F490743
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1143 | 505 | 1073 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0562763|Ga0436361_0562763_5553_6395 |
| Length | 280 |
| Sequence | MRLDPPAGAGRAWPGPARLIIQAGRRQPRRPRCIQEHSSMAGHSKWANIQHRKGRQDEKRGKAWTRVIREIMVAARLGGGDPNANPRLRLAVDKAKAVNLPADTVKRNIDKATGNLEGVTYEEIRYEGYGIAGAAIIVDTMTDNRVRTVAEVRHAFSKYGGNMGTDGSVSFQFKHVGQFVFAPGTSEDKVMEVALEAGAEDVITDDDGAIEVLCTPADFEKVKIALEGAGLTPDIAEVTMRAENTVDLAGEDSARMQKLLDVLEDLDDVQEVYHNAVLAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 9 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 10 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 11 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 12 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 13 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 14 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 15 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 16 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 17 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 18 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 19 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 20 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 21 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 22 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 23 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 24 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 25 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 26 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 27 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 28 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 29 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 30 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 31 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 32 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 33 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 34 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 35 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 36 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 37 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 38 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 39 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 40 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 41 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 42 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 43 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 44 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 45 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 46 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 47 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 48 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 49 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 50 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 51 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 52 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 53 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 54 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 55 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 56 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 57 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 58 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 59 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 60 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 61 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 62 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 63 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 64 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 65 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 66 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 67 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 68 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 69 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 70 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 71 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 72 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 73 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 74 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 83 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 84 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 85 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 87 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 92 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 98 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 100 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 104 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 105 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 114 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 121 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 128 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 135 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 136 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 140 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 141 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 142 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 145 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 146 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 147 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 151 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 152 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 153 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 154 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 155 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 156 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 159 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 160 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 161 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 162 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 164 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 165 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 166 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 167 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 168 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 169 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 170 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 171 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 172 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 174 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 175 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 176 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 190 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 191 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 201 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 205 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 206 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 208 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 218 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 219 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 222 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 226 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 228 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 289 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 293 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 296 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 300 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 301 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 302 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 303 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 304 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 305 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 306 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 308 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 309 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 310 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 311 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 312 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 313 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 314 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 315 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 316 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 317 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 318 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 319 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 320 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 321 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 322 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 323 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 324 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 325 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 326 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 327 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 328 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 329 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 330 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 331 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 332 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 333 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 334 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 335 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 336 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 340 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 341 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 342 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 343 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 344 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 345 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 346 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 347 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 348 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 349 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 350 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 351 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 352 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 353 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 354 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 355 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 359 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 361 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 362 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 363 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 364 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 365 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 366 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 367 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 368 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 369 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 370 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 371 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 372 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 373 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 374 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 375 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 376 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 377 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 378 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 379 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 380 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 381 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 382 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 383 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 384 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 385 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 386 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 387 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 426 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 427 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 428 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 429 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 432 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 433 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 436 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 437 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 438 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 439 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 440 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 441 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 442 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 443 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 444 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 466 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 467 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 472 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 475 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 476 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 477 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 488 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 489 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 490 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 492 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 498 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 499 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 501 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 502 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 504 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 505 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.79 |
| Metatranscriptomes | 0.09 |
| Isolates | 6.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.91 |
| Nodule | 0.7 |
| Rhizoplane | 2.36 |
| Rhizosphere | 73.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000038 | 3300002705 | Bacteria | 108421 |
| 2 | JGI25154J39366_1003426 | 3300002738 | Bacteria | 3336 |
| 3 | JGI25157J39369_1000127 | 3300002741 | Bacteria | 65070 |
| 4 | JGI25153J46596_10003482 | 3300003215 | Bacteria | 8805 |
| 5 | JGI25153J46596_10005637 | 3300003215 | Bacteria | 6540 |
| 6 | Ga0055538_1000019 | 3300003751 | Bacteria | 282365 |
| 7 | Ga0055539_1000024 | 3300003752 | Bacteria | 282365 |
| 8 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 9 | Ga0055533_1000032 | 3300003756 | Bacteria | 282365 |
| 10 | Ga0055525_1000041 | 3300003759 | Bacteria | 282365 |
| 11 | Ga0055535_1000330 | 3300003761 | Bacteria | 47889 |
| 12 | Ga0055535_1021772 | 3300003761 | Bacteria | 774 |
| 13 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 14 | Ga0055529_1000091 | 3300003763 | Bacteria | 138369 |
| 15 | Ga0055526_1005273 | 3300003771 | Bacteria | 7487 |
| 16 | Ga0055526_1005340 | 3300003771 | Bacteria | 7422 |
| 17 | Ga0055537_1000079 | 3300003773 | Bacteria | 69953 |
| 18 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 19 | Ga0055524_1000906 | 3300003775 | Bacteria | 19129 |
| 20 | Ga0055524_1012257 | 3300003775 | Bacteria | 3300 |
| 21 | Ga0055536_1015001 | 3300003781 | Bacteria | 2679 |
| 22 | Ga0055534_1000092 | 3300003784 | Bacteria | 70082 |
| 23 | Ga0055534_1000506 | 3300003784 | Bacteria | 21227 |
| 24 | Ga0055528_1000190 | 3300003790 | Bacteria | 52365 |
| 25 | Ga0055528_1010252 | 3300003790 | Bacteria | 3831 |
| 26 | Ga0055528_1042405 | 3300003790 | Bacteria | 1003 |
| 27 | Ga0055530_10000793 | 3300003791 | Bacteria | 26295 |
| 28 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 29 | Ga0055540_1009352 | 3300003792 | Bacteria | 3397 |
| 30 | Ga0055531_10000612 | 3300003794 | Bacteria | 30958 |
| 31 | Ga0055531_10005878 | 3300003794 | Bacteria | 7083 |
| 32 | Ga0055531_10010964 | 3300003794 | Bacteria | 4435 |
| 33 | Ga0055531_10035313 | 3300003794 | Bacteria | 1566 |
| 34 | Ga0055541_1000018 | 3300003841 | Bacteria | 282365 |
| 35 | Ga0065165_1000518 | 3300005262 | Bacteria | 59187 |
| 36 | Ga0065165_1000980 | 3300005262 | Bacteria | 35365 |
| 37 | Ga0065165_1001409 | 3300005262 | Bacteria | 26197 |
| 38 | Ga0065714_10005383 | 3300005288 | Bacteria | 4157 |
| 39 | Ga0065704_10139087 | 3300005289 | Bacteria | 1537 |
| 40 | Ga0065707_10084409 | 3300005295 | Bacteria | 7230 |
| 41 | Ga0070658_10114258 | 3300005327 | Bacteria | 2238 |
| 42 | Ga0070658_10125625 | 3300005327 | Bacteria | 2135 |
| 43 | Ga0070658_10292834 | 3300005327 | Bacteria | 1387 |
| 44 | Ga0070676_10002016 | 3300005328 | Bacteria | 10323 |
| 45 | Ga0070676_10154024 | 3300005328 | Bacteria | 1474 |
| 46 | Ga0070676_10405141 | 3300005328 | Bacteria | 950 |
| 47 | Ga0070690_100017501 | 3300005330 | Bacteria | 4311 |
| 48 | Ga0070690_100021737 | 3300005330 | Bacteria | 3920 |
| 49 | Ga0070670_100049944 | 3300005331 | Bacteria | 3596 |
| 50 | Ga0070670_100133638 | 3300005331 | Bacteria | 2143 |
| 51 | Ga0070670_100864257 | 3300005331 | Bacteria | 819 |
| 52 | Ga0068869_100009845 | 3300005334 | Bacteria | 6207 |
| 53 | Ga0068869_100049701 | 3300005334 | Bacteria | 3037 |
| 54 | Ga0068869_100099753 | 3300005334 | Bacteria | 2195 |
| 55 | Ga0068869_100133890 | 3300005334 | Bacteria | 1908 |
| 56 | Ga0068869_100232058 | 3300005334 | Bacteria | 1467 |
| 57 | Ga0068869_100635596 | 3300005334 | Bacteria | 905 |
| 58 | Ga0070666_10027703 | 3300005335 | Bacteria | 3713 |
| 59 | Ga0070666_10065827 | 3300005335 | Bacteria | 2459 |
| 60 | Ga0070666_10115059 | 3300005335 | Bacteria | 1862 |
| 61 | Ga0070680_100002933 | 3300005336 | Bacteria | 12683 |
| 62 | Ga0070680_100366898 | 3300005336 | Bacteria | 1225 |
| 63 | Ga0070682_100392009 | 3300005337 | Bacteria | 1048 |
| 64 | Ga0068868_100018848 | 3300005338 | Bacteria | 5164 |
| 65 | Ga0068868_100029892 | 3300005338 | Bacteria | 4175 |
| 66 | Ga0068868_100274579 | 3300005338 | Bacteria | 1425 |
| 67 | Ga0070689_100040247 | 3300005340 | Bacteria | 3583 |
| 68 | Ga0070689_100054502 | 3300005340 | Bacteria | 3096 |
| 69 | Ga0070687_100004765 | 3300005343 | Bacteria | 5431 |
| 70 | Ga0070661_100039421 | 3300005344 | Bacteria | 3441 |
| 71 | Ga0070668_100366599 | 3300005347 | Bacteria | 1223 |
| 72 | Ga0070669_100027387 | 3300005353 | Bacteria | 4101 |
| 73 | Ga0070669_100033268 | 3300005353 | Bacteria | 3728 |
| 74 | Ga0070669_100178152 | 3300005353 | Bacteria | 1661 |
| 75 | Ga0070669_100255320 | 3300005353 | Bacteria | 1397 |
| 76 | Ga0070675_100006945 | 3300005354 | Bacteria | 8695 |
| 77 | Ga0070675_100026797 | 3300005354 | Bacteria | 4626 |
| 78 | Ga0070675_100076526 | 3300005354 | Bacteria | 2784 |
| 79 | Ga0070675_100231758 | 3300005354 | Bacteria | 1611 |
| 80 | Ga0070675_100260126 | 3300005354 | Bacteria | 1521 |
| 81 | Ga0070675_100292535 | 3300005354 | Bacteria | 1433 |
| 82 | Ga0070675_100527759 | 3300005354 | Bacteria | 1066 |
| 83 | Ga0070671_100002690 | 3300005355 | Bacteria | 13781 |
| 84 | Ga0070671_100076175 | 3300005355 | Bacteria | 2802 |
| 85 | Ga0070671_100208978 | 3300005355 | Bacteria | 1655 |
| 86 | Ga0070671_100216489 | 3300005355 | Bacteria | 1625 |
| 87 | Ga0070674_100164780 | 3300005356 | Bacteria | 1685 |
| 88 | Ga0070674_100219904 | 3300005356 | Bacteria | 1477 |
| 89 | Ga0070674_100350757 | 3300005356 | Bacteria | 1192 |
| 90 | Ga0070674_100417774 | 3300005356 | Bacteria | 1100 |
| 91 | Ga0070674_100616422 | 3300005356 | Bacteria | 919 |
| 92 | Ga0070673_100003204 | 3300005364 | Bacteria | 10140 |
| 93 | Ga0070673_100013983 | 3300005364 | Bacteria | 5574 |
| 94 | Ga0070673_100066341 | 3300005364 | Bacteria | 2882 |
| 95 | Ga0070673_100095868 | 3300005364 | Bacteria | 2434 |
| 96 | Ga0070673_100107455 | 3300005364 | Bacteria | 2308 |
| 97 | Ga0070673_100127618 | 3300005364 | Bacteria | 2130 |
| 98 | Ga0070673_100167844 | 3300005364 | Bacteria | 1871 |
| 99 | Ga0070688_100119012 | 3300005365 | Bacteria | 1766 |
| 100 | Ga0070659_100355020 | 3300005366 | Bacteria | 1230 |
| 101 | Ga0070659_100468659 | 3300005366 | Bacteria | 1070 |
| 102 | Ga0070667_100000848 | 3300005367 | Bacteria | 28390 |
| 103 | Ga0070667_100003701 | 3300005367 | Bacteria | 13007 |
| 104 | Ga0070667_100003920 | 3300005367 | Bacteria | 12640 |
| 105 | Ga0070667_100062101 | 3300005367 | Bacteria | 3164 |
| 106 | Ga0070667_100244065 | 3300005367 | Bacteria | 1604 |
| 107 | Ga0070667_100278178 | 3300005367 | Bacteria | 1502 |
| 108 | Ga0070700_100189567 | 3300005441 | Bacteria | 1437 |
| 109 | Ga0070663_100001730 | 3300005455 | Bacteria | 12119 |
| 110 | Ga0070663_100016702 | 3300005455 | Bacteria | 4775 |
| 111 | Ga0070663_100237767 | 3300005455 | Bacteria | 1437 |
| 112 | Ga0070678_100005274 | 3300005456 | Bacteria | 7448 |
| 113 | Ga0070678_100156597 | 3300005456 | Bacteria | 1841 |
| 114 | Ga0070678_100182672 | 3300005456 | Bacteria | 1718 |
| 115 | Ga0070678_100298762 | 3300005456 | Bacteria | 1368 |
| 116 | Ga0070678_100564619 | 3300005456 | Bacteria | 1012 |
| 117 | Ga0070662_100019041 | 3300005457 | Bacteria | 4654 |
| 118 | Ga0070662_100044679 | 3300005457 | Bacteria | 3174 |
| 119 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 120 | Ga0068867_100000501 | 3300005459 | Bacteria | 26078 |
| 121 | Ga0068867_100012878 | 3300005459 | Bacteria | 5917 |
| 122 | Ga0068867_100028338 | 3300005459 | Bacteria | 4032 |
| 123 | Ga0068867_100058410 | 3300005459 | Bacteria | 2858 |
| 124 | Ga0068867_100279741 | 3300005459 | Bacteria | 1368 |
| 125 | Ga0068867_100341008 | 3300005459 | Bacteria | 1248 |
| 126 | Ga0070685_10158437 | 3300005466 | Bacteria | 1441 |
| 127 | Ga0070707_100176922 | 3300005468 | Bacteria | 2080 |
| 128 | Ga0070699_100089836 | 3300005518 | Bacteria | 2684 |
| 129 | Ga0070679_100007594 | 3300005530 | Bacteria | 10146 |
| 130 | Ga0070679_100263171 | 3300005530 | Bacteria | 1680 |
| 131 | Ga0070679_100387773 | 3300005530 | Bacteria | 1343 |
| 132 | Ga0070684_100015427 | 3300005535 | Bacteria | 6221 |
| 133 | Ga0070697_100055465 | 3300005536 | Bacteria | 3222 |
| 134 | Ga0070697_100301525 | 3300005536 | Bacteria | 1377 |
| 135 | Ga0068853_100005984 | 3300005539 | Bacteria | 9616 |
| 136 | Ga0068853_100009827 | 3300005539 | Bacteria | 7721 |
| 137 | Ga0068853_100061217 | 3300005539 | Bacteria | 3255 |
| 138 | Ga0068853_100062690 | 3300005539 | Bacteria | 3218 |
| 139 | Ga0068853_100065796 | 3300005539 | Bacteria | 3146 |
| 140 | Ga0068853_100114341 | 3300005539 | Bacteria | 2400 |
| 141 | Ga0068853_100195489 | 3300005539 | Bacteria | 1839 |
| 142 | Ga0068853_100389654 | 3300005539 | Bacteria | 1302 |
| 143 | Ga0068853_100523955 | 3300005539 | Bacteria | 1121 |
| 144 | Ga0070672_100004378 | 3300005543 | Bacteria | 9247 |
| 145 | Ga0070672_100010304 | 3300005543 | Bacteria | 6479 |
| 146 | Ga0070672_100017855 | 3300005543 | Bacteria | 5115 |
| 147 | Ga0070672_100019023 | 3300005543 | Bacteria | 4977 |
| 148 | Ga0070672_100026297 | 3300005543 | Bacteria | 4328 |
| 149 | Ga0070672_100194320 | 3300005543 | Bacteria | 1695 |
| 150 | Ga0070672_100341106 | 3300005543 | Bacteria | 1276 |
| 151 | Ga0070672_100352658 | 3300005543 | Bacteria | 1254 |
| 152 | Ga0070686_100044033 | 3300005544 | Bacteria | 2803 |
| 153 | Ga0070686_100232689 | 3300005544 | Bacteria | 1338 |
| 154 | Ga0070695_100125133 | 3300005545 | Bacteria | 1764 |
| 155 | Ga0070696_100008093 | 3300005546 | Bacteria | 7027 |
| 156 | Ga0070693_100106067 | 3300005547 | Bacteria | 1720 |
| 157 | Ga0070665_100033531 | 3300005548 | Bacteria | 5166 |
| 158 | Ga0070665_100053806 | 3300005548 | Bacteria | 4037 |
| 159 | Ga0070665_100087815 | 3300005548 | Bacteria | 3115 |
| 160 | Ga0070665_100088866 | 3300005548 | Bacteria | 3095 |
| 161 | Ga0070665_100146971 | 3300005548 | Bacteria | 2360 |
| 162 | Ga0068855_100007881 | 3300005563 | Bacteria | 12864 |
| 163 | Ga0068855_100025134 | 3300005563 | Bacteria | 7130 |
| 164 | Ga0068855_100066947 | 3300005563 | Bacteria | 4187 |
| 165 | Ga0068855_100229921 | 3300005563 | Bacteria | 2077 |
| 166 | Ga0068855_100391310 | 3300005563 | Bacteria | 1525 |
| 167 | Ga0068855_100747008 | 3300005563 | Bacteria | 1043 |
| 168 | Ga0068855_101260903 | 3300005563 | Bacteria | 766 |
| 169 | Ga0068857_100089574 | 3300005577 | Bacteria | 2753 |
| 170 | Ga0068857_100247155 | 3300005577 | Bacteria | 1634 |
| 171 | Ga0068854_100004342 | 3300005578 | Bacteria | 8937 |
| 172 | Ga0068854_100006043 | 3300005578 | Bacteria | 7672 |
| 173 | Ga0068854_100101566 | 3300005578 | Bacteria | 2157 |
| 174 | Ga0068856_100002740 | 3300005614 | Bacteria | 18046 |
| 175 | Ga0068856_100059619 | 3300005614 | Bacteria | 3770 |
| 176 | Ga0068856_100281003 | 3300005614 | Bacteria | 1681 |
| 177 | Ga0068856_100299357 | 3300005614 | Bacteria | 1626 |
| 178 | Ga0070702_100419691 | 3300005615 | Bacteria | 962 |
| 179 | Ga0068852_100053344 | 3300005616 | Bacteria | 3480 |
| 180 | Ga0068852_100392534 | 3300005616 | Bacteria | 1363 |
| 181 | Ga0068852_100485267 | 3300005616 | Bacteria | 1229 |
| 182 | Ga0068852_100522354 | 3300005616 | Bacteria | 1185 |
| 183 | Ga0068852_100646508 | 3300005616 | Bacteria | 1065 |
| 184 | Ga0068859_100010093 | 3300005617 | Bacteria | 9518 |
| 185 | Ga0068859_100031472 | 3300005617 | Bacteria | 5328 |
| 186 | Ga0068859_100089172 | 3300005617 | Bacteria | 3134 |
| 187 | Ga0068859_100257130 | 3300005617 | Bacteria | 1837 |
| 188 | Ga0068859_100667959 | 3300005617 | Bacteria | 1131 |
| 189 | Ga0068864_100000511 | 3300005618 | Bacteria | 33486 |
| 190 | Ga0068864_100007732 | 3300005618 | Bacteria | 8858 |
| 191 | Ga0068864_100070344 | 3300005618 | Bacteria | 3044 |
| 192 | Ga0068864_100310035 | 3300005618 | Bacteria | 1479 |
| 193 | Ga0068864_100468345 | 3300005618 | Bacteria | 1207 |
| 194 | Ga0068866_10021140 | 3300005718 | Bacteria | 2993 |
| 195 | Ga0068866_10350627 | 3300005718 | Bacteria | 938 |
| 196 | Ga0068861_100014651 | 3300005719 | Bacteria | 5506 |
| 197 | Ga0068861_100021631 | 3300005719 | Bacteria | 4625 |
| 198 | Ga0068861_100033936 | 3300005719 | Bacteria | 3769 |
| 199 | Ga0068851_10003542 | 3300005834 | Bacteria | 6948 |
| 200 | Ga0068870_10010438 | 3300005840 | Bacteria | 4270 |
| 201 | Ga0068870_10013784 | 3300005840 | Bacteria | 3806 |
| 202 | Ga0068863_100023710 | 3300005841 | Bacteria | 5856 |
| 203 | Ga0068863_100052686 | 3300005841 | Bacteria | 3856 |
| 204 | Ga0068863_100112251 | 3300005841 | Bacteria | 2596 |
| 205 | Ga0068863_100248906 | 3300005841 | Bacteria | 1716 |
| 206 | Ga0068863_100301890 | 3300005841 | Bacteria | 1553 |
| 207 | Ga0068863_100379266 | 3300005841 | Bacteria | 1380 |
| 208 | Ga0068863_100640784 | 3300005841 | Bacteria | 1053 |
| 209 | Ga0068858_100000359 | 3300005842 | Bacteria | 48114 |
| 210 | Ga0068858_100012197 | 3300005842 | Bacteria | 8103 |
| 211 | Ga0068858_100252078 | 3300005842 | Bacteria | 1677 |
| 212 | Ga0068860_100005022 | 3300005843 | Bacteria | 13465 |
| 213 | Ga0068860_100017155 | 3300005843 | Bacteria | 7058 |
| 214 | Ga0068860_100176967 | 3300005843 | Bacteria | 2062 |
| 215 | Ga0068860_100570768 | 3300005843 | Bacteria | 1135 |
| 216 | Ga0068862_100002767 | 3300005844 | Bacteria | 15368 |
| 217 | Ga0068862_100017960 | 3300005844 | Bacteria | 5892 |
| 218 | Ga0068862_100046445 | 3300005844 | Bacteria | 3705 |
| 219 | Ga0068862_100062862 | 3300005844 | Bacteria | 3193 |
| 220 | Ga0081540_1010828 | 3300005983 | Bacteria | 6129 |
| 221 | Ga0075365_10005796 | 3300006038 | Bacteria | 6710 |
| 222 | Ga0075368_10056248 | 3300006042 | Bacteria | 1569 |
| 223 | Ga0075368_10090039 | 3300006042 | Bacteria | 1254 |
| 224 | Ga0075363_100012260 | 3300006048 | Bacteria | 4127 |
| 225 | Ga0075363_100175349 | 3300006048 | Bacteria | 1218 |
| 226 | Ga0075364_10057248 | 3300006051 | Bacteria | 2553 |
| 227 | Ga0075432_10017514 | 3300006058 | Bacteria | 2443 |
| 228 | Ga0075432_10022694 | 3300006058 | Bacteria | 2147 |
| 229 | Ga0070715_10246192 | 3300006163 | Bacteria | 932 |
| 230 | Ga0070716_100202949 | 3300006173 | Bacteria | 1319 |
| 231 | Ga0075362_10003415 | 3300006177 | Bacteria | 5546 |
| 232 | Ga0075362_10003584 | 3300006177 | Bacteria | 5455 |
| 233 | Ga0075362_10051082 | 3300006177 | Bacteria | 1850 |
| 234 | Ga0075362_10127700 | 3300006177 | Bacteria | 1207 |
| 235 | Ga0075367_10066842 | 3300006178 | Bacteria | 2155 |
| 236 | Ga0075367_10108032 | 3300006178 | Bacteria | 1705 |
| 237 | Ga0075367_10301603 | 3300006178 | Bacteria | 1008 |
| 238 | Ga0075369_10060814 | 3300006186 | Bacteria | 1648 |
| 239 | Ga0075366_10001513 | 3300006195 | Bacteria | 11602 |
| 240 | Ga0075366_10002649 | 3300006195 | Bacteria | 9220 |
| 241 | Ga0075366_10004469 | 3300006195 | Bacteria | 7503 |
| 242 | Ga0075366_10020423 | 3300006195 | Bacteria | 3844 |
| 243 | Ga0075366_10034277 | 3300006195 | Bacteria | 2989 |
| 244 | Ga0075366_10037035 | 3300006195 | Bacteria | 2878 |
| 245 | Ga0075366_10089177 | 3300006195 | Bacteria | 1847 |
| 246 | Ga0075366_10141351 | 3300006195 | Bacteria | 1455 |
| 247 | Ga0075366_10146550 | 3300006195 | Bacteria | 1429 |
| 248 | Ga0097621_100025265 | 3300006237 | Bacteria | 4645 |
| 249 | Ga0097621_100038943 | 3300006237 | Bacteria | 3816 |
| 250 | Ga0097621_100055961 | 3300006237 | Bacteria | 3222 |
| 251 | Ga0097621_100083278 | 3300006237 | Bacteria | 2665 |
| 252 | Ga0097621_100125218 | 3300006237 | Bacteria | 2183 |
| 253 | Ga0097621_100245097 | 3300006237 | Bacteria | 1568 |
| 254 | Ga0097621_100250124 | 3300006237 | Bacteria | 1552 |
| 255 | Ga0097621_100645787 | 3300006237 | Bacteria | 971 |
| 256 | Ga0075370_10005799 | 3300006353 | Bacteria | 6172 |
| 257 | Ga0075370_10006317 | 3300006353 | Bacteria | 5951 |
| 258 | Ga0075370_10019233 | 3300006353 | Bacteria | 3717 |
| 259 | Ga0075370_10020703 | 3300006353 | Bacteria | 3598 |
| 260 | Ga0075370_10038798 | 3300006353 | Bacteria | 2681 |
| 261 | Ga0068871_100012114 | 3300006358 | Bacteria | 6347 |
| 262 | Ga0068871_100012912 | 3300006358 | Bacteria | 6184 |
| 263 | Ga0068871_100033647 | 3300006358 | Bacteria | 4061 |
| 264 | Ga0068871_100063242 | 3300006358 | Bacteria | 3026 |
| 265 | Ga0068871_100534157 | 3300006358 | Bacteria | 1060 |
| 266 | Ga0075428_100081287 | 3300006844 | Bacteria | 3536 |
| 267 | Ga0075431_100091572 | 3300006847 | Bacteria | 3138 |
| 268 | Ga0075433_10734731 | 3300006852 | Bacteria | 864 |
| 269 | Ga0075434_100154648 | 3300006871 | Bacteria | 2313 |
| 270 | Ga0075429_100003851 | 3300006880 | Bacteria | 12815 |
| 271 | Ga0075429_100024307 | 3300006880 | Bacteria | 5257 |
| 272 | Ga0075429_100083054 | 3300006880 | Bacteria | 2793 |
| 273 | Ga0068865_100010706 | 3300006881 | Bacteria | 5715 |
| 274 | Ga0068865_100012581 | 3300006881 | Bacteria | 5331 |
| 275 | Ga0068865_100028443 | 3300006881 | Bacteria | 3701 |
| 276 | Ga0068865_100301093 | 3300006881 | Bacteria | 1283 |
| 277 | Ga0075436_100027180 | 3300006914 | Bacteria | 3938 |
| 278 | Ga0075436_100028281 | 3300006914 | Bacteria | 3856 |
| 279 | Ga0075436_100035766 | 3300006914 | Bacteria | 3425 |
| 280 | Ga0097620_100010093 | 3300006931 | Bacteria | 9518 |
| 281 | Ga0097620_100031472 | 3300006931 | Bacteria | 5328 |
| 282 | Ga0097620_100089166 | 3300006931 | Bacteria | 3134 |
| 283 | Ga0097620_100257118 | 3300006931 | Bacteria | 1837 |
| 284 | Ga0097620_100667929 | 3300006931 | Bacteria | 1131 |
| 285 | Ga0099823_1000164 | 3300006944 | Bacteria | 35666 |
| 286 | Ga0099826_10000115 | 3300006948 | Bacteria | 36769 |
| 287 | Ga0099826_10072191 | 3300006948 | Bacteria | 2186 |
| 288 | Ga0075435_100008513 | 3300007076 | Bacteria | 7367 |
| 289 | Ga0075435_100248659 | 3300007076 | Bacteria | 1513 |
| 290 | Ga0105240_10003642 | 3300009093 | Bacteria | 23871 |
| 291 | Ga0105240_10013081 | 3300009093 | Bacteria | 11422 |
| 292 | Ga0105240_10061931 | 3300009093 | Bacteria | 4660 |
| 293 | Ga0105240_10102953 | 3300009093 | Bacteria | 3469 |
| 294 | Ga0111539_10017849 | 3300009094 | Bacteria | 8786 |
| 295 | Ga0111539_10312175 | 3300009094 | Bacteria | 1830 |
| 296 | Ga0111539_10503376 | 3300009094 | Bacteria | 1411 |
| 297 | Ga0105245_10046664 | 3300009098 | Bacteria | 3871 |
| 298 | Ga0105245_10087430 | 3300009098 | Bacteria | 2861 |
| 299 | Ga0105245_10126766 | 3300009098 | Bacteria | 2390 |
| 300 | Ga0105245_10179212 | 3300009098 | Bacteria | 2023 |
| 301 | Ga0105245_10211209 | 3300009098 | Bacteria | 1868 |
| 302 | Ga0114129_10014471 | 3300009147 | Bacteria | 11241 |
| 303 | Ga0114129_10297841 | 3300009147 | Bacteria | 2151 |
| 304 | Ga0105243_10000515 | 3300009148 | Bacteria | 39435 |
| 305 | Ga0105243_10011438 | 3300009148 | Bacteria | 6715 |
| 306 | Ga0105243_10045138 | 3300009148 | Bacteria | 3461 |
| 307 | Ga0105243_10161481 | 3300009148 | Bacteria | 1932 |
| 308 | Ga0105243_10269901 | 3300009148 | Bacteria | 1527 |
| 309 | Ga0105243_10272668 | 3300009148 | Bacteria | 1520 |
| 310 | Ga0105243_10796596 | 3300009148 | Bacteria | 931 |
| 311 | Ga0105241_10009853 | 3300009174 | Bacteria | 7022 |
| 312 | Ga0105241_10056280 | 3300009174 | Bacteria | 3015 |
| 313 | Ga0105241_10095833 | 3300009174 | Bacteria | 2350 |
| 314 | Ga0105241_10526652 | 3300009174 | Bacteria | 1058 |
| 315 | Ga0105242_10000382 | 3300009176 | Bacteria | 35202 |
| 316 | Ga0105242_10004129 | 3300009176 | Bacteria | 11304 |
| 317 | Ga0105242_10121670 | 3300009176 | Bacteria | 2241 |
| 318 | Ga0105242_10207852 | 3300009176 | Bacteria | 1742 |
| 319 | Ga0105242_10246119 | 3300009176 | Bacteria | 1609 |
| 320 | Ga0105248_10001109 | 3300009177 | Bacteria | 29881 |
| 321 | Ga0105248_10001415 | 3300009177 | Bacteria | 26820 |
| 322 | Ga0105248_10263516 | 3300009177 | Bacteria | 1940 |
| 323 | Ga0105248_10736134 | 3300009177 | Bacteria | 1113 |
| 324 | Ga0105237_10002223 | 3300009545 | Bacteria | 24276 |
| 325 | Ga0105237_10003141 | 3300009545 | Bacteria | 19871 |
| 326 | Ga0105237_10014808 | 3300009545 | Bacteria | 8139 |
| 327 | Ga0105237_10054485 | 3300009545 | Bacteria | 4007 |
| 328 | Ga0105237_10245328 | 3300009545 | Bacteria | 1793 |
| 329 | Ga0105238_10000128 | 3300009551 | Bacteria | 83216 |
| 330 | Ga0105238_10006811 | 3300009551 | Bacteria | 11412 |
| 331 | Ga0105238_10027040 | 3300009551 | Bacteria | 5847 |
| 332 | Ga0105238_10230868 | 3300009551 | Bacteria | 1827 |
| 333 | Ga0105238_10246774 | 3300009551 | Bacteria | 1763 |
| 334 | Ga0105238_10542154 | 3300009551 | Bacteria | 1167 |
| 335 | Ga0105249_10003146 | 3300009553 | Bacteria | 14279 |
| 336 | Ga0105249_10040918 | 3300009553 | Bacteria | 4211 |
| 337 | Ga0105249_10045561 | 3300009553 | Bacteria | 3989 |
| 338 | Ga0105249_10084089 | 3300009553 | Bacteria | 2963 |
| 339 | Ga0105249_10086584 | 3300009553 | Bacteria | 2922 |
| 340 | Ga0105249_10367690 | 3300009553 | Bacteria | 1461 |
| 341 | Ga0105239_10000470 | 3300010375 | Bacteria | 59011 |
| 342 | Ga0105239_10016362 | 3300010375 | Bacteria | 8203 |
| 343 | Ga0105239_10019647 | 3300010375 | Bacteria | 7457 |
| 344 | Ga0105239_10023748 | 3300010375 | Bacteria | 6752 |
| 345 | Ga0105239_10117267 | 3300010375 | Bacteria | 2955 |
| 346 | Ga0105239_10131049 | 3300010375 | Bacteria | 2789 |
| 347 | Ga0105239_10687542 | 3300010375 | Bacteria | 1169 |
| 348 | Ga0105246_10145831 | 3300011119 | Bacteria | 1786 |
| 349 | Ga0105246_10159810 | 3300011119 | Bacteria | 1715 |
| 350 | Ga0157319_1000017 | 3300012497 | Bacteria | 110340 |
| 351 | Ga0157347_1005390 | 3300012502 | Bacteria | 1221 |
| 352 | Ga0157370_10165877 | 3300013104 | Bacteria | 2054 |
| 353 | Ga0157369_10000172 | 3300013105 | Bacteria | 90979 |
| 354 | Ga0157369_10039971 | 3300013105 | Bacteria | 5123 |
| 355 | Ga0157369_10358386 | 3300013105 | Bacteria | 1514 |
| 356 | Ga0157369_10728207 | 3300013105 | Bacteria | 1021 |
| 357 | Ga0157374_10040292 | 3300013296 | Bacteria | 4301 |
| 358 | Ga0157374_10174012 | 3300013296 | Bacteria | 2101 |
| 359 | Ga0157378_10000016 | 3300013297 | Bacteria | 142649 |
| 360 | Ga0157378_10005086 | 3300013297 | Bacteria | 11555 |
| 361 | Ga0157378_10351365 | 3300013297 | Bacteria | 1440 |
| 362 | Ga0163162_10003443 | 3300013306 | Bacteria | 15110 |
| 363 | Ga0163162_10005037 | 3300013306 | Bacteria | 12732 |
| 364 | Ga0163162_10081316 | 3300013306 | Bacteria | 3310 |
| 365 | Ga0163162_10156745 | 3300013306 | Bacteria | 2397 |
| 366 | Ga0163162_10189925 | 3300013306 | Bacteria | 2181 |
| 367 | Ga0163162_10331903 | 3300013306 | Bacteria | 1653 |
| 368 | Ga0157372_10077581 | 3300013307 | Bacteria | 3753 |
| 369 | Ga0157372_10140502 | 3300013307 | Bacteria | 2782 |
| 370 | Ga0157372_10370304 | 3300013307 | Bacteria | 1669 |
| 371 | Ga0157372_10575252 | 3300013307 | Bacteria | 1313 |
| 372 | Ga0157375_10003836 | 3300013308 | Bacteria | 13038 |
| 373 | Ga0157375_10012374 | 3300013308 | Bacteria | 7566 |
| 374 | Ga0157375_10029286 | 3300013308 | Bacteria | 5176 |
| 375 | Ga0157375_10073195 | 3300013308 | Bacteria | 3445 |
| 376 | Ga0157375_10110281 | 3300013308 | Bacteria | 2849 |
| 377 | Ga0157375_10119885 | 3300013308 | Bacteria | 2739 |
| 378 | Ga0157375_10225306 | 3300013308 | Bacteria | 2034 |
| 379 | Ga0157375_10498754 | 3300013308 | Bacteria | 1382 |
| 380 | Ga0163163_10010941 | 3300014325 | Bacteria | 8198 |
| 381 | Ga0157380_10417405 | 3300014326 | Bacteria | 1279 |
| 382 | Ga0182008_10005557 | 3300014497 | Bacteria | 7157 |
| 383 | Ga0157377_10000022 | 3300014745 | Bacteria | 146702 |
| 384 | Ga0157377_10075116 | 3300014745 | Bacteria | 1962 |
| 385 | Ga0157379_10159004 | 3300014968 | Bacteria | 2039 |
| 386 | Ga0157379_10184475 | 3300014968 | Bacteria | 1885 |
| 387 | Ga0157379_10267566 | 3300014968 | Bacteria | 1554 |
| 388 | Ga0157376_10001097 | 3300014969 | Bacteria | 17761 |
| 389 | Ga0157376_10002980 | 3300014969 | Bacteria | 11610 |
| 390 | Ga0157376_10027826 | 3300014969 | Bacteria | 4487 |
| 391 | Ga0157376_10077529 | 3300014969 | Bacteria | 2843 |
| 392 | Ga0157376_10096398 | 3300014969 | Bacteria | 2574 |
| 393 | Ga0157376_10106684 | 3300014969 | Bacteria | 2458 |
| 394 | Ga0157376_10131874 | 3300014969 | Bacteria | 2231 |
| 395 | Ga0157376_10233591 | 3300014969 | Bacteria | 1709 |
| 396 | Ga0182007_10000472 | 3300015262 | Bacteria | 24301 |
| 397 | Ga0182007_10000653 | 3300015262 | Bacteria | 19886 |
| 398 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 399 | Ga0163161_10000092 | 3300017792 | Bacteria | 90636 |
| 400 | Ga0163161_10001617 | 3300017792 | Bacteria | 16589 |
| 401 | Ga0163161_10044124 | 3300017792 | Bacteria | 3211 |
| 402 | Ga0163161_10064992 | 3300017792 | Bacteria | 2662 |
| 403 | Ga0163161_10072407 | 3300017792 | Bacteria | 2523 |
| 404 | Ga0213872_10000008 | 3300021361 | Bacteria | 226283 |
| 405 | Ga0213872_10000058 | 3300021361 | Bacteria | 100531 |
| 406 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 407 | Ga0213872_10004816 | 3300021361 | Bacteria | 7046 |
| 408 | Ga0213872_10009068 | 3300021361 | Bacteria | 4784 |
| 409 | Ga0213872_10055839 | 3300021361 | Bacteria | 1789 |
| 410 | Ga0213872_10122518 | 3300021361 | Bacteria | 1149 |
| 411 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 412 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 413 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 414 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 415 | Ga0209672_100647 | 3300025228 | Bacteria | 17930 |
| 416 | Ga0209672_109733 | 3300025228 | Bacteria | 1337 |
| 417 | Ga0209147_101771 | 3300025229 | Bacteria | 6842 |
| 418 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 419 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 420 | Ga0209563_100052 | 3300025230 | Bacteria | 334307 |
| 421 | Ga0207427_100859 | 3300025231 | Bacteria | 13492 |
| 422 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 423 | Ga0209258_100177 | 3300025242 | Bacteria | 140714 |
| 424 | Ga0209258_100534 | 3300025242 | Bacteria | 36052 |
| 425 | Ga0207425_1000654 | 3300025245 | Bacteria | 19096 |
| 426 | Ga0209646_1000094 | 3300025246 | Bacteria | 182874 |
| 427 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 428 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 429 | Ga0209677_100015 | 3300025253 | Bacteria | 532137 |
| 430 | Ga0209677_100097 | 3300025253 | Bacteria | 97418 |
| 431 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 432 | Ga0209148_1002932 | 3300025254 | Bacteria | 5175 |
| 433 | Ga0209759_1000065 | 3300025256 | Bacteria | 187612 |
| 434 | Ga0209759_1000399 | 3300025256 | Bacteria | 53437 |
| 435 | Ga0209129_1000144 | 3300025258 | Bacteria | 115999 |
| 436 | Ga0209565_1000073 | 3300025263 | Bacteria | 164695 |
| 437 | Ga0209455_1000108 | 3300025272 | Bacteria | 193021 |
| 438 | Ga0209455_1030565 | 3300025272 | Bacteria | 916 |
| 439 | Ga0209673_1000127 | 3300025273 | Bacteria | 164695 |
| 440 | Ga0209673_1001619 | 3300025273 | Bacteria | 19616 |
| 441 | Ga0209673_1003739 | 3300025273 | Bacteria | 8682 |
| 442 | Ga0209673_1004525 | 3300025273 | Bacteria | 7401 |
| 443 | Ga0209673_1035444 | 3300025273 | Bacteria | 1493 |
| 444 | Ga0209130_1002188 | 3300025284 | Bacteria | 10305 |
| 445 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 446 | Ga0209675_1022498 | 3300025291 | Bacteria | 1654 |
| 447 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 448 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 449 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 450 | Ga0209758_1000434 | 3300025297 | Bacteria | 70561 |
| 451 | Ga0209050_1000197 | 3300025298 | Bacteria | 135303 |
| 452 | Ga0209050_1001620 | 3300025298 | Bacteria | 23116 |
| 453 | Ga0209050_1009006 | 3300025298 | Bacteria | 5199 |
| 454 | Ga0209256_1000249 | 3300025299 | Bacteria | 95279 |
| 455 | Ga0209256_1000826 | 3300025299 | Bacteria | 39205 |
| 456 | Ga0209256_1008621 | 3300025299 | Bacteria | 4677 |
| 457 | Ga0209051_1001020 | 3300025303 | Bacteria | 26785 |
| 458 | Ga0209051_1001309 | 3300025303 | Bacteria | 21862 |
| 459 | Ga0209051_1003300 | 3300025303 | Bacteria | 10694 |
| 460 | Ga0209051_1003649 | 3300025303 | Bacteria | 9969 |
| 461 | Ga0209051_1007414 | 3300025303 | Bacteria | 5995 |
| 462 | Ga0209051_1059008 | 3300025303 | Bacteria | 1219 |
| 463 | Ga0209257_1000967 | 3300025304 | Bacteria | 39365 |
| 464 | Ga0209257_1001007 | 3300025304 | Bacteria | 38067 |
| 465 | Ga0209257_1001138 | 3300025304 | Bacteria | 34042 |
| 466 | Ga0209257_1033542 | 3300025304 | Bacteria | 1613 |
| 467 | Ga0207656_10003873 | 3300025321 | Bacteria | 5188 |
| 468 | Ga0207655_1001248 | 3300025728 | Bacteria | 24268 |
| 469 | Ga0207682_10051234 | 3300025893 | Bacteria | 1709 |
| 470 | Ga0207682_10189216 | 3300025893 | Bacteria | 943 |
| 471 | Ga0207642_10005047 | 3300025899 | Bacteria | 4285 |
| 472 | Ga0207680_10005639 | 3300025903 | Bacteria | 5989 |
| 473 | Ga0207680_10115092 | 3300025903 | Bacteria | 1751 |
| 474 | Ga0207645_10001387 | 3300025907 | Bacteria | 19872 |
| 475 | Ga0207645_10019484 | 3300025907 | Bacteria | 4447 |
| 476 | Ga0207645_10029556 | 3300025907 | Bacteria | 3532 |
| 477 | Ga0207645_10523130 | 3300025907 | Bacteria | 804 |
| 478 | Ga0207643_10022995 | 3300025908 | Bacteria | 3436 |
| 479 | Ga0207684_10341424 | 3300025910 | Bacteria | 1290 |
| 480 | Ga0207654_10048107 | 3300025911 | Bacteria | 2439 |
| 481 | Ga0207654_10058662 | 3300025911 | Bacteria | 2242 |
| 482 | Ga0207654_10145045 | 3300025911 | Bacteria | 1518 |
| 483 | Ga0207654_10233033 | 3300025911 | Bacteria | 1227 |
| 484 | Ga0207695_10002390 | 3300025913 | Bacteria | 27827 |
| 485 | Ga0207695_10012192 | 3300025913 | Bacteria | 10329 |
| 486 | Ga0207695_10013685 | 3300025913 | Bacteria | 9657 |
| 487 | Ga0207695_10014882 | 3300025913 | Bacteria | 9183 |
| 488 | Ga0207695_10471322 | 3300025913 | Bacteria | 1138 |
| 489 | Ga0207695_10580776 | 3300025913 | Bacteria | 1002 |
| 490 | Ga0207695_10881394 | 3300025913 | Bacteria | 775 |
| 491 | Ga0207671_10000614 | 3300025914 | Bacteria | 47019 |
| 492 | Ga0207671_10002553 | 3300025914 | Bacteria | 19340 |
| 493 | Ga0207671_10015484 | 3300025914 | Bacteria | 5967 |
| 494 | Ga0207671_10041244 | 3300025914 | Bacteria | 3416 |
| 495 | Ga0207671_10047263 | 3300025914 | Bacteria | 3185 |
| 496 | Ga0207693_10224222 | 3300025915 | Bacteria | 1476 |
| 497 | Ga0207663_10105378 | 3300025916 | Bacteria | 1903 |
| 498 | Ga0207662_10009848 | 3300025918 | Bacteria | 5273 |
| 499 | Ga0207662_10318155 | 3300025918 | Bacteria | 1038 |
| 500 | Ga0207649_10110051 | 3300025920 | Bacteria | 1839 |
| 501 | Ga0207652_10057317 | 3300025921 | Bacteria | 3355 |
| 502 | Ga0207652_10261987 | 3300025921 | Bacteria | 1559 |
| 503 | Ga0207681_10026326 | 3300025923 | Bacteria | 3750 |
| 504 | Ga0207681_10091583 | 3300025923 | Bacteria | 2172 |
| 505 | Ga0207681_10204214 | 3300025923 | Bacteria | 1519 |
| 506 | Ga0207694_10000845 | 3300025924 | Bacteria | 27248 |
| 507 | Ga0207694_10006267 | 3300025924 | Bacteria | 9085 |
| 508 | Ga0207694_10015716 | 3300025924 | Bacteria | 5709 |
| 509 | Ga0207694_10063519 | 3300025924 | Bacteria | 2876 |
| 510 | Ga0207694_10100564 | 3300025924 | Bacteria | 2291 |
| 511 | Ga0207694_10356833 | 3300025924 | Bacteria | 1211 |
| 512 | Ga0207650_10001201 | 3300025925 | Bacteria | 19013 |
| 513 | Ga0207650_10378684 | 3300025925 | Bacteria | 1168 |
| 514 | Ga0207659_10004014 | 3300025926 | Bacteria | 8877 |
| 515 | Ga0207659_10051134 | 3300025926 | Bacteria | 2938 |
| 516 | Ga0207659_10177094 | 3300025926 | Bacteria | 1687 |
| 517 | Ga0207659_10484340 | 3300025926 | Bacteria | 1045 |
| 518 | Ga0207659_10769089 | 3300025926 | Bacteria | 827 |
| 519 | Ga0207687_10083859 | 3300025927 | Bacteria | 2308 |
| 520 | Ga0207687_10090142 | 3300025927 | Bacteria | 2234 |
| 521 | Ga0207687_10181807 | 3300025927 | Bacteria | 1630 |
| 522 | Ga0207687_10239966 | 3300025927 | Bacteria | 1436 |
| 523 | Ga0207644_10030413 | 3300025931 | Bacteria | 3755 |
| 524 | Ga0207644_10042292 | 3300025931 | Bacteria | 3228 |
| 525 | Ga0207644_10067092 | 3300025931 | Bacteria | 2614 |
| 526 | Ga0207644_10178257 | 3300025931 | Bacteria | 1664 |
| 527 | Ga0207644_10557922 | 3300025931 | Bacteria | 948 |
| 528 | Ga0207706_10023128 | 3300025933 | Bacteria | 5581 |
| 529 | Ga0207706_10023813 | 3300025933 | Bacteria | 5492 |
| 530 | Ga0207706_10045929 | 3300025933 | Bacteria | 3868 |
| 531 | Ga0207706_10164206 | 3300025933 | Bacteria | 1952 |
| 532 | Ga0207706_10177181 | 3300025933 | Bacteria | 1873 |
| 533 | Ga0207686_10003079 | 3300025934 | Bacteria | 8979 |
| 534 | Ga0207686_10007355 | 3300025934 | Bacteria | 5927 |
| 535 | Ga0207686_10052497 | 3300025934 | Bacteria | 2545 |
| 536 | Ga0207686_10213733 | 3300025934 | Bacteria | 1388 |
| 537 | Ga0207709_10000522 | 3300025935 | Bacteria | 33464 |
| 538 | Ga0207709_10021187 | 3300025935 | Bacteria | 3677 |
| 539 | Ga0207670_10132842 | 3300025936 | Bacteria | 1826 |
| 540 | Ga0207669_10063670 | 3300025937 | Bacteria | 2278 |
| 541 | Ga0207669_10538162 | 3300025937 | Bacteria | 940 |
| 542 | Ga0207704_10005184 | 3300025938 | Bacteria | 5999 |
| 543 | Ga0207704_10020136 | 3300025938 | Bacteria | 3522 |
| 544 | Ga0207704_10031520 | 3300025938 | Bacteria | 2988 |
| 545 | Ga0207704_10052210 | 3300025938 | Bacteria | 2477 |
| 546 | Ga0207704_10610881 | 3300025938 | Bacteria | 894 |
| 547 | Ga0207665_10108110 | 3300025939 | Bacteria | 1951 |
| 548 | Ga0207665_10151578 | 3300025939 | Bacteria | 1661 |
| 549 | Ga0207691_10010208 | 3300025940 | Bacteria | 9008 |
| 550 | Ga0207691_10010671 | 3300025940 | Bacteria | 8818 |
| 551 | Ga0207691_10017244 | 3300025940 | Bacteria | 6849 |
| 552 | Ga0207691_10022031 | 3300025940 | Bacteria | 6012 |
| 553 | Ga0207691_10027731 | 3300025940 | Bacteria | 5308 |
| 554 | Ga0207691_10030243 | 3300025940 | Bacteria | 5062 |
| 555 | Ga0207691_10232108 | 3300025940 | Bacteria | 1597 |
| 556 | Ga0207691_10392418 | 3300025940 | Bacteria | 1184 |
| 557 | Ga0207711_10009476 | 3300025941 | Bacteria | 8125 |
| 558 | Ga0207711_10102212 | 3300025941 | Bacteria | 2537 |
| 559 | Ga0207711_10517025 | 3300025941 | Bacteria | 1113 |
| 560 | Ga0207689_10031723 | 3300025942 | Bacteria | 4396 |
| 561 | Ga0207689_10091430 | 3300025942 | Bacteria | 2500 |
| 562 | Ga0207689_10119625 | 3300025942 | Bacteria | 2167 |
| 563 | Ga0207689_10140031 | 3300025942 | Bacteria | 1993 |
| 564 | Ga0207689_10331869 | 3300025942 | Bacteria | 1263 |
| 565 | Ga0207661_10031100 | 3300025944 | Bacteria | 4119 |
| 566 | Ga0207679_10127792 | 3300025945 | Bacteria | 2034 |
| 567 | Ga0207679_10195037 | 3300025945 | Bacteria | 1687 |
| 568 | Ga0207679_10210005 | 3300025945 | Bacteria | 1632 |
| 569 | Ga0207667_10000115 | 3300025949 | Bacteria | 128732 |
| 570 | Ga0207667_10003604 | 3300025949 | Bacteria | 19109 |
| 571 | Ga0207667_10021146 | 3300025949 | Bacteria | 7215 |
| 572 | Ga0207667_10054967 | 3300025949 | Bacteria | 4187 |
| 573 | Ga0207667_10857480 | 3300025949 | Bacteria | 902 |
| 574 | Ga0207651_10001269 | 3300025960 | Bacteria | 11360 |
| 575 | Ga0207651_10041063 | 3300025960 | Bacteria | 3067 |
| 576 | Ga0207651_10058883 | 3300025960 | Bacteria | 2657 |
| 577 | Ga0207651_10060444 | 3300025960 | Bacteria | 2630 |
| 578 | Ga0207651_10078209 | 3300025960 | Bacteria | 2372 |
| 579 | Ga0207651_10091726 | 3300025960 | Bacteria | 2225 |
| 580 | Ga0207651_10586467 | 3300025960 | Bacteria | 973 |
| 581 | Ga0207712_10001789 | 3300025961 | Bacteria | 14257 |
| 582 | Ga0207712_10028770 | 3300025961 | Bacteria | 3720 |
| 583 | Ga0207712_10112224 | 3300025961 | Bacteria | 2047 |
| 584 | Ga0207712_10112384 | 3300025961 | Bacteria | 2045 |
| 585 | Ga0207712_10127602 | 3300025961 | Bacteria | 1934 |
| 586 | Ga0207712_10142490 | 3300025961 | Bacteria | 1841 |
| 587 | Ga0207712_10201585 | 3300025961 | Bacteria | 1578 |
| 588 | Ga0207668_10129222 | 3300025972 | Bacteria | 1926 |
| 589 | Ga0207668_10357232 | 3300025972 | Bacteria | 1223 |
| 590 | Ga0207668_10501902 | 3300025972 | Bacteria | 1044 |
| 591 | Ga0207640_10004685 | 3300025981 | Bacteria | 7424 |
| 592 | Ga0207640_10031818 | 3300025981 | Bacteria | 3265 |
| 593 | Ga0207640_10099550 | 3300025981 | Bacteria | 2035 |
| 594 | Ga0207658_10001603 | 3300025986 | Bacteria | 17420 |
| 595 | Ga0207658_10036650 | 3300025986 | Bacteria | 3518 |
| 596 | Ga0207658_10080039 | 3300025986 | Bacteria | 2501 |
| 597 | Ga0207658_10112044 | 3300025986 | Bacteria | 2159 |
| 598 | Ga0207658_10113311 | 3300025986 | Bacteria | 2148 |
| 599 | Ga0207658_10337974 | 3300025986 | Bacteria | 1308 |
| 600 | Ga0207658_10765596 | 3300025986 | Bacteria | 875 |
| 601 | Ga0207677_10149004 | 3300026023 | Bacteria | 1802 |
| 602 | Ga0207677_10249226 | 3300026023 | Bacteria | 1441 |
| 603 | Ga0207703_10001821 | 3300026035 | Bacteria | 19010 |
| 604 | Ga0207703_10811799 | 3300026035 | Bacteria | 893 |
| 605 | Ga0207639_10000158 | 3300026041 | Bacteria | 51667 |
| 606 | Ga0207639_10012567 | 3300026041 | Bacteria | 5900 |
| 607 | Ga0207639_10100782 | 3300026041 | Bacteria | 2333 |
| 608 | Ga0207639_10287590 | 3300026041 | Bacteria | 1448 |
| 609 | Ga0207639_10565443 | 3300026041 | Bacteria | 1045 |
| 610 | Ga0207639_10698061 | 3300026041 | Bacteria | 941 |
| 611 | Ga0207678_10000915 | 3300026067 | Bacteria | 27002 |
| 612 | Ga0207678_10034941 | 3300026067 | Bacteria | 4377 |
| 613 | Ga0207678_10151115 | 3300026067 | Bacteria | 1983 |
| 614 | Ga0207678_10258477 | 3300026067 | Bacteria | 1492 |
| 615 | Ga0207678_10286989 | 3300026067 | Bacteria | 1413 |
| 616 | Ga0207708_10025243 | 3300026075 | Bacteria | 4494 |
| 617 | Ga0207702_10000610 | 3300026078 | Bacteria | 39489 |
| 618 | Ga0207702_10222666 | 3300026078 | Bacteria | 1759 |
| 619 | Ga0207641_10001726 | 3300026088 | Bacteria | 21102 |
| 620 | Ga0207641_10007613 | 3300026088 | Bacteria | 9004 |
| 621 | Ga0207641_10146922 | 3300026088 | Bacteria | 2132 |
| 622 | Ga0207641_10212881 | 3300026088 | Bacteria | 1788 |
| 623 | Ga0207641_10286134 | 3300026088 | Bacteria | 1552 |
| 624 | Ga0207641_10333729 | 3300026088 | Bacteria | 1441 |
| 625 | Ga0207641_10480680 | 3300026088 | Bacteria | 1204 |
| 626 | Ga0207648_10000032 | 3300026089 | Bacteria | 128009 |
| 627 | Ga0207648_10004276 | 3300026089 | Bacteria | 14725 |
| 628 | Ga0207648_10024643 | 3300026089 | Bacteria | 5367 |
| 629 | Ga0207648_10307960 | 3300026089 | Bacteria | 1421 |
| 630 | Ga0207676_10003149 | 3300026095 | Bacteria | 11781 |
| 631 | Ga0207676_10016394 | 3300026095 | Bacteria | 5364 |
| 632 | Ga0207676_10038548 | 3300026095 | Bacteria | 3649 |
| 633 | Ga0207676_10176613 | 3300026095 | Bacteria | 1866 |
| 634 | Ga0207676_10293877 | 3300026095 | Bacteria | 1481 |
| 635 | Ga0207676_10365056 | 3300026095 | Bacteria | 1339 |
| 636 | Ga0207676_10607769 | 3300026095 | Bacteria | 1051 |
| 637 | Ga0207674_10028246 | 3300026116 | Bacteria | 5923 |
| 638 | Ga0207674_10031491 | 3300026116 | Bacteria | 5572 |
| 639 | Ga0207674_10320474 | 3300026116 | Bacteria | 1499 |
| 640 | Ga0207674_10610662 | 3300026116 | Bacteria | 1053 |
| 641 | Ga0207675_100010693 | 3300026118 | Bacteria | 8597 |
| 642 | Ga0207675_100052369 | 3300026118 | Bacteria | 3809 |
| 643 | Ga0207675_100491553 | 3300026118 | Bacteria | 1221 |
| 644 | Ga0207683_10008536 | 3300026121 | Bacteria | 8766 |
| 645 | Ga0207683_10010783 | 3300026121 | Bacteria | 7793 |
| 646 | Ga0207683_10025950 | 3300026121 | Bacteria | 5057 |
| 647 | Ga0207683_10046957 | 3300026121 | Bacteria | 3781 |
| 648 | Ga0207683_10158482 | 3300026121 | Bacteria | 2045 |
| 649 | Ga0207683_10257335 | 3300026121 | Bacteria | 1594 |
| 650 | Ga0207683_10304958 | 3300026121 | Bacteria | 1457 |
| 651 | Ga0207683_10334022 | 3300026121 | Bacteria | 1389 |
| 652 | Ga0207683_10346703 | 3300026121 | Bacteria | 1363 |
| 653 | Ga0207683_10459027 | 3300026121 | Bacteria | 1175 |
| 654 | Ga0207698_10004168 | 3300026142 | Bacteria | 8790 |
| 655 | Ga0207698_10005832 | 3300026142 | Bacteria | 7649 |
| 656 | Ga0207698_11045285 | 3300026142 | Bacteria | 828 |
| 657 | Ga0209973_1000882 | 3300027252 | Bacteria | 2433 |
| 658 | Ga0209389_1013653 | 3300027296 | Bacteria | 7387 |
| 659 | Ga0209371_1013896 | 3300027312 | Bacteria | 2234 |
| 660 | Ga0209970_1000515 | 3300027614 | Bacteria | 6660 |
| 661 | Ga0209983_1006568 | 3300027665 | Bacteria | 2386 |
| 662 | Ga0209983_1063511 | 3300027665 | Bacteria | 818 |
| 663 | Ga0209282_1000109 | 3300027666 | Bacteria | 53813 |
| 664 | Ga0209813_10024848 | 3300027866 | Bacteria | 1717 |
| 665 | Ga0209974_10016800 | 3300027876 | Bacteria | 2429 |
| 666 | Ga0209974_10026849 | 3300027876 | Bacteria | 1904 |
| 667 | Ga0207428_10059781 | 3300027907 | Bacteria | 3021 |
| 668 | Ga0207428_10164516 | 3300027907 | Bacteria | 1683 |
| 669 | Ga0207428_10487575 | 3300027907 | Bacteria | 896 |
| 670 | Ga0268266_10090792 | 3300028379 | Bacteria | 2677 |
| 671 | Ga0268266_10111418 | 3300028379 | Bacteria | 2425 |
| 672 | Ga0268266_10125043 | 3300028379 | Bacteria | 2293 |
| 673 | Ga0268266_10152949 | 3300028379 | Bacteria | 2081 |
| 674 | Ga0268266_10259614 | 3300028379 | Bacteria | 1610 |
| 675 | Ga0268265_10022791 | 3300028380 | Bacteria | 4405 |
| 676 | Ga0268265_10026796 | 3300028380 | Bacteria | 4104 |
| 677 | Ga0268265_10048187 | 3300028380 | Bacteria | 3197 |
| 678 | Ga0268265_10052565 | 3300028380 | Bacteria | 3082 |
| 679 | Ga0268265_10073151 | 3300028380 | Bacteria | 2676 |
| 680 | Ga0268265_10434984 | 3300028380 | Bacteria | 1221 |
| 681 | Ga0268264_10007099 | 3300028381 | Bacteria | 9387 |
| 682 | Ga0268264_10019582 | 3300028381 | Bacteria | 5528 |
| 683 | Ga0268264_10175698 | 3300028381 | Bacteria | 1941 |
| 684 | Ga0268264_10838651 | 3300028381 | Bacteria | 920 |
| 685 | Ga0268264_10902713 | 3300028381 | Bacteria | 887 |
| 686 | Ga0265334_10018680 | 3300028573 | Bacteria | 2859 |
| 687 | Ga0307517_10008692 | 3300028786 | Bacteria | 14532 |
| 688 | Ga0307517_10123385 | 3300028786 | Bacteria | 1903 |
| 689 | Ga0307517_10161501 | 3300028786 | Bacteria | 1502 |
| 690 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 691 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 692 | Ga0307515_10000267 | 3300028794 | Bacteria | 128554 |
| 693 | Ga0307515_10000842 | 3300028794 | Bacteria | 70481 |
| 694 | Ga0307515_10001088 | 3300028794 | Bacteria | 62228 |
| 695 | Ga0307515_10001640 | 3300028794 | Bacteria | 49762 |
| 696 | Ga0307515_10020605 | 3300028794 | Bacteria | 11749 |
| 697 | Ga0307515_10031977 | 3300028794 | Bacteria | 8740 |
| 698 | Ga0307515_10054917 | 3300028794 | Bacteria | 5834 |
| 699 | Ga0307515_10066935 | 3300028794 | Bacteria | 4965 |
| 700 | Ga0307515_10111538 | 3300028794 | Bacteria | 3190 |
| 701 | Ga0307515_10131211 | 3300028794 | Bacteria | 2758 |
| 702 | Ga0307515_10157014 | 3300028794 | Bacteria | 2342 |
| 703 | Ga0268256_1015399 | 3300030500 | Bacteria | 2234 |
| 704 | Ga0307512_10035373 | 3300030522 | Bacteria | 4258 |
| 705 | Ga0307512_10045448 | 3300030522 | Bacteria | 3596 |
| 706 | Ga0316181_1119047 | 3300030744 | Bacteria | 1771 |
| 707 | Ga0316182_1368921 | 3300030745 | Bacteria | 6780 |
| 708 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 709 | Ga0265332_10000525 | 3300031238 | Bacteria | 26033 |
| 710 | Ga0265340_10006590 | 3300031247 | Bacteria | 6378 |
| 711 | Ga0265331_10001109 | 3300031250 | Bacteria | 20715 |
| 712 | Ga0265327_10000120 | 3300031251 | Bacteria | 171108 |
| 713 | Ga0265327_10006291 | 3300031251 | Bacteria | 9563 |
| 714 | Ga0265316_10000129 | 3300031344 | Bacteria | 82815 |
| 715 | Ga0307513_10003449 | 3300031456 | Bacteria | 21402 |
| 716 | Ga0307513_10026272 | 3300031456 | Bacteria | 6719 |
| 717 | Ga0307513_10040446 | 3300031456 | Bacteria | 5155 |
| 718 | Ga0307513_10069344 | 3300031456 | Bacteria | 3690 |
| 719 | Ga0307509_10006861 | 3300031507 | Bacteria | 15150 |
| 720 | Ga0307509_10010424 | 3300031507 | Bacteria | 11393 |
| 721 | Ga0307509_10019730 | 3300031507 | Bacteria | 7676 |
| 722 | Ga0307509_10111462 | 3300031507 | Bacteria | 2739 |
| 723 | Ga0307509_10111577 | 3300031507 | Bacteria | 2737 |
| 724 | Ga0307408_100000193 | 3300031548 | Bacteria | 65882 |
| 725 | Ga0307408_100087592 | 3300031548 | Bacteria | 2343 |
| 726 | Ga0307408_100308956 | 3300031548 | Bacteria | 1327 |
| 727 | Ga0307408_100508123 | 3300031548 | Bacteria | 1056 |
| 728 | Ga0307508_10000097 | 3300031616 | Bacteria | 103662 |
| 729 | Ga0307508_10002774 | 3300031616 | Bacteria | 18247 |
| 730 | Ga0307508_10049288 | 3300031616 | Bacteria | 3750 |
| 731 | Ga0307508_10088971 | 3300031616 | Bacteria | 2673 |
| 732 | Ga0307514_10000806 | 3300031649 | Bacteria | 51095 |
| 733 | Ga0307514_10001372 | 3300031649 | Bacteria | 30729 |
| 734 | Ga0307514_10002956 | 3300031649 | Bacteria | 16887 |
| 735 | Ga0307514_10197345 | 3300031649 | Bacteria | 1271 |
| 736 | Ga0265314_10000089 | 3300031711 | Bacteria | 138050 |
| 737 | Ga0265314_10089035 | 3300031711 | Bacteria | 2014 |
| 738 | Ga0265342_10134325 | 3300031712 | Bacteria | 1384 |
| 739 | Ga0265342_10208227 | 3300031712 | Bacteria | 1059 |
| 740 | Ga0316576_10001183 | 3300031727 | Bacteria | 13724 |
| 741 | Ga0316576_10070664 | 3300031727 | Bacteria | 2575 |
| 742 | Ga0316576_10450687 | 3300031727 | Bacteria | 950 |
| 743 | Ga0316578_10029623 | 3300031728 | Bacteria | 3107 |
| 744 | Ga0307516_10002245 | 3300031730 | Bacteria | 26096 |
| 745 | Ga0307516_10006152 | 3300031730 | Bacteria | 14142 |
| 746 | Ga0307516_10052707 | 3300031730 | Bacteria | 3981 |
| 747 | Ga0307516_10141051 | 3300031730 | Bacteria | 2180 |
| 748 | Ga0307516_10195284 | 3300031730 | Bacteria | 1747 |
| 749 | Ga0307516_10273936 | 3300031730 | Bacteria | 1372 |
| 750 | Ga0307405_10049105 | 3300031731 | Bacteria | 2606 |
| 751 | Ga0307405_10137989 | 3300031731 | Bacteria | 1696 |
| 752 | Ga0307405_10195011 | 3300031731 | Bacteria | 1466 |
| 753 | Ga0307405_10401191 | 3300031731 | Bacteria | 1073 |
| 754 | Ga0316577_10003998 | 3300031733 | Bacteria | 7546 |
| 755 | Ga0307413_10468300 | 3300031824 | Bacteria | 1004 |
| 756 | Ga0307518_10190276 | 3300031838 | Bacteria | 1376 |
| 757 | Ga0307410_10169160 | 3300031852 | Bacteria | 1645 |
| 758 | Ga0307410_10266690 | 3300031852 | Bacteria | 1338 |
| 759 | Ga0307407_10025101 | 3300031903 | Bacteria | 3137 |
| 760 | Ga0307412_10224187 | 3300031911 | Bacteria | 1443 |
| 761 | Ga0307412_10226921 | 3300031911 | Bacteria | 1435 |
| 762 | Ga0307412_10459704 | 3300031911 | Bacteria | 1051 |
| 763 | Ga0307409_100276739 | 3300031995 | Bacteria | 1549 |
| 764 | Ga0307416_100010663 | 3300032002 | Bacteria | 6086 |
| 765 | Ga0307416_100220902 | 3300032002 | Bacteria | 1817 |
| 766 | Ga0307416_100230428 | 3300032002 | Bacteria | 1785 |
| 767 | Ga0307416_100263350 | 3300032002 | Bacteria | 1687 |
| 768 | Ga0307416_100791153 | 3300032002 | Bacteria | 1044 |
| 769 | Ga0307414_10385744 | 3300032004 | Bacteria | 1213 |
| 770 | Ga0307414_10873422 | 3300032004 | Bacteria | 823 |
| 771 | Ga0307411_10010818 | 3300032005 | Bacteria | 4887 |
| 772 | Ga0307411_10124552 | 3300032005 | Bacteria | 1871 |
| 773 | Ga0307411_10401201 | 3300032005 | Bacteria | 1134 |
| 774 | Ga0307415_100001705 | 3300032126 | Bacteria | 10681 |
| 775 | Ga0316585_10011773 | 3300032137 | Bacteria | 2583 |
| 776 | Ga0307507_10063271 | 3300033179 | Bacteria | 3427 |
| 777 | Ga0307510_10000311 | 3300033180 | Bacteria | 44908 |
| 778 | Ga0316596_1007375 | 3300033541 | Bacteria | 2598 |
| 779 | Ga0373944_0014357 | 3300035089 | Bacteria | 2210 |
| 780 | Ga0373932_0136663 | 3300035112 | Bacteria | 830 |
| 781 | Ga0373946_0142311 | 3300035171 | Bacteria | 1113 |
| 782 | Ga0373942_0012519 | 3300035207 | Bacteria | 2028 |
| 783 | Ga0373942_0022205 | 3300035207 | Bacteria | 1608 |
| 784 | Ga0316574_0008856 | 3300035398 | Bacteria | 5611 |
| 785 | Ga0373931_0002407 | 3300035691 | Bacteria | 8277 |
| 786 | Ga0373931_0004639 | 3300035691 | Bacteria | 6284 |
| 787 | Ga0373931_0006945 | 3300035691 | Bacteria | 5326 |
| 788 | Ga0373927_0318303 | 3300035695 | Bacteria | 1024 |
| 789 | Ga0373937_0199334 | 3300036401 | Bacteria | 1882 |
| 790 | Ga0373937_0280495 | 3300036401 | Bacteria | 1573 |
| 791 | Ga0316582_0075295 | 3300036647 | Bacteria | 2193 |
| 792 | Ga0373925_0009207 | 3300037068 | Bacteria | 7187 |
| 793 | Ga0395899_0003079 | 3300037312 | Bacteria | 13283 |
| 794 | Ga0395900_0000054 | 3300037418 | Bacteria | 220487 |
| 795 | Ga0395900_0013211 | 3300037418 | Bacteria | 8441 |
| 796 | Ga0395900_0113192 | 3300037418 | Bacteria | 2785 |
| 797 | Ga0395900_0149640 | 3300037418 | Bacteria | 2385 |
| 798 | Ga0395900_0262176 | 3300037418 | Bacteria | 1725 |
| 799 | Ga0395898_0000798 | 3300037466 | Bacteria | 53358 |
| 800 | Ga0395898_0098190 | 3300037466 | Bacteria | 2812 |
| 801 | Ga0395905_0000148 | 3300037471 | Bacteria | 116301 |
| 802 | Ga0395905_0002549 | 3300037471 | Bacteria | 20091 |
| 803 | Ga0395905_0003187 | 3300037471 | Bacteria | 17661 |
| 804 | Ga0395905_0005238 | 3300037471 | Bacteria | 13272 |
| 805 | Ga0395905_0018699 | 3300037471 | Bacteria | 6572 |
| 806 | Ga0395905_0019557 | 3300037471 | Bacteria | 6418 |
| 807 | Ga0395905_0087754 | 3300037471 | Bacteria | 2916 |
| 808 | Ga0395905_0116877 | 3300037471 | Bacteria | 2506 |
| 809 | Ga0395905_0162368 | 3300037471 | Bacteria | 2099 |
| 810 | Ga0395905_0233286 | 3300037471 | Bacteria | 1720 |
| 811 | Ga0395905_0264387 | 3300037471 | Bacteria | 1606 |
| 812 | Ga0395905_0317449 | 3300037471 | Bacteria | 1447 |
| 813 | Ga0395905_0393397 | 3300037471 | Bacteria | 1280 |
| 814 | Ga0395901_0001849 | 3300038443 | Bacteria | 21886 |
| 815 | Ga0395901_0012708 | 3300038443 | Bacteria | 8540 |
| 816 | Ga0395901_0146215 | 3300038443 | Bacteria | 2484 |
| 817 | Ga0436361_0068556 | 3300039447 | Bacteria | 100895 |
| 818 | Ga0436361_0071320 | 3300039447 | Bacteria | 6752 |
| 819 | Ga0436361_0084014 | 3300039447 | Bacteria | 1321 |
| 820 | Ga0436361_0332176 | 3300039447 | Bacteria | 56332 |
| 821 | Ga0436361_0429906 | 3300039447 | Bacteria | 27265 |
| 822 | Ga0436361_0562763 | 3300039447 | Bacteria | 6798 |
| 823 | Ga0436361_0704832 | 3300039447 | Bacteria | 27869 |
| 824 | Ga0436361_0900991 | 3300039447 | Bacteria | 50083 |
| 825 | Ga0436361_1145133 | 3300039447 | Bacteria | 2723 |
| 826 | Ga0439466_0001803 | 3300041411 | Bacteria | 8374 |
| 827 | Ga0439466_0084144 | 3300041411 | Bacteria | 1001 |
| 828 | Ga0439465_0003008 | 3300041413 | Bacteria | 5510 |
| 829 | Ga0451791_0184948 | 3300041451 | Bacteria | 1496 |
| 830 | Ga0451791_0611886 | 3300041451 | Bacteria | 1252 |
| 831 | Ga0451797_0922191 | 3300041453 | Bacteria | 2632 |
| 832 | Ga0451802_0254447 | 3300041460 | Bacteria | 1407 |
| 833 | Ga0451804_0366282 | 3300041463 | Bacteria | 1982 |
| 834 | Ga0451807_0264544 | 3300041486 | Bacteria | 3369 |
| 835 | Ga0451807_1301096 | 3300041486 | Bacteria | 1234 |
| 836 | Ga0451837_0356103 | 3300041494 | Bacteria | 1062 |
| 837 | Ga0439431_0005725 | 3300041997 | Bacteria | 2742 |
| 838 | Ga0439433_0000991 | 3300041999 | Bacteria | 5727 |
| 839 | Ga0439442_003824 | 3300042002 | Bacteria | 2981 |
| 840 | Ga0439432_002602 | 3300042006 | Bacteria | 6790 |
| 841 | Ga0439449_0002379 | 3300042007 | Bacteria | 7363 |
| 842 | Ga0439449_0031483 | 3300042007 | Bacteria | 1977 |
| 843 | Ga0439452_000611 | 3300042010 | Bacteria | 18092 |
| 844 | Ga0450898_013674 | 3300042134 | Bacteria | 1356 |
| 845 | Ga0450906_013768 | 3300042145 | Bacteria | 1486 |
| 846 | Ga0450910_008596 | 3300042147 | Bacteria | 1438 |
| 847 | Ga0439446_0089340 | 3300042156 | Bacteria | 963 |
| 848 | Ga0450908_002473 | 3300042184 | Bacteria | 3614 |
| 849 | Ga0450918_000264 | 3300042531 | Bacteria | 11804 |
| 850 | Ga0451577_0031506 | 3300042876 | Bacteria | 4783 |
| 851 | Ga0451577_0262733 | 3300042876 | Bacteria | 1563 |
| 852 | Ga0466969_0000054 | 3300044656 | Bacteria | 59867 |
| 853 | Ga0466969_0006079 | 3300044656 | Bacteria | 6422 |
| 854 | Ga0466969_0073994 | 3300044656 | Bacteria | 1634 |
| 855 | Ga0466969_0139314 | 3300044656 | Bacteria | 1121 |
| 856 | Ga0466972_0001650 | 3300044658 | Bacteria | 10913 |
| 857 | Ga0466972_0018196 | 3300044658 | Bacteria | 3515 |
| 858 | Ga0453683_0001307 | 3300044673 | Bacteria | 21969 |
| 859 | Ga0466965_0001429 | 3300044683 | Bacteria | 9643 |
| 860 | Ga0466965_0040577 | 3300044683 | Bacteria | 2291 |
| 861 | Ga0466966_0003229 | 3300044684 | Bacteria | 10743 |
| 862 | Ga0466966_0010728 | 3300044684 | Bacteria | 6091 |
| 863 | Ga0466961_0023517 | 3300044693 | Bacteria | 3964 |
| 864 | Ga0466961_0039938 | 3300044693 | Bacteria | 3007 |
| 865 | Ga0466961_0054954 | 3300044693 | Bacteria | 2539 |
| 866 | Ga0466964_0006188 | 3300044706 | Bacteria | 4459 |
| 867 | Ga0466964_0008063 | 3300044706 | Bacteria | 3949 |
| 868 | Ga0453684_0311720 | 3300044712 | Bacteria | 1785 |
| 869 | Ga0466971_0016848 | 3300044719 | Bacteria | 3228 |
| 870 | Ga0466971_0020521 | 3300044719 | Bacteria | 2937 |
| 871 | Ga0466970_0008282 | 3300044765 | Bacteria | 5228 |
| 872 | Ga0466957_0009701 | 3300044842 | Bacteria | 5497 |
| 873 | Ga0466957_0030253 | 3300044842 | Bacteria | 3232 |
| 874 | Ga0466959_0003173 | 3300045049 | Bacteria | 10670 |
| 875 | Ga0466959_0010587 | 3300045049 | Bacteria | 6601 |
| 876 | Ga0466959_0268752 | 3300045049 | Bacteria | 1172 |
| 877 | Ga0466958_0056227 | 3300045836 | Bacteria | 2389 |
| 878 | Ga0495592_0000113 | 3300046454 | Bacteria | 71049 |
| 879 | Ga0495580_0115156 | 3300046472 | Bacteria | 1867 |
| 880 | Ga0495582_0079149 | 3300046473 | Bacteria | 1824 |
| 881 | Ga0495639_0022639 | 3300046475 | Bacteria | 2757 |
| 882 | Ga0495664_0209872 | 3300046477 | Bacteria | 1179 |
| 883 | Ga0495664_0280545 | 3300046477 | Bacteria | 1007 |
| 884 | Ga0495584_0194965 | 3300046491 | Bacteria | 1030 |
| 885 | Ga0495585_0014379 | 3300046492 | Bacteria | 4612 |
| 886 | Ga0495610_0045202 | 3300046512 | Bacteria | 2180 |
| 887 | Ga0495630_0330850 | 3300046517 | Bacteria | 1165 |
| 888 | Ga0495630_0656223 | 3300046517 | Bacteria | 803 |
| 889 | Ga0495632_0039270 | 3300046519 | Bacteria | 2390 |
| 890 | Ga0495632_0051289 | 3300046519 | Bacteria | 2031 |
| 891 | Ga0495632_0174863 | 3300046519 | Bacteria | 985 |
| 892 | Ga0495643_0078342 | 3300046522 | Bacteria | 1725 |
| 893 | Ga0495643_0110307 | 3300046522 | Bacteria | 1399 |
| 894 | Ga0495642_0128971 | 3300046528 | Bacteria | 1088 |
| 895 | Ga0495654_0009292 | 3300046530 | Bacteria | 5390 |
| 896 | Ga0495665_0176435 | 3300046531 | Bacteria | 1111 |
| 897 | Ga0495586_0122829 | 3300046535 | Bacteria | 1451 |
| 898 | Ga0495598_0009545 | 3300046537 | Bacteria | 2299 |
| 899 | Ga0495598_0037659 | 3300046537 | Bacteria | 1396 |
| 900 | Ga0495621_0005434 | 3300046539 | Bacteria | 3664 |
| 901 | Ga0495621_0029195 | 3300046539 | Bacteria | 1879 |
| 902 | Ga0495597_0000063 | 3300046542 | Bacteria | 91471 |
| 903 | Ga0495645_0322224 | 3300046543 | Bacteria | 1003 |
| 904 | Ga0495622_0014795 | 3300046557 | Bacteria | 3626 |
| 905 | Ga0495667_0311499 | 3300046559 | Bacteria | 997 |
| 906 | Ga0495656_0001008 | 3300046615 | Bacteria | 9110 |
| 907 | Ga0495656_0053670 | 3300046615 | Bacteria | 1732 |
| 908 | Ga0495656_0125340 | 3300046615 | Bacteria | 1217 |
| 909 | Ga0495625_0000396 | 3300046660 | Bacteria | 66627 |
| 910 | Ga0495625_0015173 | 3300046660 | Bacteria | 6114 |
| 911 | Ga0495625_0279030 | 3300046660 | Bacteria | 1076 |
| 912 | Ga0495657_0200118 | 3300046675 | Bacteria | 1218 |
| 913 | Ga0495646_0057785 | 3300046680 | Bacteria | 2320 |
| 914 | Ga0495613_0376735 | 3300046689 | Bacteria | 971 |
| 915 | Ga0495624_0034278 | 3300046690 | Bacteria | 3284 |
| 916 | Ga0495649_0003001 | 3300046694 | Bacteria | 11583 |
| 917 | Ga0495589_0002663 | 3300046794 | Bacteria | 9873 |
| 918 | Ga0495660_0028467 | 3300046810 | Bacteria | 3157 |
| 919 | Ga0495604_0142817 | 3300047317 | Bacteria | 1709 |
| 920 | Ga0495604_0375593 | 3300047317 | Bacteria | 940 |
| 921 | Ga0495676_0290931 | 3300047321 | Bacteria | 1104 |
| 922 | Ga0495687_000596 | 3300047443 | Bacteria | 42162 |
| 923 | Ga0495684_0387765 | 3300047471 | Bacteria | 984 |
| 924 | Ga0495686_0061086 | 3300047472 | Bacteria | 2341 |
| 925 | Ga0495593_0026312 | 3300047673 | Bacteria | 3213 |
| 926 | Ga0495602_0151146 | 3300048088 | Bacteria | 1825 |
| 927 | Ga0496100_0002149 | 3300048903 | Bacteria | 9914 |
| 928 | Ga0496103_0020828 | 3300048906 | Bacteria | 3943 |
| 929 | Ga0496104_0000038 | 3300048907 | Bacteria | 178150 |
| 930 | Ga0496104_0067278 | 3300048907 | Bacteria | 3403 |
| 931 | Ga0496105_0000038 | 3300048908 | Bacteria | 118666 |
| 932 | Ga0496105_0012226 | 3300048908 | Bacteria | 6796 |
| 933 | Ga0496106_0388903 | 3300048909 | Bacteria | 1121 |
| 934 | Ga0496108_0408956 | 3300048911 | Bacteria | 1185 |
| 935 | Ga0496108_0437113 | 3300048911 | Bacteria | 1143 |
| 936 | Ga0496109_0512657 | 3300048912 | Bacteria | 1132 |
| 937 | Ga0496110_0021889 | 3300048913 | Bacteria | 5421 |
| 938 | Ga0496111_0083344 | 3300048914 | Bacteria | 2336 |
| 939 | Ga0496111_0148645 | 3300048914 | Bacteria | 1737 |
| 940 | Ga0496112_0109579 | 3300048915 | Bacteria | 2731 |
| 941 | Ga0496113_0035188 | 3300048916 | Bacteria | 3662 |
| 942 | Ga0496113_0213444 | 3300048916 | Bacteria | 1537 |
| 943 | Ga0496115_0442919 | 3300048918 | Bacteria | 1050 |
| 944 | Ga0496116_0016280 | 3300048919 | Bacteria | 5826 |
| 945 | Ga0496117_0016264 | 3300048920 | Bacteria | 6286 |
| 946 | Ga0496117_0036893 | 3300048920 | Bacteria | 3650 |
| 947 | Ga0496117_0063606 | 3300048920 | Bacteria | 2521 |
| 948 | Ga0496118_0000520 | 3300048921 | Bacteria | 63206 |
| 949 | Ga0496118_0006635 | 3300048921 | Bacteria | 12635 |
| 950 | Ga0496118_0009301 | 3300048921 | Bacteria | 9959 |
| 951 | Ga0496121_0005276 | 3300048924 | Bacteria | 16661 |
| 952 | Ga0496122_0002256 | 3300048925 | Bacteria | 27891 |
| 953 | Ga0496123_0001158 | 3300048926 | Bacteria | 39125 |
| 954 | Ga0496123_0002984 | 3300048926 | Bacteria | 19647 |
| 955 | Ga0496124_0000125 | 3300048927 | Bacteria | 159942 |
| 956 | Ga0496124_0183348 | 3300048927 | Bacteria | 1609 |
| 957 | Ga0496124_0495944 | 3300048927 | Bacteria | 820 |
| 958 | Ga0496125_0372995 | 3300048928 | Bacteria | 844 |
| 959 | Ga0495682_0091568 | 3300049460 | Bacteria | 1092 |
| 960 | Ga0501032_0005261 | 3300049569 | Bacteria | 9626 |
| 961 | Ga0501032_0354473 | 3300049569 | Bacteria | 945 |
| 962 | Ga0501033_0000720 | 3300049570 | Bacteria | 30337 |
| 963 | Ga0501034_0004188 | 3300049571 | Bacteria | 16100 |
| 964 | Ga0501034_0007701 | 3300049571 | Bacteria | 11459 |
| 965 | Ga0501034_0063996 | 3300049571 | Bacteria | 3691 |
| 966 | Ga0501036_0007930 | 3300049572 | Bacteria | 8687 |
| 967 | Ga0501037_0033753 | 3300049573 | Bacteria | 3778 |
| 968 | Ga0501037_0051682 | 3300049573 | Bacteria | 3006 |
| 969 | Ga0501037_0103840 | 3300049573 | Bacteria | 2049 |
| 970 | Ga0501038_0004437 | 3300049574 | Bacteria | 13039 |
| 971 | Ga0501038_0062118 | 3300049574 | Bacteria | 3192 |
| 972 | Ga0501038_0074322 | 3300049574 | Bacteria | 2876 |
| 973 | Ga0501038_0428594 | 3300049574 | Bacteria | 1019 |
| 974 | Ga0501039_0002430 | 3300049575 | Bacteria | 13866 |
| 975 | Ga0501043_0028941 | 3300049579 | Bacteria | 4349 |
| 976 | Ga0501043_0061653 | 3300049579 | Bacteria | 2945 |
| 977 | Ga0501043_0085234 | 3300049579 | Bacteria | 2482 |
| 978 | Ga0501046_0002962 | 3300049580 | Bacteria | 15706 |
| 979 | Ga0501046_0013611 | 3300049580 | Bacteria | 6880 |
| 980 | Ga0501048_0191161 | 3300049582 | Bacteria | 1450 |
| 981 | Ga0501067_0125501 | 3300049583 | Bacteria | 1428 |
| 982 | Ga0501067_0147991 | 3300049583 | Bacteria | 1308 |
| 983 | Ga0501068_0064836 | 3300049584 | Bacteria | 2223 |
| 984 | Ga0501070_0033046 | 3300049586 | Bacteria | 4327 |
| 985 | Ga0501071_0046458 | 3300049587 | Bacteria | 3118 |
| 986 | Ga0501073_0003125 | 3300049589 | Bacteria | 12413 |
| 987 | Ga0501073_0225466 | 3300049589 | Bacteria | 1295 |
| 988 | Ga0501074_0086312 | 3300049590 | Bacteria | 2248 |
| 989 | Ga0501074_0130703 | 3300049590 | Bacteria | 1796 |
| 990 | Ga0501079_0102597 | 3300049741 | Bacteria | 2218 |
| 991 | Ga0501079_0635280 | 3300049741 | Bacteria | 840 |
| 992 | Ga0501080_0002682 | 3300049742 | Bacteria | 15585 |
| 993 | Ga0501080_0081487 | 3300049742 | Bacteria | 3006 |
| 994 | Ga0501080_0123913 | 3300049742 | Bacteria | 2394 |
| 995 | Ga0501080_0191599 | 3300049742 | Bacteria | 1879 |
| 996 | Ga0501081_0150755 | 3300049743 | Bacteria | 1670 |
| 997 | Ga0501083_0023802 | 3300049744 | Bacteria | 4247 |
| 998 | Ga0501262_012938 | 3300049759 | Bacteria | 1071 |
| 999 | Ga0501265_000359 | 3300049762 | Bacteria | 4739 |
| 1000 | Ga0501035_0021681 | 3300049822 | Bacteria | 5907 |
| 1001 | Ga0501035_0071298 | 3300049822 | Bacteria | 3077 |
| 1002 | Ga0501035_0104116 | 3300049822 | Bacteria | 2489 |
| 1003 | Ga0501044_0004235 | 3300049823 | Bacteria | 16109 |
| 1004 | Ga0501044_0016545 | 3300049823 | Bacteria | 7916 |
| 1005 | Ga0501044_0053233 | 3300049823 | Bacteria | 4165 |
| 1006 | Ga0501044_0428964 | 3300049823 | Bacteria | 1231 |
| 1007 | Ga0501044_0569944 | 3300049823 | Bacteria | 1027 |
| 1008 | Ga0501045_0208014 | 3300049824 | Bacteria | 1457 |
| 1009 | nmdc:mga03683_115249_c1 | 3300050489 | Bacteria | 1191 |
| 1010 | nmdc:mga03683_1184_c1 | 3300050489 | Bacteria | 7682 |
| 1011 | nmdc:mga03683_207506_c1 | 3300050489 | Bacteria | 901 |
| 1012 | nmdc:mga03683_29407_c1 | 3300050489 | Bacteria | 2191 |
| 1013 | nmdc:mga03n38_121729_c1 | 3300050490 | Bacteria | 1283 |
| 1014 | nmdc:mga00v17_113669_c1 | 3300050491 | Bacteria | 1719 |
| 1015 | nmdc:mga0yw44_1882_c1 | 3300050492 | Bacteria | 8638 |
| 1016 | nmdc:mga0k408_107290_c1 | 3300050493 | Bacteria | 1650 |
| 1017 | nmdc:mga0k408_113841_c1 | 3300050493 | Bacteria | 1600 |
| 1018 | nmdc:mga0k408_124761_c1 | 3300050493 | Bacteria | 1527 |
| 1019 | nmdc:mga0k408_19860_c1 | 3300050493 | Bacteria | 3760 |
| 1020 | nmdc:mga0k408_21606_c1 | 3300050493 | Bacteria | 3617 |
| 1021 | nmdc:mga0k408_320005_c1 | 3300050493 | Bacteria | 926 |
| 1022 | nmdc:mga0k408_47482_c1 | 3300050493 | Bacteria | 2482 |
| 1023 | nmdc:mga0k408_76211_c1 | 3300050493 | Bacteria | 1960 |
| 1024 | nmdc:mga0k408_78197_c1 | 3300050493 | Bacteria | 1935 |
| 1025 | nmdc:mga06z11_32826_c1 | 3300050494 | Bacteria | 2534 |
| 1026 | nmdc:mga06z11_335122_c1 | 3300050494 | Bacteria | 904 |
| 1027 | nmdc:mga04h51_18261_c1 | 3300050495 | Bacteria | 2063 |
| 1028 | nmdc:mga07m45_178027_c1 | 3300050496 | Bacteria | 1237 |
| 1029 | nmdc:mga07m45_19965_c1 | 3300050496 | Bacteria | 3636 |
| 1030 | nmdc:mga07m45_2487_c1 | 3300050496 | Bacteria | 8640 |
| 1031 | nmdc:mga07m45_43207_c1 | 3300050496 | Bacteria | 2527 |
| 1032 | nmdc:mga07m45_7058_c2 | 3300050496 | Bacteria | 4088 |
| 1033 | nmdc:mga07m45_9482_c1 | 3300050496 | Bacteria | 5052 |
| 1034 | nmdc:mga05p37_67216_c1 | 3300050507 | Bacteria | 4409 |
| 1035 | nmdc:mga09592_44330_c1 | 3300050508 | Bacteria | 3744 |
| 1036 | nmdc:mga0qj67_301007_c1 | 3300050509 | Bacteria | 1299 |
| 1037 | nmdc:mga06r32_35879_c1 | 3300050510 | Bacteria | 4680 |
| 1038 | nmdc:mga08y16_6614_c1 | 3300050511 | Bacteria | 12156 |
| 1039 | nmdc:mga0n895_282394_c1 | 3300050512 | Bacteria | 1683 |
| 1040 | nmdc:mga0n895_6398_c1 | 3300050512 | Bacteria | 9997 |
| 1041 | nmdc:mga0n895_836151_c1 | 3300050512 | Bacteria | 909 |
| 1042 | nmdc:mga0rr50_6385_c1 | 3300050513 | Bacteria | 7170 |
| 1043 | nmdc:mga0rr50_676651_c1 | 3300050513 | Bacteria | 881 |
| 1044 | nmdc:mga08x19_32951_c1 | 3300050514 | Bacteria | 3268 |
| 1045 | nmdc:mga08x19_51210_c1 | 3300050514 | Bacteria | 2652 |
| 1046 | nmdc:mga08x19_55184_c1 | 3300050514 | Bacteria | 2560 |
| 1047 | nmdc:mga0a205_190348_c1 | 3300050515 | Bacteria | 1944 |
| 1048 | nmdc:mga0a205_355291_c1 | 3300050515 | Bacteria | 1332 |
| 1049 | Ga0500635_0000026 | 3300053080 | Bacteria | 104983 |
| 1050 | Ga0500578_0000926 | 3300053086 | Bacteria | 32927 |
| 1051 | Ga0500578_0086543 | 3300053086 | Bacteria | 1991 |
| 1052 | Ga0500651_0002343 | 3300053093 | Bacteria | 9953 |
| 1053 | Ga0500651_0015061 | 3300053093 | Bacteria | 4741 |
| 1054 | Ga0500651_0037658 | 3300053093 | Bacteria | 3048 |
| 1055 | Ga0500651_0121288 | 3300053093 | Bacteria | 1587 |
| 1056 | Ga0500594_0000905 | 3300053118 | Bacteria | 6359 |
| 1057 | Ga0500597_011262 | 3300053120 | Bacteria | 3228 |
| 1058 | Ga0500623_103280 | 3300053127 | Bacteria | 1296 |
| 1059 | Ga0500652_009409 | 3300053131 | Bacteria | 3303 |
| 1060 | Ga0500559_0000260 | 3300053136 | Bacteria | 41596 |
| 1061 | Ga0500568_0017724 | 3300053139 | Bacteria | 3136 |
| 1062 | Ga0500616_0097632 | 3300053153 | Bacteria | 1442 |
| 1063 | Ga0500619_000059 | 3300053154 | Bacteria | 33814 |
| 1064 | Ga0500622_0001479 | 3300053156 | Bacteria | 18702 |
| 1065 | Ga0500622_0001878 | 3300053156 | Bacteria | 15867 |
| 1066 | Ga0501084_0279667 | 3300054114 | Bacteria | 1409 |
| 1067 | Ga0500661_012541 | 3300055283 | Bacteria | 1530 |
| 1068 | Ga0590071_001283 | 3300059421 | Bacteria | 6744 |
| 1069 | Ga0501082_0068584 | 3300060353 | Bacteria | 3053 |
| 1070 | Ga0501082_0687342 | 3300060353 | Bacteria | 895 |
| 1071 | Ga0466962_0002298 | 3300061719 | Bacteria | 9060 |
| 1072 | Ga0466962_0088000 | 3300061719 | Bacteria | 1487 |
| 1073 | Ga0530510_0186491 | 3300061734 | Bacteria | 1539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10017849 | Ga0111539_1001784910 | 193 |
| 2 | 3300005338 | Ga0068868_100274579 | Ga0068868_1002745792 | 215 |
| 3 | 3300005617 | Ga0068859_100257130 | Ga0068859_1002571302 | 215 |
| 4 | 3300005841 | Ga0068863_100052686 | Ga0068863_1000526863 | 215 |
| 5 | 3300006237 | Ga0097621_100055961 | Ga0097621_1000559613 | 215 |
| 6 | 3300006931 | Ga0097620_100257118 | Ga0097620_1002571182 | 215 |
| 7 | 3300013297 | Ga0157378_10000016 | Ga0157378_10000016104 | 215 |
| 8 | 3300025924 | Ga0207694_10015716 | Ga0207694_100157162 | 215 |
| 9 | 3300026088 | Ga0207641_10333729 | Ga0207641_103337292 | 215 |
| 10 | 3300026095 | Ga0207676_10607769 | Ga0207676_106077691 | 215 |
| 11 | 3300005539 | Ga0068853_100523955 | Ga0068853_1005239551 | 216 |
| 12 | 3300049569 | Ga0501032_0354473 | Ga0501032_0354473_67_783 | 217 |
| 13 | 3300049571 | Ga0501034_0007701 | Ga0501034_0007701_7202_7918 | 217 |
| 14 | 3300049579 | Ga0501043_0028941 | Ga0501043_0028941_381_1097 | 217 |
| 15 | 3300049586 | Ga0501070_0033046 | Ga0501070_0033046_578_1294 | 217 |
| 16 | 3300049590 | Ga0501074_0086312 | Ga0501074_0086312_1023_1739 | 217 |
| 17 | 3300005354 | Ga0070675_100292535 | Ga0070675_1002925352 | 218 |
| 18 | 3300005367 | Ga0070667_100000848 | Ga0070667_1000008486 | 218 |
| 19 | 3300005455 | Ga0070663_100001730 | Ga0070663_1000017304 | 218 |
| 20 | 3300005459 | Ga0068867_100012878 | Ga0068867_1000128785 | 218 |
| 21 | 3300005539 | Ga0068853_100061217 | Ga0068853_1000612172 | 218 |
| 22 | 3300005543 | Ga0070672_100010304 | Ga0070672_1000103044 | 218 |
| 23 | 3300005548 | Ga0070665_100088866 | Ga0070665_1000888662 | 218 |
| 24 | 3300005618 | Ga0068864_100468345 | Ga0068864_1004683451 | 218 |
| 25 | 3300006881 | Ga0068865_100010706 | Ga0068865_1000107065 | 218 |
| 26 | 3300009176 | Ga0105242_10207852 | Ga0105242_102078522 | 218 |
| 27 | 3300009177 | Ga0105248_10001415 | Ga0105248_1000141520 | 218 |
| 28 | 3300009177 | Ga0105248_10263516 | Ga0105248_102635162 | 218 |
| 29 | 3300009545 | Ga0105237_10003141 | Ga0105237_1000314113 | 218 |
| 30 | 3300009553 | Ga0105249_10003146 | Ga0105249_1000314610 | 218 |
| 31 | 3300013296 | Ga0157374_10174012 | Ga0157374_101740121 | 218 |
| 32 | 3300013308 | Ga0157375_10012374 | Ga0157375_100123744 | 218 |
| 33 | 3300025913 | Ga0207695_10471322 | Ga0207695_104713221 | 218 |
| 34 | 3300025914 | Ga0207671_10041244 | Ga0207671_100412442 | 218 |
| 35 | 3300025938 | Ga0207704_10031520 | Ga0207704_100315203 | 218 |
| 36 | 3300025940 | Ga0207691_10017244 | Ga0207691_100172445 | 218 |
| 37 | 3300025941 | Ga0207711_10009476 | Ga0207711_100094767 | 218 |
| 38 | 3300025961 | Ga0207712_10001789 | Ga0207712_100017894 | 218 |
| 39 | 3300025961 | Ga0207712_10112384 | Ga0207712_101123841 | 218 |
| 40 | 3300025986 | Ga0207658_10001603 | Ga0207658_100016037 | 218 |
| 41 | 3300026041 | Ga0207639_10012567 | Ga0207639_100125672 | 218 |
| 42 | 3300026041 | Ga0207639_10100782 | Ga0207639_101007824 | 218 |
| 43 | 3300026067 | Ga0207678_10000915 | Ga0207678_100009154 | 218 |
| 44 | 3300026089 | Ga0207648_10024643 | Ga0207648_100246434 | 218 |
| 45 | 3300028379 | Ga0268266_10111418 | Ga0268266_101114183 | 218 |
| 46 | 3300047472 | Ga0495686_0061086 | Ga0495686_0061086_1491_2207 | 218 |
| 47 | 3300048925 | Ga0496122_0002256 | Ga0496122_0002256_21933_22649 | 218 |
| 48 | 3300048926 | Ga0496123_0002984 | Ga0496123_0002984_6543_7259 | 218 |
| 49 | 3300048927 | Ga0496124_0495944 | Ga0496124_0495944_58_774 | 218 |
| 50 | 3300053120 | Ga0500597_011262 | Ga0500597_011262_2159_2875 | 218 |
| 51 | 3300005335 | Ga0070666_10115059 | Ga0070666_101150593 | 219 |
| 52 | 3300005338 | Ga0068868_100018848 | Ga0068868_1000188482 | 219 |
| 53 | 3300005367 | Ga0070667_100278178 | Ga0070667_1002781781 | 219 |
| 54 | 3300005539 | Ga0068853_100005984 | Ga0068853_1000059842 | 219 |
| 55 | 3300005539 | Ga0068853_100195489 | Ga0068853_1001954892 | 219 |
| 56 | 3300005548 | Ga0070665_100033531 | Ga0070665_1000335313 | 219 |
| 57 | 3300005563 | Ga0068855_100007881 | Ga0068855_10000788112 | 219 |
| 58 | 3300005577 | Ga0068857_100089574 | Ga0068857_1000895742 | 219 |
| 59 | 3300005614 | Ga0068856_100281003 | Ga0068856_1002810032 | 219 |
| 60 | 3300005841 | Ga0068863_100301890 | Ga0068863_1003018902 | 219 |
| 61 | 3300005841 | Ga0068863_100379266 | Ga0068863_1003792662 | 219 |
| 62 | 3300006358 | Ga0068871_100534157 | Ga0068871_1005341571 | 219 |
| 63 | 3300009553 | Ga0105249_10086584 | Ga0105249_100865842 | 219 |
| 64 | 3300010375 | Ga0105239_10019647 | Ga0105239_100196473 | 219 |
| 65 | 3300013308 | Ga0157375_10225306 | Ga0157375_102253063 | 219 |
| 66 | 3300025914 | Ga0207671_10047263 | Ga0207671_100472633 | 219 |
| 67 | 3300025949 | Ga0207667_10003604 | Ga0207667_100036047 | 219 |
| 68 | 3300025960 | Ga0207651_10078209 | Ga0207651_100782092 | 219 |
| 69 | 3300025961 | Ga0207712_10127602 | Ga0207712_101276022 | 219 |
| 70 | 3300026041 | Ga0207639_10000158 | Ga0207639_1000015818 | 219 |
| 71 | 3300026067 | Ga0207678_10286989 | Ga0207678_102869892 | 219 |
| 72 | 3300026088 | Ga0207641_10007613 | Ga0207641_100076133 | 219 |
| 73 | 3300028379 | Ga0268266_10090792 | Ga0268266_100907922 | 219 |
| 74 | 3300049573 | Ga0501037_0051682 | Ga0501037_0051682_2036_2752 | 219 |
| 75 | 3300049590 | Ga0501074_0130703 | Ga0501074_0130703_1019_1735 | 219 |
| 76 | 3300049742 | Ga0501080_0081487 | Ga0501080_0081487_255_971 | 219 |
| 77 | 3300049822 | Ga0501035_0104116 | Ga0501035_0104116_841_1557 | 219 |
| 78 | 3300049823 | Ga0501044_0053233 | Ga0501044_0053233_2769_3485 | 219 |
| 79 | 3300005563 | Ga0068855_100229921 | Ga0068855_1002299212 | 220 |
| 80 | 3300006881 | Ga0068865_100301093 | Ga0068865_1003010932 | 220 |
| 81 | 3300010375 | Ga0105239_10117267 | Ga0105239_101172673 | 220 |
| 82 | 3300025938 | Ga0207704_10052210 | Ga0207704_100522103 | 220 |
| 83 | 3300025981 | Ga0207640_10099550 | Ga0207640_100995503 | 220 |
| 84 | 3300026095 | Ga0207676_10293877 | Ga0207676_102938772 | 220 |
| 85 | 3300035398 | Ga0316574_0008856 | Ga0316574_0008856_2115_2855 | 220 |
| 86 | 3300048928 | Ga0496125_0372995 | Ga0496125_0372995_26_745 | 220 |
| 87 | 3300048920 | Ga0496117_0036893 | Ga0496117_0036893_1469_2185 | 221 |
| 88 | 3300048921 | Ga0496118_0000520 | Ga0496118_0000520_21832_22548 | 221 |
| 89 | 3300055283 | Ga0500661_012541 | Ga0500661_012541_529_1449 | 222 |
| 90 | 3300003794 | Ga0055531_10000612 | Ga0055531_1000061227 | 223 |
| 91 | 3300037312 | Ga0395899_0003079 | Ga0395899_0003079_8062_8790 | 223 |
| 92 | 3300037418 | Ga0395900_0149640 | Ga0395900_0149640_135_863 | 223 |
| 93 | 3300037471 | Ga0395905_0116877 | Ga0395905_0116877_1467_2195 | 223 |
| 94 | 3300038443 | Ga0395901_0012708 | Ga0395901_0012708_6687_7415 | 223 |
| 95 | 3300006163 | Ga0070715_10246192 | Ga0070715_102461921 | 224 |
| 96 | 3300006852 | Ga0075433_10734731 | Ga0075433_107347311 | 224 |
| 97 | 3300025915 | Ga0207693_10224222 | Ga0207693_102242222 | 224 |
| 98 | 3300031727 | Ga0316576_10450687 | Ga0316576_104506871 | 224 |
| 99 | 3300032002 | Ga0307416_100791153 | Ga0307416_1007911531 | 224 |
| 100 | 3300037471 | Ga0395905_0000148 | Ga0395905_0000148_13435_14160 | 224 |
| 101 | 3300037471 | Ga0395905_0003187 | Ga0395905_0003187_3867_4592 | 224 |
| 102 | 3300048927 | Ga0496124_0183348 | Ga0496124_0183348_532_1263 | 224 |
| 103 | 3300050511 | nmdc:mga08y16_6614_c1 | nmdc:mga08y16_6614_c1_1490_2245 | 224 |
| 104 | 3300005459 | Ga0068867_100000005 | Ga0068867_10000000592 | 225 |
| 105 | 3300006880 | Ga0075429_100003851 | Ga0075429_1000038512 | 225 |
| 106 | 3300009148 | Ga0105243_10000515 | Ga0105243_1000051524 | 225 |
| 107 | 3300014745 | Ga0157377_10000022 | Ga0157377_1000002282 | 225 |
| 108 | 3300025935 | Ga0207709_10000522 | Ga0207709_1000052216 | 225 |
| 109 | 3300026089 | Ga0207648_10000032 | Ga0207648_1000003252 | 225 |
| 110 | 3300026142 | Ga0207698_10005832 | Ga0207698_100058325 | 225 |
| 111 | 3300031730 | Ga0307516_10195284 | Ga0307516_101952841 | 225 |
| 112 | 3300032002 | Ga0307416_100230428 | Ga0307416_1002304282 | 225 |
| 113 | 3300037471 | Ga0395905_0019557 | Ga0395905_0019557_3466_4194 | 225 |
| 114 | 3300037471 | Ga0395905_0162368 | Ga0395905_0162368_141_866 | 225 |
| 115 | 3300041997 | Ga0439431_0005725 | Ga0439431_0005725_987_1724 | 225 |
| 116 | 3300042007 | Ga0439449_0031483 | Ga0439449_0031483_316_1041 | 225 |
| 117 | 3300042134 | Ga0450898_013674 | Ga0450898_013674_86_823 | 225 |
| 118 | 3300044656 | Ga0466969_0006079 | Ga0466969_0006079_5376_6101 | 225 |
| 119 | 3300044656 | Ga0466969_0073994 | Ga0466969_0073994_242_967 | 225 |
| 120 | 3300044683 | Ga0466965_0040577 | Ga0466965_0040577_1469_2194 | 225 |
| 121 | 3300044684 | Ga0466966_0003229 | Ga0466966_0003229_2328_3053 | 225 |
| 122 | 3300044693 | Ga0466961_0023517 | Ga0466961_0023517_2434_3159 | 225 |
| 123 | 3300044693 | Ga0466961_0054954 | Ga0466961_0054954_639_1364 | 225 |
| 124 | 3300044706 | Ga0466964_0006188 | Ga0466964_0006188_1453_2178 | 225 |
| 125 | 3300044719 | Ga0466971_0020521 | Ga0466971_0020521_1152_1877 | 225 |
| 126 | 3300044765 | Ga0466970_0008282 | Ga0466970_0008282_1902_2627 | 225 |
| 127 | 3300044842 | Ga0466957_0009701 | Ga0466957_0009701_767_1492 | 225 |
| 128 | 3300045049 | Ga0466959_0003173 | Ga0466959_0003173_991_1716 | 225 |
| 129 | 3300045049 | Ga0466959_0268752 | Ga0466959_0268752_417_1142 | 225 |
| 130 | 3300049759 | Ga0501262_012938 | Ga0501262_012938_265_990 | 225 |
| 131 | 3300049762 | Ga0501265_000359 | Ga0501265_000359_332_1057 | 225 |
| 132 | 3300050508 | nmdc:mga09592_44330_c1 | nmdc:mga09592_44330_c1_1064_1789 | 225 |
| 133 | 3300050509 | nmdc:mga0qj67_301007_c1 | nmdc:mga0qj67_301007_c1_538_1263 | 225 |
| 134 | 3300061719 | Ga0466962_0088000 | Ga0466962_0088000_593_1318 | 225 |
| 135 | 3300005577 | Ga0068857_100247155 | Ga0068857_1002471552 | 226 |
| 136 | 3300006177 | Ga0075362_10003415 | Ga0075362_100034152 | 226 |
| 137 | 3300009147 | Ga0114129_10297841 | Ga0114129_102978411 | 226 |
| 138 | 3300014969 | Ga0157376_10233591 | Ga0157376_102335912 | 226 |
| 139 | 3300015683 | Ga0183362_10001 | Ga0183362_100011328 | 226 |
| 140 | 3300026116 | Ga0207674_10320474 | Ga0207674_103204742 | 226 |
| 141 | 3300031616 | Ga0307508_10088971 | Ga0307508_100889714 | 226 |
| 142 | 3300037418 | Ga0395900_0013211 | Ga0395900_0013211_7529_8245 | 226 |
| 143 | 3300041411 | Ga0439466_0001803 | Ga0439466_0001803_4225_4950 | 226 |
| 144 | 3300041413 | Ga0439465_0003008 | Ga0439465_0003008_4294_5019 | 226 |
| 145 | 3300041999 | Ga0439433_0000991 | Ga0439433_0000991_756_1481 | 226 |
| 146 | 3300042006 | Ga0439432_002602 | Ga0439432_002602_5262_5987 | 226 |
| 147 | 3300042007 | Ga0439449_0002379 | Ga0439449_0002379_1149_1874 | 226 |
| 148 | 3300042010 | Ga0439452_000611 | Ga0439452_000611_7164_7889 | 226 |
| 149 | 3300042876 | Ga0451577_0262733 | Ga0451577_0262733_278_958 | 226 |
| 150 | 3300048924 | Ga0496121_0005276 | Ga0496121_0005276_233_958 | 226 |
| 151 | 3300048926 | Ga0496123_0001158 | Ga0496123_0001158_30303_31028 | 226 |
| 152 | 3300050489 | nmdc:mga03683_29407_c1 | nmdc:mga03683_29407_c1_883_1608 | 226 |
| 153 | 3300005353 | Ga0070669_100255320 | Ga0070669_1002553202 | 227 |
| 154 | 3300006195 | Ga0075366_10141351 | Ga0075366_101413512 | 227 |
| 155 | 3300006844 | Ga0075428_100081287 | Ga0075428_1000812873 | 227 |
| 156 | 3300006847 | Ga0075431_100091572 | Ga0075431_1000915722 | 227 |
| 157 | 3300006880 | Ga0075429_100024307 | Ga0075429_1000243075 | 227 |
| 158 | 3300009147 | Ga0114129_10014471 | Ga0114129_1001447114 | 227 |
| 159 | 3300009148 | Ga0105243_10161481 | Ga0105243_101614812 | 227 |
| 160 | 3300025923 | Ga0207681_10204214 | Ga0207681_102042142 | 227 |
| 161 | 3300041463 | Ga0451804_0366282 | Ga0451804_0366282_161_889 | 227 |
| 162 | 3300044712 | Ga0453684_0311720 | Ga0453684_0311720_200_928 | 227 |
| 163 | 3300050493 | nmdc:mga0k408_113841_c1 | nmdc:mga0k408_113841_c1_415_1140 | 227 |
| 164 | 3300050507 | nmdc:mga05p37_67216_c1 | nmdc:mga05p37_67216_c1_2413_3135 | 227 |
| 165 | 3300050510 | nmdc:mga06r32_35879_c1 | nmdc:mga06r32_35879_c1_378_1100 | 227 |
| 166 | 3300003784 | Ga0055534_1000506 | Ga0055534_100050610 | 228 |
| 167 | 3300006195 | Ga0075366_10034277 | Ga0075366_100342772 | 228 |
| 168 | 3300025284 | Ga0209130_1002188 | Ga0209130_10021883 | 228 |
| 169 | 3300025291 | Ga0209675_1022498 | Ga0209675_10224982 | 228 |
| 170 | 3300025303 | Ga0209051_1003300 | Ga0209051_10033006 | 228 |
| 171 | 3300027907 | Ga0207428_10487575 | Ga0207428_104875751 | 228 |
| 172 | 3300032004 | Ga0307414_10873422 | Ga0307414_108734221 | 228 |
| 173 | 3300037471 | Ga0395905_0317449 | Ga0395905_0317449_370_1089 | 228 |
| 174 | 3300046542 | Ga0495597_0000063 | Ga0495597_0000063_16886_17611 | 228 |
| 175 | 3300046794 | Ga0495589_0002663 | Ga0495589_0002663_5370_6095 | 228 |
| 176 | 3300050493 | nmdc:mga0k408_47482_c1 | nmdc:mga0k408_47482_c1_977_1699 | 228 |
| 177 | 3300006195 | Ga0075366_10002649 | Ga0075366_100026499 | 229 |
| 178 | 3300026121 | Ga0207683_10346703 | Ga0207683_103467032 | 229 |
| 179 | 3300044656 | Ga0466969_0139314 | Ga0466969_0139314_341_1063 | 229 |
| 180 | 3300044683 | Ga0466965_0001429 | Ga0466965_0001429_6512_7234 | 229 |
| 181 | 3300044684 | Ga0466966_0010728 | Ga0466966_0010728_4283_5005 | 229 |
| 182 | 3300044693 | Ga0466961_0039938 | Ga0466961_0039938_335_1057 | 229 |
| 183 | 3300044706 | Ga0466964_0008063 | Ga0466964_0008063_2976_3698 | 229 |
| 184 | 3300044719 | Ga0466971_0016848 | Ga0466971_0016848_571_1293 | 229 |
| 185 | 3300044842 | Ga0466957_0030253 | Ga0466957_0030253_638_1360 | 229 |
| 186 | 3300045049 | Ga0466959_0010587 | Ga0466959_0010587_5365_6087 | 229 |
| 187 | 3300045836 | Ga0466958_0056227 | Ga0466958_0056227_1493_2215 | 229 |
| 188 | 3300046615 | Ga0495656_0001008 | Ga0495656_0001008_3120_3845 | 229 |
| 189 | 3300061719 | Ga0466962_0002298 | Ga0466962_0002298_7037_7759 | 229 |
| 190 | 3300003761 | Ga0055535_1000330 | Ga0055535_100033046 | 230 |
| 191 | 3300003762 | Ga0055542_1000039 | Ga0055542_100003982 | 230 |
| 192 | 3300005335 | Ga0070666_10065827 | Ga0070666_100658272 | 230 |
| 193 | 3300005344 | Ga0070661_100039421 | Ga0070661_1000394214 | 230 |
| 194 | 3300005354 | Ga0070675_100527759 | Ga0070675_1005277591 | 230 |
| 195 | 3300005456 | Ga0070678_100298762 | Ga0070678_1002987621 | 230 |
| 196 | 3300005457 | Ga0070662_100019041 | Ga0070662_1000190415 | 230 |
| 197 | 3300005578 | Ga0068854_100101566 | Ga0068854_1001015662 | 230 |
| 198 | 3300005616 | Ga0068852_100053344 | Ga0068852_1000533443 | 230 |
| 199 | 3300005834 | Ga0068851_10003542 | Ga0068851_100035423 | 230 |
| 200 | 3300006353 | Ga0075370_10038798 | Ga0075370_100387982 | 230 |
| 201 | 3300009551 | Ga0105238_10246774 | Ga0105238_102467742 | 230 |
| 202 | 3300009551 | Ga0105238_10542154 | Ga0105238_105421542 | 230 |
| 203 | 3300013306 | Ga0163162_10331903 | Ga0163162_103319032 | 230 |
| 204 | 3300013307 | Ga0157372_10370304 | Ga0157372_103703042 | 230 |
| 205 | 3300014497 | Ga0182008_10005557 | Ga0182008_100055574 | 230 |
| 206 | 3300014969 | Ga0157376_10096398 | Ga0157376_100963982 | 230 |
| 207 | 3300015262 | Ga0182007_10000472 | Ga0182007_1000047223 | 230 |
| 208 | 3300015262 | Ga0182007_10000653 | Ga0182007_100006537 | 230 |
| 209 | 3300025228 | Ga0209672_100647 | Ga0209672_10064718 | 230 |
| 210 | 3300025229 | Ga0209147_101771 | Ga0209147_1017712 | 230 |
| 211 | 3300025242 | Ga0209258_100099 | Ga0209258_100099131 | 230 |
| 212 | 3300025254 | Ga0209148_1000103 | Ga0209148_1000103131 | 230 |
| 213 | 3300025298 | Ga0209050_1001620 | Ga0209050_100162013 | 230 |
| 214 | 3300025303 | Ga0209051_1001020 | Ga0209051_100102020 | 230 |
| 215 | 3300025304 | Ga0209257_1001138 | Ga0209257_100113814 | 230 |
| 216 | 3300025321 | Ga0207656_10003873 | Ga0207656_100038735 | 230 |
| 217 | 3300025728 | Ga0207655_1001248 | Ga0207655_100124820 | 230 |
| 218 | 3300025903 | Ga0207680_10115092 | Ga0207680_101150922 | 230 |
| 219 | 3300025921 | Ga0207652_10057317 | Ga0207652_100573172 | 230 |
| 220 | 3300025924 | Ga0207694_10063519 | Ga0207694_100635192 | 230 |
| 221 | 3300025926 | Ga0207659_10769089 | Ga0207659_107690891 | 230 |
| 222 | 3300025933 | Ga0207706_10023813 | Ga0207706_100238134 | 230 |
| 223 | 3300025940 | Ga0207691_10232108 | Ga0207691_102321082 | 230 |
| 224 | 3300025940 | Ga0207691_10392418 | Ga0207691_103924182 | 230 |
| 225 | 3300025960 | Ga0207651_10058883 | Ga0207651_100588832 | 230 |
| 226 | 3300025972 | Ga0207668_10501902 | Ga0207668_105019021 | 230 |
| 227 | 3300026116 | Ga0207674_10028246 | Ga0207674_100282464 | 230 |
| 228 | 3300026121 | Ga0207683_10025950 | Ga0207683_100259504 | 230 |
| 229 | 3300028794 | Ga0307515_10001088 | Ga0307515_1000108833 | 230 |
| 230 | 3300031251 | Ga0265327_10006291 | Ga0265327_100062912 | 230 |
| 231 | 3300031548 | Ga0307408_100087592 | Ga0307408_1000875923 | 230 |
| 232 | 3300046475 | Ga0495639_0022639 | Ga0495639_0022639_1550_2275 | 230 |
| 233 | 3300046477 | Ga0495664_0280545 | Ga0495664_0280545_117_842 | 230 |
| 234 | 3300046615 | Ga0495656_0125340 | Ga0495656_0125340_470_1195 | 230 |
| 235 | 3300046675 | Ga0495657_0200118 | Ga0495657_0200118_210_935 | 230 |
| 236 | 3300047321 | Ga0495676_0290931 | Ga0495676_0290931_70_795 | 230 |
| 237 | 3300048903 | Ga0496100_0002149 | Ga0496100_0002149_8674_9399 | 230 |
| 238 | 3300048906 | Ga0496103_0020828 | Ga0496103_0020828_468_1193 | 230 |
| 239 | 3300048908 | Ga0496105_0012226 | Ga0496105_0012226_416_1141 | 230 |
| 240 | 3300048912 | Ga0496109_0512657 | Ga0496109_0512657_26_751 | 230 |
| 241 | 3300048916 | Ga0496113_0213444 | Ga0496113_0213444_519_1244 | 230 |
| 242 | 3300048919 | Ga0496116_0016280 | Ga0496116_0016280_1507_2232 | 230 |
| 243 | 3300048920 | Ga0496117_0016264 | Ga0496117_0016264_839_1564 | 230 |
| 244 | 3300048921 | Ga0496118_0009301 | Ga0496118_0009301_7464_8189 | 230 |
| 245 | 3300050496 | nmdc:mga07m45_2487_c1 | nmdc:mga07m45_2487_c1_4760_5485 | 230 |
| 246 | 3300005536 | Ga0070697_100055465 | Ga0070697_1000554655 | 231 |
| 247 | 3300006173 | Ga0070716_100202949 | Ga0070716_1002029492 | 231 |
| 248 | 3300025910 | Ga0207684_10341424 | Ga0207684_103414242 | 231 |
| 249 | 3300025939 | Ga0207665_10151578 | Ga0207665_101515783 | 231 |
| 250 | 3300031731 | Ga0307405_10049105 | Ga0307405_100491052 | 231 |
| 251 | 3300005364 | Ga0070673_100095868 | Ga0070673_1000958682 | 232 |
| 252 | 3300031852 | Ga0307410_10266690 | Ga0307410_102666902 | 232 |
| 253 | 3300031911 | Ga0307412_10459704 | Ga0307412_104597042 | 232 |
| 254 | 3300032005 | Ga0307411_10401201 | Ga0307411_104012012 | 232 |
| 255 | 3300037471 | Ga0395905_0018699 | Ga0395905_0018699_3006_3977 | 232 |
| 256 | 3300053154 | Ga0500619_000059 | Ga0500619_000059_32660_33385 | 232 |
| 257 | 3300005331 | Ga0070670_100864257 | Ga0070670_1008642571 | 233 |
| 258 | 3300005336 | Ga0070680_100366898 | Ga0070680_1003668981 | 233 |
| 259 | 3300005337 | Ga0070682_100392009 | Ga0070682_1003920091 | 233 |
| 260 | 3300005354 | Ga0070675_100231758 | Ga0070675_1002317582 | 233 |
| 261 | 3300005356 | Ga0070674_100417774 | Ga0070674_1004177742 | 233 |
| 262 | 3300005456 | Ga0070678_100005274 | Ga0070678_1000052744 | 233 |
| 263 | 3300005530 | Ga0070679_100263171 | Ga0070679_1002631711 | 233 |
| 264 | 3300005539 | Ga0068853_100065796 | Ga0068853_1000657963 | 233 |
| 265 | 3300005547 | Ga0070693_100106067 | Ga0070693_1001060672 | 233 |
| 266 | 3300005614 | Ga0068856_100059619 | Ga0068856_1000596193 | 233 |
| 267 | 3300005615 | Ga0070702_100419691 | Ga0070702_1004196911 | 233 |
| 268 | 3300005616 | Ga0068852_100646508 | Ga0068852_1006465081 | 233 |
| 269 | 3300005841 | Ga0068863_100112251 | Ga0068863_1001122512 | 233 |
| 270 | 3300006237 | Ga0097621_100025265 | Ga0097621_1000252655 | 233 |
| 271 | 3300006358 | Ga0068871_100012912 | Ga0068871_1000129124 | 233 |
| 272 | 3300006871 | Ga0075434_100154648 | Ga0075434_1001546483 | 233 |
| 273 | 3300009174 | Ga0105241_10095833 | Ga0105241_100958332 | 233 |
| 274 | 3300009551 | Ga0105238_10230868 | Ga0105238_102308683 | 233 |
| 275 | 3300009553 | Ga0105249_10045561 | Ga0105249_100455614 | 233 |
| 276 | 3300013105 | Ga0157369_10358386 | Ga0157369_103583861 | 233 |
| 277 | 3300013306 | Ga0163162_10081316 | Ga0163162_100813164 | 233 |
| 278 | 3300013306 | Ga0163162_10156745 | Ga0163162_101567452 | 233 |
| 279 | 3300013306 | Ga0163162_10189925 | Ga0163162_101899251 | 233 |
| 280 | 3300013307 | Ga0157372_10575252 | Ga0157372_105752522 | 233 |
| 281 | 3300013308 | Ga0157375_10119885 | Ga0157375_101198851 | 233 |
| 282 | 3300014968 | Ga0157379_10267566 | Ga0157379_102675662 | 233 |
| 283 | 3300014969 | Ga0157376_10001097 | Ga0157376_100010973 | 233 |
| 284 | 3300017792 | Ga0163161_10064992 | Ga0163161_100649923 | 233 |
| 285 | 3300025907 | Ga0207645_10523130 | Ga0207645_105231301 | 233 |
| 286 | 3300025911 | Ga0207654_10233033 | Ga0207654_102330331 | 233 |
| 287 | 3300025926 | Ga0207659_10177094 | Ga0207659_101770942 | 233 |
| 288 | 3300025931 | Ga0207644_10178257 | Ga0207644_101782572 | 233 |
| 289 | 3300025939 | Ga0207665_10108110 | Ga0207665_101081103 | 233 |
| 290 | 3300026088 | Ga0207641_10212881 | Ga0207641_102128812 | 233 |
| 291 | 3300026121 | Ga0207683_10008536 | Ga0207683_100085364 | 233 |
| 292 | 3300026121 | Ga0207683_10257335 | Ga0207683_102573351 | 233 |
| 293 | 3300031911 | Ga0307412_10224187 | Ga0307412_102241871 | 233 |
| 294 | 3300005539 | Ga0068853_100009827 | Ga0068853_1000098276 | 234 |
| 295 | 3300005983 | Ga0081540_1010828 | Ga0081540_10108285 | 234 |
| 296 | 3300006195 | Ga0075366_10001513 | Ga0075366_100015136 | 234 |
| 297 | 3300046517 | Ga0495630_0656223 | Ga0495630_0656223_35_748 | 234 |
| 298 | 3300048920 | Ga0496117_0063606 | Ga0496117_0063606_996_1709 | 234 |
| 299 | 3300048921 | Ga0496118_0006635 | Ga0496118_0006635_2569_3282 | 234 |
| 300 | 3300050493 | nmdc:mga0k408_320005_c1 | nmdc:mga0k408_320005_c1_51_776 | 234 |
| 301 | 3300005328 | Ga0070676_10154024 | Ga0070676_101540242 | 235 |
| 302 | 3300005334 | Ga0068869_100232058 | Ga0068869_1002320582 | 235 |
| 303 | 3300005334 | Ga0068869_100635596 | Ga0068869_1006355961 | 235 |
| 304 | 3300005340 | Ga0070689_100040247 | Ga0070689_1000402472 | 235 |
| 305 | 3300005356 | Ga0070674_100616422 | Ga0070674_1006164221 | 235 |
| 306 | 3300005364 | Ga0070673_100107455 | Ga0070673_1001074552 | 235 |
| 307 | 3300005365 | Ga0070688_100119012 | Ga0070688_1001190122 | 235 |
| 308 | 3300005455 | Ga0070663_100016702 | Ga0070663_1000167024 | 235 |
| 309 | 3300005459 | Ga0068867_100058410 | Ga0068867_1000584101 | 235 |
| 310 | 3300005543 | Ga0070672_100341106 | Ga0070672_1003411062 | 235 |
| 311 | 3300005548 | Ga0070665_100146971 | Ga0070665_1001469712 | 235 |
| 312 | 3300005843 | Ga0068860_100570768 | Ga0068860_1005707682 | 235 |
| 313 | 3300005844 | Ga0068862_100046445 | Ga0068862_1000464453 | 235 |
| 314 | 3300006237 | Ga0097621_100250124 | Ga0097621_1002501242 | 235 |
| 315 | 3300006358 | Ga0068871_100033647 | Ga0068871_1000336473 | 235 |
| 316 | 3300009174 | Ga0105241_10009853 | Ga0105241_100098534 | 235 |
| 317 | 3300009176 | Ga0105242_10000382 | Ga0105242_1000038211 | 235 |
| 318 | 3300009176 | Ga0105242_10246119 | Ga0105242_102461191 | 235 |
| 319 | 3300010375 | Ga0105239_10016362 | Ga0105239_100163622 | 235 |
| 320 | 3300013105 | Ga0157369_10000172 | Ga0157369_1000017244 | 235 |
| 321 | 3300013105 | Ga0157369_10728207 | Ga0157369_107282072 | 235 |
| 322 | 3300013306 | Ga0163162_10005037 | Ga0163162_1000503714 | 235 |
| 323 | 3300013307 | Ga0157372_10077581 | Ga0157372_100775814 | 235 |
| 324 | 3300013308 | Ga0157375_10003836 | Ga0157375_1000383614 | 235 |
| 325 | 3300014969 | Ga0157376_10077529 | Ga0157376_100775292 | 235 |
| 326 | 3300014969 | Ga0157376_10131874 | Ga0157376_101318742 | 235 |
| 327 | 3300025907 | Ga0207645_10019484 | Ga0207645_100194843 | 235 |
| 328 | 3300025911 | Ga0207654_10048107 | Ga0207654_100481071 | 235 |
| 329 | 3300025913 | Ga0207695_10014882 | Ga0207695_100148829 | 235 |
| 330 | 3300025914 | Ga0207671_10000614 | Ga0207671_1000061444 | 235 |
| 331 | 3300025916 | Ga0207663_10105378 | Ga0207663_101053783 | 235 |
| 332 | 3300025924 | Ga0207694_10006267 | Ga0207694_100062677 | 235 |
| 333 | 3300025934 | Ga0207686_10003079 | Ga0207686_1000307910 | 235 |
| 334 | 3300025934 | Ga0207686_10213733 | Ga0207686_102137331 | 235 |
| 335 | 3300025937 | Ga0207669_10063670 | Ga0207669_100636703 | 235 |
| 336 | 3300025938 | Ga0207704_10005184 | Ga0207704_100051843 | 235 |
| 337 | 3300025940 | Ga0207691_10027731 | Ga0207691_100277314 | 235 |
| 338 | 3300025942 | Ga0207689_10031723 | Ga0207689_100317237 | 235 |
| 339 | 3300025961 | Ga0207712_10201585 | Ga0207712_102015852 | 235 |
| 340 | 3300025986 | Ga0207658_10765596 | Ga0207658_107655961 | 235 |
| 341 | 3300026041 | Ga0207639_10565443 | Ga0207639_105654431 | 235 |
| 342 | 3300026067 | Ga0207678_10034941 | Ga0207678_100349412 | 235 |
| 343 | 3300026121 | Ga0207683_10459027 | Ga0207683_104590271 | 235 |
| 344 | 3300028379 | Ga0268266_10152949 | Ga0268266_101529491 | 235 |
| 345 | 3300028380 | Ga0268265_10022791 | Ga0268265_100227912 | 235 |
| 346 | 3300035171 | Ga0373946_0142311 | Ga0373946_0142311_11_733 | 235 |
| 347 | 3300036401 | Ga0373937_0280495 | Ga0373937_0280495_542_1264 | 235 |
| 348 | 3300041451 | Ga0451791_0611886 | Ga0451791_0611886_428_1144 | 235 |
| 349 | 3300041453 | Ga0451797_0922191 | Ga0451797_0922191_1658_2374 | 235 |
| 350 | 3300041486 | Ga0451807_0264544 | Ga0451807_0264544_2525_3241 | 235 |
| 351 | 3300046473 | Ga0495582_0079149 | Ga0495582_0079149_625_1347 | 235 |
| 352 | 3300046531 | Ga0495665_0176435 | Ga0495665_0176435_337_1059 | 235 |
| 353 | 3300046559 | Ga0495667_0311499 | Ga0495667_0311499_49_771 | 235 |
| 354 | 3300047317 | Ga0495604_0142817 | Ga0495604_0142817_331_1053 | 235 |
| 355 | 3300047471 | Ga0495684_0387765 | Ga0495684_0387765_206_928 | 235 |
| 356 | 3300048907 | Ga0496104_0000038 | Ga0496104_0000038_97872_98594 | 235 |
| 357 | 3300048907 | Ga0496104_0067278 | Ga0496104_0067278_612_1337 | 235 |
| 358 | 3300048908 | Ga0496105_0000038 | Ga0496105_0000038_79517_80239 | 235 |
| 359 | 3300048918 | Ga0496115_0442919 | Ga0496115_0442919_313_1032 | 235 |
| 360 | 3300049571 | Ga0501034_0063996 | Ga0501034_0063996_2857_3573 | 235 |
| 361 | 3300049573 | Ga0501037_0103840 | Ga0501037_0103840_427_1143 | 235 |
| 362 | 3300049574 | Ga0501038_0062118 | Ga0501038_0062118_2273_2989 | 235 |
| 363 | 3300049574 | Ga0501038_0428594 | Ga0501038_0428594_153_869 | 235 |
| 364 | 3300049579 | Ga0501043_0061653 | Ga0501043_0061653_36_752 | 235 |
| 365 | 3300049580 | Ga0501046_0013611 | Ga0501046_0013611_85_801 | 235 |
| 366 | 3300049582 | Ga0501048_0191161 | Ga0501048_0191161_441_1157 | 235 |
| 367 | 3300049583 | Ga0501067_0125501 | Ga0501067_0125501_560_1276 | 235 |
| 368 | 3300049587 | Ga0501071_0046458 | Ga0501071_0046458_304_1020 | 235 |
| 369 | 3300049589 | Ga0501073_0225466 | Ga0501073_0225466_287_1006 | 235 |
| 370 | 3300049741 | Ga0501079_0635280 | Ga0501079_0635280_70_786 | 235 |
| 371 | 3300049742 | Ga0501080_0123913 | Ga0501080_0123913_881_1597 | 235 |
| 372 | 3300049742 | Ga0501080_0191599 | Ga0501080_0191599_1039_1758 | 235 |
| 373 | 3300049743 | Ga0501081_0150755 | Ga0501081_0150755_918_1634 | 235 |
| 374 | 3300049822 | Ga0501035_0021681 | Ga0501035_0021681_1017_1733 | 235 |
| 375 | 3300049822 | Ga0501035_0071298 | Ga0501035_0071298_642_1358 | 235 |
| 376 | 3300049823 | Ga0501044_0428964 | Ga0501044_0428964_466_1185 | 235 |
| 377 | 3300049823 | Ga0501044_0569944 | Ga0501044_0569944_13_729 | 235 |
| 378 | 3300049824 | Ga0501045_0208014 | Ga0501045_0208014_349_1065 | 235 |
| 379 | 3300053093 | Ga0500651_0002343 | Ga0500651_0002343_172_888 | 235 |
| 380 | 3300060353 | Ga0501082_0687342 | Ga0501082_0687342_125_841 | 235 |
| 381 | iso_pu_bacteria | 2547132374 | 2548497411 | 235 |
| 382 | iso_pu_bacteria | 2643221570 | 2643866555 | 235 |
| 383 | iso_pu_bacteria | 2643221596 | 2643993307 | 235 |
| 384 | iso_pu_bacteria | 2643221609 | 2644060672 | 235 |
| 385 | iso_pu_bacteria | 2643221611 | 2644073993 | 235 |
| 386 | iso_pu_bacteria | 2643221652 | 2644294088 | 235 |
| 387 | iso_pu_bacteria | 2643221717 | 2644646091 | 235 |
| 388 | iso_pu_bacteria | 2738543012 | 2739242697 | 235 |
| 389 | iso_pu_bacteria | 2816332133 | 2816472986 | 235 |
| 390 | iso_pu_bacteria | 2842718218 | 2842719557 | 235 |
| 391 | iso_pu_bacteria | 2894023352 | 2894025498 | 235 |
| 392 | iso_pu_bacteria | 2919704043 | 2919704595 | 235 |
| 393 | iso_pu_bacteria | 2974320154 | 2974323383 | 235 |
| 394 | iso_pu_bacteria | 2990710928 | 2990712259 | 235 |
| 395 | iso_pu_bacteria | 2588253510 | 2588293860 | 236 |
| 396 | 3300025920 | Ga0207649_10110051 | Ga0207649_101100512 | 237 |
| 397 | 3300050512 | nmdc:mga0n895_282394_c1 | nmdc:mga0n895_282394_c1_149_871 | 237 |
| 398 | iso_pu_bacteria | 2513020051 | 2513227112 | 237 |
| 399 | iso_pu_bacteria | 2521172590 | 2521559459 | 237 |
| 400 | iso_pu_bacteria | 2585428057 | 2587726262 | 237 |
| 401 | iso_pu_bacteria | 2585428058 | 2587734433 | 237 |
| 402 | iso_pu_bacteria | 2585428062 | 2587756321 | 237 |
| 403 | iso_pu_bacteria | 2599185214 | 2599623669 | 237 |
| 404 | iso_pu_bacteria | 2599185226 | 2599671712 | 237 |
| 405 | iso_pu_bacteria | 2599185227 | 2599681275 | 237 |
| 406 | iso_pu_bacteria | 2599185229 | 2599693322 | 237 |
| 407 | iso_pu_bacteria | 2643221592 | 2643970947 | 237 |
| 408 | iso_pu_bacteria | 2643221625 | 2644138798 | 237 |
| 409 | iso_pu_bacteria | 2643221628 | 2644159603 | 237 |
| 410 | iso_pu_bacteria | 2643221648 | 2644273966 | 237 |
| 411 | iso_pu_bacteria | 2643221654 | 2644302385 | 237 |
| 412 | iso_pu_bacteria | 2643221658 | 2644327626 | 237 |
| 413 | iso_pu_bacteria | 2643221660 | 2644340208 | 237 |
| 414 | iso_pu_bacteria | 2643221672 | 2644401470 | 237 |
| 415 | iso_pu_bacteria | 2643221683 | 2644468171 | 237 |
| 416 | iso_pu_bacteria | 2738541277 | 2738717738 | 237 |
| 417 | iso_pu_bacteria | 2738541307 | 2738879349 | 237 |
| 418 | iso_pu_bacteria | 2738543013 | 2739250715 | 237 |
| 419 | iso_pu_bacteria | 2738543019 | 2739278424 | 237 |
| 420 | iso_pu_bacteria | 2818991446 | 2819597222 | 237 |
| 421 | iso_pu_bacteria | 2831265667 | 2831266347 | 237 |
| 422 | iso_pu_bacteria | 2831864461 | 2831865697 | 237 |
| 423 | iso_pu_bacteria | 2838054893 | 2838057541 | 237 |
| 424 | iso_pu_bacteria | 2842677519 | 2842679860 | 237 |
| 425 | iso_pu_bacteria | 2881101125 | 2881101839 | 237 |
| 426 | iso_pu_bacteria | 2885192300 | 2885192692 | 237 |
| 427 | iso_pu_bacteria | 2885198086 | 2885204471 | 237 |
| 428 | iso_pu_bacteria | 2885211737 | 2885218124 | 237 |
| 429 | iso_pu_bacteria | 2886848708 | 2886853673 | 237 |
| 430 | iso_pu_bacteria | 2899924645 | 2899924726 | 237 |
| 431 | iso_pu_bacteria | 2904434214 | 2904435676 | 237 |
| 432 | iso_pu_bacteria | 2904449895 | 2904454425 | 237 |
| 433 | iso_pu_bacteria | 2904456579 | 2904461132 | 237 |
| 434 | iso_pu_bacteria | 2919046199 | 2919047891 | 237 |
| 435 | iso_pu_bacteria | 2919462493 | 2919466009 | 237 |
| 436 | iso_pu_bacteria | 2923510766 | 2923513200 | 237 |
| 437 | iso_pu_bacteria | 2928037797 | 2928039147 | 237 |
| 438 | iso_pu_bacteria | 2928044640 | 2928045248 | 237 |
| 439 | iso_pu_bacteria | 2928051484 | 2928053053 | 237 |
| 440 | iso_pu_bacteria | 2928064002 | 2928064275 | 237 |
| 441 | iso_pu_bacteria | 2928070936 | 2928071712 | 237 |
| 442 | iso_pu_bacteria | 2928084124 | 2928084343 | 237 |
| 443 | iso_pu_bacteria | 2928115317 | 2928118549 | 237 |
| 444 | iso_pu_bacteria | 2928130867 | 2928134948 | 237 |
| 445 | iso_pu_bacteria | 2929520902 | 2929527014 | 237 |
| 446 | iso_pu_bacteria | 2939631187 | 2939632057 | 237 |
| 447 | iso_pu_bacteria | 2945909444 | 2945911610 | 237 |
| 448 | iso_pu_bacteria | 2945945610 | 2945948182 | 237 |
| 449 | iso_pu_bacteria | 2945972063 | 2945977173 | 237 |
| 450 | iso_pu_bacteria | 2945984333 | 2945986048 | 237 |
| 451 | iso_pu_bacteria | 2954767861 | 2954772300 | 237 |
| 452 | iso_pu_bacteria | 639633007 | 639785686 | 237 |
| 453 | 3300026089 | Ga0207648_10307960 | Ga0207648_103079603 | 238 |
| 454 | 3300049569 | Ga0501032_0005261 | Ga0501032_0005261_6721_7542 | 238 |
| 455 | 3300049570 | Ga0501033_0000720 | Ga0501033_0000720_5116_5937 | 238 |
| 456 | 3300049571 | Ga0501034_0004188 | Ga0501034_0004188_5244_6065 | 238 |
| 457 | 3300049572 | Ga0501036_0007930 | Ga0501036_0007930_2623_3444 | 238 |
| 458 | 3300049573 | Ga0501037_0033753 | Ga0501037_0033753_1176_1997 | 238 |
| 459 | 3300049574 | Ga0501038_0004437 | Ga0501038_0004437_2992_3813 | 238 |
| 460 | 3300049575 | Ga0501039_0002430 | Ga0501039_0002430_7359_8180 | 238 |
| 461 | 3300049579 | Ga0501043_0085234 | Ga0501043_0085234_1407_2228 | 238 |
| 462 | 3300049580 | Ga0501046_0002962 | Ga0501046_0002962_9800_10621 | 238 |
| 463 | 3300049584 | Ga0501068_0064836 | Ga0501068_0064836_370_1191 | 238 |
| 464 | 3300049589 | Ga0501073_0003125 | Ga0501073_0003125_10374_11195 | 238 |
| 465 | 3300049741 | Ga0501079_0102597 | Ga0501079_0102597_721_1542 | 238 |
| 466 | 3300049742 | Ga0501080_0002682 | Ga0501080_0002682_12575_13396 | 238 |
| 467 | 3300049744 | Ga0501083_0023802 | Ga0501083_0023802_1167_1988 | 238 |
| 468 | 3300049823 | Ga0501044_0004235 | Ga0501044_0004235_15202_16032 | 238 |
| 469 | 3300049823 | Ga0501044_0016545 | Ga0501044_0016545_5244_6065 | 238 |
| 470 | 3300054114 | Ga0501084_0279667 | Ga0501084_0279667_204_1025 | 238 |
| 471 | 3300060353 | Ga0501082_0068584 | Ga0501082_0068584_14_835 | 238 |
| 472 | 3300005353 | Ga0070669_100027387 | Ga0070669_1000273873 | 239 |
| 473 | 3300005354 | Ga0070675_100076526 | Ga0070675_1000765263 | 239 |
| 474 | 3300005364 | Ga0070673_100127618 | Ga0070673_1001276183 | 239 |
| 475 | 3300006051 | Ga0075364_10057248 | Ga0075364_100572483 | 239 |
| 476 | 3300009094 | Ga0111539_10503376 | Ga0111539_105033763 | 239 |
| 477 | 3300009176 | Ga0105242_10004129 | Ga0105242_100041297 | 239 |
| 478 | 3300021361 | Ga0213872_10009068 | Ga0213872_100090683 | 239 |
| 479 | 3300025893 | Ga0207682_10189216 | Ga0207682_101892161 | 239 |
| 480 | 3300025923 | Ga0207681_10091583 | Ga0207681_100915833 | 239 |
| 481 | 3300025926 | Ga0207659_10051134 | Ga0207659_100511343 | 239 |
| 482 | 3300025934 | Ga0207686_10007355 | Ga0207686_100073557 | 239 |
| 483 | 3300025961 | Ga0207712_10142490 | Ga0207712_101424902 | 239 |
| 484 | 3300026121 | Ga0207683_10334022 | Ga0207683_103340222 | 239 |
| 485 | 3300027252 | Ga0209973_1000882 | Ga0209973_10008822 | 239 |
| 486 | 3300027665 | Ga0209983_1006568 | Ga0209983_10065682 | 239 |
| 487 | 3300027876 | Ga0209974_10016800 | Ga0209974_100168002 | 239 |
| 488 | 3300028379 | Ga0268266_10259614 | Ga0268266_102596142 | 239 |
| 489 | 3300028381 | Ga0268264_10902713 | Ga0268264_109027131 | 239 |
| 490 | 3300028794 | Ga0307515_10000267 | Ga0307515_1000026734 | 239 |
| 491 | 3300028794 | Ga0307515_10111538 | Ga0307515_101115382 | 239 |
| 492 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002583 | 239 |
| 493 | 3300031238 | Ga0265332_10000525 | Ga0265332_1000052524 | 239 |
| 494 | 3300031247 | Ga0265340_10006590 | Ga0265340_100065905 | 239 |
| 495 | 3300031456 | Ga0307513_10026272 | Ga0307513_100262723 | 239 |
| 496 | 3300031548 | Ga0307408_100000193 | Ga0307408_10000019343 | 239 |
| 497 | 3300031649 | Ga0307514_10000806 | Ga0307514_1000080616 | 239 |
| 498 | 3300031711 | Ga0265314_10000089 | Ga0265314_1000008975 | 239 |
| 499 | 3300032004 | Ga0307414_10385744 | Ga0307414_103857441 | 239 |
| 500 | 3300037471 | Ga0395905_0233286 | Ga0395905_0233286_642_1361 | 239 |
| 501 | 3300039447 | Ga0436361_0704832 | Ga0436361_0704832_9603_10322 | 239 |
| 502 | 3300046528 | Ga0495642_0128971 | Ga0495642_0128971_24_743 | 239 |
| 503 | 3300046537 | Ga0495598_0009545 | Ga0495598_0009545_1211_1930 | 239 |
| 504 | 3300046539 | Ga0495621_0005434 | Ga0495621_0005434_680_1399 | 239 |
| 505 | 3300046615 | Ga0495656_0053670 | Ga0495656_0053670_461_1180 | 239 |
| 506 | 3300050491 | nmdc:mga00v17_113669_c1 | nmdc:mga00v17_113669_c1_621_1340 | 239 |
| 507 | 3300053153 | Ga0500616_0097632 | Ga0500616_0097632_458_1177 | 239 |
| 508 | 3300059421 | Ga0590071_001283 | Ga0590071_001283_1011_1730 | 239 |
| 509 | 3300003215 | JGI25153J46596_10005637 | JGI25153J46596_100056375 | 240 |
| 510 | 3300003771 | Ga0055526_1005340 | Ga0055526_10053409 | 240 |
| 511 | 3300005295 | Ga0065707_10084409 | Ga0065707_100844092 | 240 |
| 512 | 3300005330 | Ga0070690_100017501 | Ga0070690_1000175013 | 240 |
| 513 | 3300005334 | Ga0068869_100049701 | Ga0068869_1000497014 | 240 |
| 514 | 3300005334 | Ga0068869_100133890 | Ga0068869_1001338902 | 240 |
| 515 | 3300005343 | Ga0070687_100004765 | Ga0070687_1000047652 | 240 |
| 516 | 3300005347 | Ga0070668_100366599 | Ga0070668_1003665992 | 240 |
| 517 | 3300005353 | Ga0070669_100033268 | Ga0070669_1000332684 | 240 |
| 518 | 3300005355 | Ga0070671_100216489 | Ga0070671_1002164892 | 240 |
| 519 | 3300005356 | Ga0070674_100164780 | Ga0070674_1001647802 | 240 |
| 520 | 3300005456 | Ga0070678_100156597 | Ga0070678_1001565973 | 240 |
| 521 | 3300005459 | Ga0068867_100000501 | Ga0068867_10000050111 | 240 |
| 522 | 3300005459 | Ga0068867_100028338 | Ga0068867_1000283382 | 240 |
| 523 | 3300005518 | Ga0070699_100089836 | Ga0070699_1000898363 | 240 |
| 524 | 3300005535 | Ga0070684_100015427 | Ga0070684_1000154276 | 240 |
| 525 | 3300005536 | Ga0070697_100301525 | Ga0070697_1003015252 | 240 |
| 526 | 3300005539 | Ga0068853_100389654 | Ga0068853_1003896542 | 240 |
| 527 | 3300005543 | Ga0070672_100004378 | Ga0070672_1000043788 | 240 |
| 528 | 3300005544 | Ga0070686_100044033 | Ga0070686_1000440334 | 240 |
| 529 | 3300005545 | Ga0070695_100125133 | Ga0070695_1001251332 | 240 |
| 530 | 3300005546 | Ga0070696_100008093 | Ga0070696_1000080934 | 240 |
| 531 | 3300005616 | Ga0068852_100522354 | Ga0068852_1005223541 | 240 |
| 532 | 3300005617 | Ga0068859_100089172 | Ga0068859_1000891723 | 240 |
| 533 | 3300005617 | Ga0068859_100667959 | Ga0068859_1006679591 | 240 |
| 534 | 3300005718 | Ga0068866_10021140 | Ga0068866_100211404 | 240 |
| 535 | 3300005718 | Ga0068866_10350627 | Ga0068866_103506271 | 240 |
| 536 | 3300005719 | Ga0068861_100021631 | Ga0068861_1000216316 | 240 |
| 537 | 3300005842 | Ga0068858_100252078 | Ga0068858_1002520782 | 240 |
| 538 | 3300005843 | Ga0068860_100017155 | Ga0068860_1000171552 | 240 |
| 539 | 3300005844 | Ga0068862_100002767 | Ga0068862_10000276713 | 240 |
| 540 | 3300005844 | Ga0068862_100017960 | Ga0068862_1000179605 | 240 |
| 541 | 3300006237 | Ga0097621_100245097 | Ga0097621_1002450973 | 240 |
| 542 | 3300006358 | Ga0068871_100012114 | Ga0068871_1000121144 | 240 |
| 543 | 3300006881 | Ga0068865_100012581 | Ga0068865_1000125816 | 240 |
| 544 | 3300006914 | Ga0075436_100027180 | Ga0075436_1000271802 | 240 |
| 545 | 3300006914 | Ga0075436_100028281 | Ga0075436_1000282813 | 240 |
| 546 | 3300006914 | Ga0075436_100035766 | Ga0075436_1000357667 | 240 |
| 547 | 3300006931 | Ga0097620_100089166 | Ga0097620_1000891663 | 240 |
| 548 | 3300006931 | Ga0097620_100667929 | Ga0097620_1006679291 | 240 |
| 549 | 3300007076 | Ga0075435_100008513 | Ga0075435_1000085132 | 240 |
| 550 | 3300007076 | Ga0075435_100248659 | Ga0075435_1002486592 | 240 |
| 551 | 3300009098 | Ga0105245_10087430 | Ga0105245_100874302 | 240 |
| 552 | 3300009148 | Ga0105243_10011438 | Ga0105243_100114382 | 240 |
| 553 | 3300009148 | Ga0105243_10269901 | Ga0105243_102699013 | 240 |
| 554 | 3300009553 | Ga0105249_10040918 | Ga0105249_100409183 | 240 |
| 555 | 3300009553 | Ga0105249_10367690 | Ga0105249_103676901 | 240 |
| 556 | 3300013297 | Ga0157378_10005086 | Ga0157378_100050868 | 240 |
| 557 | 3300013306 | Ga0163162_10003443 | Ga0163162_100034437 | 240 |
| 558 | 3300013308 | Ga0157375_10073195 | Ga0157375_100731954 | 240 |
| 559 | 3300014968 | Ga0157379_10184475 | Ga0157379_101844753 | 240 |
| 560 | 3300017792 | Ga0163161_10072407 | Ga0163161_100724072 | 240 |
| 561 | 3300021361 | Ga0213872_10000070 | Ga0213872_1000007088 | 240 |
| 562 | 3300025245 | Ga0207425_1000654 | Ga0207425_10006542 | 240 |
| 563 | 3300025258 | Ga0209129_1000144 | Ga0209129_100014455 | 240 |
| 564 | 3300025295 | Ga0209564_1000029 | Ga0209564_100002999 | 240 |
| 565 | 3300025297 | Ga0209758_1000043 | Ga0209758_1000043341 | 240 |
| 566 | 3300025299 | Ga0209256_1008621 | Ga0209256_10086213 | 240 |
| 567 | 3300025899 | Ga0207642_10005047 | Ga0207642_100050475 | 240 |
| 568 | 3300025918 | Ga0207662_10009848 | Ga0207662_100098482 | 240 |
| 569 | 3300025935 | Ga0207709_10021187 | Ga0207709_100211872 | 240 |
| 570 | 3300025937 | Ga0207669_10538162 | Ga0207669_105381621 | 240 |
| 571 | 3300025938 | Ga0207704_10020136 | Ga0207704_100201365 | 240 |
| 572 | 3300025940 | Ga0207691_10022031 | Ga0207691_100220315 | 240 |
| 573 | 3300025942 | Ga0207689_10331869 | Ga0207689_103318692 | 240 |
| 574 | 3300025944 | Ga0207661_10031100 | Ga0207661_100311002 | 240 |
| 575 | 3300025961 | Ga0207712_10028770 | Ga0207712_100287703 | 240 |
| 576 | 3300025972 | Ga0207668_10357232 | Ga0207668_103572322 | 240 |
| 577 | 3300026075 | Ga0207708_10025243 | Ga0207708_100252435 | 240 |
| 578 | 3300026089 | Ga0207648_10004276 | Ga0207648_1000427611 | 240 |
| 579 | 3300026118 | Ga0207675_100010693 | Ga0207675_10001069312 | 240 |
| 580 | 3300026121 | Ga0207683_10304958 | Ga0207683_103049583 | 240 |
| 581 | 3300026142 | Ga0207698_11045285 | Ga0207698_110452851 | 240 |
| 582 | 3300028380 | Ga0268265_10026796 | Ga0268265_100267963 | 240 |
| 583 | 3300028380 | Ga0268265_10048187 | Ga0268265_100481872 | 240 |
| 584 | 3300028380 | Ga0268265_10052565 | Ga0268265_100525653 | 240 |
| 585 | 3300028381 | Ga0268264_10019582 | Ga0268264_100195825 | 240 |
| 586 | 3300031344 | Ga0265316_10000129 | Ga0265316_1000012933 | 240 |
| 587 | 3300031824 | Ga0307413_10468300 | Ga0307413_104683002 | 240 |
| 588 | 3300035112 | Ga0373932_0136663 | Ga0373932_0136663_30_752 | 240 |
| 589 | 3300035207 | Ga0373942_0012519 | Ga0373942_0012519_115_837 | 240 |
| 590 | 3300035207 | Ga0373942_0022205 | Ga0373942_0022205_39_761 | 240 |
| 591 | 3300035691 | Ga0373931_0002407 | Ga0373931_0002407_6631_7353 | 240 |
| 592 | 3300035695 | Ga0373927_0318303 | Ga0373927_0318303_244_966 | 240 |
| 593 | 3300036401 | Ga0373937_0199334 | Ga0373937_0199334_1056_1778 | 240 |
| 594 | 3300036647 | Ga0316582_0075295 | Ga0316582_0075295_259_1011 | 240 |
| 595 | 3300037068 | Ga0373925_0009207 | Ga0373925_0009207_5298_6020 | 240 |
| 596 | 3300039447 | Ga0436361_0332176 | Ga0436361_0332176_43877_44599 | 240 |
| 597 | 3300041486 | Ga0451807_1301096 | Ga0451807_1301096_305_1027 | 240 |
| 598 | 3300041494 | Ga0451837_0356103 | Ga0451837_0356103_104_841 | 240 |
| 599 | 3300046477 | Ga0495664_0209872 | Ga0495664_0209872_130_852 | 240 |
| 600 | 3300046517 | Ga0495630_0330850 | Ga0495630_0330850_348_1070 | 240 |
| 601 | 3300046535 | Ga0495586_0122829 | Ga0495586_0122829_229_951 | 240 |
| 602 | 3300047317 | Ga0495604_0375593 | Ga0495604_0375593_137_859 | 240 |
| 603 | 3300047443 | Ga0495687_000596 | Ga0495687_000596_39269_39991 | 240 |
| 604 | 3300049574 | Ga0501038_0074322 | Ga0501038_0074322_1873_2595 | 240 |
| 605 | 3300049583 | Ga0501067_0147991 | Ga0501067_0147991_221_943 | 240 |
| 606 | 3300050496 | nmdc:mga07m45_19965_c1 | nmdc:mga07m45_19965_c1_618_1340 | 240 |
| 607 | 3300050512 | nmdc:mga0n895_6398_c1 | nmdc:mga0n895_6398_c1_5507_6229 | 240 |
| 608 | 3300050512 | nmdc:mga0n895_836151_c1 | nmdc:mga0n895_836151_c1_100_822 | 240 |
| 609 | 3300050513 | nmdc:mga0rr50_6385_c1 | nmdc:mga0rr50_6385_c1_461_1183 | 240 |
| 610 | 3300050513 | nmdc:mga0rr50_676651_c1 | nmdc:mga0rr50_676651_c1_19_741 | 240 |
| 611 | 3300050514 | nmdc:mga08x19_32951_c1 | nmdc:mga08x19_32951_c1_1264_1986 | 240 |
| 612 | 3300050514 | nmdc:mga08x19_51210_c1 | nmdc:mga08x19_51210_c1_65_787 | 240 |
| 613 | 3300050514 | nmdc:mga08x19_55184_c1 | nmdc:mga08x19_55184_c1_315_1037 | 240 |
| 614 | 3300050515 | nmdc:mga0a205_190348_c1 | nmdc:mga0a205_190348_c1_1102_1824 | 240 |
| 615 | 3300050515 | nmdc:mga0a205_355291_c1 | nmdc:mga0a205_355291_c1_271_993 | 240 |
| 616 | 3300002705 | JGI25156J39149_1000038 | JGI25156J39149_1000038105 | 241 |
| 617 | 3300002738 | JGI25154J39366_1003426 | JGI25154J39366_10034262 | 241 |
| 618 | 3300002741 | JGI25157J39369_1000127 | JGI25157J39369_10001276 | 241 |
| 619 | 3300003215 | JGI25153J46596_10003482 | JGI25153J46596_100034826 | 241 |
| 620 | 3300003751 | Ga0055538_1000019 | Ga0055538_1000019126 | 241 |
| 621 | 3300003752 | Ga0055539_1000024 | Ga0055539_1000024165 | 241 |
| 622 | 3300003756 | Ga0055533_1000024 | Ga0055533_1000024242 | 241 |
| 623 | 3300003756 | Ga0055533_1000032 | Ga0055533_1000032126 | 241 |
| 624 | 3300003759 | Ga0055525_1000041 | Ga0055525_1000041126 | 241 |
| 625 | 3300003761 | Ga0055535_1021772 | Ga0055535_10217721 | 241 |
| 626 | 3300003763 | Ga0055529_1000091 | Ga0055529_100009144 | 241 |
| 627 | 3300003771 | Ga0055526_1005273 | Ga0055526_10052735 | 241 |
| 628 | 3300003773 | Ga0055537_1000079 | Ga0055537_100007948 | 241 |
| 629 | 3300003775 | Ga0055524_1000012 | Ga0055524_100001263 | 241 |
| 630 | 3300003775 | Ga0055524_1000906 | Ga0055524_10009061 | 241 |
| 631 | 3300003775 | Ga0055524_1012257 | Ga0055524_10122571 | 241 |
| 632 | 3300003781 | Ga0055536_1015001 | Ga0055536_10150012 | 241 |
| 633 | 3300003784 | Ga0055534_1000092 | Ga0055534_100009233 | 241 |
| 634 | 3300003790 | Ga0055528_1000190 | Ga0055528_100019031 | 241 |
| 635 | 3300003790 | Ga0055528_1010252 | Ga0055528_10102522 | 241 |
| 636 | 3300003790 | Ga0055528_1042405 | Ga0055528_10424051 | 241 |
| 637 | 3300003791 | Ga0055530_10000793 | Ga0055530_100007934 | 241 |
| 638 | 3300003792 | Ga0055540_1000012 | Ga0055540_1000012182 | 241 |
| 639 | 3300003792 | Ga0055540_1009352 | Ga0055540_10093523 | 241 |
| 640 | 3300003794 | Ga0055531_10005878 | Ga0055531_100058782 | 241 |
| 641 | 3300003794 | Ga0055531_10010964 | Ga0055531_100109644 | 241 |
| 642 | 3300003794 | Ga0055531_10035313 | Ga0055531_100353131 | 241 |
| 643 | 3300003841 | Ga0055541_1000018 | Ga0055541_1000018165 | 241 |
| 644 | 3300005262 | Ga0065165_1000518 | Ga0065165_10005188 | 241 |
| 645 | 3300005262 | Ga0065165_1000980 | Ga0065165_100098018 | 241 |
| 646 | 3300005262 | Ga0065165_1001409 | Ga0065165_100140920 | 241 |
| 647 | 3300005288 | Ga0065714_10005383 | Ga0065714_100053833 | 241 |
| 648 | 3300005289 | Ga0065704_10139087 | Ga0065704_101390872 | 241 |
| 649 | 3300005327 | Ga0070658_10114258 | Ga0070658_101142583 | 241 |
| 650 | 3300005327 | Ga0070658_10125625 | Ga0070658_101256252 | 241 |
| 651 | 3300005327 | Ga0070658_10292834 | Ga0070658_102928341 | 241 |
| 652 | 3300005328 | Ga0070676_10002016 | Ga0070676_100020165 | 241 |
| 653 | 3300005328 | Ga0070676_10405141 | Ga0070676_104051411 | 241 |
| 654 | 3300005330 | Ga0070690_100021737 | Ga0070690_1000217372 | 241 |
| 655 | 3300005331 | Ga0070670_100049944 | Ga0070670_1000499443 | 241 |
| 656 | 3300005331 | Ga0070670_100133638 | Ga0070670_1001336382 | 241 |
| 657 | 3300005334 | Ga0068869_100009845 | Ga0068869_1000098456 | 241 |
| 658 | 3300005334 | Ga0068869_100099753 | Ga0068869_1000997532 | 241 |
| 659 | 3300005335 | Ga0070666_10027703 | Ga0070666_100277034 | 241 |
| 660 | 3300005336 | Ga0070680_100002933 | Ga0070680_1000029339 | 241 |
| 661 | 3300005338 | Ga0068868_100029892 | Ga0068868_1000298922 | 241 |
| 662 | 3300005340 | Ga0070689_100054502 | Ga0070689_1000545022 | 241 |
| 663 | 3300005353 | Ga0070669_100178152 | Ga0070669_1001781521 | 241 |
| 664 | 3300005354 | Ga0070675_100006945 | Ga0070675_1000069453 | 241 |
| 665 | 3300005354 | Ga0070675_100026797 | Ga0070675_1000267974 | 241 |
| 666 | 3300005354 | Ga0070675_100260126 | Ga0070675_1002601262 | 241 |
| 667 | 3300005355 | Ga0070671_100002690 | Ga0070671_10000269011 | 241 |
| 668 | 3300005355 | Ga0070671_100076175 | Ga0070671_1000761752 | 241 |
| 669 | 3300005355 | Ga0070671_100208978 | Ga0070671_1002089781 | 241 |
| 670 | 3300005356 | Ga0070674_100219904 | Ga0070674_1002199042 | 241 |
| 671 | 3300005356 | Ga0070674_100350757 | Ga0070674_1003507572 | 241 |
| 672 | 3300005364 | Ga0070673_100003204 | Ga0070673_1000032044 | 241 |
| 673 | 3300005364 | Ga0070673_100013983 | Ga0070673_1000139832 | 241 |
| 674 | 3300005364 | Ga0070673_100066341 | Ga0070673_1000663412 | 241 |
| 675 | 3300005364 | Ga0070673_100167844 | Ga0070673_1001678441 | 241 |
| 676 | 3300005366 | Ga0070659_100355020 | Ga0070659_1003550202 | 241 |
| 677 | 3300005366 | Ga0070659_100468659 | Ga0070659_1004686591 | 241 |
| 678 | 3300005367 | Ga0070667_100003701 | Ga0070667_1000037019 | 241 |
| 679 | 3300005367 | Ga0070667_100003920 | Ga0070667_10000392013 | 241 |
| 680 | 3300005367 | Ga0070667_100062101 | Ga0070667_1000621011 | 241 |
| 681 | 3300005367 | Ga0070667_100244065 | Ga0070667_1002440652 | 241 |
| 682 | 3300005441 | Ga0070700_100189567 | Ga0070700_1001895672 | 241 |
| 683 | 3300005455 | Ga0070663_100237767 | Ga0070663_1002377672 | 241 |
| 684 | 3300005456 | Ga0070678_100182672 | Ga0070678_1001826722 | 241 |
| 685 | 3300005456 | Ga0070678_100564619 | Ga0070678_1005646192 | 241 |
| 686 | 3300005457 | Ga0070662_100044679 | Ga0070662_1000446792 | 241 |
| 687 | 3300005459 | Ga0068867_100279741 | Ga0068867_1002797411 | 241 |
| 688 | 3300005459 | Ga0068867_100341008 | Ga0068867_1003410082 | 241 |
| 689 | 3300005466 | Ga0070685_10158437 | Ga0070685_101584372 | 241 |
| 690 | 3300005468 | Ga0070707_100176922 | Ga0070707_1001769223 | 241 |
| 691 | 3300005530 | Ga0070679_100007594 | Ga0070679_1000075949 | 241 |
| 692 | 3300005530 | Ga0070679_100387773 | Ga0070679_1003877732 | 241 |
| 693 | 3300005539 | Ga0068853_100062690 | Ga0068853_1000626902 | 241 |
| 694 | 3300005539 | Ga0068853_100114341 | Ga0068853_1001143412 | 241 |
| 695 | 3300005543 | Ga0070672_100017855 | Ga0070672_1000178552 | 241 |
| 696 | 3300005543 | Ga0070672_100019023 | Ga0070672_1000190232 | 241 |
| 697 | 3300005543 | Ga0070672_100026297 | Ga0070672_1000262973 | 241 |
| 698 | 3300005543 | Ga0070672_100194320 | Ga0070672_1001943202 | 241 |
| 699 | 3300005543 | Ga0070672_100352658 | Ga0070672_1003526582 | 241 |
| 700 | 3300005544 | Ga0070686_100232689 | Ga0070686_1002326892 | 241 |
| 701 | 3300005548 | Ga0070665_100053806 | Ga0070665_1000538063 | 241 |
| 702 | 3300005548 | Ga0070665_100087815 | Ga0070665_1000878152 | 241 |
| 703 | 3300005563 | Ga0068855_100025134 | Ga0068855_1000251347 | 241 |
| 704 | 3300005563 | Ga0068855_100066947 | Ga0068855_1000669475 | 241 |
| 705 | 3300005563 | Ga0068855_100391310 | Ga0068855_1003913102 | 241 |
| 706 | 3300005563 | Ga0068855_100747008 | Ga0068855_1007470081 | 241 |
| 707 | 3300005563 | Ga0068855_101260903 | Ga0068855_1012609031 | 241 |
| 708 | 3300005578 | Ga0068854_100004342 | Ga0068854_10000434212 | 241 |
| 709 | 3300005578 | Ga0068854_100006043 | Ga0068854_1000060437 | 241 |
| 710 | 3300005614 | Ga0068856_100002740 | Ga0068856_10000274014 | 241 |
| 711 | 3300005614 | Ga0068856_100299357 | Ga0068856_1002993571 | 241 |
| 712 | 3300005616 | Ga0068852_100392534 | Ga0068852_1003925342 | 241 |
| 713 | 3300005616 | Ga0068852_100485267 | Ga0068852_1004852672 | 241 |
| 714 | 3300005617 | Ga0068859_100010093 | Ga0068859_1000100933 | 241 |
| 715 | 3300005617 | Ga0068859_100031472 | Ga0068859_1000314722 | 241 |
| 716 | 3300005618 | Ga0068864_100000511 | Ga0068864_10000051126 | 241 |
| 717 | 3300005618 | Ga0068864_100007732 | Ga0068864_1000077325 | 241 |
| 718 | 3300005618 | Ga0068864_100070344 | Ga0068864_1000703442 | 241 |
| 719 | 3300005618 | Ga0068864_100310035 | Ga0068864_1003100351 | 241 |
| 720 | 3300005719 | Ga0068861_100014651 | Ga0068861_1000146513 | 241 |
| 721 | 3300005719 | Ga0068861_100033936 | Ga0068861_1000339362 | 241 |
| 722 | 3300005840 | Ga0068870_10010438 | Ga0068870_100104382 | 241 |
| 723 | 3300005840 | Ga0068870_10013784 | Ga0068870_100137843 | 241 |
| 724 | 3300005841 | Ga0068863_100023710 | Ga0068863_1000237104 | 241 |
| 725 | 3300005841 | Ga0068863_100248906 | Ga0068863_1002489062 | 241 |
| 726 | 3300005841 | Ga0068863_100640784 | Ga0068863_1006407842 | 241 |
| 727 | 3300005842 | Ga0068858_100000359 | Ga0068858_10000035928 | 241 |
| 728 | 3300005842 | Ga0068858_100012197 | Ga0068858_1000121972 | 241 |
| 729 | 3300005843 | Ga0068860_100005022 | Ga0068860_1000050228 | 241 |
| 730 | 3300005843 | Ga0068860_100176967 | Ga0068860_1001769672 | 241 |
| 731 | 3300005844 | Ga0068862_100062862 | Ga0068862_1000628622 | 241 |
| 732 | 3300006038 | Ga0075365_10005796 | Ga0075365_100057969 | 241 |
| 733 | 3300006042 | Ga0075368_10056248 | Ga0075368_100562482 | 241 |
| 734 | 3300006042 | Ga0075368_10090039 | Ga0075368_100900393 | 241 |
| 735 | 3300006048 | Ga0075363_100012260 | Ga0075363_1000122603 | 241 |
| 736 | 3300006048 | Ga0075363_100175349 | Ga0075363_1001753491 | 241 |
| 737 | 3300006058 | Ga0075432_10017514 | Ga0075432_100175142 | 241 |
| 738 | 3300006058 | Ga0075432_10022694 | Ga0075432_100226942 | 241 |
| 739 | 3300006177 | Ga0075362_10003584 | Ga0075362_100035847 | 241 |
| 740 | 3300006177 | Ga0075362_10051082 | Ga0075362_100510822 | 241 |
| 741 | 3300006177 | Ga0075362_10127700 | Ga0075362_101277002 | 241 |
| 742 | 3300006178 | Ga0075367_10066842 | Ga0075367_100668422 | 241 |
| 743 | 3300006178 | Ga0075367_10108032 | Ga0075367_101080323 | 241 |
| 744 | 3300006178 | Ga0075367_10301603 | Ga0075367_103016032 | 241 |
| 745 | 3300006186 | Ga0075369_10060814 | Ga0075369_100608142 | 241 |
| 746 | 3300006195 | Ga0075366_10004469 | Ga0075366_100044692 | 241 |
| 747 | 3300006195 | Ga0075366_10020423 | Ga0075366_100204232 | 241 |
| 748 | 3300006195 | Ga0075366_10037035 | Ga0075366_100370352 | 241 |
| 749 | 3300006195 | Ga0075366_10089177 | Ga0075366_100891772 | 241 |
| 750 | 3300006195 | Ga0075366_10146550 | Ga0075366_101465501 | 241 |
| 751 | 3300006237 | Ga0097621_100038943 | Ga0097621_1000389433 | 241 |
| 752 | 3300006237 | Ga0097621_100083278 | Ga0097621_1000832782 | 241 |
| 753 | 3300006237 | Ga0097621_100125218 | Ga0097621_1001252182 | 241 |
| 754 | 3300006237 | Ga0097621_100645787 | Ga0097621_1006457872 | 241 |
| 755 | 3300006353 | Ga0075370_10005799 | Ga0075370_100057999 | 241 |
| 756 | 3300006353 | Ga0075370_10006317 | Ga0075370_100063174 | 241 |
| 757 | 3300006353 | Ga0075370_10019233 | Ga0075370_100192334 | 241 |
| 758 | 3300006353 | Ga0075370_10020703 | Ga0075370_100207034 | 241 |
| 759 | 3300006358 | Ga0068871_100063242 | Ga0068871_1000632422 | 241 |
| 760 | 3300006880 | Ga0075429_100083054 | Ga0075429_1000830542 | 241 |
| 761 | 3300006881 | Ga0068865_100028443 | Ga0068865_1000284432 | 241 |
| 762 | 3300006931 | Ga0097620_100010093 | Ga0097620_1000100933 | 241 |
| 763 | 3300006931 | Ga0097620_100031472 | Ga0097620_1000314722 | 241 |
| 764 | 3300006944 | Ga0099823_1000164 | Ga0099823_100016419 | 241 |
| 765 | 3300006948 | Ga0099826_10000115 | Ga0099826_1000011527 | 241 |
| 766 | 3300006948 | Ga0099826_10072191 | Ga0099826_100721913 | 241 |
| 767 | 3300009093 | Ga0105240_10003642 | Ga0105240_1000364217 | 241 |
| 768 | 3300009093 | Ga0105240_10013081 | Ga0105240_1001308111 | 241 |
| 769 | 3300009093 | Ga0105240_10061931 | Ga0105240_100619315 | 241 |
| 770 | 3300009093 | Ga0105240_10102953 | Ga0105240_101029532 | 241 |
| 771 | 3300009094 | Ga0111539_10312175 | Ga0111539_103121753 | 241 |
| 772 | 3300009098 | Ga0105245_10046664 | Ga0105245_100466644 | 241 |
| 773 | 3300009098 | Ga0105245_10126766 | Ga0105245_101267662 | 241 |
| 774 | 3300009098 | Ga0105245_10179212 | Ga0105245_101792122 | 241 |
| 775 | 3300009098 | Ga0105245_10211209 | Ga0105245_102112092 | 241 |
| 776 | 3300009148 | Ga0105243_10045138 | Ga0105243_100451382 | 241 |
| 777 | 3300009148 | Ga0105243_10272668 | Ga0105243_102726682 | 241 |
| 778 | 3300009148 | Ga0105243_10796596 | Ga0105243_107965962 | 241 |
| 779 | 3300009174 | Ga0105241_10056280 | Ga0105241_100562802 | 241 |
| 780 | 3300009174 | Ga0105241_10526652 | Ga0105241_105266522 | 241 |
| 781 | 3300009176 | Ga0105242_10121670 | Ga0105242_101216702 | 241 |
| 782 | 3300009177 | Ga0105248_10001109 | Ga0105248_1000110929 | 241 |
| 783 | 3300009177 | Ga0105248_10736134 | Ga0105248_107361342 | 241 |
| 784 | 3300009545 | Ga0105237_10002223 | Ga0105237_100022239 | 241 |
| 785 | 3300009545 | Ga0105237_10014808 | Ga0105237_100148082 | 241 |
| 786 | 3300009545 | Ga0105237_10054485 | Ga0105237_100544853 | 241 |
| 787 | 3300009545 | Ga0105237_10245328 | Ga0105237_102453282 | 241 |
| 788 | 3300009551 | Ga0105238_10000128 | Ga0105238_1000012849 | 241 |
| 789 | 3300009551 | Ga0105238_10006811 | Ga0105238_1000681114 | 241 |
| 790 | 3300009551 | Ga0105238_10027040 | Ga0105238_100270402 | 241 |
| 791 | 3300009553 | Ga0105249_10084089 | Ga0105249_100840894 | 241 |
| 792 | 3300010375 | Ga0105239_10000470 | Ga0105239_1000047046 | 241 |
| 793 | 3300010375 | Ga0105239_10023748 | Ga0105239_100237486 | 241 |
| 794 | 3300010375 | Ga0105239_10131049 | Ga0105239_101310492 | 241 |
| 795 | 3300010375 | Ga0105239_10687542 | Ga0105239_106875422 | 241 |
| 796 | 3300011119 | Ga0105246_10145831 | Ga0105246_101458313 | 241 |
| 797 | 3300011119 | Ga0105246_10159810 | Ga0105246_101598101 | 241 |
| 798 | 3300012497 | Ga0157319_1000017 | Ga0157319_100001790 | 241 |
| 799 | 3300012502 | Ga0157347_1005390 | Ga0157347_10053902 | 241 |
| 800 | 3300013104 | Ga0157370_10165877 | Ga0157370_101658772 | 241 |
| 801 | 3300013105 | Ga0157369_10039971 | Ga0157369_100399715 | 241 |
| 802 | 3300013296 | Ga0157374_10040292 | Ga0157374_100402923 | 241 |
| 803 | 3300013297 | Ga0157378_10351365 | Ga0157378_103513651 | 241 |
| 804 | 3300013307 | Ga0157372_10140502 | Ga0157372_101405023 | 241 |
| 805 | 3300013308 | Ga0157375_10029286 | Ga0157375_100292863 | 241 |
| 806 | 3300013308 | Ga0157375_10110281 | Ga0157375_101102812 | 241 |
| 807 | 3300013308 | Ga0157375_10498754 | Ga0157375_104987541 | 241 |
| 808 | 3300014325 | Ga0163163_10010941 | Ga0163163_100109418 | 241 |
| 809 | 3300014326 | Ga0157380_10417405 | Ga0157380_104174051 | 241 |
| 810 | 3300014745 | Ga0157377_10075116 | Ga0157377_100751162 | 241 |
| 811 | 3300014968 | Ga0157379_10159004 | Ga0157379_101590042 | 241 |
| 812 | 3300014969 | Ga0157376_10002980 | Ga0157376_100029809 | 241 |
| 813 | 3300014969 | Ga0157376_10027826 | Ga0157376_100278262 | 241 |
| 814 | 3300014969 | Ga0157376_10106684 | Ga0157376_101066842 | 241 |
| 815 | 3300017792 | Ga0163161_10000092 | Ga0163161_1000009286 | 241 |
| 816 | 3300017792 | Ga0163161_10001617 | Ga0163161_1000161717 | 241 |
| 817 | 3300017792 | Ga0163161_10044124 | Ga0163161_100441244 | 241 |
| 818 | 3300021361 | Ga0213872_10000008 | Ga0213872_1000000897 | 241 |
| 819 | 3300021361 | Ga0213872_10000058 | Ga0213872_1000005842 | 241 |
| 820 | 3300021361 | Ga0213872_10004816 | Ga0213872_100048167 | 241 |
| 821 | 3300021361 | Ga0213872_10055839 | Ga0213872_100558391 | 241 |
| 822 | 3300021361 | Ga0213872_10122518 | Ga0213872_101225181 | 241 |
| 823 | 3300025224 | Ga0209784_100009 | Ga0209784_100009233 | 241 |
| 824 | 3300025225 | Ga0209566_100007 | Ga0209566_100007233 | 241 |
| 825 | 3300025226 | Ga0209674_100007 | Ga0209674_100007283 | 241 |
| 826 | 3300025226 | Ga0209674_100018 | Ga0209674_100018233 | 241 |
| 827 | 3300025228 | Ga0209672_109733 | Ga0209672_1097332 | 241 |
| 828 | 3300025230 | Ga0209563_100013 | Ga0209563_100013699 | 241 |
| 829 | 3300025230 | Ga0209563_100020 | Ga0209563_100020233 | 241 |
| 830 | 3300025230 | Ga0209563_100052 | Ga0209563_100052327 | 241 |
| 831 | 3300025231 | Ga0207427_100859 | Ga0207427_1008595 | 241 |
| 832 | 3300025242 | Ga0209258_100177 | Ga0209258_10017788 | 241 |
| 833 | 3300025242 | Ga0209258_100534 | Ga0209258_10053427 | 241 |
| 834 | 3300025246 | Ga0209646_1000094 | Ga0209646_100009465 | 241 |
| 835 | 3300025250 | Ga0209026_1000009 | Ga0209026_1000009136 | 241 |
| 836 | 3300025253 | Ga0209677_100010 | Ga0209677_100010233 | 241 |
| 837 | 3300025253 | Ga0209677_100015 | Ga0209677_100015507 | 241 |
| 838 | 3300025253 | Ga0209677_100097 | Ga0209677_10009777 | 241 |
| 839 | 3300025254 | Ga0209148_1002932 | Ga0209148_10029326 | 241 |
| 840 | 3300025256 | Ga0209759_1000065 | Ga0209759_1000065136 | 241 |
| 841 | 3300025256 | Ga0209759_1000399 | Ga0209759_100039944 | 241 |
| 842 | 3300025263 | Ga0209565_1000073 | Ga0209565_100007339 | 241 |
| 843 | 3300025272 | Ga0209455_1000108 | Ga0209455_100010844 | 241 |
| 844 | 3300025272 | Ga0209455_1030565 | Ga0209455_10305652 | 241 |
| 845 | 3300025273 | Ga0209673_1000127 | Ga0209673_1000127128 | 241 |
| 846 | 3300025273 | Ga0209673_1001619 | Ga0209673_10016197 | 241 |
| 847 | 3300025273 | Ga0209673_1003739 | Ga0209673_10037392 | 241 |
| 848 | 3300025273 | Ga0209673_1004525 | Ga0209673_10045257 | 241 |
| 849 | 3300025273 | Ga0209673_1035444 | Ga0209673_10354441 | 241 |
| 850 | 3300025291 | Ga0209675_1000029 | Ga0209675_1000029128 | 241 |
| 851 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003216 | 241 |
| 852 | 3300025297 | Ga0209758_1000434 | Ga0209758_10004349 | 241 |
| 853 | 3300025298 | Ga0209050_1000197 | Ga0209050_100019791 | 241 |
| 854 | 3300025298 | Ga0209050_1009006 | Ga0209050_10090062 | 241 |
| 855 | 3300025299 | Ga0209256_1000249 | Ga0209256_100024985 | 241 |
| 856 | 3300025299 | Ga0209256_1000826 | Ga0209256_100082633 | 241 |
| 857 | 3300025303 | Ga0209051_1001309 | Ga0209051_10013097 | 241 |
| 858 | 3300025303 | Ga0209051_1003649 | Ga0209051_100364910 | 241 |
| 859 | 3300025303 | Ga0209051_1007414 | Ga0209051_10074142 | 241 |
| 860 | 3300025303 | Ga0209051_1059008 | Ga0209051_10590082 | 241 |
| 861 | 3300025304 | Ga0209257_1000967 | Ga0209257_10009673 | 241 |
| 862 | 3300025304 | Ga0209257_1001007 | Ga0209257_10010071 | 241 |
| 863 | 3300025304 | Ga0209257_1033542 | Ga0209257_10335422 | 241 |
| 864 | 3300025893 | Ga0207682_10051234 | Ga0207682_100512341 | 241 |
| 865 | 3300025903 | Ga0207680_10005639 | Ga0207680_100056398 | 241 |
| 866 | 3300025907 | Ga0207645_10001387 | Ga0207645_1000138717 | 241 |
| 867 | 3300025907 | Ga0207645_10029556 | Ga0207645_100295562 | 241 |
| 868 | 3300025908 | Ga0207643_10022995 | Ga0207643_100229952 | 241 |
| 869 | 3300025911 | Ga0207654_10058662 | Ga0207654_100586622 | 241 |
| 870 | 3300025911 | Ga0207654_10145045 | Ga0207654_101450452 | 241 |
| 871 | 3300025913 | Ga0207695_10002390 | Ga0207695_1000239016 | 241 |
| 872 | 3300025913 | Ga0207695_10012192 | Ga0207695_100121925 | 241 |
| 873 | 3300025913 | Ga0207695_10013685 | Ga0207695_100136858 | 241 |
| 874 | 3300025913 | Ga0207695_10580776 | Ga0207695_105807761 | 241 |
| 875 | 3300025913 | Ga0207695_10881394 | Ga0207695_108813941 | 241 |
| 876 | 3300025914 | Ga0207671_10002553 | Ga0207671_100025538 | 241 |
| 877 | 3300025914 | Ga0207671_10015484 | Ga0207671_100154844 | 241 |
| 878 | 3300025918 | Ga0207662_10318155 | Ga0207662_103181551 | 241 |
| 879 | 3300025921 | Ga0207652_10261987 | Ga0207652_102619872 | 241 |
| 880 | 3300025923 | Ga0207681_10026326 | Ga0207681_100263264 | 241 |
| 881 | 3300025924 | Ga0207694_10000845 | Ga0207694_100008452 | 241 |
| 882 | 3300025924 | Ga0207694_10100564 | Ga0207694_101005642 | 241 |
| 883 | 3300025924 | Ga0207694_10356833 | Ga0207694_103568331 | 241 |
| 884 | 3300025925 | Ga0207650_10001201 | Ga0207650_100012012 | 241 |
| 885 | 3300025925 | Ga0207650_10378684 | Ga0207650_103786842 | 241 |
| 886 | 3300025926 | Ga0207659_10004014 | Ga0207659_100040146 | 241 |
| 887 | 3300025926 | Ga0207659_10484340 | Ga0207659_104843401 | 241 |
| 888 | 3300025927 | Ga0207687_10083859 | Ga0207687_100838593 | 241 |
| 889 | 3300025927 | Ga0207687_10090142 | Ga0207687_100901422 | 241 |
| 890 | 3300025927 | Ga0207687_10181807 | Ga0207687_101818072 | 241 |
| 891 | 3300025927 | Ga0207687_10239966 | Ga0207687_102399662 | 241 |
| 892 | 3300025931 | Ga0207644_10030413 | Ga0207644_100304134 | 241 |
| 893 | 3300025931 | Ga0207644_10042292 | Ga0207644_100422923 | 241 |
| 894 | 3300025931 | Ga0207644_10067092 | Ga0207644_100670922 | 241 |
| 895 | 3300025931 | Ga0207644_10557922 | Ga0207644_105579221 | 241 |
| 896 | 3300025933 | Ga0207706_10023128 | Ga0207706_100231282 | 241 |
| 897 | 3300025933 | Ga0207706_10045929 | Ga0207706_100459292 | 241 |
| 898 | 3300025933 | Ga0207706_10164206 | Ga0207706_101642062 | 241 |
| 899 | 3300025933 | Ga0207706_10177181 | Ga0207706_101771812 | 241 |
| 900 | 3300025934 | Ga0207686_10052497 | Ga0207686_100524972 | 241 |
| 901 | 3300025936 | Ga0207670_10132842 | Ga0207670_101328422 | 241 |
| 902 | 3300025938 | Ga0207704_10610881 | Ga0207704_106108812 | 241 |
| 903 | 3300025940 | Ga0207691_10010208 | Ga0207691_100102083 | 241 |
| 904 | 3300025940 | Ga0207691_10010671 | Ga0207691_100106718 | 241 |
| 905 | 3300025940 | Ga0207691_10030243 | Ga0207691_100302432 | 241 |
| 906 | 3300025941 | Ga0207711_10102212 | Ga0207711_101022122 | 241 |
| 907 | 3300025941 | Ga0207711_10517025 | Ga0207711_105170251 | 241 |
| 908 | 3300025942 | Ga0207689_10091430 | Ga0207689_100914302 | 241 |
| 909 | 3300025942 | Ga0207689_10119625 | Ga0207689_101196252 | 241 |
| 910 | 3300025942 | Ga0207689_10140031 | Ga0207689_101400312 | 241 |
| 911 | 3300025945 | Ga0207679_10127792 | Ga0207679_101277922 | 241 |
| 912 | 3300025945 | Ga0207679_10195037 | Ga0207679_101950372 | 241 |
| 913 | 3300025945 | Ga0207679_10210005 | Ga0207679_102100051 | 241 |
| 914 | 3300025949 | Ga0207667_10000115 | Ga0207667_1000011583 | 241 |
| 915 | 3300025949 | Ga0207667_10021146 | Ga0207667_100211465 | 241 |
| 916 | 3300025949 | Ga0207667_10054967 | Ga0207667_100549671 | 241 |
| 917 | 3300025949 | Ga0207667_10857480 | Ga0207667_108574801 | 241 |
| 918 | 3300025960 | Ga0207651_10001269 | Ga0207651_1000126911 | 241 |
| 919 | 3300025960 | Ga0207651_10041063 | Ga0207651_100410633 | 241 |
| 920 | 3300025960 | Ga0207651_10060444 | Ga0207651_100604442 | 241 |
| 921 | 3300025960 | Ga0207651_10091726 | Ga0207651_100917262 | 241 |
| 922 | 3300025960 | Ga0207651_10586467 | Ga0207651_105864672 | 241 |
| 923 | 3300025961 | Ga0207712_10112224 | Ga0207712_101122242 | 241 |
| 924 | 3300025972 | Ga0207668_10129222 | Ga0207668_101292222 | 241 |
| 925 | 3300025981 | Ga0207640_10004685 | Ga0207640_100046859 | 241 |
| 926 | 3300025981 | Ga0207640_10031818 | Ga0207640_100318182 | 241 |
| 927 | 3300025986 | Ga0207658_10036650 | Ga0207658_100366504 | 241 |
| 928 | 3300025986 | Ga0207658_10080039 | Ga0207658_100800393 | 241 |
| 929 | 3300025986 | Ga0207658_10112044 | Ga0207658_101120442 | 241 |
| 930 | 3300025986 | Ga0207658_10113311 | Ga0207658_101133111 | 241 |
| 931 | 3300025986 | Ga0207658_10337974 | Ga0207658_103379742 | 241 |
| 932 | 3300026023 | Ga0207677_10149004 | Ga0207677_101490042 | 241 |
| 933 | 3300026023 | Ga0207677_10249226 | Ga0207677_102492262 | 241 |
| 934 | 3300026035 | Ga0207703_10001821 | Ga0207703_100018214 | 241 |
| 935 | 3300026035 | Ga0207703_10811799 | Ga0207703_108117991 | 241 |
| 936 | 3300026041 | Ga0207639_10287590 | Ga0207639_102875901 | 241 |
| 937 | 3300026041 | Ga0207639_10698061 | Ga0207639_106980612 | 241 |
| 938 | 3300026067 | Ga0207678_10151115 | Ga0207678_101511152 | 241 |
| 939 | 3300026067 | Ga0207678_10258477 | Ga0207678_102584772 | 241 |
| 940 | 3300026078 | Ga0207702_10000610 | Ga0207702_1000061022 | 241 |
| 941 | 3300026078 | Ga0207702_10222666 | Ga0207702_102226662 | 241 |
| 942 | 3300026088 | Ga0207641_10001726 | Ga0207641_100017264 | 241 |
| 943 | 3300026088 | Ga0207641_10146922 | Ga0207641_101469222 | 241 |
| 944 | 3300026088 | Ga0207641_10286134 | Ga0207641_102861342 | 241 |
| 945 | 3300026088 | Ga0207641_10480680 | Ga0207641_104806802 | 241 |
| 946 | 3300026095 | Ga0207676_10003149 | Ga0207676_100031497 | 241 |
| 947 | 3300026095 | Ga0207676_10016394 | Ga0207676_100163944 | 241 |
| 948 | 3300026095 | Ga0207676_10038548 | Ga0207676_100385484 | 241 |
| 949 | 3300026095 | Ga0207676_10176613 | Ga0207676_101766132 | 241 |
| 950 | 3300026095 | Ga0207676_10365056 | Ga0207676_103650562 | 241 |
| 951 | 3300026116 | Ga0207674_10031491 | Ga0207674_100314912 | 241 |
| 952 | 3300026116 | Ga0207674_10610662 | Ga0207674_106106622 | 241 |
| 953 | 3300026118 | Ga0207675_100052369 | Ga0207675_1000523692 | 241 |
| 954 | 3300026118 | Ga0207675_100491553 | Ga0207675_1004915532 | 241 |
| 955 | 3300026121 | Ga0207683_10010783 | Ga0207683_100107838 | 241 |
| 956 | 3300026121 | Ga0207683_10046957 | Ga0207683_100469572 | 241 |
| 957 | 3300026121 | Ga0207683_10158482 | Ga0207683_101584822 | 241 |
| 958 | 3300026142 | Ga0207698_10004168 | Ga0207698_100041689 | 241 |
| 959 | 3300027296 | Ga0209389_1013653 | Ga0209389_10136532 | 241 |
| 960 | 3300027312 | Ga0209371_1013896 | Ga0209371_10138961 | 241 |
| 961 | 3300027614 | Ga0209970_1000515 | Ga0209970_10005155 | 241 |
| 962 | 3300027665 | Ga0209983_1063511 | Ga0209983_10635111 | 241 |
| 963 | 3300027666 | Ga0209282_1000109 | Ga0209282_100010927 | 241 |
| 964 | 3300027866 | Ga0209813_10024848 | Ga0209813_100248482 | 241 |
| 965 | 3300027876 | Ga0209974_10026849 | Ga0209974_100268492 | 241 |
| 966 | 3300027907 | Ga0207428_10059781 | Ga0207428_100597812 | 241 |
| 967 | 3300027907 | Ga0207428_10164516 | Ga0207428_101645162 | 241 |
| 968 | 3300028379 | Ga0268266_10125043 | Ga0268266_101250432 | 241 |
| 969 | 3300028380 | Ga0268265_10073151 | Ga0268265_100731512 | 241 |
| 970 | 3300028380 | Ga0268265_10434984 | Ga0268265_104349842 | 241 |
| 971 | 3300028381 | Ga0268264_10007099 | Ga0268264_100070998 | 241 |
| 972 | 3300028381 | Ga0268264_10175698 | Ga0268264_101756982 | 241 |
| 973 | 3300028381 | Ga0268264_10838651 | Ga0268264_108386511 | 241 |
| 974 | 3300028573 | Ga0265334_10018680 | Ga0265334_100186802 | 241 |
| 975 | 3300028786 | Ga0307517_10008692 | Ga0307517_100086922 | 241 |
| 976 | 3300028786 | Ga0307517_10123385 | Ga0307517_101233852 | 241 |
| 977 | 3300028786 | Ga0307517_10161501 | Ga0307517_101615012 | 241 |
| 978 | 3300028794 | Ga0307515_10000049 | Ga0307515_10000049212 | 241 |
| 979 | 3300028794 | Ga0307515_10000066 | Ga0307515_10000066101 | 241 |
| 980 | 3300028794 | Ga0307515_10000842 | Ga0307515_1000084255 | 241 |
| 981 | 3300028794 | Ga0307515_10001640 | Ga0307515_1000164033 | 241 |
| 982 | 3300028794 | Ga0307515_10020605 | Ga0307515_1002060511 | 241 |
| 983 | 3300028794 | Ga0307515_10031977 | Ga0307515_100319775 | 241 |
| 984 | 3300028794 | Ga0307515_10054917 | Ga0307515_100549175 | 241 |
| 985 | 3300028794 | Ga0307515_10066935 | Ga0307515_100669353 | 241 |
| 986 | 3300028794 | Ga0307515_10131211 | Ga0307515_101312112 | 241 |
| 987 | 3300028794 | Ga0307515_10157014 | Ga0307515_101570142 | 241 |
| 988 | 3300030500 | Ga0268256_1015399 | Ga0268256_10153992 | 241 |
| 989 | 3300030522 | Ga0307512_10035373 | Ga0307512_100353732 | 241 |
| 990 | 3300030522 | Ga0307512_10045448 | Ga0307512_100454483 | 241 |
| 991 | 3300030744 | Ga0316181_1119047 | Ga0316181_11190472 | 241 |
| 992 | 3300030745 | Ga0316182_1368921 | Ga0316182_13689214 | 241 |
| 993 | 3300031250 | Ga0265331_10001109 | Ga0265331_100011096 | 241 |
| 994 | 3300031251 | Ga0265327_10000120 | Ga0265327_10000120140 | 241 |
| 995 | 3300031456 | Ga0307513_10003449 | Ga0307513_1000344914 | 241 |
| 996 | 3300031456 | Ga0307513_10040446 | Ga0307513_100404465 | 241 |
| 997 | 3300031456 | Ga0307513_10069344 | Ga0307513_100693445 | 241 |
| 998 | 3300031507 | Ga0307509_10006861 | Ga0307509_100068618 | 241 |
| 999 | 3300031507 | Ga0307509_10010424 | Ga0307509_100104245 | 241 |
| 1000 | 3300031507 | Ga0307509_10019730 | Ga0307509_100197306 | 241 |
| 1001 | 3300031507 | Ga0307509_10111462 | Ga0307509_101114622 | 241 |
| 1002 | 3300031507 | Ga0307509_10111577 | Ga0307509_101115773 | 241 |
| 1003 | 3300031548 | Ga0307408_100308956 | Ga0307408_1003089562 | 241 |
| 1004 | 3300031548 | Ga0307408_100508123 | Ga0307408_1005081232 | 241 |
| 1005 | 3300031616 | Ga0307508_10000097 | Ga0307508_1000009795 | 241 |
| 1006 | 3300031616 | Ga0307508_10002774 | Ga0307508_1000277411 | 241 |
| 1007 | 3300031616 | Ga0307508_10049288 | Ga0307508_100492882 | 241 |
| 1008 | 3300031649 | Ga0307514_10001372 | Ga0307514_1000137223 | 241 |
| 1009 | 3300031649 | Ga0307514_10002956 | Ga0307514_100029568 | 241 |
| 1010 | 3300031649 | Ga0307514_10197345 | Ga0307514_101973452 | 241 |
| 1011 | 3300031711 | Ga0265314_10089035 | Ga0265314_100890352 | 241 |
| 1012 | 3300031712 | Ga0265342_10134325 | Ga0265342_101343252 | 241 |
| 1013 | 3300031712 | Ga0265342_10208227 | Ga0265342_102082271 | 241 |
| 1014 | 3300031727 | Ga0316576_10001183 | Ga0316576_100011836 | 241 |
| 1015 | 3300031727 | Ga0316576_10070664 | Ga0316576_100706642 | 241 |
| 1016 | 3300031728 | Ga0316578_10029623 | Ga0316578_100296234 | 241 |
| 1017 | 3300031730 | Ga0307516_10002245 | Ga0307516_1000224515 | 241 |
| 1018 | 3300031730 | Ga0307516_10006152 | Ga0307516_1000615210 | 241 |
| 1019 | 3300031730 | Ga0307516_10052707 | Ga0307516_100527073 | 241 |
| 1020 | 3300031730 | Ga0307516_10141051 | Ga0307516_101410512 | 241 |
| 1021 | 3300031730 | Ga0307516_10273936 | Ga0307516_102739362 | 241 |
| 1022 | 3300031731 | Ga0307405_10137989 | Ga0307405_101379892 | 241 |
| 1023 | 3300031731 | Ga0307405_10195011 | Ga0307405_101950111 | 241 |
| 1024 | 3300031731 | Ga0307405_10401191 | Ga0307405_104011912 | 241 |
| 1025 | 3300031733 | Ga0316577_10003998 | Ga0316577_100039984 | 241 |
| 1026 | 3300031838 | Ga0307518_10190276 | Ga0307518_101902762 | 241 |
| 1027 | 3300031852 | Ga0307410_10169160 | Ga0307410_101691602 | 241 |
| 1028 | 3300031903 | Ga0307407_10025101 | Ga0307407_100251012 | 241 |
| 1029 | 3300031911 | Ga0307412_10226921 | Ga0307412_102269212 | 241 |
| 1030 | 3300031995 | Ga0307409_100276739 | Ga0307409_1002767392 | 241 |
| 1031 | 3300032002 | Ga0307416_100010663 | Ga0307416_1000106635 | 241 |
| 1032 | 3300032002 | Ga0307416_100220902 | Ga0307416_1002209022 | 241 |
| 1033 | 3300032002 | Ga0307416_100263350 | Ga0307416_1002633502 | 241 |
| 1034 | 3300032005 | Ga0307411_10010818 | Ga0307411_100108185 | 241 |
| 1035 | 3300032005 | Ga0307411_10124552 | Ga0307411_101245522 | 241 |
| 1036 | 3300032126 | Ga0307415_100001705 | Ga0307415_1000017059 | 241 |
| 1037 | 3300032137 | Ga0316585_10011773 | Ga0316585_100117731 | 241 |
| 1038 | 3300033179 | Ga0307507_10063271 | Ga0307507_100632712 | 241 |
| 1039 | 3300033180 | Ga0307510_10000311 | Ga0307510_1000031114 | 241 |
| 1040 | 3300033541 | Ga0316596_1007375 | Ga0316596_10073754 | 241 |
| 1041 | 3300035089 | Ga0373944_0014357 | Ga0373944_0014357_243_968 | 241 |
| 1042 | 3300035691 | Ga0373931_0004639 | Ga0373931_0004639_3328_4053 | 241 |
| 1043 | 3300035691 | Ga0373931_0006945 | Ga0373931_0006945_3115_3915 | 241 |
| 1044 | 3300037418 | Ga0395900_0000054 | Ga0395900_0000054_43835_44560 | 241 |
| 1045 | 3300037418 | Ga0395900_0113192 | Ga0395900_0113192_533_1261 | 241 |
| 1046 | 3300037418 | Ga0395900_0262176 | Ga0395900_0262176_38_763 | 241 |
| 1047 | 3300037466 | Ga0395898_0000798 | Ga0395898_0000798_27152_27877 | 241 |
| 1048 | 3300037466 | Ga0395898_0098190 | Ga0395898_0098190_1470_2195 | 241 |
| 1049 | 3300037471 | Ga0395905_0002549 | Ga0395905_0002549_3084_3815 | 241 |
| 1050 | 3300037471 | Ga0395905_0005238 | Ga0395905_0005238_1252_1977 | 241 |
| 1051 | 3300037471 | Ga0395905_0087754 | Ga0395905_0087754_486_1211 | 241 |
| 1052 | 3300037471 | Ga0395905_0264387 | Ga0395905_0264387_596_1327 | 241 |
| 1053 | 3300037471 | Ga0395905_0393397 | Ga0395905_0393397_354_1079 | 241 |
| 1054 | 3300038443 | Ga0395901_0001849 | Ga0395901_0001849_20725_21450 | 241 |
| 1055 | 3300038443 | Ga0395901_0146215 | Ga0395901_0146215_1519_2247 | 241 |
| 1056 | 3300039447 | Ga0436361_0068556 | Ga0436361_0068556_85044_85772 | 241 |
| 1057 | 3300039447 | Ga0436361_0071320 | Ga0436361_0071320_667_1395 | 241 |
| 1058 | 3300039447 | Ga0436361_0084014 | Ga0436361_0084014_241_969 | 241 |
| 1059 | 3300039447 | Ga0436361_0429906 | Ga0436361_0429906_25658_26383 | 241 |
| 1060 | 3300039447 | Ga0436361_0562763 | Ga0436361_0562763_5553_6395 | 241 |
| 1061 | 3300039447 | Ga0436361_0900991 | Ga0436361_0900991_4446_5174 | 241 |
| 1062 | 3300039447 | Ga0436361_1145133 | Ga0436361_1145133_1190_1915 | 241 |
| 1063 | 3300041411 | Ga0439466_0084144 | Ga0439466_0084144_31_756 | 241 |
| 1064 | 3300041451 | Ga0451791_0184948 | Ga0451791_0184948_335_1060 | 241 |
| 1065 | 3300041460 | Ga0451802_0254447 | Ga0451802_0254447_553_1278 | 241 |
| 1066 | 3300042002 | Ga0439442_003824 | Ga0439442_003824_1457_2182 | 241 |
| 1067 | 3300042145 | Ga0450906_013768 | Ga0450906_013768_465_1190 | 241 |
| 1068 | 3300042147 | Ga0450910_008596 | Ga0450910_008596_663_1388 | 241 |
| 1069 | 3300042156 | Ga0439446_0089340 | Ga0439446_0089340_202_927 | 241 |
| 1070 | 3300042184 | Ga0450908_002473 | Ga0450908_002473_2558_3283 | 241 |
| 1071 | 3300042531 | Ga0450918_000264 | Ga0450918_000264_6064_6789 | 241 |
| 1072 | 3300042876 | Ga0451577_0031506 | Ga0451577_0031506_1662_2387 | 241 |
| 1073 | 3300044656 | Ga0466969_0000054 | Ga0466969_0000054_38570_39295 | 241 |
| 1074 | 3300044658 | Ga0466972_0001650 | Ga0466972_0001650_5951_6676 | 241 |
| 1075 | 3300044658 | Ga0466972_0018196 | Ga0466972_0018196_2733_3458 | 241 |
| 1076 | 3300044673 | Ga0453683_0001307 | Ga0453683_0001307_1207_1935 | 241 |
| 1077 | 3300046454 | Ga0495592_0000113 | Ga0495592_0000113_5572_6297 | 241 |
| 1078 | 3300046472 | Ga0495580_0115156 | Ga0495580_0115156_1031_1756 | 241 |
| 1079 | 3300046491 | Ga0495584_0194965 | Ga0495584_0194965_79_804 | 241 |
| 1080 | 3300046492 | Ga0495585_0014379 | Ga0495585_0014379_225_950 | 241 |
| 1081 | 3300046512 | Ga0495610_0045202 | Ga0495610_0045202_602_1327 | 241 |
| 1082 | 3300046519 | Ga0495632_0039270 | Ga0495632_0039270_299_1024 | 241 |
| 1083 | 3300046519 | Ga0495632_0051289 | Ga0495632_0051289_480_1205 | 241 |
| 1084 | 3300046519 | Ga0495632_0174863 | Ga0495632_0174863_218_943 | 241 |
| 1085 | 3300046522 | Ga0495643_0078342 | Ga0495643_0078342_921_1646 | 241 |
| 1086 | 3300046522 | Ga0495643_0110307 | Ga0495643_0110307_91_816 | 241 |
| 1087 | 3300046530 | Ga0495654_0009292 | Ga0495654_0009292_373_1098 | 241 |
| 1088 | 3300046537 | Ga0495598_0037659 | Ga0495598_0037659_192_920 | 241 |
| 1089 | 3300046539 | Ga0495621_0029195 | Ga0495621_0029195_561_1289 | 241 |
| 1090 | 3300046543 | Ga0495645_0322224 | Ga0495645_0322224_60_785 | 241 |
| 1091 | 3300046557 | Ga0495622_0014795 | Ga0495622_0014795_2268_2993 | 241 |
| 1092 | 3300046660 | Ga0495625_0000396 | Ga0495625_0000396_39522_40247 | 241 |
| 1093 | 3300046660 | Ga0495625_0015173 | Ga0495625_0015173_1489_2214 | 241 |
| 1094 | 3300046660 | Ga0495625_0279030 | Ga0495625_0279030_79_804 | 241 |
| 1095 | 3300046680 | Ga0495646_0057785 | Ga0495646_0057785_1113_1838 | 241 |
| 1096 | 3300046689 | Ga0495613_0376735 | Ga0495613_0376735_164_889 | 241 |
| 1097 | 3300046690 | Ga0495624_0034278 | Ga0495624_0034278_1483_2208 | 241 |
| 1098 | 3300046694 | Ga0495649_0003001 | Ga0495649_0003001_10822_11547 | 241 |
| 1099 | 3300046810 | Ga0495660_0028467 | Ga0495660_0028467_2087_2812 | 241 |
| 1100 | 3300047673 | Ga0495593_0026312 | Ga0495593_0026312_323_1048 | 241 |
| 1101 | 3300048088 | Ga0495602_0151146 | Ga0495602_0151146_957_1682 | 241 |
| 1102 | 3300048909 | Ga0496106_0388903 | Ga0496106_0388903_226_954 | 241 |
| 1103 | 3300048911 | Ga0496108_0408956 | Ga0496108_0408956_422_1147 | 241 |
| 1104 | 3300048911 | Ga0496108_0437113 | Ga0496108_0437113_377_1102 | 241 |
| 1105 | 3300048913 | Ga0496110_0021889 | Ga0496110_0021889_2370_3095 | 241 |
| 1106 | 3300048914 | Ga0496111_0083344 | Ga0496111_0083344_922_1647 | 241 |
| 1107 | 3300048914 | Ga0496111_0148645 | Ga0496111_0148645_314_1039 | 241 |
| 1108 | 3300048915 | Ga0496112_0109579 | Ga0496112_0109579_1128_1853 | 241 |
| 1109 | 3300048916 | Ga0496113_0035188 | Ga0496113_0035188_2772_3497 | 241 |
| 1110 | 3300048927 | Ga0496124_0000125 | Ga0496124_0000125_121563_122288 | 241 |
| 1111 | 3300049460 | Ga0495682_0091568 | Ga0495682_0091568_149_874 | 241 |
| 1112 | 3300050489 | nmdc:mga03683_115249_c1 | nmdc:mga03683_115249_c1_288_1013 | 241 |
| 1113 | 3300050489 | nmdc:mga03683_1184_c1 | nmdc:mga03683_1184_c1_758_1483 | 241 |
| 1114 | 3300050489 | nmdc:mga03683_207506_c1 | nmdc:mga03683_207506_c1_115_840 | 241 |
| 1115 | 3300050490 | nmdc:mga03n38_121729_c1 | nmdc:mga03n38_121729_c1_398_1123 | 241 |
| 1116 | 3300050492 | nmdc:mga0yw44_1882_c1 | nmdc:mga0yw44_1882_c1_1987_2712 | 241 |
| 1117 | 3300050493 | nmdc:mga0k408_107290_c1 | nmdc:mga0k408_107290_c1_62_787 | 241 |
| 1118 | 3300050493 | nmdc:mga0k408_124761_c1 | nmdc:mga0k408_124761_c1_738_1463 | 241 |
| 1119 | 3300050493 | nmdc:mga0k408_19860_c1 | nmdc:mga0k408_19860_c1_2442_3167 | 241 |
| 1120 | 3300050493 | nmdc:mga0k408_21606_c1 | nmdc:mga0k408_21606_c1_1567_2292 | 241 |
| 1121 | 3300050493 | nmdc:mga0k408_76211_c1 | nmdc:mga0k408_76211_c1_775_1500 | 241 |
| 1122 | 3300050493 | nmdc:mga0k408_78197_c1 | nmdc:mga0k408_78197_c1_504_1229 | 241 |
| 1123 | 3300050494 | nmdc:mga06z11_32826_c1 | nmdc:mga06z11_32826_c1_363_1088 | 241 |
| 1124 | 3300050494 | nmdc:mga06z11_335122_c1 | nmdc:mga06z11_335122_c1_64_789 | 241 |
| 1125 | 3300050495 | nmdc:mga04h51_18261_c1 | nmdc:mga04h51_18261_c1_827_1552 | 241 |
| 1126 | 3300050496 | nmdc:mga07m45_178027_c1 | nmdc:mga07m45_178027_c1_489_1214 | 241 |
| 1127 | 3300050496 | nmdc:mga07m45_43207_c1 | nmdc:mga07m45_43207_c1_1395_2120 | 241 |
| 1128 | 3300050496 | nmdc:mga07m45_7058_c2 | nmdc:mga07m45_7058_c2_729_1454 | 241 |
| 1129 | 3300050496 | nmdc:mga07m45_9482_c1 | nmdc:mga07m45_9482_c1_588_1313 | 241 |
| 1130 | 3300053080 | Ga0500635_0000026 | Ga0500635_0000026_5083_5883 | 241 |
| 1131 | 3300053086 | Ga0500578_0000926 | Ga0500578_0000926_578_1303 | 241 |
| 1132 | 3300053086 | Ga0500578_0086543 | Ga0500578_0086543_485_1210 | 241 |
| 1133 | 3300053093 | Ga0500651_0015061 | Ga0500651_0015061_3723_4448 | 241 |
| 1134 | 3300053093 | Ga0500651_0037658 | Ga0500651_0037658_2132_2857 | 241 |
| 1135 | 3300053093 | Ga0500651_0121288 | Ga0500651_0121288_519_1244 | 241 |
| 1136 | 3300053118 | Ga0500594_0000905 | Ga0500594_0000905_4681_5406 | 241 |
| 1137 | 3300053127 | Ga0500623_103280 | Ga0500623_103280_371_1096 | 241 |
| 1138 | 3300053131 | Ga0500652_009409 | Ga0500652_009409_950_1675 | 241 |
| 1139 | 3300053136 | Ga0500559_0000260 | Ga0500559_0000260_34382_35107 | 241 |
| 1140 | 3300053139 | Ga0500568_0017724 | Ga0500568_0017724_23_754 | 241 |
| 1141 | 3300053156 | Ga0500622_0001479 | Ga0500622_0001479_3242_3967 | 241 |
| 1142 | 3300053156 | Ga0500622_0001878 | Ga0500622_0001878_13730_14455 | 241 |
| 1143 | 3300061734 | Ga0530510_0186491 | Ga0530510_0186491_620_1348 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b9q-assembly1.cif.gz_A | the serp optimized structure of ribonucleotide reductase from rhodobacter sphaeroides | 0.8102 | 23 | 81 |
| 7b9p-assembly1.cif.gz_A-2 | structure of ribonucleotide reductase from rhodobacter sphaeroides | 0.7844 | 23 | 83 |
| 1yj7-assembly1.cif.gz_C | crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj | 0.7306 | 140 | 191 |
| 4hac-assembly1.cif.gz_B | crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei | 0.728 | 149 | 203 |
| 2nxc-assembly1.cif.gz_A | apo-form of t. thermophilus ribosomal protein l11 methyltransferase (prma) | 0.7252 | 138 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lfpA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9478 | 83 | 241 | 3.30.70.980 |
| 1mw7A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain | 0.9126 | 83 | 238 | 3.30.70.980 |
| af_I1K9D8_53_128_1.10.10.200 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9051 | 5 | 74 | 1.10.10.200 |
| 1lfpA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.9045 | 19 | 79 | 1.10.10.200 |
| 1mw7A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain | 0.904 | 26 | 77 | 1.10.10.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1U2A0-F1-model_v4 | deleted | 0.9891 | 86 | 239 |
|
| AF-A0A258LN40-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9849 | 134 | 239 |
GO:0003677
GO:0005829 |
| AF-A0A4V1U2A0-F1-model_v4 | deleted | 0.9828 | 86 | 239 |
|
| AF-A0A258LN40-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9758 | 134 | 239 |
GO:0003677
GO:0005829 |
| AF-A0A7Z9XSW8-F1-model_v4 | YebC/PmpR family DNA-binding transcriptional regulator | 0.9725 | 77 | 241 |
GO:0003677
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar