 Ga0207658_100366504 241
928 3300025986 Ga0207658_10080039 Ga0207658_100800393 241
929 3300025986 Ga0207658_10112044 Ga0207658_101120442 241
930 3300025986 Ga0207658_10113311 Ga0207658_101133111 241
931 3300025986 Ga0207658_10337974 Ga0207658_103379742 241
932 3300026023 Ga0207677_10149004 Ga0207677_101490042 241
933 3300026023 Ga0207677_10249226 Ga0207677_102492262 241
934 3300026035 Ga0207703_10001821 Ga0207703_100018214 241
935 3300026035 Ga0207703_10811799 Ga0207703_108117991 241
936 3300026041 Ga0207639_10287590 Ga0207639_102875901 241
937 3300026041 Ga0207639_10698061 Ga0207639_106980612 241
938 3300026067 Ga0207678_10151115 Ga0207678_101511152 241
939 3300026067 Ga0207678_10258477 Ga0207678_102584772 241
940 3300026078 Ga0207702_10000610 Ga0207702_1000061022 241
941 3300026078 Ga0207702_10222666 Ga0207702_102226662 241
942 3300026088 Ga0207641_10001726 Ga0207641_100017264 241
943 3300026088 Ga0207641_10146922 Ga0207641_101469222 241
944 3300026088 Ga0207641_10286134 Ga0207641_102861342 241
945 3300026088 Ga0207641_10480680 Ga0207641_104806802 241
946 3300026095 Ga0207676_10003149 Ga0207676_100031497 241
947 3300026095 Ga0207676_10016394 Ga0207676_100163944 241
948 3300026095 Ga0207676_10038548 Ga0207676_100385484 241
949 3300026095 Ga0207676_10176613 Ga0207676_101766132 241
950 3300026095 Ga0207676_10365056 Ga0207676_103650562 241
951 3300026116 Ga0207674_10031491 Ga0207674_100314912 241
952 3300026116 Ga0207674_10610662 Ga0207674_106106622 241
953 3300026118 Ga0207675_100052369 Ga0207675_1000523692 241
954 3300026118 Ga0207675_100491553 Ga0207675_1004915532 241
955 3300026121 Ga0207683_10010783 Ga0207683_100107838 241
956 3300026121 Ga0207683_10046957 Ga0207683_100469572 241
957 3300026121 Ga0207683_10158482 Ga0207683_101584822 241
958 3300026142 Ga0207698_10004168 Ga0207698_100041689 241
959 3300027296 Ga0209389_1013653 Ga0209389_10136532 241
960 3300027312 Ga0209371_1013896 Ga0209371_10138961 241
961 3300027614 Ga0209970_1000515 Ga0209970_10005155 241
962 3300027665 Ga0209983_1063511 Ga0209983_10635111 241
963 3300027666 Ga0209282_1000109 Ga0209282_100010927 241
964 3300027866 Ga0209813_10024848 Ga0209813_100248482 241
965 3300027876 Ga0209974_10026849 Ga0209974_100268492 241
966 3300027907 Ga0207428_10059781 Ga0207428_100597812 241
967 3300027907 Ga0207428_10164516 Ga0207428_101645162 241
968 3300028379 Ga0268266_10125043 Ga0268266_101250432 241
969 3300028380 Ga0268265_10073151 Ga0268265_100731512 241
970 3300028380 Ga0268265_10434984 Ga0268265_104349842 241
971 3300028381 Ga0268264_10007099 Ga0268264_100070998 241
972 3300028381 Ga0268264_10175698 Ga0268264_101756982 241
973 3300028381 Ga0268264_10838651 Ga0268264_108386511 241
974 3300028573 Ga0265334_10018680 Ga0265334_100186802 241
975 3300028786 Ga0307517_10008692 Ga0307517_100086922 241
976 3300028786 Ga0307517_10123385 Ga0307517_101233852 241
977 3300028786 Ga0307517_10161501 Ga0307517_101615012 241
978 3300028794 Ga0307515_10000049 Ga0307515_10000049212 241
979 3300028794 Ga0307515_10000066 Ga0307515_10000066101 241
980 3300028794 Ga0307515_10000842 Ga0307515_1000084255 241
981 3300028794 Ga0307515_10001640 Ga0307515_1000164033 241
982 3300028794 Ga0307515_10020605 Ga0307515_1002060511 241
983 3300028794 Ga0307515_10031977 Ga0307515_100319775 241
984 3300028794 Ga0307515_10054917 Ga0307515_100549175 241
985 3300028794 Ga0307515_10066935 Ga0307515_100669353 241
986 3300028794 Ga0307515_10131211 Ga0307515_101312112 241
987 3300028794 Ga0307515_10157014 Ga0307515_101570142 241
988 3300030500 Ga0268256_1015399 Ga0268256_10153992 241
989 3300030522 Ga0307512_10035373 Ga0307512_100353732 241
990 3300030522 Ga0307512_10045448 Ga0307512_100454483 241
991 3300030744 Ga0316181_1119047 Ga0316181_11190472 241
992 3300030745 Ga0316182_1368921 Ga0316182_13689214 241
993 3300031250 Ga0265331_10001109 Ga0265331_100011096 241
994 3300031251 Ga0265327_10000120 Ga0265327_10000120140 241
995 3300031456 Ga0307513_10003449 Ga0307513_1000344914 241
996 3300031456 Ga0307513_10040446 Ga0307513_100404465 241
997 3300031456 Ga0307513_10069344 Ga0307513_100693445 241
998 3300031507 Ga0307509_10006861 Ga0307509_100068618 241
999 3300031507 Ga0307509_10010424 Ga0307509_100104245 241
1000 3300031507 Ga0307509_10019730 Ga0307509_100197306 241
1001 3300031507 Ga0307509_10111462 Ga0307509_101114622 241
1002 3300031507 Ga0307509_10111577 Ga0307509_101115773 241
1003 3300031548 Ga0307408_100308956 Ga0307408_1003089562 241
1004 3300031548 Ga0307408_100508123 Ga0307408_1005081232 241
1005 3300031616 Ga0307508_10000097 Ga0307508_1000009795 241
1006 3300031616 Ga0307508_10002774 Ga0307508_1000277411 241
1007 3300031616 Ga0307508_10049288 Ga0307508_100492882 241
1008 3300031649 Ga0307514_10001372 Ga0307514_1000137223 241
1009 3300031649 Ga0307514_10002956 Ga0307514_100029568 241
1010 3300031649 Ga0307514_10197345 Ga0307514_101973452 241
1011 3300031711 Ga0265314_10089035 Ga0265314_100890352 241
1012 3300031712 Ga0265342_10134325 Ga0265342_101343252 241
1013 3300031712 Ga0265342_10208227 Ga0265342_102082271 241
1014 3300031727 Ga0316576_10001183 Ga0316576_100011836 241
1015 3300031727 Ga0316576_10070664 Ga0316576_100706642 241
1016 3300031728 Ga0316578_10029623 Ga0316578_100296234 241
1017 3300031730 Ga0307516_10002245 Ga0307516_1000224515 241
1018 3300031730 Ga0307516_10006152 Ga0307516_1000615210 241
1019 3300031730 Ga0307516_10052707 Ga0307516_100527073 241
1020 3300031730 Ga0307516_10141051 Ga0307516_101410512 241
1021 3300031730 Ga0307516_10273936 Ga0307516_102739362 241
1022 3300031731 Ga0307405_10137989 Ga0307405_101379892 241
1023 3300031731 Ga0307405_10195011 Ga0307405_101950111 241
1024 3300031731 Ga0307405_10401191 Ga0307405_104011912 241
1025 3300031733 Ga0316577_10003998 Ga0316577_100039984 241
1026 3300031838 Ga0307518_10190276 Ga0307518_101902762 241
1027 3300031852 Ga0307410_10169160 Ga0307410_101691602 241
1028 3300031903 Ga0307407_10025101 Ga0307407_100251012 241
1029 3300031911 Ga0307412_10226921 Ga0307412_102269212 241
1030 3300031995 Ga0307409_100276739 Ga0307409_1002767392 241
1031 3300032002 Ga0307416_100010663 Ga0307416_1000106635 241
1032 3300032002 Ga0307416_100220902 Ga0307416_1002209022 241
1033 3300032002 Ga0307416_100263350 Ga0307416_1002633502 241
1034 3300032005 Ga0307411_10010818 Ga0307411_100108185 241
1035 3300032005 Ga0307411_10124552 Ga0307411_101245522 241
1036 3300032126 Ga0307415_100001705 Ga0307415_1000017059 241
1037 3300032137 Ga0316585_10011773 Ga0316585_100117731 241
1038 3300033179 Ga0307507_10063271 Ga0307507_100632712 241
1039 3300033180 Ga0307510_10000311 Ga0307510_1000031114 241
1040 3300033541 Ga0316596_1007375 Ga0316596_10073754 241
1041 3300035089 Ga0373944_0014357 Ga0373944_0014357_243_968 241
1042 3300035691 Ga0373931_0004639 Ga0373931_0004639_3328_4053 241
1043 3300035691 Ga0373931_0006945 Ga0373931_0006945_3115_3915 241
1044 3300037418 Ga0395900_0000054 Ga0395900_0000054_43835_44560 241
1045 3300037418 Ga0395900_0113192 Ga0395900_0113192_533_1261 241
1046 3300037418 Ga0395900_0262176 Ga0395900_0262176_38_763 241
1047 3300037466 Ga0395898_0000798 Ga0395898_0000798_27152_27877 241
1048 3300037466 Ga0395898_0098190 Ga0395898_0098190_1470_2195 241
1049 3300037471 Ga0395905_0002549 Ga0395905_0002549_3084_3815 241
1050 3300037471 Ga0395905_0005238 Ga0395905_0005238_1252_1977 241
1051 3300037471 Ga0395905_0087754 Ga0395905_0087754_486_1211 241
1052 3300037471 Ga0395905_0264387 Ga0395905_0264387_596_1327 241
1053 3300037471 Ga0395905_0393397 Ga0395905_0393397_354_1079 241
1054 3300038443 Ga0395901_0001849 Ga0395901_0001849_20725_21450 241
1055 3300038443 Ga0395901_0146215 Ga0395901_0146215_1519_2247 241
1056 3300039447 Ga0436361_0068556 Ga0436361_0068556_85044_85772 241
1057 3300039447 Ga0436361_0071320 Ga0436361_0071320_667_1395 241
1058 3300039447 Ga0436361_0084014 Ga0436361_0084014_241_969 241
1059 3300039447 Ga0436361_0429906 Ga0436361_0429906_25658_26383 241
1060 3300039447 Ga0436361_0562763 Ga0436361_0562763_5553_6395 241
1061 3300039447 Ga0436361_0900991 Ga0436361_0900991_4446_5174 241
1062 3300039447 Ga0436361_1145133 Ga0436361_1145133_1190_1915 241
1063 3300041411 Ga0439466_0084144 Ga0439466_0084144_31_756 241
1064 3300041451 Ga0451791_0184948 Ga0451791_0184948_335_1060 241
1065 3300041460 Ga0451802_0254447 Ga0451802_0254447_553_1278 241
1066 3300042002 Ga0439442_003824 Ga0439442_003824_1457_2182 241
1067 3300042145 Ga0450906_013768 Ga0450906_013768_465_1190 241
1068 3300042147 Ga0450910_008596 Ga0450910_008596_663_1388 241
1069 3300042156 Ga0439446_0089340 Ga0439446_0089340_202_927 241
1070 3300042184 Ga0450908_002473 Ga0450908_002473_2558_3283 241
1071 3300042531 Ga0450918_000264 Ga0450918_000264_6064_6789 241
1072 3300042876 Ga0451577_0031506 Ga0451577_0031506_1662_2387 241
1073 3300044656 Ga0466969_0000054 Ga0466969_0000054_38570_39295 241
1074 3300044658 Ga0466972_0001650 Ga0466972_0001650_5951_6676 241
1075 3300044658 Ga0466972_0018196 Ga0466972_0018196_2733_3458 241
1076 3300044673 Ga0453683_0001307 Ga0453683_0001307_1207_1935 241
1077 3300046454 Ga0495592_0000113 Ga0495592_0000113_5572_6297 241
1078 3300046472 Ga0495580_0115156 Ga0495580_0115156_1031_1756 241
1079 3300046491 Ga0495584_0194965 Ga0495584_0194965_79_804 241
1080 3300046492 Ga0495585_0014379 Ga0495585_0014379_225_950 241
1081 3300046512 Ga0495610_0045202 Ga0495610_0045202_602_1327 241
1082 3300046519 Ga0495632_0039270 Ga0495632_0039270_299_1024 241
1083 3300046519 Ga0495632_0051289 Ga0495632_0051289_480_1205 241
1084 3300046519 Ga0495632_0174863 Ga0495632_0174863_218_943 241
1085 3300046522 Ga0495643_0078342 Ga0495643_0078342_921_1646 241
1086 3300046522 Ga0495643_0110307 Ga0495643_0110307_91_816 241
1087 3300046530 Ga0495654_0009292 Ga0495654_0009292_373_1098 241
1088 3300046537 Ga0495598_0037659 Ga0495598_0037659_192_920 241
1089 3300046539 Ga0495621_0029195 Ga0495621_0029195_561_1289 241
1090 3300046543 Ga0495645_0322224 Ga0495645_0322224_60_785 241
1091 3300046557 Ga0495622_0014795 Ga0495622_0014795_2268_2993 241
1092 3300046660 Ga0495625_0000396 Ga0495625_0000396_39522_40247 241
1093 3300046660 Ga0495625_0015173 Ga0495625_0015173_1489_2214 241
1094 3300046660 Ga0495625_0279030 Ga0495625_0279030_79_804 241
1095 3300046680 Ga0495646_0057785 Ga0495646_0057785_1113_1838 241
1096 3300046689 Ga0495613_0376735 Ga0495613_0376735_164_889 241
1097 3300046690 Ga0495624_0034278 Ga0495624_0034278_1483_2208 241
1098 3300046694 Ga0495649_0003001 Ga0495649_0003001_10822_11547 241
1099 3300046810 Ga0495660_0028467 Ga0495660_0028467_2087_2812 241
1100 3300047673 Ga0495593_0026312 Ga0495593_0026312_323_1048 241
1101 3300048088 Ga0495602_0151146 Ga0495602_0151146_957_1682 241
1102 3300048909 Ga0496106_0388903 Ga0496106_0388903_226_954 241
1103 3300048911 Ga0496108_0408956 Ga0496108_0408956_422_1147 241
1104 3300048911 Ga0496108_0437113 Ga0496108_0437113_377_1102 241
1105 3300048913 Ga0496110_0021889 Ga0496110_0021889_2370_3095 241
1106 3300048914 Ga0496111_0083344 Ga0496111_0083344_922_1647 241
1107 3300048914 Ga0496111_0148645 Ga0496111_0148645_314_1039 241
1108 3300048915 Ga0496112_0109579 Ga0496112_0109579_1128_1853 241
1109 3300048916 Ga0496113_0035188 Ga0496113_0035188_2772_3497 241
1110 3300048927 Ga0496124_0000125 Ga0496124_0000125_121563_122288 241
1111 3300049460 Ga0495682_0091568 Ga0495682_0091568_149_874 241
1112 3300050489 nmdc:mga03683_115249_c1 nmdc:mga03683_115249_c1_288_1013 241
1113 3300050489 nmdc:mga03683_1184_c1 nmdc:mga03683_1184_c1_758_1483 241
1114 3300050489 nmdc:mga03683_207506_c1 nmdc:mga03683_207506_c1_115_840 241
1115 3300050490 nmdc:mga03n38_121729_c1 nmdc:mga03n38_121729_c1_398_1123 241
1116 3300050492 nmdc:mga0yw44_1882_c1 nmdc:mga0yw44_1882_c1_1987_2712 241
1117 3300050493 nmdc:mga0k408_107290_c1 nmdc:mga0k408_107290_c1_62_787 241
1118 3300050493 nmdc:mga0k408_124761_c1 nmdc:mga0k408_124761_c1_738_1463 241
1119 3300050493 nmdc:mga0k408_19860_c1 nmdc:mga0k408_19860_c1_2442_3167 241
1120 3300050493 nmdc:mga0k408_21606_c1 nmdc:mga0k408_21606_c1_1567_2292 241
1121 3300050493 nmdc:mga0k408_76211_c1 nmdc:mga0k408_76211_c1_775_1500 241
1122 3300050493 nmdc:mga0k408_78197_c1 nmdc:mga0k408_78197_c1_504_1229 241
1123 3300050494 nmdc:mga06z11_32826_c1 nmdc:mga06z11_32826_c1_363_1088 241
1124 3300050494 nmdc:mga06z11_335122_c1 nmdc:mga06z11_335122_c1_64_789 241
1125 3300050495 nmdc:mga04h51_18261_c1 nmdc:mga04h51_18261_c1_827_1552 241
1126 3300050496 nmdc:mga07m45_178027_c1 nmdc:mga07m45_178027_c1_489_1214 241
1127 3300050496 nmdc:mga07m45_43207_c1 nmdc:mga07m45_43207_c1_1395_2120 241
1128 3300050496 nmdc:mga07m45_7058_c2 nmdc:mga07m45_7058_c2_729_1454 241
1129 3300050496 nmdc:mga07m45_9482_c1 nmdc:mga07m45_9482_c1_588_1313 241
1130 3300053080 Ga0500635_0000026 Ga0500635_0000026_5083_5883 241
1131 3300053086 Ga0500578_0000926 Ga0500578_0000926_578_1303 241
1132 3300053086 Ga0500578_0086543 Ga0500578_0086543_485_1210 241
1133 3300053093 Ga0500651_0015061 Ga0500651_0015061_3723_4448 241
1134 3300053093 Ga0500651_0037658 Ga0500651_0037658_2132_2857 241
1135 3300053093 Ga0500651_0121288 Ga0500651_0121288_519_1244 241
1136 3300053118 Ga0500594_0000905 Ga0500594_0000905_4681_5406 241
1137 3300053127 Ga0500623_103280 Ga0500623_103280_371_1096 241
1138 3300053131 Ga0500652_009409 Ga0500652_009409_950_1675 241
1139 3300053136 Ga0500559_0000260 Ga0500559_0000260_34382_35107 241
1140 3300053139 Ga0500568_0017724 Ga0500568_0017724_23_754 241
1141 3300053156 Ga0500622_0001479 Ga0500622_0001479_3242_3967 241
1142 3300053156 Ga0500622_0001878 Ga0500622_0001878_13730_14455 241
1143 3300061734 Ga0530510_0186491 Ga0530510_0186491_620_1348 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

44

115

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

121

276

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b9q-assembly1.cif.gz_A the serp optimized structure of ribonucleotide reductase from rhodobacter sphaeroides 0.8102 23 81
7b9p-assembly1.cif.gz_A-2 structure of ribonucleotide reductase from rhodobacter sphaeroides 0.7844 23 83
1yj7-assembly1.cif.gz_C crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.7306 140 191
4hac-assembly1.cif.gz_B crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei 0.728 149 203
2nxc-assembly1.cif.gz_A apo-form of t. thermophilus ribosomal protein l11 methyltransferase (prma) 0.7252 138 177
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9478 83 241 3.30.70.980
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9126 83 238 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9051 5 74 1.10.10.200
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9045 19 79 1.10.10.200
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.904 26 77 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A4V1U2A0-F1-model_v4 deleted 0.9891 86 239
AF-A0A258LN40-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9849 134 239 GO:0003677
GO:0005829
AF-A0A4V1U2A0-F1-model_v4 deleted 0.9828 86 239
AF-A0A258LN40-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9758 134 239 GO:0003677
GO:0005829
AF-A0A7Z9XSW8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9725 77 241 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
91.24 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map