F490744
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1143 | 423 | 2286 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0570193|Ga0466960_0570193_29_649 |
| Length | 206 |
| Sequence | VLFCVLPSKCKMVWTGRFDMLLMIDNYDSFTYNLVQYFGELGEEVRTYRNDEITLDEIAAMNPDRICISPGPCTPHEAGISVPLLQHFAGKTPILGVCLGHQSIGAAFGGKVIRAKQVMHGKTSVIAHTGVGVFKDLPSPYTVIRYHSLAIERASLPDCLEVTAWTDDGEIMGVRHKEFNIQGVQFHPESILSEHGHALLKNFLSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 60 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 145 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 146 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 147 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 148 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 149 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 168 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 177 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 181 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 186 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 193 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 315 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 321 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 323 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 325 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 327 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 332 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 344 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 345 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 347 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 349 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 350 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 355 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 356 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 357 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 358 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 359 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 360 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 361 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 362 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 363 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 364 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 365 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 366 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 367 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 368 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 369 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 370 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 371 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 372 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 373 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 374 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 375 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 376 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 377 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 378 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 379 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 380 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 381 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 382 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 383 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 384 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 385 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 386 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 387 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 388 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 389 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 390 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 391 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 392 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 393 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 394 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 395 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 396 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 397 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 398 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 399 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 400 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 401 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 402 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 403 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 404 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 405 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 406 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 407 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 408 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 409 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 410 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 411 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 412 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 413 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 414 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 415 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 416 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 417 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 418 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 419 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 420 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 421 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 422 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 423 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.83 |
| Metatranscriptomes | 1.14 |
| Isolates | 6.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.92 |
| Nodule | 0.7 |
| Rhizoplane | 2.8 |
| Rhizosphere | 79.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466960_0570193 | 3300044901 | Bacteria | 669 |
| 2 | JGI25155J39150_1000336 | 3300002704 | Bacteria | 15086 |
| 3 | JGI25155J39150_1000485 | 3300002704 | Bacteria | 9807 |
| 4 | JGI25156J39149_1000267 | 3300002705 | Bacteria | 35297 |
| 5 | JGI25156J39149_1013381 | 3300002705 | Bacteria | 1744 |
| 6 | JGI25154J39366_1000739 | 3300002738 | Bacteria | 14651 |
| 7 | JGI25154J39366_1001209 | 3300002738 | Bacteria | 9784 |
| 8 | JGI25154J39366_1002200 | 3300002738 | Bacteria | 5398 |
| 9 | JGI25158J39367_1003079 | 3300002739 | Bacteria | 2624 |
| 10 | JGI25157J39369_1000372 | 3300002741 | Bacteria | 30863 |
| 11 | JGI25157J39369_1000495 | 3300002741 | Bacteria | 24307 |
| 12 | JGI25164J39214_1003913 | 3300002772 | Bacteria | 1791 |
| 13 | JGI25150J39212_1000910 | 3300002774 | Bacteria | 9622 |
| 14 | JGI25150J39212_1003626 | 3300002774 | Bacteria | 3583 |
| 15 | JGI25159J45721_1002200 | 3300002987 | Bacteria | 7576 |
| 16 | JGI25159J45721_1005724 | 3300002987 | Bacteria | 3849 |
| 17 | JGI25165J46597_1000713 | 3300003214 | Bacteria | 26161 |
| 18 | JGI25153J46596_10018531 | 3300003215 | Bacteria | 2700 |
| 19 | JGI25160J50197_1003453 | 3300003354 | Bacteria | 7072 |
| 20 | JGI25161J50226_1006300 | 3300003374 | Bacteria | 2165 |
| 21 | Ga0007410J51695_1015624 | 3300003574 | Bacteria | 2390 |
| 22 | Ga0007410J51695_1044871 | 3300003574 | Bacteria | 2302 |
| 23 | Ga0007409J51694_1007308 | 3300003575 | Bacteria | 2829 |
| 24 | Ga0007409J51694_1023914 | 3300003575 | Bacteria | 3351 |
| 25 | Ga0007416J51690_1029024 | 3300003577 | Bacteria | 2453 |
| 26 | Ga0032354_1058597 | 3300003693 | Bacteria | 1089 |
| 27 | Ga0055538_1000062 | 3300003751 | Bacteria | 105260 |
| 28 | Ga0055538_1000281 | 3300003751 | Bacteria | 26161 |
| 29 | Ga0055539_1000093 | 3300003752 | Bacteria | 105260 |
| 30 | Ga0055539_1000305 | 3300003752 | Bacteria | 26161 |
| 31 | Ga0055533_1000105 | 3300003756 | Bacteria | 105260 |
| 32 | Ga0055533_1000286 | 3300003756 | Bacteria | 26161 |
| 33 | Ga0055532_1000034 | 3300003758 | Bacteria | 210984 |
| 34 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 35 | Ga0055525_1000137 | 3300003759 | Bacteria | 105260 |
| 36 | Ga0055525_1000405 | 3300003759 | Bacteria | 26891 |
| 37 | Ga0055526_1001033 | 3300003771 | Bacteria | 20365 |
| 38 | Ga0055526_1005708 | 3300003771 | Bacteria | 7051 |
| 39 | Ga0055537_1000580 | 3300003773 | Bacteria | 20336 |
| 40 | Ga0055537_1009165 | 3300003773 | Bacteria | 2210 |
| 41 | Ga0055524_1002755 | 3300003775 | Bacteria | 8837 |
| 42 | Ga0055524_1010041 | 3300003775 | Bacteria | 3798 |
| 43 | Ga0055534_1000283 | 3300003784 | Bacteria | 34520 |
| 44 | Ga0055528_1000495 | 3300003790 | Bacteria | 31111 |
| 45 | Ga0055530_10050684 | 3300003791 | Bacteria | 966 |
| 46 | Ga0055541_1000063 | 3300003841 | Bacteria | 105260 |
| 47 | Ga0055541_1000198 | 3300003841 | Bacteria | 26161 |
| 48 | Ga0055543_1003826 | 3300004625 | Bacteria | 4273 |
| 49 | Ga0065165_1002857 | 3300005262 | Bacteria | 13394 |
| 50 | Ga0065165_1004075 | 3300005262 | Bacteria | 9468 |
| 51 | Ga0065714_10171696 | 3300005288 | Bacteria | 999 |
| 52 | Ga0065715_10042333 | 3300005293 | Bacteria | 959 |
| 53 | Ga0070658_10710717 | 3300005327 | Bacteria | 872 |
| 54 | Ga0070670_100086718 | 3300005331 | Bacteria | 2690 |
| 55 | Ga0070682_100098361 | 3300005337 | Bacteria | 1927 |
| 56 | Ga0070682_100577228 | 3300005337 | Bacteria | 884 |
| 57 | Ga0070660_100016657 | 3300005339 | Bacteria | 5341 |
| 58 | Ga0070660_100044451 | 3300005339 | Bacteria | 3398 |
| 59 | Ga0070661_100051855 | 3300005344 | Bacteria | 3003 |
| 60 | Ga0070659_100001752 | 3300005366 | Bacteria | 15587 |
| 61 | Ga0070659_100082019 | 3300005366 | Bacteria | 2576 |
| 62 | Ga0070659_100216063 | 3300005366 | Bacteria | 1581 |
| 63 | Ga0070662_100057197 | 3300005457 | Bacteria | 2833 |
| 64 | Ga0070662_100692878 | 3300005457 | Bacteria | 861 |
| 65 | Ga0068867_100056392 | 3300005459 | Bacteria | 2907 |
| 66 | Ga0070706_100007456 | 3300005467 | Bacteria | 10255 |
| 67 | Ga0070707_100111118 | 3300005468 | Bacteria | 2658 |
| 68 | Ga0070699_100042824 | 3300005518 | Bacteria | 3918 |
| 69 | Ga0070679_100691385 | 3300005530 | Bacteria | 963 |
| 70 | Ga0070697_100618561 | 3300005536 | Bacteria | 953 |
| 71 | Ga0068855_100016570 | 3300005563 | Bacteria | 8864 |
| 72 | Ga0068855_100035272 | 3300005563 | Bacteria | 5958 |
| 73 | Ga0068855_101052987 | 3300005563 | Bacteria | 852 |
| 74 | Ga0068855_101571899 | 3300005563 | Bacteria | 673 |
| 75 | Ga0070664_100003553 | 3300005564 | Bacteria | 12597 |
| 76 | Ga0070664_100298359 | 3300005564 | Bacteria | 1456 |
| 77 | Ga0068857_100326958 | 3300005577 | Bacteria | 1417 |
| 78 | Ga0068854_100017165 | 3300005578 | Bacteria | 4840 |
| 79 | Ga0068856_100163375 | 3300005614 | Bacteria | 2238 |
| 80 | Ga0068852_100004237 | 3300005616 | Bacteria | 10127 |
| 81 | Ga0068852_100004430 | 3300005616 | Bacteria | 9925 |
| 82 | Ga0068863_100298029 | 3300005841 | Bacteria | 1564 |
| 83 | Ga0070717_10473844 | 3300006028 | Bacteria | 1130 |
| 84 | Ga0075366_10002981 | 3300006195 | Bacteria | 8821 |
| 85 | Ga0075428_100377519 | 3300006844 | Bacteria | 1520 |
| 86 | Ga0075430_100258757 | 3300006846 | Bacteria | 1442 |
| 87 | Ga0075431_100002888 | 3300006847 | Bacteria | 16633 |
| 88 | Ga0079104_1005592 | 3300006946 | Bacteria | 4978 |
| 89 | Ga0079104_1008552 | 3300006946 | Bacteria | 3567 |
| 90 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 91 | Ga0105244_10002041 | 3300009036 | Bacteria | 15556 |
| 92 | Ga0105244_10003441 | 3300009036 | Bacteria | 11284 |
| 93 | Ga0105244_10035827 | 3300009036 | Bacteria | 2604 |
| 94 | Ga0105244_10110311 | 3300009036 | Bacteria | 1339 |
| 95 | Ga0105244_10174679 | 3300009036 | Bacteria | 1021 |
| 96 | Ga0105250_10120377 | 3300009092 | Bacteria | 1079 |
| 97 | Ga0105240_10001608 | 3300009093 | Bacteria | 38292 |
| 98 | Ga0105240_10016336 | 3300009093 | Bacteria | 10052 |
| 99 | Ga0105240_10190542 | 3300009093 | Bacteria | 2412 |
| 100 | Ga0105241_10120376 | 3300009174 | Bacteria | 2113 |
| 101 | Ga0105242_10037198 | 3300009176 | Bacteria | 3909 |
| 102 | Ga0105242_10180899 | 3300009176 | Bacteria | 1860 |
| 103 | Ga0105237_10010944 | 3300009545 | Bacteria | 9627 |
| 104 | Ga0105238_10000763 | 3300009551 | Bacteria | 33477 |
| 105 | Ga0105239_10010387 | 3300010375 | Bacteria | 10421 |
| 106 | Ga0105239_10368622 | 3300010375 | Bacteria | 1623 |
| 107 | Ga0105239_10961472 | 3300010375 | Bacteria | 981 |
| 108 | Ga0157373_10711950 | 3300013100 | Bacteria | 736 |
| 109 | Ga0157371_10039633 | 3300013102 | Bacteria | 3369 |
| 110 | Ga0157370_11246340 | 3300013104 | Bacteria | 671 |
| 111 | Ga0157369_10000804 | 3300013105 | Bacteria | 40126 |
| 112 | Ga0157369_10574078 | 3300013105 | Bacteria | 1165 |
| 113 | Ga0157374_10000924 | 3300013296 | Bacteria | 25554 |
| 114 | Ga0157374_11006092 | 3300013296 | Bacteria | 853 |
| 115 | Ga0157378_10091922 | 3300013297 | Bacteria | 2760 |
| 116 | Ga0157378_11144502 | 3300013297 | Bacteria | 816 |
| 117 | Ga0163162_10379875 | 3300013306 | Bacteria | 1546 |
| 118 | Ga0182008_10003605 | 3300014497 | Bacteria | 9271 |
| 119 | Ga0182008_10056599 | 3300014497 | Bacteria | 1937 |
| 120 | Ga0182006_1000033 | 3300015261 | Bacteria | 238180 |
| 121 | Ga0182006_1000080 | 3300015261 | Bacteria | 122163 |
| 122 | Ga0182006_1058779 | 3300015261 | Bacteria | 1457 |
| 123 | Ga0182007_10000042 | 3300015262 | Bacteria | 111840 |
| 124 | Ga0182007_10030574 | 3300015262 | Bacteria | 1839 |
| 125 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 126 | Ga0182005_1000024 | 3300015265 | Bacteria | 238256 |
| 127 | Ga0182005_1001434 | 3300015265 | Bacteria | 9601 |
| 128 | Ga0163161_10012023 | 3300017792 | Bacteria | 6004 |
| 129 | Ga0163161_10012229 | 3300017792 | Bacteria | 5953 |
| 130 | Ga0163161_10087249 | 3300017792 | Bacteria | 2304 |
| 131 | Ga0213872_10000430 | 3300021361 | Bacteria | 34377 |
| 132 | Ga0213872_10001856 | 3300021361 | Bacteria | 13064 |
| 133 | Ga0213872_10002336 | 3300021361 | Bacteria | 11273 |
| 134 | Ga0213872_10004434 | 3300021361 | Bacteria | 7457 |
| 135 | Ga0213872_10024411 | 3300021361 | Bacteria | 2781 |
| 136 | Ga0213872_10115807 | 3300021361 | Bacteria | 1187 |
| 137 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 138 | Ga0209435_100176 | 3300025206 | Bacteria | 19214 |
| 139 | Ga0209436_100769 | 3300025208 | Bacteria | 13300 |
| 140 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 141 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 142 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 143 | Ga0209566_100119 | 3300025225 | Bacteria | 105312 |
| 144 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 145 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 146 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 147 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 148 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 149 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 150 | Ga0207427_100759 | 3300025231 | Bacteria | 14690 |
| 151 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 152 | Ga0209437_100332 | 3300025233 | Bacteria | 58796 |
| 153 | Ga0209437_105938 | 3300025233 | Bacteria | 2056 |
| 154 | Ga0209437_107841 | 3300025233 | Bacteria | 1720 |
| 155 | Ga0209258_101277 | 3300025242 | Bacteria | 9457 |
| 156 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 157 | Ga0207425_1000829 | 3300025245 | Bacteria | 15420 |
| 158 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 159 | Ga0209646_1000107 | 3300025246 | Bacteria | 163112 |
| 160 | Ga0209646_1000190 | 3300025246 | Bacteria | 75772 |
| 161 | Ga0209026_1000063 | 3300025250 | Bacteria | 211324 |
| 162 | Ga0209026_1005858 | 3300025250 | Bacteria | 3170 |
| 163 | Ga0209026_1012017 | 3300025250 | Bacteria | 1527 |
| 164 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 165 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 166 | Ga0209677_101699 | 3300025253 | Bacteria | 9186 |
| 167 | Ga0209148_1000237 | 3300025254 | Bacteria | 88748 |
| 168 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 169 | Ga0209759_1000198 | 3300025256 | Bacteria | 95052 |
| 170 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 171 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 172 | Ga0209565_1000055 | 3300025263 | Bacteria | 201184 |
| 173 | Ga0209565_1000677 | 3300025263 | Bacteria | 21295 |
| 174 | Ga0209565_1002957 | 3300025263 | Bacteria | 5775 |
| 175 | Ga0209565_1003264 | 3300025263 | Bacteria | 5342 |
| 176 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 177 | Ga0209455_1029838 | 3300025272 | Bacteria | 936 |
| 178 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 179 | Ga0209673_1003338 | 3300025273 | Bacteria | 9600 |
| 180 | Ga0209130_1000169 | 3300025284 | Bacteria | 95167 |
| 181 | Ga0209130_1002260 | 3300025284 | Bacteria | 9942 |
| 182 | Ga0209675_1000052 | 3300025291 | Bacteria | 201332 |
| 183 | Ga0209675_1001299 | 3300025291 | Bacteria | 14837 |
| 184 | Ga0209025_1000473 | 3300025294 | Bacteria | 78078 |
| 185 | Ga0209025_1001876 | 3300025294 | Bacteria | 24626 |
| 186 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 187 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 188 | Ga0209564_1000063 | 3300025295 | Bacteria | 318515 |
| 189 | Ga0209564_1000271 | 3300025295 | Bacteria | 108422 |
| 190 | Ga0209564_1001666 | 3300025295 | Bacteria | 21297 |
| 191 | Ga0209564_1028858 | 3300025295 | Bacteria | 1761 |
| 192 | Ga0209758_1000288 | 3300025297 | Bacteria | 99096 |
| 193 | Ga0209758_1000436 | 3300025297 | Bacteria | 70342 |
| 194 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 195 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 196 | Ga0209256_1000100 | 3300025299 | Bacteria | 201246 |
| 197 | Ga0209256_1000754 | 3300025299 | Bacteria | 42096 |
| 198 | Ga0207426_1003112 | 3300025302 | Bacteria | 9466 |
| 199 | Ga0209051_1028245 | 3300025303 | Bacteria | 2219 |
| 200 | Ga0207656_10071281 | 3300025321 | Bacteria | 1544 |
| 201 | Ga0207655_1001651 | 3300025728 | Bacteria | 19767 |
| 202 | Ga0207655_1016701 | 3300025728 | Bacteria | 3999 |
| 203 | Ga0207655_1064734 | 3300025728 | Bacteria | 1392 |
| 204 | Ga0207705_10034051 | 3300025909 | Bacteria | 3641 |
| 205 | Ga0207684_10008262 | 3300025910 | Bacteria | 9268 |
| 206 | Ga0207654_10022625 | 3300025911 | Bacteria | 3356 |
| 207 | Ga0207695_10008939 | 3300025913 | Bacteria | 12470 |
| 208 | Ga0207695_10012318 | 3300025913 | Bacteria | 10275 |
| 209 | Ga0207695_10136114 | 3300025913 | Bacteria | 2409 |
| 210 | Ga0207671_10004652 | 3300025914 | Bacteria | 12996 |
| 211 | Ga0207671_10309446 | 3300025914 | Bacteria | 1249 |
| 212 | Ga0207657_10012688 | 3300025919 | Bacteria | 8304 |
| 213 | Ga0207657_10231476 | 3300025919 | Bacteria | 1478 |
| 214 | Ga0207657_10525715 | 3300025919 | Bacteria | 926 |
| 215 | Ga0207649_10024118 | 3300025920 | Bacteria | 3532 |
| 216 | Ga0207649_10493530 | 3300025920 | Bacteria | 930 |
| 217 | Ga0207652_10464901 | 3300025921 | Bacteria | 1140 |
| 218 | Ga0207694_10000343 | 3300025924 | Bacteria | 44142 |
| 219 | Ga0207694_10858659 | 3300025924 | Bacteria | 767 |
| 220 | Ga0207650_10063319 | 3300025925 | Bacteria | 2765 |
| 221 | Ga0207690_10000951 | 3300025932 | Bacteria | 18563 |
| 222 | Ga0207690_10323880 | 3300025932 | Bacteria | 1212 |
| 223 | Ga0207690_10330334 | 3300025932 | Bacteria | 1201 |
| 224 | Ga0207686_10036176 | 3300025934 | Bacteria | 2970 |
| 225 | Ga0207709_10388720 | 3300025935 | Bacteria | 1063 |
| 226 | Ga0207679_10004406 | 3300025945 | Bacteria | 8766 |
| 227 | Ga0207667_10000912 | 3300025949 | Bacteria | 37632 |
| 228 | Ga0207667_10007366 | 3300025949 | Bacteria | 13242 |
| 229 | Ga0207667_10317294 | 3300025949 | Bacteria | 1592 |
| 230 | Ga0207667_10550318 | 3300025949 | Bacteria | 1167 |
| 231 | Ga0207640_10041316 | 3300025981 | Bacteria | 2932 |
| 232 | Ga0207639_10170095 | 3300026041 | Bacteria | 1844 |
| 233 | Ga0207678_10439887 | 3300026067 | Bacteria | 1132 |
| 234 | Ga0207702_10168886 | 3300026078 | Bacteria | 2004 |
| 235 | Ga0207641_10366349 | 3300026088 | Bacteria | 1377 |
| 236 | Ga0207648_10086029 | 3300026089 | Bacteria | 2742 |
| 237 | Ga0207674_10182190 | 3300026116 | Bacteria | 2052 |
| 238 | Ga0207674_10281988 | 3300026116 | Bacteria | 1609 |
| 239 | Ga0207698_10044764 | 3300026142 | Bacteria | 3329 |
| 240 | Ga0207698_10095163 | 3300026142 | Bacteria | 2451 |
| 241 | Ga0207698_10385474 | 3300026142 | Bacteria | 1335 |
| 242 | Ga0209281_1005374 | 3300027111 | Bacteria | 3569 |
| 243 | Ga0209282_1000009 | 3300027666 | Bacteria | 233366 |
| 244 | Ga0209974_10027183 | 3300027876 | Bacteria | 1892 |
| 245 | Ga0265336_10006403 | 3300028666 | Bacteria | 4244 |
| 246 | Ga0265336_10048575 | 3300028666 | Bacteria | 1286 |
| 247 | Ga0265338_10066959 | 3300028800 | Bacteria | 3105 |
| 248 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 249 | Ga0265324_10000616 | 3300029957 | Bacteria | 24232 |
| 250 | Ga0268256_1004381 | 3300030500 | Bacteria | 5881 |
| 251 | Ga0316177_1075487 | 3300030731 | Bacteria | 5574 |
| 252 | Ga0316178_1172473 | 3300030735 | Bacteria | 1017 |
| 253 | Ga0316180_1064742 | 3300030736 | Bacteria | 1510 |
| 254 | Ga0316181_1137224 | 3300030744 | Bacteria | 4539 |
| 255 | Ga0316182_1021746 | 3300030745 | Bacteria | 1163 |
| 256 | Ga0316182_1361262 | 3300030745 | Bacteria | 1173 |
| 257 | Ga0265332_10000030 | 3300031238 | Bacteria | 175141 |
| 258 | Ga0265332_10001445 | 3300031238 | Bacteria | 13313 |
| 259 | Ga0265328_10000016 | 3300031239 | Bacteria | 132959 |
| 260 | Ga0265325_10002841 | 3300031241 | Bacteria | 11549 |
| 261 | Ga0265325_10007848 | 3300031241 | Bacteria | 6354 |
| 262 | Ga0265331_10009812 | 3300031250 | Bacteria | 5340 |
| 263 | Ga0265331_10013920 | 3300031250 | Bacteria | 4303 |
| 264 | Ga0265331_10054133 | 3300031250 | Bacteria | 1911 |
| 265 | Ga0265331_10089997 | 3300031250 | Bacteria | 1419 |
| 266 | Ga0265331_10158693 | 3300031250 | Bacteria | 1025 |
| 267 | Ga0265327_10000528 | 3300031251 | Bacteria | 65837 |
| 268 | Ga0265327_10000674 | 3300031251 | Bacteria | 54882 |
| 269 | Ga0265327_10001509 | 3300031251 | Bacteria | 28791 |
| 270 | Ga0265327_10015618 | 3300031251 | Bacteria | 4886 |
| 271 | Ga0265327_10018721 | 3300031251 | Bacteria | 4281 |
| 272 | Ga0265327_10059966 | 3300031251 | Bacteria | 1947 |
| 273 | Ga0265327_10123875 | 3300031251 | Bacteria | 1222 |
| 274 | Ga0265327_10216212 | 3300031251 | Bacteria | 863 |
| 275 | Ga0265316_10090702 | 3300031344 | Bacteria | 2332 |
| 276 | Ga0265316_10158523 | 3300031344 | Bacteria | 1693 |
| 277 | Ga0265316_10376779 | 3300031344 | Bacteria | 1024 |
| 278 | Ga0307509_10000076 | 3300031507 | Bacteria | 138855 |
| 279 | Ga0307408_100000432 | 3300031548 | Bacteria | 37289 |
| 280 | Ga0307408_100002407 | 3300031548 | Bacteria | 13173 |
| 281 | Ga0307408_100010617 | 3300031548 | Bacteria | 6076 |
| 282 | Ga0265313_10040874 | 3300031595 | Bacteria | 2289 |
| 283 | Ga0316575_10003832 | 3300031665 | Bacteria | 5243 |
| 284 | Ga0265314_10001144 | 3300031711 | Bacteria | 30747 |
| 285 | Ga0265314_10008929 | 3300031711 | Bacteria | 8538 |
| 286 | Ga0265314_10118654 | 3300031711 | Bacteria | 1669 |
| 287 | Ga0307405_10084076 | 3300031731 | Bacteria | 2088 |
| 288 | Ga0307405_10270046 | 3300031731 | Bacteria | 1275 |
| 289 | Ga0307413_10141496 | 3300031824 | Bacteria | 1663 |
| 290 | Ga0307518_10057653 | 3300031838 | Bacteria | 2821 |
| 291 | Ga0307412_10000169 | 3300031911 | Bacteria | 46494 |
| 292 | Ga0307416_100000975 | 3300032002 | Bacteria | 15137 |
| 293 | Ga0307416_100104940 | 3300032002 | Bacteria | 2472 |
| 294 | Ga0307414_10174903 | 3300032004 | Bacteria | 1720 |
| 295 | Ga0307414_10285519 | 3300032004 | Bacteria | 1389 |
| 296 | Ga0307411_10541983 | 3300032005 | Bacteria | 991 |
| 297 | Ga0316583_10021200 | 3300032133 | Bacteria | 2330 |
| 298 | Ga0316583_10069475 | 3300032133 | Bacteria | 1232 |
| 299 | Ga0316582_0049684 | 3300036647 | Bacteria | 2654 |
| 300 | Ga0395899_0000521 | 3300037312 | Bacteria | 42304 |
| 301 | Ga0395899_0002474 | 3300037312 | Bacteria | 14991 |
| 302 | Ga0395899_0002806 | 3300037312 | Bacteria | 14038 |
| 303 | Ga0395899_0003830 | 3300037312 | Bacteria | 11871 |
| 304 | Ga0395899_0018674 | 3300037312 | Bacteria | 5269 |
| 305 | Ga0395899_0125972 | 3300037312 | Bacteria | 1832 |
| 306 | Ga0395899_0126723 | 3300037312 | Bacteria | 1825 |
| 307 | Ga0395900_0006506 | 3300037418 | Bacteria | 12173 |
| 308 | Ga0395900_0010081 | 3300037418 | Bacteria | 9664 |
| 309 | Ga0395900_0014022 | 3300037418 | Bacteria | 8184 |
| 310 | Ga0395900_0031672 | 3300037418 | Bacteria | 5435 |
| 311 | Ga0395900_0035466 | 3300037418 | Bacteria | 5137 |
| 312 | Ga0395900_0113125 | 3300037418 | Bacteria | 2786 |
| 313 | Ga0395900_0181240 | 3300037418 | Bacteria | 2140 |
| 314 | Ga0395900_0285610 | 3300037418 | Bacteria | 1640 |
| 315 | Ga0395900_0289530 | 3300037418 | Bacteria | 1627 |
| 316 | Ga0395900_0622000 | 3300037418 | Bacteria | 1018 |
| 317 | Ga0395898_0000559 | 3300037466 | Bacteria | 69751 |
| 318 | Ga0395898_0089880 | 3300037466 | Bacteria | 2955 |
| 319 | Ga0395898_0478763 | 3300037466 | Bacteria | 1184 |
| 320 | Ga0395898_0508579 | 3300037466 | Bacteria | 1145 |
| 321 | Ga0395898_0690689 | 3300037466 | Bacteria | 962 |
| 322 | Ga0395898_0892151 | 3300037466 | Bacteria | 827 |
| 323 | Ga0395905_0010442 | 3300037471 | Bacteria | 9034 |
| 324 | Ga0395905_0013127 | 3300037471 | Bacteria | 7952 |
| 325 | Ga0395905_0036632 | 3300037471 | Bacteria | 4608 |
| 326 | Ga0395905_0036694 | 3300037471 | Bacteria | 4604 |
| 327 | Ga0395905_0055914 | 3300037471 | Bacteria | 3693 |
| 328 | Ga0395905_0093364 | 3300037471 | Bacteria | 2822 |
| 329 | Ga0395901_0000328 | 3300038443 | Bacteria | 58470 |
| 330 | Ga0395901_0000824 | 3300038443 | Bacteria | 34332 |
| 331 | Ga0395901_0002710 | 3300038443 | Bacteria | 17843 |
| 332 | Ga0395901_0002897 | 3300038443 | Bacteria | 17321 |
| 333 | Ga0395901_0020765 | 3300038443 | Bacteria | 6723 |
| 334 | Ga0395901_0066242 | 3300038443 | Bacteria | 3762 |
| 335 | Ga0395901_0117619 | 3300038443 | Bacteria | 2793 |
| 336 | Ga0400483_005643 | 3300039062 | Bacteria | 2692 |
| 337 | Ga0400483_266454 | 3300039062 | Bacteria | 3843 |
| 338 | Ga0436361_0013073 | 3300039447 | Bacteria | 17617 |
| 339 | Ga0436361_0303014 | 3300039447 | Bacteria | 21994 |
| 340 | Ga0436361_0314274 | 3300039447 | Bacteria | 1808 |
| 341 | Ga0436361_0512442 | 3300039447 | Bacteria | 20430 |
| 342 | Ga0436361_0544664 | 3300039447 | Bacteria | 11764 |
| 343 | Ga0436361_0930389 | 3300039447 | Bacteria | 10390 |
| 344 | Ga0436361_1012850 | 3300039447 | Bacteria | 830 |
| 345 | Ga0436361_1027676 | 3300039447 | Bacteria | 838 |
| 346 | Ga0436361_1072133 | 3300039447 | Bacteria | 3944 |
| 347 | Ga0436361_1091442 | 3300039447 | Bacteria | 27914 |
| 348 | Ga0436361_1097952 | 3300039447 | Bacteria | 1349 |
| 349 | Ga0436361_1206124 | 3300039447 | Bacteria | 9470 |
| 350 | Ga0439436_0086795 | 3300041404 | Bacteria | 871 |
| 351 | Ga0451837_0319601 | 3300041494 | Bacteria | 1101 |
| 352 | Ga0439448_0000161 | 3300042005 | Bacteria | 13290 |
| 353 | Ga0439449_0009520 | 3300042007 | Bacteria | 3681 |
| 354 | Ga0439450_017711 | 3300042008 | Bacteria | 1489 |
| 355 | Ga0439450_042434 | 3300042008 | Bacteria | 1060 |
| 356 | Ga0439450_053924 | 3300042008 | Bacteria | 960 |
| 357 | Ga0450904_007543 | 3300042139 | Bacteria | 1079 |
| 358 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 359 | Ga0451577_0000345 | 3300042876 | Bacteria | 87020 |
| 360 | Ga0451577_0071284 | 3300042876 | Bacteria | 3099 |
| 361 | Ga0451577_0219478 | 3300042876 | Bacteria | 1718 |
| 362 | Ga0451577_0407278 | 3300042876 | Bacteria | 1234 |
| 363 | Ga0451577_0689600 | 3300042876 | Bacteria | 925 |
| 364 | Ga0451577_0743976 | 3300042876 | Bacteria | 887 |
| 365 | Ga0451577_0944695 | 3300042876 | Bacteria | 775 |
| 366 | Ga0466969_0250847 | 3300044656 | Bacteria | 802 |
| 367 | Ga0466972_0000420 | 3300044658 | Bacteria | 22023 |
| 368 | Ga0466972_0003973 | 3300044658 | Bacteria | 7370 |
| 369 | Ga0466972_0011040 | 3300044658 | Bacteria | 4535 |
| 370 | Ga0466977_0107028 | 3300044666 | Bacteria | 1834 |
| 371 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 372 | Ga0466965_0002121 | 3300044683 | Bacteria | 8329 |
| 373 | Ga0466965_0028860 | 3300044683 | Bacteria | 2697 |
| 374 | Ga0466965_0029552 | 3300044683 | Bacteria | 2667 |
| 375 | Ga0466965_0031596 | 3300044683 | Bacteria | 2582 |
| 376 | Ga0466965_0036795 | 3300044683 | Bacteria | 2402 |
| 377 | Ga0466965_0073626 | 3300044683 | Bacteria | 1720 |
| 378 | Ga0466966_0001854 | 3300044684 | Bacteria | 13710 |
| 379 | Ga0466966_0006887 | 3300044684 | Bacteria | 7530 |
| 380 | Ga0466966_0029262 | 3300044684 | Bacteria | 3584 |
| 381 | Ga0466966_0082568 | 3300044684 | Bacteria | 1999 |
| 382 | Ga0466961_0068851 | 3300044693 | Bacteria | 2247 |
| 383 | Ga0466964_0007888 | 3300044706 | Bacteria | 3987 |
| 384 | Ga0466964_0018884 | 3300044706 | Bacteria | 2647 |
| 385 | Ga0466964_0260780 | 3300044706 | Bacteria | 858 |
| 386 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 387 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 388 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 389 | Ga0453684_0000694 | 3300044712 | Bacteria | 119688 |
| 390 | Ga0453684_0010268 | 3300044712 | Bacteria | 16038 |
| 391 | Ga0453684_0109392 | 3300044712 | Bacteria | 3362 |
| 392 | Ga0453684_1610308 | 3300044712 | Bacteria | 666 |
| 393 | Ga0466971_0002015 | 3300044719 | Bacteria | 8591 |
| 394 | Ga0466971_0162361 | 3300044719 | Bacteria | 1046 |
| 395 | Ga0466968_0009040 | 3300044735 | Bacteria | 3831 |
| 396 | Ga0466968_0210388 | 3300044735 | Bacteria | 913 |
| 397 | Ga0466957_0001920 | 3300044842 | Bacteria | 11037 |
| 398 | Ga0466957_0018243 | 3300044842 | Bacteria | 4119 |
| 399 | Ga0466957_0076144 | 3300044842 | Bacteria | 2083 |
| 400 | Ga0466960_0257561 | 3300044901 | Bacteria | 971 |
| 401 | Ga0466959_0002185 | 3300045049 | Bacteria | 12440 |
| 402 | Ga0466959_0025858 | 3300045049 | Bacteria | 4353 |
| 403 | Ga0466959_0155315 | 3300045049 | Bacteria | 1611 |
| 404 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 405 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 406 | Ga0451576_0002868 | 3300045051 | Bacteria | 24693 |
| 407 | Ga0451576_0005999 | 3300045051 | Bacteria | 15024 |
| 408 | Ga0451576_0199277 | 3300045051 | Bacteria | 2091 |
| 409 | Ga0451576_0359886 | 3300045051 | Bacteria | 1524 |
| 410 | Ga0466958_0000123 | 3300045836 | Bacteria | 25381 |
| 411 | Ga0466967_0652134 | 3300045976 | Bacteria | 1041 |
| 412 | Ga0495617_000022 | 3300046452 | Bacteria | 185975 |
| 413 | Ga0495617_000075 | 3300046452 | Bacteria | 78250 |
| 414 | Ga0495617_001209 | 3300046452 | Bacteria | 11631 |
| 415 | Ga0495617_018396 | 3300046452 | Bacteria | 2362 |
| 416 | Ga0495617_101153 | 3300046452 | Bacteria | 936 |
| 417 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 418 | Ga0495627_000398 | 3300046453 | Bacteria | 38966 |
| 419 | Ga0495627_028660 | 3300046453 | Bacteria | 1777 |
| 420 | Ga0495627_030153 | 3300046453 | Bacteria | 1720 |
| 421 | Ga0495592_0002825 | 3300046454 | Bacteria | 12317 |
| 422 | Ga0495603_0219775 | 3300046455 | Bacteria | 1096 |
| 423 | Ga0495603_0333361 | 3300046455 | Bacteria | 870 |
| 424 | Ga0495590_0000057 | 3300046457 | Bacteria | 93720 |
| 425 | Ga0495590_0000143 | 3300046457 | Bacteria | 43197 |
| 426 | Ga0495590_0003098 | 3300046457 | Bacteria | 6801 |
| 427 | Ga0495590_0005737 | 3300046457 | Bacteria | 4877 |
| 428 | Ga0495629_0020396 | 3300046459 | Bacteria | 4733 |
| 429 | Ga0495629_0041378 | 3300046459 | Bacteria | 3242 |
| 430 | Ga0495638_0001680 | 3300046460 | Bacteria | 19581 |
| 431 | Ga0495638_0005569 | 3300046460 | Bacteria | 9312 |
| 432 | Ga0495638_0029512 | 3300046460 | Bacteria | 3537 |
| 433 | Ga0495638_0142822 | 3300046460 | Bacteria | 1395 |
| 434 | Ga0495638_0279409 | 3300046460 | Bacteria | 908 |
| 435 | Ga0495638_0294735 | 3300046460 | Bacteria | 876 |
| 436 | Ga0495638_0350140 | 3300046460 | Bacteria | 780 |
| 437 | Ga0495638_0469701 | 3300046460 | Bacteria | 639 |
| 438 | Ga0495653_0000044 | 3300046463 | Bacteria | 115591 |
| 439 | Ga0495653_0003313 | 3300046463 | Bacteria | 12931 |
| 440 | Ga0495653_0028893 | 3300046463 | Bacteria | 4432 |
| 441 | Ga0495653_0030963 | 3300046463 | Bacteria | 4256 |
| 442 | Ga0495653_0062600 | 3300046463 | Bacteria | 2810 |
| 443 | Ga0495653_0142416 | 3300046463 | Bacteria | 1684 |
| 444 | Ga0495653_0220831 | 3300046463 | Bacteria | 1274 |
| 445 | Ga0495650_0000082 | 3300046471 | Bacteria | 239477 |
| 446 | Ga0495650_0000254 | 3300046471 | Bacteria | 103512 |
| 447 | Ga0495650_0001173 | 3300046471 | Bacteria | 27987 |
| 448 | Ga0495650_0001749 | 3300046471 | Bacteria | 19780 |
| 449 | Ga0495650_0003298 | 3300046471 | Bacteria | 11915 |
| 450 | Ga0495650_0005094 | 3300046471 | Bacteria | 8689 |
| 451 | Ga0495650_0012103 | 3300046471 | Bacteria | 4666 |
| 452 | Ga0495580_0291017 | 3300046472 | Bacteria | 1113 |
| 453 | Ga0495582_0027191 | 3300046473 | Bacteria | 3134 |
| 454 | Ga0495582_0317982 | 3300046473 | Bacteria | 896 |
| 455 | Ga0495605_0000098 | 3300046474 | Bacteria | 109816 |
| 456 | Ga0495605_0000102 | 3300046474 | Bacteria | 107430 |
| 457 | Ga0495605_0000153 | 3300046474 | Bacteria | 88955 |
| 458 | Ga0495605_0002046 | 3300046474 | Bacteria | 12721 |
| 459 | Ga0495605_0020353 | 3300046474 | Bacteria | 3526 |
| 460 | Ga0495605_0037236 | 3300046474 | Bacteria | 2448 |
| 461 | Ga0495605_0051571 | 3300046474 | Bacteria | 2003 |
| 462 | Ga0495605_0118230 | 3300046474 | Bacteria | 1203 |
| 463 | Ga0495605_0119063 | 3300046474 | Bacteria | 1198 |
| 464 | Ga0495605_0127029 | 3300046474 | Bacteria | 1152 |
| 465 | Ga0495605_0176519 | 3300046474 | Bacteria | 941 |
| 466 | Ga0495605_0185627 | 3300046474 | Bacteria | 912 |
| 467 | Ga0495639_0099019 | 3300046475 | Bacteria | 1375 |
| 468 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 469 | Ga0495584_0000232 | 3300046491 | Bacteria | 40218 |
| 470 | Ga0495584_0000729 | 3300046491 | Bacteria | 21708 |
| 471 | Ga0495584_0002317 | 3300046491 | Bacteria | 10849 |
| 472 | Ga0495584_0008319 | 3300046491 | Bacteria | 5372 |
| 473 | Ga0495584_0009911 | 3300046491 | Bacteria | 4896 |
| 474 | Ga0495584_0016425 | 3300046491 | Bacteria | 3774 |
| 475 | Ga0495584_0050942 | 3300046491 | Bacteria | 2085 |
| 476 | Ga0495584_0072746 | 3300046491 | Bacteria | 1727 |
| 477 | Ga0495584_0142839 | 3300046491 | Bacteria | 1215 |
| 478 | Ga0495584_0263303 | 3300046491 | Bacteria | 876 |
| 479 | Ga0495584_0480564 | 3300046491 | Bacteria | 632 |
| 480 | Ga0495585_0000023 | 3300046492 | Bacteria | 149218 |
| 481 | Ga0495585_0000152 | 3300046492 | Bacteria | 74325 |
| 482 | Ga0495585_0000444 | 3300046492 | Bacteria | 39574 |
| 483 | Ga0495585_0004011 | 3300046492 | Bacteria | 9694 |
| 484 | Ga0495585_0022356 | 3300046492 | Bacteria | 3630 |
| 485 | Ga0495585_0036679 | 3300046492 | Bacteria | 2763 |
| 486 | Ga0495585_0063062 | 3300046492 | Bacteria | 2034 |
| 487 | Ga0495585_0065031 | 3300046492 | Bacteria | 1998 |
| 488 | Ga0495585_0081256 | 3300046492 | Bacteria | 1755 |
| 489 | Ga0495585_0086044 | 3300046492 | Bacteria | 1698 |
| 490 | Ga0495585_0093181 | 3300046492 | Bacteria | 1620 |
| 491 | Ga0495585_0110487 | 3300046492 | Bacteria | 1462 |
| 492 | Ga0495585_0120150 | 3300046492 | Bacteria | 1390 |
| 493 | Ga0495585_0124453 | 3300046492 | Bacteria | 1361 |
| 494 | Ga0495585_0127601 | 3300046492 | Bacteria | 1341 |
| 495 | Ga0495585_0130882 | 3300046492 | Bacteria | 1320 |
| 496 | Ga0495585_0198599 | 3300046492 | Bacteria | 1022 |
| 497 | Ga0495594_0014891 | 3300046499 | Bacteria | 4081 |
| 498 | Ga0495594_0067330 | 3300046499 | Bacteria | 1987 |
| 499 | Ga0495594_0068128 | 3300046499 | Bacteria | 1976 |
| 500 | Ga0495594_0111098 | 3300046499 | Bacteria | 1545 |
| 501 | Ga0495594_0203838 | 3300046499 | Bacteria | 1127 |
| 502 | Ga0495596_0000032 | 3300046500 | Bacteria | 102282 |
| 503 | Ga0495596_0001270 | 3300046500 | Bacteria | 14619 |
| 504 | Ga0495596_0004904 | 3300046500 | Bacteria | 6418 |
| 505 | Ga0495596_0019014 | 3300046500 | Bacteria | 2826 |
| 506 | Ga0495596_0019824 | 3300046500 | Bacteria | 2758 |
| 507 | Ga0495596_0064880 | 3300046500 | Bacteria | 1420 |
| 508 | Ga0495596_0104091 | 3300046500 | Bacteria | 1102 |
| 509 | Ga0495596_0140228 | 3300046500 | Bacteria | 938 |
| 510 | Ga0495596_0215517 | 3300046500 | Bacteria | 745 |
| 511 | Ga0495596_0219493 | 3300046500 | Bacteria | 738 |
| 512 | Ga0495607_0018756 | 3300046501 | Bacteria | 4400 |
| 513 | Ga0495607_0021757 | 3300046501 | Bacteria | 4032 |
| 514 | Ga0495607_0034462 | 3300046501 | Bacteria | 3071 |
| 515 | Ga0495607_0053231 | 3300046501 | Bacteria | 2340 |
| 516 | Ga0495607_0071833 | 3300046501 | Bacteria | 1928 |
| 517 | Ga0495607_0075941 | 3300046501 | Bacteria | 1860 |
| 518 | Ga0495607_0082535 | 3300046501 | Bacteria | 1763 |
| 519 | Ga0495607_0094427 | 3300046501 | Bacteria | 1613 |
| 520 | Ga0495607_0142834 | 3300046501 | Bacteria | 1233 |
| 521 | Ga0495607_0156528 | 3300046501 | Bacteria | 1161 |
| 522 | Ga0495607_0170248 | 3300046501 | Bacteria | 1100 |
| 523 | Ga0495607_0201691 | 3300046501 | Bacteria | 984 |
| 524 | Ga0495607_0304687 | 3300046501 | Bacteria | 749 |
| 525 | Ga0495583_0000106 | 3300046506 | Bacteria | 140932 |
| 526 | Ga0495583_0000150 | 3300046506 | Bacteria | 117772 |
| 527 | Ga0495583_0000597 | 3300046506 | Bacteria | 49120 |
| 528 | Ga0495583_0001383 | 3300046506 | Bacteria | 24824 |
| 529 | Ga0495583_0001918 | 3300046506 | Bacteria | 19228 |
| 530 | Ga0495583_0002413 | 3300046506 | Bacteria | 16045 |
| 531 | Ga0495583_0016522 | 3300046506 | Bacteria | 3962 |
| 532 | Ga0495583_0019473 | 3300046506 | Bacteria | 3541 |
| 533 | Ga0495583_0032678 | 3300046506 | Bacteria | 2509 |
| 534 | Ga0495583_0055535 | 3300046506 | Bacteria | 1789 |
| 535 | Ga0495583_0153492 | 3300046506 | Bacteria | 953 |
| 536 | Ga0495583_0208027 | 3300046506 | Bacteria | 793 |
| 537 | Ga0495606_0000080 | 3300046507 | Bacteria | 161866 |
| 538 | Ga0495606_0000090 | 3300046507 | Bacteria | 154737 |
| 539 | Ga0495606_0000099 | 3300046507 | Bacteria | 150950 |
| 540 | Ga0495606_0000524 | 3300046507 | Bacteria | 62049 |
| 541 | Ga0495606_0001629 | 3300046507 | Bacteria | 29255 |
| 542 | Ga0495606_0002603 | 3300046507 | Bacteria | 20634 |
| 543 | Ga0495606_0002891 | 3300046507 | Bacteria | 18970 |
| 544 | Ga0495606_0003267 | 3300046507 | Bacteria | 17378 |
| 545 | Ga0495606_0086803 | 3300046507 | Bacteria | 1932 |
| 546 | Ga0495606_0156832 | 3300046507 | Bacteria | 1331 |
| 547 | Ga0495606_0167075 | 3300046507 | Bacteria | 1279 |
| 548 | Ga0495606_0167282 | 3300046507 | Bacteria | 1278 |
| 549 | Ga0495606_0177366 | 3300046507 | Bacteria | 1231 |
| 550 | Ga0495606_0273276 | 3300046507 | Bacteria | 927 |
| 551 | Ga0495606_0287086 | 3300046507 | Bacteria | 897 |
| 552 | Ga0495606_0360638 | 3300046507 | Bacteria | 768 |
| 553 | Ga0495606_0482262 | 3300046507 | Bacteria | 629 |
| 554 | Ga0495608_0026533 | 3300046511 | Bacteria | 3948 |
| 555 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 556 | Ga0495610_0000668 | 3300046512 | Bacteria | 33359 |
| 557 | Ga0495610_0051728 | 3300046512 | Bacteria | 1997 |
| 558 | Ga0495610_0056760 | 3300046512 | Bacteria | 1881 |
| 559 | Ga0495610_0094937 | 3300046512 | Bacteria | 1345 |
| 560 | Ga0495610_0149659 | 3300046512 | Bacteria | 997 |
| 561 | Ga0495616_0000490 | 3300046513 | Bacteria | 30167 |
| 562 | Ga0495616_0002388 | 3300046513 | Bacteria | 12495 |
| 563 | Ga0495616_0004647 | 3300046513 | Bacteria | 8621 |
| 564 | Ga0495616_0006823 | 3300046513 | Bacteria | 6878 |
| 565 | Ga0495616_0016924 | 3300046513 | Bacteria | 4026 |
| 566 | Ga0495616_0018127 | 3300046513 | Bacteria | 3872 |
| 567 | Ga0495616_0018885 | 3300046513 | Bacteria | 3769 |
| 568 | Ga0495616_0027167 | 3300046513 | Bacteria | 3039 |
| 569 | Ga0495616_0029168 | 3300046513 | Bacteria | 2915 |
| 570 | Ga0495616_0052218 | 3300046513 | Bacteria | 2035 |
| 571 | Ga0495616_0140557 | 3300046513 | Bacteria | 1099 |
| 572 | Ga0495616_0166939 | 3300046513 | Bacteria | 986 |
| 573 | Ga0495616_0209388 | 3300046513 | Bacteria | 853 |
| 574 | Ga0495620_0025372 | 3300046515 | Bacteria | 2805 |
| 575 | Ga0495628_0000382 | 3300046516 | Bacteria | 40502 |
| 576 | Ga0495630_0290113 | 3300046517 | Bacteria | 1250 |
| 577 | Ga0495631_0001332 | 3300046518 | Bacteria | 15128 |
| 578 | Ga0495631_0001436 | 3300046518 | Bacteria | 14479 |
| 579 | Ga0495631_0017621 | 3300046518 | Bacteria | 3374 |
| 580 | Ga0495631_0021527 | 3300046518 | Bacteria | 3002 |
| 581 | Ga0495631_0089877 | 3300046518 | Bacteria | 1322 |
| 582 | Ga0495631_0108701 | 3300046518 | Bacteria | 1192 |
| 583 | Ga0495631_0132606 | 3300046518 | Bacteria | 1070 |
| 584 | Ga0495631_0178075 | 3300046518 | Bacteria | 911 |
| 585 | Ga0495631_0256240 | 3300046518 | Bacteria | 745 |
| 586 | Ga0495631_0264638 | 3300046518 | Bacteria | 732 |
| 587 | Ga0495631_0348127 | 3300046518 | Bacteria | 630 |
| 588 | Ga0495632_0000052 | 3300046519 | Bacteria | 132992 |
| 589 | Ga0495632_0000396 | 3300046519 | Bacteria | 40964 |
| 590 | Ga0495632_0001555 | 3300046519 | Bacteria | 18930 |
| 591 | Ga0495632_0003734 | 3300046519 | Bacteria | 10656 |
| 592 | Ga0495632_0012494 | 3300046519 | Bacteria | 4897 |
| 593 | Ga0495632_0077299 | 3300046519 | Bacteria | 1591 |
| 594 | Ga0495632_0229594 | 3300046519 | Bacteria | 837 |
| 595 | Ga0495637_0000018 | 3300046520 | Bacteria | 186671 |
| 596 | Ga0495637_0000195 | 3300046520 | Bacteria | 47191 |
| 597 | Ga0495637_0025136 | 3300046520 | Bacteria | 2686 |
| 598 | Ga0495637_0157208 | 3300046520 | Bacteria | 854 |
| 599 | Ga0495643_0000109 | 3300046522 | Bacteria | 135859 |
| 600 | Ga0495643_0000250 | 3300046522 | Bacteria | 78905 |
| 601 | Ga0495643_0000914 | 3300046522 | Bacteria | 31057 |
| 602 | Ga0495643_0001163 | 3300046522 | Bacteria | 25714 |
| 603 | Ga0495643_0014484 | 3300046522 | Bacteria | 4691 |
| 604 | Ga0495643_0020420 | 3300046522 | Bacteria | 3817 |
| 605 | Ga0495643_0074658 | 3300046522 | Bacteria | 1775 |
| 606 | Ga0495643_0167799 | 3300046522 | Bacteria | 1075 |
| 607 | Ga0495643_0169250 | 3300046522 | Bacteria | 1069 |
| 608 | Ga0495643_0173777 | 3300046522 | Bacteria | 1051 |
| 609 | Ga0495643_0288040 | 3300046522 | Bacteria | 753 |
| 610 | Ga0495644_0001124 | 3300046523 | Bacteria | 10982 |
| 611 | Ga0495644_0003935 | 3300046523 | Bacteria | 5846 |
| 612 | Ga0495644_0012464 | 3300046523 | Bacteria | 3269 |
| 613 | Ga0495644_0033210 | 3300046523 | Bacteria | 1949 |
| 614 | Ga0495644_0036962 | 3300046523 | Bacteria | 1842 |
| 615 | Ga0495644_0049248 | 3300046523 | Bacteria | 1581 |
| 616 | Ga0495644_0105342 | 3300046523 | Bacteria | 1068 |
| 617 | Ga0495644_0131017 | 3300046523 | Bacteria | 955 |
| 618 | Ga0495644_0138769 | 3300046523 | Bacteria | 928 |
| 619 | Ga0495644_0161425 | 3300046523 | Bacteria | 859 |
| 620 | Ga0495648_0001108 | 3300046524 | Bacteria | 27307 |
| 621 | Ga0495648_0001296 | 3300046524 | Bacteria | 24870 |
| 622 | Ga0495648_0001297 | 3300046524 | Bacteria | 24870 |
| 623 | Ga0495648_0001425 | 3300046524 | Bacteria | 23386 |
| 624 | Ga0495648_0003753 | 3300046524 | Bacteria | 13223 |
| 625 | Ga0495648_0012427 | 3300046524 | Bacteria | 6353 |
| 626 | Ga0495648_0015868 | 3300046524 | Bacteria | 5445 |
| 627 | Ga0495648_0030615 | 3300046524 | Bacteria | 3555 |
| 628 | Ga0495648_0049127 | 3300046524 | Bacteria | 2589 |
| 629 | Ga0495648_0081899 | 3300046524 | Bacteria | 1834 |
| 630 | Ga0495648_0103442 | 3300046524 | Bacteria | 1566 |
| 631 | Ga0495648_0120682 | 3300046524 | Bacteria | 1409 |
| 632 | Ga0495648_0124831 | 3300046524 | Bacteria | 1377 |
| 633 | Ga0495648_0169639 | 3300046524 | Bacteria | 1120 |
| 634 | Ga0495648_0221552 | 3300046524 | Bacteria | 932 |
| 635 | Ga0495663_0018991 | 3300046525 | Bacteria | 1961 |
| 636 | Ga0495663_0027435 | 3300046525 | Bacteria | 1671 |
| 637 | Ga0495663_0080205 | 3300046525 | Bacteria | 1050 |
| 638 | Ga0495663_0097680 | 3300046525 | Bacteria | 964 |
| 639 | Ga0495666_0006871 | 3300046526 | Bacteria | 5714 |
| 640 | Ga0495666_0007557 | 3300046526 | Bacteria | 5437 |
| 641 | Ga0495666_0089356 | 3300046526 | Bacteria | 1454 |
| 642 | Ga0495666_0136337 | 3300046526 | Bacteria | 1145 |
| 643 | Ga0495642_0000529 | 3300046528 | Bacteria | 19421 |
| 644 | Ga0495642_0003891 | 3300046528 | Bacteria | 5852 |
| 645 | Ga0495642_0004563 | 3300046528 | Bacteria | 5366 |
| 646 | Ga0495642_0022005 | 3300046528 | Bacteria | 2509 |
| 647 | Ga0495642_0049932 | 3300046528 | Bacteria | 1719 |
| 648 | Ga0495642_0055624 | 3300046528 | Bacteria | 1633 |
| 649 | Ga0495642_0091444 | 3300046528 | Bacteria | 1288 |
| 650 | Ga0495642_0095315 | 3300046528 | Bacteria | 1262 |
| 651 | Ga0495642_0097224 | 3300046528 | Bacteria | 1250 |
| 652 | Ga0495642_0128850 | 3300046528 | Bacteria | 1088 |
| 653 | Ga0495642_0135331 | 3300046528 | Bacteria | 1062 |
| 654 | Ga0495652_0195423 | 3300046529 | Bacteria | 1540 |
| 655 | Ga0495652_0225042 | 3300046529 | Bacteria | 1407 |
| 656 | Ga0495654_0000030 | 3300046530 | Bacteria | 216715 |
| 657 | Ga0495654_0018430 | 3300046530 | Bacteria | 3658 |
| 658 | Ga0495654_0021405 | 3300046530 | Bacteria | 3363 |
| 659 | Ga0495654_0154397 | 3300046530 | Bacteria | 1012 |
| 660 | Ga0495665_0001301 | 3300046531 | Bacteria | 13308 |
| 661 | Ga0495665_0034596 | 3300046531 | Bacteria | 2701 |
| 662 | Ga0495640_0244079 | 3300046533 | Bacteria | 1126 |
| 663 | Ga0495586_0003956 | 3300046535 | Bacteria | 7954 |
| 664 | Ga0495586_0348397 | 3300046535 | Bacteria | 850 |
| 665 | Ga0495587_0106740 | 3300046536 | Bacteria | 1610 |
| 666 | Ga0495587_0212022 | 3300046536 | Bacteria | 1093 |
| 667 | Ga0495598_0015527 | 3300046537 | Bacteria | 1925 |
| 668 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 669 | Ga0495609_0001531 | 3300046538 | Bacteria | 15203 |
| 670 | Ga0495609_0002820 | 3300046538 | Bacteria | 10412 |
| 671 | Ga0495609_0005405 | 3300046538 | Bacteria | 6723 |
| 672 | Ga0495609_0006790 | 3300046538 | Bacteria | 5791 |
| 673 | Ga0495609_0053145 | 3300046538 | Bacteria | 1801 |
| 674 | Ga0495609_0087078 | 3300046538 | Bacteria | 1361 |
| 675 | Ga0495609_0090129 | 3300046538 | Bacteria | 1333 |
| 676 | Ga0495609_0094483 | 3300046538 | Bacteria | 1298 |
| 677 | Ga0495609_0112477 | 3300046538 | Bacteria | 1174 |
| 678 | Ga0495609_0167361 | 3300046538 | Bacteria | 929 |
| 679 | Ga0495621_0167216 | 3300046539 | Bacteria | 872 |
| 680 | Ga0495597_0001115 | 3300046542 | Bacteria | 20308 |
| 681 | Ga0495597_0001285 | 3300046542 | Bacteria | 18457 |
| 682 | Ga0495597_0001411 | 3300046542 | Bacteria | 17326 |
| 683 | Ga0495597_0002378 | 3300046542 | Bacteria | 12035 |
| 684 | Ga0495597_0004502 | 3300046542 | Bacteria | 7634 |
| 685 | Ga0495597_0018041 | 3300046542 | Bacteria | 3315 |
| 686 | Ga0495597_0018630 | 3300046542 | Bacteria | 3255 |
| 687 | Ga0495597_0059212 | 3300046542 | Bacteria | 1672 |
| 688 | Ga0495597_0176075 | 3300046542 | Bacteria | 866 |
| 689 | Ga0495597_0217646 | 3300046542 | Bacteria | 759 |
| 690 | Ga0495645_0068890 | 3300046543 | Bacteria | 2554 |
| 691 | Ga0495622_0000044 | 3300046557 | Bacteria | 115528 |
| 692 | Ga0495622_0002393 | 3300046557 | Bacteria | 9126 |
| 693 | Ga0495622_0004973 | 3300046557 | Bacteria | 6157 |
| 694 | Ga0495622_0031549 | 3300046557 | Bacteria | 2476 |
| 695 | Ga0495622_0031647 | 3300046557 | Bacteria | 2471 |
| 696 | Ga0495622_0185930 | 3300046557 | Bacteria | 930 |
| 697 | Ga0495622_0271346 | 3300046557 | Bacteria | 743 |
| 698 | Ga0495633_0000917 | 3300046558 | Bacteria | 24985 |
| 699 | Ga0495633_0003343 | 3300046558 | Bacteria | 10770 |
| 700 | Ga0495633_0006937 | 3300046558 | Bacteria | 6622 |
| 701 | Ga0495633_0008903 | 3300046558 | Bacteria | 5597 |
| 702 | Ga0495633_0018586 | 3300046558 | Bacteria | 3527 |
| 703 | Ga0495633_0023285 | 3300046558 | Bacteria | 3069 |
| 704 | Ga0495633_0059388 | 3300046558 | Bacteria | 1793 |
| 705 | Ga0495633_0097204 | 3300046558 | Bacteria | 1367 |
| 706 | Ga0495633_0195396 | 3300046558 | Bacteria | 929 |
| 707 | Ga0495633_0237567 | 3300046558 | Bacteria | 832 |
| 708 | Ga0495633_0349354 | 3300046558 | Bacteria | 670 |
| 709 | Ga0495656_0052339 | 3300046615 | Bacteria | 1750 |
| 710 | Ga0495656_0090382 | 3300046615 | Bacteria | 1399 |
| 711 | Ga0495656_0176549 | 3300046615 | Bacteria | 1047 |
| 712 | Ga0495668_0000035 | 3300046616 | Bacteria | 240241 |
| 713 | Ga0495668_0000211 | 3300046616 | Bacteria | 84615 |
| 714 | Ga0495668_0000286 | 3300046616 | Bacteria | 69771 |
| 715 | Ga0495668_0000939 | 3300046616 | Bacteria | 32535 |
| 716 | Ga0495668_0001545 | 3300046616 | Bacteria | 21835 |
| 717 | Ga0495668_0004452 | 3300046616 | Bacteria | 9939 |
| 718 | Ga0495668_0007872 | 3300046616 | Bacteria | 6738 |
| 719 | Ga0495668_0066663 | 3300046616 | Bacteria | 1980 |
| 720 | Ga0495668_0069634 | 3300046616 | Bacteria | 1934 |
| 721 | Ga0495668_0110644 | 3300046616 | Bacteria | 1502 |
| 722 | Ga0495668_0111339 | 3300046616 | Bacteria | 1497 |
| 723 | Ga0495668_0124532 | 3300046616 | Bacteria | 1410 |
| 724 | Ga0495668_0157375 | 3300046616 | Bacteria | 1244 |
| 725 | Ga0495668_0251588 | 3300046616 | Bacteria | 967 |
| 726 | Ga0495634_0029850 | 3300046642 | Bacteria | 3771 |
| 727 | Ga0495634_0185328 | 3300046642 | Bacteria | 1301 |
| 728 | Ga0495611_0001030 | 3300046648 | Bacteria | 14761 |
| 729 | Ga0495611_0003988 | 3300046648 | Bacteria | 6425 |
| 730 | Ga0495611_0006487 | 3300046648 | Bacteria | 4986 |
| 731 | Ga0495611_0012387 | 3300046648 | Bacteria | 3626 |
| 732 | Ga0495611_0019917 | 3300046648 | Bacteria | 2884 |
| 733 | Ga0495611_0024927 | 3300046648 | Bacteria | 2603 |
| 734 | Ga0495611_0030738 | 3300046648 | Bacteria | 2362 |
| 735 | Ga0495611_0058343 | 3300046648 | Bacteria | 1750 |
| 736 | Ga0495611_0184440 | 3300046648 | Bacteria | 974 |
| 737 | Ga0495611_0245871 | 3300046648 | Bacteria | 830 |
| 738 | Ga0495625_0000338 | 3300046660 | Bacteria | 71524 |
| 739 | Ga0495625_0001765 | 3300046660 | Bacteria | 25007 |
| 740 | Ga0495625_0016076 | 3300046660 | Bacteria | 5897 |
| 741 | Ga0495625_0032153 | 3300046660 | Bacteria | 3895 |
| 742 | Ga0495625_0032657 | 3300046660 | Bacteria | 3857 |
| 743 | Ga0495625_0159609 | 3300046660 | Bacteria | 1511 |
| 744 | Ga0495625_0229305 | 3300046660 | Bacteria | 1213 |
| 745 | Ga0495625_0244011 | 3300046660 | Bacteria | 1168 |
| 746 | Ga0495625_0464422 | 3300046660 | Bacteria | 780 |
| 747 | Ga0495635_0008609 | 3300046663 | Bacteria | 7123 |
| 748 | Ga0495635_0117569 | 3300046663 | Bacteria | 1814 |
| 749 | Ga0495659_0000139 | 3300046664 | Bacteria | 32158 |
| 750 | Ga0495659_0006513 | 3300046664 | Bacteria | 3687 |
| 751 | Ga0495659_0012720 | 3300046664 | Bacteria | 2731 |
| 752 | Ga0495659_0021812 | 3300046664 | Bacteria | 2161 |
| 753 | Ga0495661_0000074 | 3300046665 | Bacteria | 120402 |
| 754 | Ga0495661_0014026 | 3300046665 | Bacteria | 5371 |
| 755 | Ga0495661_0024464 | 3300046665 | Bacteria | 3908 |
| 756 | Ga0495661_0024989 | 3300046665 | Bacteria | 3865 |
| 757 | Ga0495661_0050895 | 3300046665 | Bacteria | 2504 |
| 758 | Ga0495661_0056989 | 3300046665 | Bacteria | 2334 |
| 759 | Ga0495661_0081170 | 3300046665 | Bacteria | 1869 |
| 760 | Ga0495661_0090282 | 3300046665 | Bacteria | 1744 |
| 761 | Ga0495661_0095657 | 3300046665 | Bacteria | 1681 |
| 762 | Ga0495661_0097206 | 3300046665 | Bacteria | 1663 |
| 763 | Ga0495661_0170266 | 3300046665 | Bacteria | 1162 |
| 764 | Ga0495661_0170462 | 3300046665 | Bacteria | 1161 |
| 765 | Ga0495661_0178616 | 3300046665 | Bacteria | 1126 |
| 766 | Ga0495661_0194602 | 3300046665 | Bacteria | 1065 |
| 767 | Ga0495661_0218634 | 3300046665 | Bacteria | 988 |
| 768 | Ga0495661_0276444 | 3300046665 | Bacteria | 848 |
| 769 | Ga0495661_0465967 | 3300046665 | Bacteria | 606 |
| 770 | Ga0495588_0000451 | 3300046674 | Bacteria | 20713 |
| 771 | Ga0495588_0012930 | 3300046674 | Bacteria | 3961 |
| 772 | Ga0495588_0037807 | 3300046674 | Bacteria | 2453 |
| 773 | Ga0495588_0056552 | 3300046674 | Bacteria | 2025 |
| 774 | Ga0495588_0124955 | 3300046674 | Bacteria | 1356 |
| 775 | Ga0495588_0136992 | 3300046674 | Bacteria | 1292 |
| 776 | Ga0495588_0183519 | 3300046674 | Bacteria | 1106 |
| 777 | Ga0495588_0209771 | 3300046674 | Bacteria | 1028 |
| 778 | Ga0495599_0009879 | 3300046678 | Bacteria | 5840 |
| 779 | Ga0495599_0302397 | 3300046678 | Bacteria | 965 |
| 780 | Ga0495623_0010353 | 3300046679 | Bacteria | 6037 |
| 781 | Ga0495623_0089894 | 3300046679 | Bacteria | 1886 |
| 782 | Ga0495623_0186117 | 3300046679 | Bacteria | 1203 |
| 783 | Ga0495623_0264807 | 3300046679 | Bacteria | 961 |
| 784 | Ga0495646_0315081 | 3300046680 | Bacteria | 825 |
| 785 | Ga0495669_0000101 | 3300046684 | Bacteria | 53876 |
| 786 | Ga0495669_0000495 | 3300046684 | Bacteria | 18130 |
| 787 | Ga0495669_0001145 | 3300046684 | Bacteria | 10993 |
| 788 | Ga0495669_0081917 | 3300046684 | Bacteria | 1482 |
| 789 | Ga0495669_0093504 | 3300046684 | Bacteria | 1390 |
| 790 | Ga0495669_0174437 | 3300046684 | Bacteria | 1023 |
| 791 | Ga0495613_0026824 | 3300046689 | Bacteria | 4290 |
| 792 | Ga0495613_0392189 | 3300046689 | Bacteria | 948 |
| 793 | Ga0495624_0004359 | 3300046690 | Bacteria | 10375 |
| 794 | Ga0495624_0020490 | 3300046690 | Bacteria | 4400 |
| 795 | Ga0495624_0124437 | 3300046690 | Bacteria | 1583 |
| 796 | Ga0495670_0000859 | 3300046691 | Bacteria | 14714 |
| 797 | Ga0495670_0013263 | 3300046691 | Bacteria | 4053 |
| 798 | Ga0495670_0044778 | 3300046691 | Bacteria | 2209 |
| 799 | Ga0495670_0087076 | 3300046691 | Bacteria | 1596 |
| 800 | Ga0495670_0155332 | 3300046691 | Bacteria | 1200 |
| 801 | Ga0495670_0158563 | 3300046691 | Bacteria | 1188 |
| 802 | Ga0495670_0238538 | 3300046691 | Bacteria | 968 |
| 803 | Ga0495671_0000087 | 3300046692 | Bacteria | 87327 |
| 804 | Ga0495671_0000605 | 3300046692 | Bacteria | 26398 |
| 805 | Ga0495671_0003550 | 3300046692 | Bacteria | 9532 |
| 806 | Ga0495671_0212145 | 3300046692 | Bacteria | 938 |
| 807 | Ga0495671_0219143 | 3300046692 | Bacteria | 921 |
| 808 | Ga0495671_0249224 | 3300046692 | Bacteria | 857 |
| 809 | Ga0495649_0000194 | 3300046694 | Bacteria | 53689 |
| 810 | Ga0495649_0008705 | 3300046694 | Bacteria | 6087 |
| 811 | Ga0495649_0016852 | 3300046694 | Bacteria | 4136 |
| 812 | Ga0495649_0082460 | 3300046694 | Bacteria | 1718 |
| 813 | Ga0495649_0148011 | 3300046694 | Bacteria | 1234 |
| 814 | Ga0495649_0183663 | 3300046694 | Bacteria | 1090 |
| 815 | Ga0495649_0243124 | 3300046694 | Bacteria | 926 |
| 816 | Ga0495649_0280284 | 3300046694 | Bacteria | 852 |
| 817 | Ga0495649_0331277 | 3300046694 | Bacteria | 771 |
| 818 | Ga0495649_0408167 | 3300046694 | Bacteria | 681 |
| 819 | Ga0495589_0000086 | 3300046794 | Bacteria | 86130 |
| 820 | Ga0495589_0000132 | 3300046794 | Bacteria | 68363 |
| 821 | Ga0495589_0018768 | 3300046794 | Bacteria | 3545 |
| 822 | Ga0495589_0051939 | 3300046794 | Bacteria | 2025 |
| 823 | Ga0495589_0075941 | 3300046794 | Bacteria | 1638 |
| 824 | Ga0495589_0081465 | 3300046794 | Bacteria | 1574 |
| 825 | Ga0495589_0106770 | 3300046794 | Bacteria | 1352 |
| 826 | Ga0495589_0139767 | 3300046794 | Bacteria | 1160 |
| 827 | Ga0495589_0182429 | 3300046794 | Bacteria | 995 |
| 828 | Ga0495589_0253560 | 3300046794 | Bacteria | 821 |
| 829 | Ga0495600_0002033 | 3300046809 | Bacteria | 11394 |
| 830 | Ga0495600_0161897 | 3300046809 | Bacteria | 1446 |
| 831 | Ga0495600_0388825 | 3300046809 | Bacteria | 869 |
| 832 | Ga0495660_0001930 | 3300046810 | Bacteria | 13528 |
| 833 | Ga0495660_0003563 | 3300046810 | Bacteria | 9601 |
| 834 | Ga0495660_0007681 | 3300046810 | Bacteria | 6335 |
| 835 | Ga0495660_0028271 | 3300046810 | Bacteria | 3169 |
| 836 | Ga0495660_0097121 | 3300046810 | Bacteria | 1521 |
| 837 | Ga0495660_0102255 | 3300046810 | Bacteria | 1473 |
| 838 | Ga0495660_0204625 | 3300046810 | Bacteria | 940 |
| 839 | Ga0495660_0207146 | 3300046810 | Bacteria | 932 |
| 840 | Ga0495660_0216121 | 3300046810 | Bacteria | 906 |
| 841 | Ga0495660_0216966 | 3300046810 | Bacteria | 904 |
| 842 | Ga0495660_0232356 | 3300046810 | Bacteria | 863 |
| 843 | Ga0495660_0262214 | 3300046810 | Bacteria | 797 |
| 844 | Ga0495581_0197328 | 3300047315 | Bacteria | 1177 |
| 845 | Ga0495581_0387533 | 3300047315 | Bacteria | 815 |
| 846 | Ga0495604_0032878 | 3300047317 | Bacteria | 4108 |
| 847 | Ga0495604_0053804 | 3300047317 | Bacteria | 3109 |
| 848 | Ga0495604_0108518 | 3300047317 | Bacteria | 2027 |
| 849 | Ga0495636_0003424 | 3300047318 | Bacteria | 6152 |
| 850 | Ga0495636_0004254 | 3300047318 | Bacteria | 5617 |
| 851 | Ga0495636_0011954 | 3300047318 | Bacteria | 3439 |
| 852 | Ga0495636_0093780 | 3300047318 | Bacteria | 1306 |
| 853 | Ga0495636_0182706 | 3300047318 | Bacteria | 952 |
| 854 | Ga0495674_0011663 | 3300047319 | Bacteria | 8289 |
| 855 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 856 | Ga0495672_0000278 | 3300047320 | Bacteria | 71017 |
| 857 | Ga0495672_0000512 | 3300047320 | Bacteria | 44570 |
| 858 | Ga0495672_0001189 | 3300047320 | Bacteria | 26357 |
| 859 | Ga0495672_0033064 | 3300047320 | Bacteria | 3208 |
| 860 | Ga0495672_0110608 | 3300047320 | Bacteria | 1475 |
| 861 | Ga0495672_0149142 | 3300047320 | Bacteria | 1214 |
| 862 | Ga0495672_0192288 | 3300047320 | Bacteria | 1025 |
| 863 | Ga0495672_0270825 | 3300047320 | Bacteria | 815 |
| 864 | Ga0495676_0000015 | 3300047321 | Bacteria | 199492 |
| 865 | Ga0495676_0068178 | 3300047321 | Bacteria | 2750 |
| 866 | Ga0495676_0478428 | 3300047321 | Bacteria | 819 |
| 867 | Ga0495680_0663530 | 3300047322 | Bacteria | 692 |
| 868 | Ga0495683_0000036 | 3300047323 | Bacteria | 144974 |
| 869 | Ga0495683_0005881 | 3300047323 | Bacteria | 6742 |
| 870 | Ga0495683_0006168 | 3300047323 | Bacteria | 6571 |
| 871 | Ga0495683_0015050 | 3300047323 | Bacteria | 4029 |
| 872 | Ga0495683_0043476 | 3300047323 | Bacteria | 2261 |
| 873 | Ga0495683_0069970 | 3300047323 | Bacteria | 1724 |
| 874 | Ga0495683_0085180 | 3300047323 | Bacteria | 1537 |
| 875 | Ga0495683_0118925 | 3300047323 | Bacteria | 1255 |
| 876 | Ga0495683_0287733 | 3300047323 | Bacteria | 709 |
| 877 | Ga0495687_000038 | 3300047443 | Bacteria | 251616 |
| 878 | Ga0495687_000057 | 3300047443 | Bacteria | 186224 |
| 879 | Ga0495687_000165 | 3300047443 | Bacteria | 99031 |
| 880 | Ga0495687_001055 | 3300047443 | Bacteria | 27247 |
| 881 | Ga0495687_001122 | 3300047443 | Bacteria | 26027 |
| 882 | Ga0495687_001809 | 3300047443 | Bacteria | 18804 |
| 883 | Ga0495687_007401 | 3300047443 | Bacteria | 6469 |
| 884 | Ga0495687_070205 | 3300047443 | Bacteria | 1407 |
| 885 | Ga0495675_0296286 | 3300047444 | Bacteria | 961 |
| 886 | Ga0495677_0000004 | 3300047445 | Bacteria | 248210 |
| 887 | Ga0495677_0000948 | 3300047445 | Bacteria | 11680 |
| 888 | Ga0495677_0005204 | 3300047445 | Bacteria | 4948 |
| 889 | Ga0495677_0005995 | 3300047445 | Bacteria | 4600 |
| 890 | Ga0495677_0030645 | 3300047445 | Bacteria | 1957 |
| 891 | Ga0495677_0069528 | 3300047445 | Bacteria | 1311 |
| 892 | Ga0495677_0074959 | 3300047445 | Bacteria | 1263 |
| 893 | Ga0495677_0086085 | 3300047445 | Bacteria | 1181 |
| 894 | Ga0495677_0149704 | 3300047445 | Bacteria | 898 |
| 895 | Ga0495677_0170223 | 3300047445 | Bacteria | 842 |
| 896 | Ga0495677_0178619 | 3300047445 | Bacteria | 822 |
| 897 | Ga0495679_001332 | 3300047446 | Bacteria | 14284 |
| 898 | Ga0495679_063648 | 3300047446 | Bacteria | 1076 |
| 899 | Ga0495685_000299 | 3300047447 | Bacteria | 16305 |
| 900 | Ga0495685_021233 | 3300047447 | Bacteria | 2234 |
| 901 | Ga0495685_023768 | 3300047447 | Bacteria | 2110 |
| 902 | Ga0495685_039572 | 3300047447 | Bacteria | 1613 |
| 903 | Ga0495685_082816 | 3300047447 | Bacteria | 1067 |
| 904 | Ga0495673_0000069 | 3300047469 | Bacteria | 218170 |
| 905 | Ga0495673_0000203 | 3300047469 | Bacteria | 89918 |
| 906 | Ga0495673_0000236 | 3300047469 | Bacteria | 79618 |
| 907 | Ga0495673_0046695 | 3300047469 | Bacteria | 1918 |
| 908 | Ga0495673_0185264 | 3300047469 | Bacteria | 786 |
| 909 | Ga0495681_0001009 | 3300047470 | Bacteria | 21583 |
| 910 | Ga0495681_0015607 | 3300047470 | Bacteria | 4291 |
| 911 | Ga0495681_0051862 | 3300047470 | Bacteria | 1927 |
| 912 | Ga0495681_0074195 | 3300047470 | Bacteria | 1534 |
| 913 | Ga0495681_0076968 | 3300047470 | Bacteria | 1498 |
| 914 | Ga0495681_0120190 | 3300047470 | Bacteria | 1128 |
| 915 | Ga0495686_0000620 | 3300047472 | Bacteria | 48981 |
| 916 | Ga0495686_0001028 | 3300047472 | Bacteria | 33622 |
| 917 | Ga0495686_0006069 | 3300047472 | Bacteria | 9368 |
| 918 | Ga0495686_0048133 | 3300047472 | Bacteria | 2689 |
| 919 | Ga0495686_0053203 | 3300047472 | Bacteria | 2537 |
| 920 | Ga0495686_0132978 | 3300047472 | Bacteria | 1473 |
| 921 | Ga0495686_0264985 | 3300047472 | Bacteria | 960 |
| 922 | Ga0495593_0041261 | 3300047673 | Bacteria | 2482 |
| 923 | Ga0495602_0123252 | 3300048088 | Bacteria | 2081 |
| 924 | Ga0495602_0124621 | 3300048088 | Bacteria | 2066 |
| 925 | Ga0495602_0236664 | 3300048088 | Bacteria | 1368 |
| 926 | Ga0495614_0037921 | 3300048089 | Bacteria | 2068 |
| 927 | Ga0495614_0106892 | 3300048089 | Bacteria | 1227 |
| 928 | Ga0495615_0004412 | 3300048090 | Bacteria | 2456 |
| 929 | Ga0495615_0108744 | 3300048090 | Bacteria | 791 |
| 930 | Ga0495615_0130685 | 3300048090 | Bacteria | 734 |
| 931 | Ga0495626_0000048 | 3300048091 | Bacteria | 161634 |
| 932 | Ga0495626_0000279 | 3300048091 | Bacteria | 56185 |
| 933 | Ga0495626_0000998 | 3300048091 | Bacteria | 24336 |
| 934 | Ga0495626_0001757 | 3300048091 | Bacteria | 16497 |
| 935 | Ga0495626_0002805 | 3300048091 | Bacteria | 11678 |
| 936 | Ga0495626_0005031 | 3300048091 | Bacteria | 7893 |
| 937 | Ga0495626_0010181 | 3300048091 | Bacteria | 5042 |
| 938 | Ga0495626_0021084 | 3300048091 | Bacteria | 3239 |
| 939 | Ga0495626_0049285 | 3300048091 | Bacteria | 1950 |
| 940 | Ga0495626_0052127 | 3300048091 | Bacteria | 1886 |
| 941 | Ga0495626_0057384 | 3300048091 | Bacteria | 1781 |
| 942 | Ga0495626_0065425 | 3300048091 | Bacteria | 1645 |
| 943 | Ga0495626_0111765 | 3300048091 | Bacteria | 1182 |
| 944 | Ga0495626_0156595 | 3300048091 | Bacteria | 957 |
| 945 | Ga0495626_0173292 | 3300048091 | Bacteria | 898 |
| 946 | Ga0495626_0180387 | 3300048091 | Bacteria | 875 |
| 947 | Ga0495626_0192718 | 3300048091 | Bacteria | 839 |
| 948 | Ga0495626_0223047 | 3300048091 | Bacteria | 765 |
| 949 | Ga0496100_0037867 | 3300048903 | Bacteria | 3053 |
| 950 | Ga0496100_0154562 | 3300048903 | Bacteria | 1639 |
| 951 | Ga0496101_0070873 | 3300048904 | Bacteria | 2553 |
| 952 | Ga0496101_0088835 | 3300048904 | Bacteria | 2296 |
| 953 | Ga0496101_0344823 | 3300048904 | Bacteria | 1170 |
| 954 | Ga0496102_0000478 | 3300048905 | Bacteria | 44372 |
| 955 | Ga0496102_0008640 | 3300048905 | Bacteria | 8741 |
| 956 | Ga0496102_0017344 | 3300048905 | Bacteria | 6306 |
| 957 | Ga0496102_0060082 | 3300048905 | Bacteria | 3477 |
| 958 | Ga0496102_0215355 | 3300048905 | Bacteria | 1810 |
| 959 | Ga0496102_0844309 | 3300048905 | Bacteria | 838 |
| 960 | Ga0496103_0039346 | 3300048906 | Bacteria | 2905 |
| 961 | Ga0496103_0066485 | 3300048906 | Bacteria | 2250 |
| 962 | Ga0496103_0146237 | 3300048906 | Bacteria | 1513 |
| 963 | Ga0496104_0443679 | 3300048907 | Bacteria | 1210 |
| 964 | Ga0496105_0674294 | 3300048908 | Bacteria | 796 |
| 965 | Ga0496106_0335160 | 3300048909 | Bacteria | 1215 |
| 966 | Ga0496106_0830783 | 3300048909 | Bacteria | 732 |
| 967 | Ga0496107_0131596 | 3300048910 | Bacteria | 1847 |
| 968 | Ga0496107_0227084 | 3300048910 | Bacteria | 1389 |
| 969 | Ga0496109_0233913 | 3300048912 | Bacteria | 1729 |
| 970 | Ga0496110_0000092 | 3300048913 | Bacteria | 48035 |
| 971 | Ga0496110_0223501 | 3300048913 | Bacteria | 1712 |
| 972 | Ga0496111_0104260 | 3300048914 | Bacteria | 2086 |
| 973 | Ga0496113_0097164 | 3300048916 | Bacteria | 2278 |
| 974 | Ga0496113_1025587 | 3300048916 | Bacteria | 649 |
| 975 | Ga0496114_0117903 | 3300048917 | Bacteria | 2280 |
| 976 | Ga0496115_0186034 | 3300048918 | Bacteria | 1716 |
| 977 | Ga0496115_0530364 | 3300048918 | Bacteria | 943 |
| 978 | Ga0496115_0702750 | 3300048918 | Bacteria | 795 |
| 979 | Ga0496115_0713328 | 3300048918 | Bacteria | 787 |
| 980 | Ga0496116_0010336 | 3300048919 | Bacteria | 7838 |
| 981 | Ga0496116_0044055 | 3300048919 | Bacteria | 3034 |
| 982 | Ga0496116_0201000 | 3300048919 | Bacteria | 1043 |
| 983 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 984 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 985 | Ga0496121_0002018 | 3300048924 | Bacteria | 32204 |
| 986 | Ga0496121_0057712 | 3300048924 | Bacteria | 3215 |
| 987 | Ga0496121_0236502 | 3300048924 | Bacteria | 1276 |
| 988 | Ga0496121_0333285 | 3300048924 | Bacteria | 1017 |
| 989 | Ga0496121_0439019 | 3300048924 | Bacteria | 844 |
| 990 | Ga0496122_0003525 | 3300048925 | Bacteria | 20479 |
| 991 | Ga0496122_0020064 | 3300048925 | Bacteria | 6067 |
| 992 | Ga0496122_0042085 | 3300048925 | Bacteria | 3598 |
| 993 | Ga0496123_0000084 | 3300048926 | Bacteria | 187479 |
| 994 | Ga0496123_0001425 | 3300048926 | Bacteria | 33435 |
| 995 | Ga0496123_0003683 | 3300048926 | Bacteria | 16896 |
| 996 | Ga0496123_0004216 | 3300048926 | Bacteria | 15340 |
| 997 | Ga0496124_0010436 | 3300048927 | Bacteria | 9401 |
| 998 | Ga0496124_0134060 | 3300048927 | Bacteria | 1964 |
| 999 | Ga0496124_0233802 | 3300048927 | Bacteria | 1372 |
| 1000 | Ga0496124_0258140 | 3300048927 | Bacteria | 1284 |
| 1001 | Ga0496124_0468886 | 3300048927 | Bacteria | 853 |
| 1002 | Ga0496124_0521428 | 3300048927 | Bacteria | 791 |
| 1003 | Ga0496125_0000368 | 3300048928 | Bacteria | 84924 |
| 1004 | Ga0496125_0089020 | 3300048928 | Bacteria | 2323 |
| 1005 | Ga0496125_0204119 | 3300048928 | Bacteria | 1290 |
| 1006 | Ga0496126_0027941 | 3300048929 | Bacteria | 5380 |
| 1007 | Ga0496126_0114487 | 3300048929 | Bacteria | 2346 |
| 1008 | Ga0496126_0287297 | 3300048929 | Bacteria | 1361 |
| 1009 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 1010 | Ga0495678_000034 | 3300049459 | Bacteria | 207827 |
| 1011 | Ga0495678_000095 | 3300049459 | Bacteria | 109532 |
| 1012 | Ga0495678_000383 | 3300049459 | Bacteria | 44894 |
| 1013 | Ga0495678_001376 | 3300049459 | Bacteria | 19384 |
| 1014 | Ga0495678_001441 | 3300049459 | Bacteria | 18715 |
| 1015 | Ga0495678_009739 | 3300049459 | Bacteria | 4722 |
| 1016 | Ga0495678_056982 | 3300049459 | Bacteria | 1482 |
| 1017 | Ga0495678_083062 | 3300049459 | Bacteria | 1145 |
| 1018 | Ga0495682_0000089 | 3300049460 | Bacteria | 80020 |
| 1019 | Ga0495682_0000432 | 3300049460 | Bacteria | 29176 |
| 1020 | Ga0495682_0022370 | 3300049460 | Bacteria | 2364 |
| 1021 | Ga0495682_0058762 | 3300049460 | Bacteria | 1390 |
| 1022 | Ga0495682_0078158 | 3300049460 | Bacteria | 1190 |
| 1023 | Ga0495682_0084149 | 3300049460 | Bacteria | 1143 |
| 1024 | Ga0495682_0093822 | 3300049460 | Bacteria | 1078 |
| 1025 | Ga0495682_0208689 | 3300049460 | Bacteria | 692 |
| 1026 | Ga0501295_001090 | 3300049518 | Bacteria | 2671 |
| 1027 | Ga0501315_008783 | 3300049531 | Bacteria | 1182 |
| 1028 | Ga0501316_007461 | 3300049532 | Bacteria | 1188 |
| 1029 | Ga0501323_018249 | 3300049539 | Bacteria | 907 |
| 1030 | Ga0501034_0000134 | 3300049571 | Bacteria | 137745 |
| 1031 | Ga0501034_1031688 | 3300049571 | Bacteria | 705 |
| 1032 | Ga0501075_0111296 | 3300049591 | Bacteria | 2082 |
| 1033 | Ga0501202_066870 | 3300049652 | Bacteria | 822 |
| 1034 | Ga0501211_003557 | 3300049658 | Bacteria | 1603 |
| 1035 | Ga0501211_012123 | 3300049658 | Bacteria | 851 |
| 1036 | Ga0501216_079505 | 3300049660 | Bacteria | 691 |
| 1037 | Ga0501227_184370 | 3300049665 | Bacteria | 587 |
| 1038 | Ga0501230_014418 | 3300049667 | Bacteria | 1297 |
| 1039 | Ga0501238_001560 | 3300049671 | Bacteria | 2659 |
| 1040 | Ga0501240_041629 | 3300049673 | Bacteria | 765 |
| 1041 | Ga0501249_036722 | 3300049679 | Bacteria | 1104 |
| 1042 | Ga0501081_0134001 | 3300049743 | Bacteria | 1772 |
| 1043 | Ga0501083_0049975 | 3300049744 | Bacteria | 2816 |
| 1044 | Ga0501269_000473 | 3300049766 | Bacteria | 8609 |
| 1045 | Ga0501269_038157 | 3300049766 | Bacteria | 633 |
| 1046 | Ga0501280_000153 | 3300049776 | Bacteria | 17816 |
| 1047 | Ga0501283_049195 | 3300049779 | Bacteria | 744 |
| 1048 | Ga0501035_0006010 | 3300049822 | Bacteria | 11433 |
| 1049 | Ga0501044_0252781 | 3300049823 | Bacteria | 1703 |
| 1050 | Ga0501045_0552537 | 3300049824 | Bacteria | 854 |
| 1051 | nmdc:mga0k408_2236_c1 | 3300050493 | Bacteria | 10354 |
| 1052 | nmdc:mga0qj67_246743_c1 | 3300050509 | Bacteria | 1449 |
| 1053 | nmdc:mga0qj67_484271_c1 | 3300050509 | Bacteria | 995 |
| 1054 | Ga0495601_0011317 | 3300053077 | Bacteria | 5332 |
| 1055 | Ga0500572_034944 | 3300053111 | Bacteria | 1427 |
| 1056 | Ga0500594_0114301 | 3300053118 | Bacteria | 842 |
| 1057 | Ga0500595_022717 | 3300053119 | Bacteria | 2214 |
| 1058 | Ga0500618_000653 | 3300053125 | Bacteria | 20633 |
| 1059 | Ga0500618_062749 | 3300053125 | Bacteria | 835 |
| 1060 | Ga0500618_071845 | 3300053125 | Bacteria | 776 |
| 1061 | Ga0500574_000047 | 3300053141 | Bacteria | 14143 |
| 1062 | Ga0500586_000912 | 3300053145 | Bacteria | 6084 |
| 1063 | Ga0500619_003631 | 3300053154 | Bacteria | 3193 |
| 1064 | Ga0500622_0204456 | 3300053156 | Bacteria | 896 |
| 1065 | Ga0500636_0000203 | 3300053177 | Bacteria | 32197 |
| 1066 | Ga0500637_0148477 | 3300053178 | Bacteria | 1355 |
| 1067 | Ga0500625_005119 | 3300053729 | Bacteria | 5443 |
| 1068 | Ga0587082_018912 | 3300059504 | Bacteria | 1101 |
| 1069 | Ga0587083_0076817 | 3300059505 | Bacteria | 787 |
| 1070 | Ga0587106_019270 | 3300059605 | Bacteria | 994 |
| 1071 | Ga0587068_008109 | 3300059641 | Bacteria | 1514 |
| 1072 | Ga0466962_0000755 | 3300061719 | Bacteria | 14519 |
| 1073 | Ga0466962_0015221 | 3300061719 | Bacteria | 3709 |
| 1074 | Ga0466962_0085214 | 3300061719 | Bacteria | 1512 |
| 1075 | 2511250316 | 2511231003 | Bacteria | 5606035 |
| 1076 | 2511387578 | 2511231026 | Bacteria | 5225445 |
| 1077 | 2521559828 | 2521172590 | Bacteria | 5047645 |
| 1078 | 2550693195 | 2548876994 | Bacteria | 4904866 |
| 1079 | 2553007038 | 2551306416 | Bacteria | 6152985 |
| 1080 | 2585294009 | 2582581311 | Bacteria | 6763856 |
| 1081 | 2601672277 | 2600255292 | Bacteria | 6300551 |
| 1082 | 2643791754 | 2643221554 | Bacteria | 6603920 |
| 1083 | 2643796623 | 2643221556 | Bacteria | 7251154 |
| 1084 | 2644027059 | 2643221603 | Bacteria | 6147767 |
| 1085 | 2644216767 | 2643221638 | Bacteria | 6579467 |
| 1086 | 2644254523 | 2643221645 | Bacteria | 7207331 |
| 1087 | 2644360070 | 2643221664 | Bacteria | 7272945 |
| 1088 | 2644472745 | 2643221684 | Bacteria | 7145183 |
| 1089 | 2735816544 | 2734482258 | Unclassified | 2930739 |
| 1090 | 2738742905 | 2738541280 | Bacteria | 6630198 |
| 1091 | 2738827056 | 2738541297 | Bacteria | 6549566 |
| 1092 | 2738845993 | 2738541300 | Bacteria | 6675882 |
| 1093 | 2739150853 | 2738541357 | Bacteria | 6549408 |
| 1094 | 2739192772 | 2738543003 | Bacteria | 6549560 |
| 1095 | 2739276901 | 2738543018 | Bacteria | 6718814 |
| 1096 | 2739319249 | 2738543026 | Bacteria | 6549408 |
| 1097 | 2739337490 | 2738543029 | Bacteria | 6549249 |
| 1098 | 2739345945 | 2738543030 | Bacteria | 6719714 |
| 1099 | 2765571084 | 2765235838 | Bacteria | 5445269 |
| 1100 | 2808984992 | 2808606386 | Bacteria | 4471946 |
| 1101 | 2809130124 | 2808606415 | Bacteria | 4576710 |
| 1102 | 2809145549 | 2808606418 | Bacteria | 6724496 |
| 1103 | 2809150399 | 2808606419 | Bacteria | 4576925 |
| 1104 | 2817259865 | 2816332253 | Bacteria | 6764532 |
| 1105 | 2817456660 | 2816332286 | Bacteria | 6853759 |
| 1106 | 2819544567 | 2818991436 | Bacteria | 5376622 |
| 1107 | 2819594069 | 2818991445 | Bacteria | 4955017 |
| 1108 | 2819618263 | 2818991449 | Bacteria | 5518009 |
| 1109 | 2821136476 | 2821131069 | Bacteria | 6108407 |
| 1110 | 2839096680 | 2839094727 | Bacteria | 5534556 |
| 1111 | 2842713691 | 2842711865 | Bacteria | 7155354 |
| 1112 | 2852621377 | 2852618963 | Bacteria | 4577824 |
| 1113 | 2857541724 | 2857537821 | Bacteria | 5248181 |
| 1114 | 2857549308 | 2857547612 | Bacteria | 6179999 |
| 1115 | 2857558525 | 2857553236 | Bacteria | 6166726 |
| 1116 | 2857562340 | 2857558681 | Bacteria | 6617694 |
| 1117 | 2857568293 | 2857564685 | Bacteria | 6290584 |
| 1118 | 2858953932 | 2858950400 | Bacteria | 6783797 |
| 1119 | 2884815180 | 2884811622 | Bacteria | 5552861 |
| 1120 | 2884839896 | 2884836552 | Bacteria | 5219991 |
| 1121 | 2884856293 | 2884852848 | Bacteria | 5221161 |
| 1122 | 2885081346 | 2885080285 | Bacteria | 6355622 |
| 1123 | 2891635436 | 2891633521 | Bacteria | 4602265 |
| 1124 | 2896158658 | 2896154374 | Bacteria | 5221518 |
| 1125 | 2904428566 | 2904424332 | Bacteria | 7633521 |
| 1126 | 2904444394 | 2904439833 | Bacteria | 5931679 |
| 1127 | 2904535547 | 2904530477 | Bacteria | 5876334 |
| 1128 | 2904588119 | 2904584206 | Bacteria | 6028872 |
| 1129 | 2904595155 | 2904589729 | Bacteria | 6113573 |
| 1130 | 2904606068 | 2904601388 | Bacteria | 5884906 |
| 1131 | 2919051306 | 2919046199 | Bacteria | 5567169 |
| 1132 | 2919084266 | 2919079590 | Bacteria | 5946433 |
| 1133 | 2919477225 | 2919476304 | Bacteria | 5888696 |
| 1134 | 2923513595 | 2923510766 | Bacteria | 5926163 |
| 1135 | 2928135288 | 2928130867 | Bacteria | 5467269 |
| 1136 | 2932416362 | 2932410948 | Bacteria | 6312192 |
| 1137 | 2932422245 | 2932416698 | Bacteria | 6315112 |
| 1138 | 639788486 | 639633007 | Bacteria | 4376040 |
| 1139 | 8020810836 | 8020807995 | Bacteria | 6801506 |
| 1140 | 8040172684 | 8040167225 | Bacteria | 6542727 |
| 1141 | 8040176359 | 8040173305 | Bacteria | 6827067 |
| 1142 | 8047675702 | 8047673197 | Bacteria | 7395230 |
| 1143 | 8055225935 | 8055225921 | Bacteria | 3341787 |
| 1144 | Ga0466960_0570193 | |||
| 1145 | JGI25155J39150_1000336 | |||
| 1146 | JGI25155J39150_1000485 | |||
| 1147 | JGI25156J39149_1000267 | |||
| 1148 | JGI25156J39149_1013381 | |||
| 1149 | JGI25154J39366_1000739 | |||
| 1150 | JGI25154J39366_1001209 | |||
| 1151 | JGI25154J39366_1002200 | |||
| 1152 | JGI25158J39367_1003079 | |||
| 1153 | JGI25157J39369_1000372 | |||
| 1154 | JGI25157J39369_1000495 | |||
| 1155 | JGI25164J39214_1003913 | |||
| 1156 | JGI25150J39212_1000910 | |||
| 1157 | JGI25150J39212_1003626 | |||
| 1158 | JGI25159J45721_1002200 | |||
| 1159 | JGI25159J45721_1005724 | |||
| 1160 | JGI25165J46597_1000713 | |||
| 1161 | JGI25153J46596_10018531 | |||
| 1162 | JGI25160J50197_1003453 | |||
| 1163 | JGI25161J50226_1006300 | |||
| 1164 | Ga0007410J51695_1015624 | |||
| 1165 | Ga0007410J51695_1044871 | |||
| 1166 | Ga0007409J51694_1007308 | |||
| 1167 | Ga0007409J51694_1023914 | |||
| 1168 | Ga0007416J51690_1029024 | |||
| 1169 | Ga0032354_1058597 | |||
| 1170 | Ga0055538_1000062 | |||
| 1171 | Ga0055538_1000281 | |||
| 1172 | Ga0055539_1000093 | |||
| 1173 | Ga0055539_1000305 | |||
| 1174 | Ga0055533_1000105 | |||
| 1175 | Ga0055533_1000286 | |||
| 1176 | Ga0055532_1000034 | |||
| 1177 | Ga0055525_1000018 | |||
| 1178 | Ga0055525_1000137 | |||
| 1179 | Ga0055525_1000405 | |||
| 1180 | Ga0055526_1001033 | |||
| 1181 | Ga0055526_1005708 | |||
| 1182 | Ga0055537_1000580 | |||
| 1183 | Ga0055537_1009165 | |||
| 1184 | Ga0055524_1002755 | |||
| 1185 | Ga0055524_1010041 | |||
| 1186 | Ga0055534_1000283 | |||
| 1187 | Ga0055528_1000495 | |||
| 1188 | Ga0055530_10050684 | |||
| 1189 | Ga0055541_1000063 | |||
| 1190 | Ga0055541_1000198 | |||
| 1191 | Ga0055543_1003826 | |||
| 1192 | Ga0065165_1002857 | |||
| 1193 | Ga0065165_1004075 | |||
| 1194 | Ga0065714_10171696 | |||
| 1195 | Ga0065715_10042333 | |||
| 1196 | Ga0070658_10710717 | |||
| 1197 | Ga0070670_100086718 | |||
| 1198 | Ga0070682_100098361 | |||
| 1199 | Ga0070682_100577228 | |||
| 1200 | Ga0070660_100016657 | |||
| 1201 | Ga0070660_100044451 | |||
| 1202 | Ga0070661_100051855 | |||
| 1203 | Ga0070659_100001752 | |||
| 1204 | Ga0070659_100082019 | |||
| 1205 | Ga0070659_100216063 | |||
| 1206 | Ga0070662_100057197 | |||
| 1207 | Ga0070662_100692878 | |||
| 1208 | Ga0068867_100056392 | |||
| 1209 | Ga0070706_100007456 | |||
| 1210 | Ga0070707_100111118 | |||
| 1211 | Ga0070699_100042824 | |||
| 1212 | Ga0070679_100691385 | |||
| 1213 | Ga0070697_100618561 | |||
| 1214 | Ga0068855_100016570 | |||
| 1215 | Ga0068855_100035272 | |||
| 1216 | Ga0068855_101052987 | |||
| 1217 | Ga0068855_101571899 | |||
| 1218 | Ga0070664_100003553 | |||
| 1219 | Ga0070664_100298359 | |||
| 1220 | Ga0068857_100326958 | |||
| 1221 | Ga0068854_100017165 | |||
| 1222 | Ga0068856_100163375 | |||
| 1223 | Ga0068852_100004237 | |||
| 1224 | Ga0068852_100004430 | |||
| 1225 | Ga0068863_100298029 | |||
| 1226 | Ga0070717_10473844 | |||
| 1227 | Ga0075366_10002981 | |||
| 1228 | Ga0075428_100377519 | |||
| 1229 | Ga0075430_100258757 | |||
| 1230 | Ga0075431_100002888 | |||
| 1231 | Ga0079104_1005592 | |||
| 1232 | Ga0079104_1008552 | |||
| 1233 | Ga0099826_10000010 | |||
| 1234 | Ga0105244_10002041 | |||
| 1235 | Ga0105244_10003441 | |||
| 1236 | Ga0105244_10035827 | |||
| 1237 | Ga0105244_10110311 | |||
| 1238 | Ga0105244_10174679 | |||
| 1239 | Ga0105250_10120377 | |||
| 1240 | Ga0105240_10001608 | |||
| 1241 | Ga0105240_10016336 | |||
| 1242 | Ga0105240_10190542 | |||
| 1243 | Ga0105241_10120376 | |||
| 1244 | Ga0105242_10037198 | |||
| 1245 | Ga0105242_10180899 | |||
| 1246 | Ga0105237_10010944 | |||
| 1247 | Ga0105238_10000763 | |||
| 1248 | Ga0105239_10010387 | |||
| 1249 | Ga0105239_10368622 | |||
| 1250 | Ga0105239_10961472 | |||
| 1251 | Ga0157373_10711950 | |||
| 1252 | Ga0157371_10039633 | |||
| 1253 | Ga0157370_11246340 | |||
| 1254 | Ga0157369_10000804 | |||
| 1255 | Ga0157369_10574078 | |||
| 1256 | Ga0157374_10000924 | |||
| 1257 | Ga0157374_11006092 | |||
| 1258 | Ga0157378_10091922 | |||
| 1259 | Ga0157378_11144502 | |||
| 1260 | Ga0163162_10379875 | |||
| 1261 | Ga0182008_10003605 | |||
| 1262 | Ga0182008_10056599 | |||
| 1263 | Ga0182006_1000033 | |||
| 1264 | Ga0182006_1000080 | |||
| 1265 | Ga0182006_1058779 | |||
| 1266 | Ga0182007_10000042 | |||
| 1267 | Ga0182007_10030574 | |||
| 1268 | Ga0182005_1000016 | |||
| 1269 | Ga0182005_1000024 | |||
| 1270 | Ga0182005_1001434 | |||
| 1271 | Ga0163161_10012023 | |||
| 1272 | Ga0163161_10012229 | |||
| 1273 | Ga0163161_10087249 | |||
| 1274 | Ga0213872_10000430 | |||
| 1275 | Ga0213872_10001856 | |||
| 1276 | Ga0213872_10002336 | |||
| 1277 | Ga0213872_10004434 | |||
| 1278 | Ga0213872_10024411 | |||
| 1279 | Ga0213872_10115807 | |||
| 1280 | Ga0209435_100007 | |||
| 1281 | Ga0209435_100176 | |||
| 1282 | Ga0209436_100769 | |||
| 1283 | Ga0209784_100010 | |||
| 1284 | Ga0209784_100021 | |||
| 1285 | Ga0209566_100008 | |||
| 1286 | Ga0209566_100119 | |||
| 1287 | Ga0209674_100019 | |||
| 1288 | Ga0209674_100036 | |||
| 1289 | Ga0209147_100017 | |||
| 1290 | Ga0209563_100011 | |||
| 1291 | Ga0209563_100021 | |||
| 1292 | Ga0209563_100040 | |||
| 1293 | Ga0207427_100759 | |||
| 1294 | Ga0209437_100019 | |||
| 1295 | Ga0209437_100332 | |||
| 1296 | Ga0209437_105938 | |||
| 1297 | Ga0209437_107841 | |||
| 1298 | Ga0209258_101277 | |||
| 1299 | Ga0207425_1000021 | |||
| 1300 | Ga0207425_1000829 | |||
| 1301 | Ga0209646_1000044 | |||
| 1302 | Ga0209646_1000107 | |||
| 1303 | Ga0209646_1000190 | |||
| 1304 | Ga0209026_1000063 | |||
| 1305 | Ga0209026_1005858 | |||
| 1306 | Ga0209026_1012017 | |||
| 1307 | Ga0209677_100011 | |||
| 1308 | Ga0209677_100023 | |||
| 1309 | Ga0209677_101699 | |||
| 1310 | Ga0209148_1000237 | |||
| 1311 | Ga0209759_1000048 | |||
| 1312 | Ga0209759_1000198 | |||
| 1313 | Ga0209129_1000020 | |||
| 1314 | Ga0209233_1000025 | |||
| 1315 | Ga0209565_1000055 | |||
| 1316 | Ga0209565_1000677 | |||
| 1317 | Ga0209565_1002957 | |||
| 1318 | Ga0209565_1003264 | |||
| 1319 | Ga0209455_1000070 | |||
| 1320 | Ga0209455_1029838 | |||
| 1321 | Ga0209673_1000040 | |||
| 1322 | Ga0209673_1003338 | |||
| 1323 | Ga0209130_1000169 | |||
| 1324 | Ga0209130_1002260 | |||
| 1325 | Ga0209675_1000052 | |||
| 1326 | Ga0209675_1001299 | |||
| 1327 | Ga0209025_1000473 | |||
| 1328 | Ga0209025_1001876 | |||
| 1329 | Ga0209564_1000027 | |||
| 1330 | Ga0209564_1000047 | |||
| 1331 | Ga0209564_1000063 | |||
| 1332 | Ga0209564_1000271 | |||
| 1333 | Ga0209564_1001666 | |||
| 1334 | Ga0209564_1028858 | |||
| 1335 | Ga0209758_1000288 | |||
| 1336 | Ga0209758_1000436 | |||
| 1337 | Ga0209050_1000050 | |||
| 1338 | Ga0209256_1000054 | |||
| 1339 | Ga0209256_1000100 | |||
| 1340 | Ga0209256_1000754 | |||
| 1341 | Ga0207426_1003112 | |||
| 1342 | Ga0209051_1028245 | |||
| 1343 | Ga0207656_10071281 | |||
| 1344 | Ga0207655_1001651 | |||
| 1345 | Ga0207655_1016701 | |||
| 1346 | Ga0207655_1064734 | |||
| 1347 | Ga0207705_10034051 | |||
| 1348 | Ga0207684_10008262 | |||
| 1349 | Ga0207654_10022625 | |||
| 1350 | Ga0207695_10008939 | |||
| 1351 | Ga0207695_10012318 | |||
| 1352 | Ga0207695_10136114 | |||
| 1353 | Ga0207671_10004652 | |||
| 1354 | Ga0207671_10309446 | |||
| 1355 | Ga0207657_10012688 | |||
| 1356 | Ga0207657_10231476 | |||
| 1357 | Ga0207657_10525715 | |||
| 1358 | Ga0207649_10024118 | |||
| 1359 | Ga0207649_10493530 | |||
| 1360 | Ga0207652_10464901 | |||
| 1361 | Ga0207694_10000343 | |||
| 1362 | Ga0207694_10858659 | |||
| 1363 | Ga0207650_10063319 | |||
| 1364 | Ga0207690_10000951 | |||
| 1365 | Ga0207690_10323880 | |||
| 1366 | Ga0207690_10330334 | |||
| 1367 | Ga0207686_10036176 | |||
| 1368 | Ga0207709_10388720 | |||
| 1369 | Ga0207679_10004406 | |||
| 1370 | Ga0207667_10000912 | |||
| 1371 | Ga0207667_10007366 | |||
| 1372 | Ga0207667_10317294 | |||
| 1373 | Ga0207667_10550318 | |||
| 1374 | Ga0207640_10041316 | |||
| 1375 | Ga0207639_10170095 | |||
| 1376 | Ga0207678_10439887 | |||
| 1377 | Ga0207702_10168886 | |||
| 1378 | Ga0207641_10366349 | |||
| 1379 | Ga0207648_10086029 | |||
| 1380 | Ga0207674_10182190 | |||
| 1381 | Ga0207674_10281988 | |||
| 1382 | Ga0207698_10044764 | |||
| 1383 | Ga0207698_10095163 | |||
| 1384 | Ga0207698_10385474 | |||
| 1385 | Ga0209281_1005374 | |||
| 1386 | Ga0209282_1000009 | |||
| 1387 | Ga0209974_10027183 | |||
| 1388 | Ga0265336_10006403 | |||
| 1389 | Ga0265336_10048575 | |||
| 1390 | Ga0265338_10066959 | |||
| 1391 | Ga0265324_10000002 | |||
| 1392 | Ga0265324_10000616 | |||
| 1393 | Ga0268256_1004381 | |||
| 1394 | Ga0316177_1075487 | |||
| 1395 | Ga0316178_1172473 | |||
| 1396 | Ga0316180_1064742 | |||
| 1397 | Ga0316181_1137224 | |||
| 1398 | Ga0316182_1021746 | |||
| 1399 | Ga0316182_1361262 | |||
| 1400 | Ga0265332_10000030 | |||
| 1401 | Ga0265332_10001445 | |||
| 1402 | Ga0265328_10000016 | |||
| 1403 | Ga0265325_10002841 | |||
| 1404 | Ga0265325_10007848 | |||
| 1405 | Ga0265331_10009812 | |||
| 1406 | Ga0265331_10013920 | |||
| 1407 | Ga0265331_10054133 | |||
| 1408 | Ga0265331_10089997 | |||
| 1409 | Ga0265331_10158693 | |||
| 1410 | Ga0265327_10000528 | |||
| 1411 | Ga0265327_10000674 | |||
| 1412 | Ga0265327_10001509 | |||
| 1413 | Ga0265327_10015618 | |||
| 1414 | Ga0265327_10018721 | |||
| 1415 | Ga0265327_10059966 | |||
| 1416 | Ga0265327_10123875 | |||
| 1417 | Ga0265327_10216212 | |||
| 1418 | Ga0265316_10090702 | |||
| 1419 | Ga0265316_10158523 | |||
| 1420 | Ga0265316_10376779 | |||
| 1421 | Ga0307509_10000076 | |||
| 1422 | Ga0307408_100000432 | |||
| 1423 | Ga0307408_100002407 | |||
| 1424 | Ga0307408_100010617 | |||
| 1425 | Ga0265313_10040874 | |||
| 1426 | Ga0316575_10003832 | |||
| 1427 | Ga0265314_10001144 | |||
| 1428 | Ga0265314_10008929 | |||
| 1429 | Ga0265314_10118654 | |||
| 1430 | Ga0307405_10084076 | |||
| 1431 | Ga0307405_10270046 | |||
| 1432 | Ga0307413_10141496 | |||
| 1433 | Ga0307518_10057653 | |||
| 1434 | Ga0307412_10000169 | |||
| 1435 | Ga0307416_100000975 | |||
| 1436 | Ga0307416_100104940 | |||
| 1437 | Ga0307414_10174903 | |||
| 1438 | Ga0307414_10285519 | |||
| 1439 | Ga0307411_10541983 | |||
| 1440 | Ga0316583_10021200 | |||
| 1441 | Ga0316583_10069475 | |||
| 1442 | Ga0316582_0049684 | |||
| 1443 | Ga0395899_0000521 | |||
| 1444 | Ga0395899_0002474 | |||
| 1445 | Ga0395899_0002806 | |||
| 1446 | Ga0395899_0003830 | |||
| 1447 | Ga0395899_0018674 | |||
| 1448 | Ga0395899_0125972 | |||
| 1449 | Ga0395899_0126723 | |||
| 1450 | Ga0395900_0006506 | |||
| 1451 | Ga0395900_0010081 | |||
| 1452 | Ga0395900_0014022 | |||
| 1453 | Ga0395900_0031672 | |||
| 1454 | Ga0395900_0035466 | |||
| 1455 | Ga0395900_0113125 | |||
| 1456 | Ga0395900_0181240 | |||
| 1457 | Ga0395900_0285610 | |||
| 1458 | Ga0395900_0289530 | |||
| 1459 | Ga0395900_0622000 | |||
| 1460 | Ga0395898_0000559 | |||
| 1461 | Ga0395898_0089880 | |||
| 1462 | Ga0395898_0478763 | |||
| 1463 | Ga0395898_0508579 | |||
| 1464 | Ga0395898_0690689 | |||
| 1465 | Ga0395898_0892151 | |||
| 1466 | Ga0395905_0010442 | |||
| 1467 | Ga0395905_0013127 | |||
| 1468 | Ga0395905_0036632 | |||
| 1469 | Ga0395905_0036694 | |||
| 1470 | Ga0395905_0055914 | |||
| 1471 | Ga0395905_0093364 | |||
| 1472 | Ga0395901_0000328 | |||
| 1473 | Ga0395901_0000824 | |||
| 1474 | Ga0395901_0002710 | |||
| 1475 | Ga0395901_0002897 | |||
| 1476 | Ga0395901_0020765 | |||
| 1477 | Ga0395901_0066242 | |||
| 1478 | Ga0395901_0117619 | |||
| 1479 | Ga0400483_005643 | |||
| 1480 | Ga0400483_266454 | |||
| 1481 | Ga0436361_0013073 | |||
| 1482 | Ga0436361_0303014 | |||
| 1483 | Ga0436361_0314274 | |||
| 1484 | Ga0436361_0512442 | |||
| 1485 | Ga0436361_0544664 | |||
| 1486 | Ga0436361_0930389 | |||
| 1487 | Ga0436361_1012850 | |||
| 1488 | Ga0436361_1027676 | |||
| 1489 | Ga0436361_1072133 | |||
| 1490 | Ga0436361_1091442 | |||
| 1491 | Ga0436361_1097952 | |||
| 1492 | Ga0436361_1206124 | |||
| 1493 | Ga0439436_0086795 | |||
| 1494 | Ga0451837_0319601 | |||
| 1495 | Ga0439448_0000161 | |||
| 1496 | Ga0439449_0009520 | |||
| 1497 | Ga0439450_017711 | |||
| 1498 | Ga0439450_042434 | |||
| 1499 | Ga0439450_053924 | |||
| 1500 | Ga0450904_007543 | |||
| 1501 | Ga0451577_0000002 | |||
| 1502 | Ga0451577_0000345 | |||
| 1503 | Ga0451577_0071284 | |||
| 1504 | Ga0451577_0219478 | |||
| 1505 | Ga0451577_0407278 | |||
| 1506 | Ga0451577_0689600 | |||
| 1507 | Ga0451577_0743976 | |||
| 1508 | Ga0451577_0944695 | |||
| 1509 | Ga0466969_0250847 | |||
| 1510 | Ga0466972_0000420 | |||
| 1511 | Ga0466972_0003973 | |||
| 1512 | Ga0466972_0011040 | |||
| 1513 | Ga0466977_0107028 | |||
| 1514 | Ga0453683_0000013 | |||
| 1515 | Ga0466965_0002121 | |||
| 1516 | Ga0466965_0028860 | |||
| 1517 | Ga0466965_0029552 | |||
| 1518 | Ga0466965_0031596 | |||
| 1519 | Ga0466965_0036795 | |||
| 1520 | Ga0466965_0073626 | |||
| 1521 | Ga0466966_0001854 | |||
| 1522 | Ga0466966_0006887 | |||
| 1523 | Ga0466966_0029262 | |||
| 1524 | Ga0466966_0082568 | |||
| 1525 | Ga0466961_0068851 | |||
| 1526 | Ga0466964_0007888 | |||
| 1527 | Ga0466964_0018884 | |||
| 1528 | Ga0466964_0260780 | |||
| 1529 | Ga0453684_0000002 | |||
| 1530 | Ga0453684_0000040 | |||
| 1531 | Ga0453684_0000065 | |||
| 1532 | Ga0453684_0000694 | |||
| 1533 | Ga0453684_0010268 | |||
| 1534 | Ga0453684_0109392 | |||
| 1535 | Ga0453684_1610308 | |||
| 1536 | Ga0466971_0002015 | |||
| 1537 | Ga0466971_0162361 | |||
| 1538 | Ga0466968_0009040 | |||
| 1539 | Ga0466968_0210388 | |||
| 1540 | Ga0466957_0001920 | |||
| 1541 | Ga0466957_0018243 | |||
| 1542 | Ga0466957_0076144 | |||
| 1543 | Ga0466960_0257561 | |||
| 1544 | Ga0466959_0002185 | |||
| 1545 | Ga0466959_0025858 | |||
| 1546 | Ga0466959_0155315 | |||
| 1547 | Ga0451576_0000006 | |||
| 1548 | Ga0451576_0000037 | |||
| 1549 | Ga0451576_0002868 | |||
| 1550 | Ga0451576_0005999 | |||
| 1551 | Ga0451576_0199277 | |||
| 1552 | Ga0451576_0359886 | |||
| 1553 | Ga0466958_0000123 | |||
| 1554 | Ga0466967_0652134 | |||
| 1555 | Ga0495617_000022 | |||
| 1556 | Ga0495617_000075 | |||
| 1557 | Ga0495617_001209 | |||
| 1558 | Ga0495617_018396 | |||
| 1559 | Ga0495617_101153 | |||
| 1560 | Ga0495627_000011 | |||
| 1561 | Ga0495627_000398 | |||
| 1562 | Ga0495627_028660 | |||
| 1563 | Ga0495627_030153 | |||
| 1564 | Ga0495592_0002825 | |||
| 1565 | Ga0495603_0219775 | |||
| 1566 | Ga0495603_0333361 | |||
| 1567 | Ga0495590_0000057 | |||
| 1568 | Ga0495590_0000143 | |||
| 1569 | Ga0495590_0003098 | |||
| 1570 | Ga0495590_0005737 | |||
| 1571 | Ga0495629_0020396 | |||
| 1572 | Ga0495629_0041378 | |||
| 1573 | Ga0495638_0001680 | |||
| 1574 | Ga0495638_0005569 | |||
| 1575 | Ga0495638_0029512 | |||
| 1576 | Ga0495638_0142822 | |||
| 1577 | Ga0495638_0279409 | |||
| 1578 | Ga0495638_0294735 | |||
| 1579 | Ga0495638_0350140 | |||
| 1580 | Ga0495638_0469701 | |||
| 1581 | Ga0495653_0000044 | |||
| 1582 | Ga0495653_0003313 | |||
| 1583 | Ga0495653_0028893 | |||
| 1584 | Ga0495653_0030963 | |||
| 1585 | Ga0495653_0062600 | |||
| 1586 | Ga0495653_0142416 | |||
| 1587 | Ga0495653_0220831 | |||
| 1588 | Ga0495650_0000082 | |||
| 1589 | Ga0495650_0000254 | |||
| 1590 | Ga0495650_0001173 | |||
| 1591 | Ga0495650_0001749 | |||
| 1592 | Ga0495650_0003298 | |||
| 1593 | Ga0495650_0005094 | |||
| 1594 | Ga0495650_0012103 | |||
| 1595 | Ga0495580_0291017 | |||
| 1596 | Ga0495582_0027191 | |||
| 1597 | Ga0495582_0317982 | |||
| 1598 | Ga0495605_0000098 | |||
| 1599 | Ga0495605_0000102 | |||
| 1600 | Ga0495605_0000153 | |||
| 1601 | Ga0495605_0002046 | |||
| 1602 | Ga0495605_0020353 | |||
| 1603 | Ga0495605_0037236 | |||
| 1604 | Ga0495605_0051571 | |||
| 1605 | Ga0495605_0118230 | |||
| 1606 | Ga0495605_0119063 | |||
| 1607 | Ga0495605_0127029 | |||
| 1608 | Ga0495605_0176519 | |||
| 1609 | Ga0495605_0185627 | |||
| 1610 | Ga0495639_0099019 | |||
| 1611 | Ga0495584_0000005 | |||
| 1612 | Ga0495584_0000232 | |||
| 1613 | Ga0495584_0000729 | |||
| 1614 | Ga0495584_0002317 | |||
| 1615 | Ga0495584_0008319 | |||
| 1616 | Ga0495584_0009911 | |||
| 1617 | Ga0495584_0016425 | |||
| 1618 | Ga0495584_0050942 | |||
| 1619 | Ga0495584_0072746 | |||
| 1620 | Ga0495584_0142839 | |||
| 1621 | Ga0495584_0263303 | |||
| 1622 | Ga0495584_0480564 | |||
| 1623 | Ga0495585_0000023 | |||
| 1624 | Ga0495585_0000152 | |||
| 1625 | Ga0495585_0000444 | |||
| 1626 | Ga0495585_0004011 | |||
| 1627 | Ga0495585_0022356 | |||
| 1628 | Ga0495585_0036679 | |||
| 1629 | Ga0495585_0063062 | |||
| 1630 | Ga0495585_0065031 | |||
| 1631 | Ga0495585_0081256 | |||
| 1632 | Ga0495585_0086044 | |||
| 1633 | Ga0495585_0093181 | |||
| 1634 | Ga0495585_0110487 | |||
| 1635 | Ga0495585_0120150 | |||
| 1636 | Ga0495585_0124453 | |||
| 1637 | Ga0495585_0127601 | |||
| 1638 | Ga0495585_0130882 | |||
| 1639 | Ga0495585_0198599 | |||
| 1640 | Ga0495594_0014891 | |||
| 1641 | Ga0495594_0067330 | |||
| 1642 | Ga0495594_0068128 | |||
| 1643 | Ga0495594_0111098 | |||
| 1644 | Ga0495594_0203838 | |||
| 1645 | Ga0495596_0000032 | |||
| 1646 | Ga0495596_0001270 | |||
| 1647 | Ga0495596_0004904 | |||
| 1648 | Ga0495596_0019014 | |||
| 1649 | Ga0495596_0019824 | |||
| 1650 | Ga0495596_0064880 | |||
| 1651 | Ga0495596_0104091 | |||
| 1652 | Ga0495596_0140228 | |||
| 1653 | Ga0495596_0215517 | |||
| 1654 | Ga0495596_0219493 | |||
| 1655 | Ga0495607_0018756 | |||
| 1656 | Ga0495607_0021757 | |||
| 1657 | Ga0495607_0034462 | |||
| 1658 | Ga0495607_0053231 | |||
| 1659 | Ga0495607_0071833 | |||
| 1660 | Ga0495607_0075941 | |||
| 1661 | Ga0495607_0082535 | |||
| 1662 | Ga0495607_0094427 | |||
| 1663 | Ga0495607_0142834 | |||
| 1664 | Ga0495607_0156528 | |||
| 1665 | Ga0495607_0170248 | |||
| 1666 | Ga0495607_0201691 | |||
| 1667 | Ga0495607_0304687 | |||
| 1668 | Ga0495583_0000106 | |||
| 1669 | Ga0495583_0000150 | |||
| 1670 | Ga0495583_0000597 | |||
| 1671 | Ga0495583_0001383 | |||
| 1672 | Ga0495583_0001918 | |||
| 1673 | Ga0495583_0002413 | |||
| 1674 | Ga0495583_0016522 | |||
| 1675 | Ga0495583_0019473 | |||
| 1676 | Ga0495583_0032678 | |||
| 1677 | Ga0495583_0055535 | |||
| 1678 | Ga0495583_0153492 | |||
| 1679 | Ga0495583_0208027 | |||
| 1680 | Ga0495606_0000080 | |||
| 1681 | Ga0495606_0000090 | |||
| 1682 | Ga0495606_0000099 | |||
| 1683 | Ga0495606_0000524 | |||
| 1684 | Ga0495606_0001629 | |||
| 1685 | Ga0495606_0002603 | |||
| 1686 | Ga0495606_0002891 | |||
| 1687 | Ga0495606_0003267 | |||
| 1688 | Ga0495606_0086803 | |||
| 1689 | Ga0495606_0156832 | |||
| 1690 | Ga0495606_0167075 | |||
| 1691 | Ga0495606_0167282 | |||
| 1692 | Ga0495606_0177366 | |||
| 1693 | Ga0495606_0273276 | |||
| 1694 | Ga0495606_0287086 | |||
| 1695 | Ga0495606_0360638 | |||
| 1696 | Ga0495606_0482262 | |||
| 1697 | Ga0495608_0026533 | |||
| 1698 | Ga0495610_0000017 | |||
| 1699 | Ga0495610_0000668 | |||
| 1700 | Ga0495610_0051728 | |||
| 1701 | Ga0495610_0056760 | |||
| 1702 | Ga0495610_0094937 | |||
| 1703 | Ga0495610_0149659 | |||
| 1704 | Ga0495616_0000490 | |||
| 1705 | Ga0495616_0002388 | |||
| 1706 | Ga0495616_0004647 | |||
| 1707 | Ga0495616_0006823 | |||
| 1708 | Ga0495616_0016924 | |||
| 1709 | Ga0495616_0018127 | |||
| 1710 | Ga0495616_0018885 | |||
| 1711 | Ga0495616_0027167 | |||
| 1712 | Ga0495616_0029168 | |||
| 1713 | Ga0495616_0052218 | |||
| 1714 | Ga0495616_0140557 | |||
| 1715 | Ga0495616_0166939 | |||
| 1716 | Ga0495616_0209388 | |||
| 1717 | Ga0495620_0025372 | |||
| 1718 | Ga0495628_0000382 | |||
| 1719 | Ga0495630_0290113 | |||
| 1720 | Ga0495631_0001332 | |||
| 1721 | Ga0495631_0001436 | |||
| 1722 | Ga0495631_0017621 | |||
| 1723 | Ga0495631_0021527 | |||
| 1724 | Ga0495631_0089877 | |||
| 1725 | Ga0495631_0108701 | |||
| 1726 | Ga0495631_0132606 | |||
| 1727 | Ga0495631_0178075 | |||
| 1728 | Ga0495631_0256240 | |||
| 1729 | Ga0495631_0264638 | |||
| 1730 | Ga0495631_0348127 | |||
| 1731 | Ga0495632_0000052 | |||
| 1732 | Ga0495632_0000396 | |||
| 1733 | Ga0495632_0001555 | |||
| 1734 | Ga0495632_0003734 | |||
| 1735 | Ga0495632_0012494 | |||
| 1736 | Ga0495632_0077299 | |||
| 1737 | Ga0495632_0229594 | |||
| 1738 | Ga0495637_0000018 | |||
| 1739 | Ga0495637_0000195 | |||
| 1740 | Ga0495637_0025136 | |||
| 1741 | Ga0495637_0157208 | |||
| 1742 | Ga0495643_0000109 | |||
| 1743 | Ga0495643_0000250 | |||
| 1744 | Ga0495643_0000914 | |||
| 1745 | Ga0495643_0001163 | |||
| 1746 | Ga0495643_0014484 | |||
| 1747 | Ga0495643_0020420 | |||
| 1748 | Ga0495643_0074658 | |||
| 1749 | Ga0495643_0167799 | |||
| 1750 | Ga0495643_0169250 | |||
| 1751 | Ga0495643_0173777 | |||
| 1752 | Ga0495643_0288040 | |||
| 1753 | Ga0495644_0001124 | |||
| 1754 | Ga0495644_0003935 | |||
| 1755 | Ga0495644_0012464 | |||
| 1756 | Ga0495644_0033210 | |||
| 1757 | Ga0495644_0036962 | |||
| 1758 | Ga0495644_0049248 | |||
| 1759 | Ga0495644_0105342 | |||
| 1760 | Ga0495644_0131017 | |||
| 1761 | Ga0495644_0138769 | |||
| 1762 | Ga0495644_0161425 | |||
| 1763 | Ga0495648_0001108 | |||
| 1764 | Ga0495648_0001296 | |||
| 1765 | Ga0495648_0001297 | |||
| 1766 | Ga0495648_0001425 | |||
| 1767 | Ga0495648_0003753 | |||
| 1768 | Ga0495648_0012427 | |||
| 1769 | Ga0495648_0015868 | |||
| 1770 | Ga0495648_0030615 | |||
| 1771 | Ga0495648_0049127 | |||
| 1772 | Ga0495648_0081899 | |||
| 1773 | Ga0495648_0103442 | |||
| 1774 | Ga0495648_0120682 | |||
| 1775 | Ga0495648_0124831 | |||
| 1776 | Ga0495648_0169639 | |||
| 1777 | Ga0495648_0221552 | |||
| 1778 | Ga0495663_0018991 | |||
| 1779 | Ga0495663_0027435 | |||
| 1780 | Ga0495663_0080205 | |||
| 1781 | Ga0495663_0097680 | |||
| 1782 | Ga0495666_0006871 | |||
| 1783 | Ga0495666_0007557 | |||
| 1784 | Ga0495666_0089356 | |||
| 1785 | Ga0495666_0136337 | |||
| 1786 | Ga0495642_0000529 | |||
| 1787 | Ga0495642_0003891 | |||
| 1788 | Ga0495642_0004563 | |||
| 1789 | Ga0495642_0022005 | |||
| 1790 | Ga0495642_0049932 | |||
| 1791 | Ga0495642_0055624 | |||
| 1792 | Ga0495642_0091444 | |||
| 1793 | Ga0495642_0095315 | |||
| 1794 | Ga0495642_0097224 | |||
| 1795 | Ga0495642_0128850 | |||
| 1796 | Ga0495642_0135331 | |||
| 1797 | Ga0495652_0195423 | |||
| 1798 | Ga0495652_0225042 | |||
| 1799 | Ga0495654_0000030 | |||
| 1800 | Ga0495654_0018430 | |||
| 1801 | Ga0495654_0021405 | |||
| 1802 | Ga0495654_0154397 | |||
| 1803 | Ga0495665_0001301 | |||
| 1804 | Ga0495665_0034596 | |||
| 1805 | Ga0495640_0244079 | |||
| 1806 | Ga0495586_0003956 | |||
| 1807 | Ga0495586_0348397 | |||
| 1808 | Ga0495587_0106740 | |||
| 1809 | Ga0495587_0212022 | |||
| 1810 | Ga0495598_0015527 | |||
| 1811 | Ga0495609_0000007 | |||
| 1812 | Ga0495609_0001531 | |||
| 1813 | Ga0495609_0002820 | |||
| 1814 | Ga0495609_0005405 | |||
| 1815 | Ga0495609_0006790 | |||
| 1816 | Ga0495609_0053145 | |||
| 1817 | Ga0495609_0087078 | |||
| 1818 | Ga0495609_0090129 | |||
| 1819 | Ga0495609_0094483 | |||
| 1820 | Ga0495609_0112477 | |||
| 1821 | Ga0495609_0167361 | |||
| 1822 | Ga0495621_0167216 | |||
| 1823 | Ga0495597_0001115 | |||
| 1824 | Ga0495597_0001285 | |||
| 1825 | Ga0495597_0001411 | |||
| 1826 | Ga0495597_0002378 | |||
| 1827 | Ga0495597_0004502 | |||
| 1828 | Ga0495597_0018041 | |||
| 1829 | Ga0495597_0018630 | |||
| 1830 | Ga0495597_0059212 | |||
| 1831 | Ga0495597_0176075 | |||
| 1832 | Ga0495597_0217646 | |||
| 1833 | Ga0495645_0068890 | |||
| 1834 | Ga0495622_0000044 | |||
| 1835 | Ga0495622_0002393 | |||
| 1836 | Ga0495622_0004973 | |||
| 1837 | Ga0495622_0031549 | |||
| 1838 | Ga0495622_0031647 | |||
| 1839 | Ga0495622_0185930 | |||
| 1840 | Ga0495622_0271346 | |||
| 1841 | Ga0495633_0000917 | |||
| 1842 | Ga0495633_0003343 | |||
| 1843 | Ga0495633_0006937 | |||
| 1844 | Ga0495633_0008903 | |||
| 1845 | Ga0495633_0018586 | |||
| 1846 | Ga0495633_0023285 | |||
| 1847 | Ga0495633_0059388 | |||
| 1848 | Ga0495633_0097204 | |||
| 1849 | Ga0495633_0195396 | |||
| 1850 | Ga0495633_0237567 | |||
| 1851 | Ga0495633_0349354 | |||
| 1852 | Ga0495656_0052339 | |||
| 1853 | Ga0495656_0090382 | |||
| 1854 | Ga0495656_0176549 | |||
| 1855 | Ga0495668_0000035 | |||
| 1856 | Ga0495668_0000211 | |||
| 1857 | Ga0495668_0000286 | |||
| 1858 | Ga0495668_0000939 | |||
| 1859 | Ga0495668_0001545 | |||
| 1860 | Ga0495668_0004452 | |||
| 1861 | Ga0495668_0007872 | |||
| 1862 | Ga0495668_0066663 | |||
| 1863 | Ga0495668_0069634 | |||
| 1864 | Ga0495668_0110644 | |||
| 1865 | Ga0495668_0111339 | |||
| 1866 | Ga0495668_0124532 | |||
| 1867 | Ga0495668_0157375 | |||
| 1868 | Ga0495668_0251588 | |||
| 1869 | Ga0495634_0029850 | |||
| 1870 | Ga0495634_0185328 | |||
| 1871 | Ga0495611_0001030 | |||
| 1872 | Ga0495611_0003988 | |||
| 1873 | Ga0495611_0006487 | |||
| 1874 | Ga0495611_0012387 | |||
| 1875 | Ga0495611_0019917 | |||
| 1876 | Ga0495611_0024927 | |||
| 1877 | Ga0495611_0030738 | |||
| 1878 | Ga0495611_0058343 | |||
| 1879 | Ga0495611_0184440 | |||
| 1880 | Ga0495611_0245871 | |||
| 1881 | Ga0495625_0000338 | |||
| 1882 | Ga0495625_0001765 | |||
| 1883 | Ga0495625_0016076 | |||
| 1884 | Ga0495625_0032153 | |||
| 1885 | Ga0495625_0032657 | |||
| 1886 | Ga0495625_0159609 | |||
| 1887 | Ga0495625_0229305 | |||
| 1888 | Ga0495625_0244011 | |||
| 1889 | Ga0495625_0464422 | |||
| 1890 | Ga0495635_0008609 | |||
| 1891 | Ga0495635_0117569 | |||
| 1892 | Ga0495659_0000139 | |||
| 1893 | Ga0495659_0006513 | |||
| 1894 | Ga0495659_0012720 | |||
| 1895 | Ga0495659_0021812 | |||
| 1896 | Ga0495661_0000074 | |||
| 1897 | Ga0495661_0014026 | |||
| 1898 | Ga0495661_0024464 | |||
| 1899 | Ga0495661_0024989 | |||
| 1900 | Ga0495661_0050895 | |||
| 1901 | Ga0495661_0056989 | |||
| 1902 | Ga0495661_0081170 | |||
| 1903 | Ga0495661_0090282 | |||
| 1904 | Ga0495661_0095657 | |||
| 1905 | Ga0495661_0097206 | |||
| 1906 | Ga0495661_0170266 | |||
| 1907 | Ga0495661_0170462 | |||
| 1908 | Ga0495661_0178616 | |||
| 1909 | Ga0495661_0194602 | |||
| 1910 | Ga0495661_0218634 | |||
| 1911 | Ga0495661_0276444 | |||
| 1912 | Ga0495661_0465967 | |||
| 1913 | Ga0495588_0000451 | |||
| 1914 | Ga0495588_0012930 | |||
| 1915 | Ga0495588_0037807 | |||
| 1916 | Ga0495588_0056552 | |||
| 1917 | Ga0495588_0124955 | |||
| 1918 | Ga0495588_0136992 | |||
| 1919 | Ga0495588_0183519 | |||
| 1920 | Ga0495588_0209771 | |||
| 1921 | Ga0495599_0009879 | |||
| 1922 | Ga0495599_0302397 | |||
| 1923 | Ga0495623_0010353 | |||
| 1924 | Ga0495623_0089894 | |||
| 1925 | Ga0495623_0186117 | |||
| 1926 | Ga0495623_0264807 | |||
| 1927 | Ga0495646_0315081 | |||
| 1928 | Ga0495669_0000101 | |||
| 1929 | Ga0495669_0000495 | |||
| 1930 | Ga0495669_0001145 | |||
| 1931 | Ga0495669_0081917 | |||
| 1932 | Ga0495669_0093504 | |||
| 1933 | Ga0495669_0174437 | |||
| 1934 | Ga0495613_0026824 | |||
| 1935 | Ga0495613_0392189 | |||
| 1936 | Ga0495624_0004359 | |||
| 1937 | Ga0495624_0020490 | |||
| 1938 | Ga0495624_0124437 | |||
| 1939 | Ga0495670_0000859 | |||
| 1940 | Ga0495670_0013263 | |||
| 1941 | Ga0495670_0044778 | |||
| 1942 | Ga0495670_0087076 | |||
| 1943 | Ga0495670_0155332 | |||
| 1944 | Ga0495670_0158563 | |||
| 1945 | Ga0495670_0238538 | |||
| 1946 | Ga0495671_0000087 | |||
| 1947 | Ga0495671_0000605 | |||
| 1948 | Ga0495671_0003550 | |||
| 1949 | Ga0495671_0212145 | |||
| 1950 | Ga0495671_0219143 | |||
| 1951 | Ga0495671_0249224 | |||
| 1952 | Ga0495649_0000194 | |||
| 1953 | Ga0495649_0008705 | |||
| 1954 | Ga0495649_0016852 | |||
| 1955 | Ga0495649_0082460 | |||
| 1956 | Ga0495649_0148011 | |||
| 1957 | Ga0495649_0183663 | |||
| 1958 | Ga0495649_0243124 | |||
| 1959 | Ga0495649_0280284 | |||
| 1960 | Ga0495649_0331277 | |||
| 1961 | Ga0495649_0408167 | |||
| 1962 | Ga0495589_0000086 | |||
| 1963 | Ga0495589_0000132 | |||
| 1964 | Ga0495589_0018768 | |||
| 1965 | Ga0495589_0051939 | |||
| 1966 | Ga0495589_0075941 | |||
| 1967 | Ga0495589_0081465 | |||
| 1968 | Ga0495589_0106770 | |||
| 1969 | Ga0495589_0139767 | |||
| 1970 | Ga0495589_0182429 | |||
| 1971 | Ga0495589_0253560 | |||
| 1972 | Ga0495600_0002033 | |||
| 1973 | Ga0495600_0161897 | |||
| 1974 | Ga0495600_0388825 | |||
| 1975 | Ga0495660_0001930 | |||
| 1976 | Ga0495660_0003563 | |||
| 1977 | Ga0495660_0007681 | |||
| 1978 | Ga0495660_0028271 | |||
| 1979 | Ga0495660_0097121 | |||
| 1980 | Ga0495660_0102255 | |||
| 1981 | Ga0495660_0204625 | |||
| 1982 | Ga0495660_0207146 | |||
| 1983 | Ga0495660_0216121 | |||
| 1984 | Ga0495660_0216966 | |||
| 1985 | Ga0495660_0232356 | |||
| 1986 | Ga0495660_0262214 | |||
| 1987 | Ga0495581_0197328 | |||
| 1988 | Ga0495581_0387533 | |||
| 1989 | Ga0495604_0032878 | |||
| 1990 | Ga0495604_0053804 | |||
| 1991 | Ga0495604_0108518 | |||
| 1992 | Ga0495636_0003424 | |||
| 1993 | Ga0495636_0004254 | |||
| 1994 | Ga0495636_0011954 | |||
| 1995 | Ga0495636_0093780 | |||
| 1996 | Ga0495636_0182706 | |||
| 1997 | Ga0495674_0011663 | |||
| 1998 | Ga0495672_0000013 | |||
| 1999 | Ga0495672_0000278 | |||
| 2000 | Ga0495672_0000512 | |||
| 2001 | Ga0495672_0001189 | |||
| 2002 | Ga0495672_0033064 | |||
| 2003 | Ga0495672_0110608 | |||
| 2004 | Ga0495672_0149142 | |||
| 2005 | Ga0495672_0192288 | |||
| 2006 | Ga0495672_0270825 | |||
| 2007 | Ga0495676_0000015 | |||
| 2008 | Ga0495676_0068178 | |||
| 2009 | Ga0495676_0478428 | |||
| 2010 | Ga0495680_0663530 | |||
| 2011 | Ga0495683_0000036 | |||
| 2012 | Ga0495683_0005881 | |||
| 2013 | Ga0495683_0006168 | |||
| 2014 | Ga0495683_0015050 | |||
| 2015 | Ga0495683_0043476 | |||
| 2016 | Ga0495683_0069970 | |||
| 2017 | Ga0495683_0085180 | |||
| 2018 | Ga0495683_0118925 | |||
| 2019 | Ga0495683_0287733 | |||
| 2020 | Ga0495687_000038 | |||
| 2021 | Ga0495687_000057 | |||
| 2022 | Ga0495687_000165 | |||
| 2023 | Ga0495687_001055 | |||
| 2024 | Ga0495687_001122 | |||
| 2025 | Ga0495687_001809 | |||
| 2026 | Ga0495687_007401 | |||
| 2027 | Ga0495687_070205 | |||
| 2028 | Ga0495675_0296286 | |||
| 2029 | Ga0495677_0000004 | |||
| 2030 | Ga0495677_0000948 | |||
| 2031 | Ga0495677_0005204 | |||
| 2032 | Ga0495677_0005995 | |||
| 2033 | Ga0495677_0030645 | |||
| 2034 | Ga0495677_0069528 | |||
| 2035 | Ga0495677_0074959 | |||
| 2036 | Ga0495677_0086085 | |||
| 2037 | Ga0495677_0149704 | |||
| 2038 | Ga0495677_0170223 | |||
| 2039 | Ga0495677_0178619 | |||
| 2040 | Ga0495679_001332 | |||
| 2041 | Ga0495679_063648 | |||
| 2042 | Ga0495685_000299 | |||
| 2043 | Ga0495685_021233 | |||
| 2044 | Ga0495685_023768 | |||
| 2045 | Ga0495685_039572 | |||
| 2046 | Ga0495685_082816 | |||
| 2047 | Ga0495673_0000069 | |||
| 2048 | Ga0495673_0000203 | |||
| 2049 | Ga0495673_0000236 | |||
| 2050 | Ga0495673_0046695 | |||
| 2051 | Ga0495673_0185264 | |||
| 2052 | Ga0495681_0001009 | |||
| 2053 | Ga0495681_0015607 | |||
| 2054 | Ga0495681_0051862 | |||
| 2055 | Ga0495681_0074195 | |||
| 2056 | Ga0495681_0076968 | |||
| 2057 | Ga0495681_0120190 | |||
| 2058 | Ga0495686_0000620 | |||
| 2059 | Ga0495686_0001028 | |||
| 2060 | Ga0495686_0006069 | |||
| 2061 | Ga0495686_0048133 | |||
| 2062 | Ga0495686_0053203 | |||
| 2063 | Ga0495686_0132978 | |||
| 2064 | Ga0495686_0264985 | |||
| 2065 | Ga0495593_0041261 | |||
| 2066 | Ga0495602_0123252 | |||
| 2067 | Ga0495602_0124621 | |||
| 2068 | Ga0495602_0236664 | |||
| 2069 | Ga0495614_0037921 | |||
| 2070 | Ga0495614_0106892 | |||
| 2071 | Ga0495615_0004412 | |||
| 2072 | Ga0495615_0108744 | |||
| 2073 | Ga0495615_0130685 | |||
| 2074 | Ga0495626_0000048 | |||
| 2075 | Ga0495626_0000279 | |||
| 2076 | Ga0495626_0000998 | |||
| 2077 | Ga0495626_0001757 | |||
| 2078 | Ga0495626_0002805 | |||
| 2079 | Ga0495626_0005031 | |||
| 2080 | Ga0495626_0010181 | |||
| 2081 | Ga0495626_0021084 | |||
| 2082 | Ga0495626_0049285 | |||
| 2083 | Ga0495626_0052127 | |||
| 2084 | Ga0495626_0057384 | |||
| 2085 | Ga0495626_0065425 | |||
| 2086 | Ga0495626_0111765 | |||
| 2087 | Ga0495626_0156595 | |||
| 2088 | Ga0495626_0173292 | |||
| 2089 | Ga0495626_0180387 | |||
| 2090 | Ga0495626_0192718 | |||
| 2091 | Ga0495626_0223047 | |||
| 2092 | Ga0496100_0037867 | |||
| 2093 | Ga0496100_0154562 | |||
| 2094 | Ga0496101_0070873 | |||
| 2095 | Ga0496101_0088835 | |||
| 2096 | Ga0496101_0344823 | |||
| 2097 | Ga0496102_0000478 | |||
| 2098 | Ga0496102_0008640 | |||
| 2099 | Ga0496102_0017344 | |||
| 2100 | Ga0496102_0060082 | |||
| 2101 | Ga0496102_0215355 | |||
| 2102 | Ga0496102_0844309 | |||
| 2103 | Ga0496103_0039346 | |||
| 2104 | Ga0496103_0066485 | |||
| 2105 | Ga0496103_0146237 | |||
| 2106 | Ga0496104_0443679 | |||
| 2107 | Ga0496105_0674294 | |||
| 2108 | Ga0496106_0335160 | |||
| 2109 | Ga0496106_0830783 | |||
| 2110 | Ga0496107_0131596 | |||
| 2111 | Ga0496107_0227084 | |||
| 2112 | Ga0496109_0233913 | |||
| 2113 | Ga0496110_0000092 | |||
| 2114 | Ga0496110_0223501 | |||
| 2115 | Ga0496111_0104260 | |||
| 2116 | Ga0496113_0097164 | |||
| 2117 | Ga0496113_1025587 | |||
| 2118 | Ga0496114_0117903 | |||
| 2119 | Ga0496115_0186034 | |||
| 2120 | Ga0496115_0530364 | |||
| 2121 | Ga0496115_0702750 | |||
| 2122 | Ga0496115_0713328 | |||
| 2123 | Ga0496116_0010336 | |||
| 2124 | Ga0496116_0044055 | |||
| 2125 | Ga0496116_0201000 | |||
| 2126 | Ga0496117_0000005 | |||
| 2127 | Ga0496118_0000031 | |||
| 2128 | Ga0496121_0002018 | |||
| 2129 | Ga0496121_0057712 | |||
| 2130 | Ga0496121_0236502 | |||
| 2131 | Ga0496121_0333285 | |||
| 2132 | Ga0496121_0439019 | |||
| 2133 | Ga0496122_0003525 | |||
| 2134 | Ga0496122_0020064 | |||
| 2135 | Ga0496122_0042085 | |||
| 2136 | Ga0496123_0000084 | |||
| 2137 | Ga0496123_0001425 | |||
| 2138 | Ga0496123_0003683 | |||
| 2139 | Ga0496123_0004216 | |||
| 2140 | Ga0496124_0010436 | |||
| 2141 | Ga0496124_0134060 | |||
| 2142 | Ga0496124_0233802 | |||
| 2143 | Ga0496124_0258140 | |||
| 2144 | Ga0496124_0468886 | |||
| 2145 | Ga0496124_0521428 | |||
| 2146 | Ga0496125_0000368 | |||
| 2147 | Ga0496125_0089020 | |||
| 2148 | Ga0496125_0204119 | |||
| 2149 | Ga0496126_0027941 | |||
| 2150 | Ga0496126_0114487 | |||
| 2151 | Ga0496126_0287297 | |||
| 2152 | Ga0495678_000010 | |||
| 2153 | Ga0495678_000034 | |||
| 2154 | Ga0495678_000095 | |||
| 2155 | Ga0495678_000383 | |||
| 2156 | Ga0495678_001376 | |||
| 2157 | Ga0495678_001441 | |||
| 2158 | Ga0495678_009739 | |||
| 2159 | Ga0495678_056982 | |||
| 2160 | Ga0495678_083062 | |||
| 2161 | Ga0495682_0000089 | |||
| 2162 | Ga0495682_0000432 | |||
| 2163 | Ga0495682_0022370 | |||
| 2164 | Ga0495682_0058762 | |||
| 2165 | Ga0495682_0078158 | |||
| 2166 | Ga0495682_0084149 | |||
| 2167 | Ga0495682_0093822 | |||
| 2168 | Ga0495682_0208689 | |||
| 2169 | Ga0501295_001090 | |||
| 2170 | Ga0501315_008783 | |||
| 2171 | Ga0501316_007461 | |||
| 2172 | Ga0501323_018249 | |||
| 2173 | Ga0501034_0000134 | |||
| 2174 | Ga0501034_1031688 | |||
| 2175 | Ga0501075_0111296 | |||
| 2176 | Ga0501202_066870 | |||
| 2177 | Ga0501211_003557 | |||
| 2178 | Ga0501211_012123 | |||
| 2179 | Ga0501216_079505 | |||
| 2180 | Ga0501227_184370 | |||
| 2181 | Ga0501230_014418 | |||
| 2182 | Ga0501238_001560 | |||
| 2183 | Ga0501240_041629 | |||
| 2184 | Ga0501249_036722 | |||
| 2185 | Ga0501081_0134001 | |||
| 2186 | Ga0501083_0049975 | |||
| 2187 | Ga0501269_000473 | |||
| 2188 | Ga0501269_038157 | |||
| 2189 | Ga0501280_000153 | |||
| 2190 | Ga0501283_049195 | |||
| 2191 | Ga0501035_0006010 | |||
| 2192 | Ga0501044_0252781 | |||
| 2193 | Ga0501045_0552537 | |||
| 2194 | nmdc:mga0k408_2236_c1 | |||
| 2195 | nmdc:mga0qj67_246743_c1 | |||
| 2196 | nmdc:mga0qj67_484271_c1 | |||
| 2197 | Ga0495601_0011317 | |||
| 2198 | Ga0500572_034944 | |||
| 2199 | Ga0500594_0114301 | |||
| 2200 | Ga0500595_022717 | |||
| 2201 | Ga0500618_000653 | |||
| 2202 | Ga0500618_062749 | |||
| 2203 | Ga0500618_071845 | |||
| 2204 | Ga0500574_000047 | |||
| 2205 | Ga0500586_000912 | |||
| 2206 | Ga0500619_003631 | |||
| 2207 | Ga0500622_0204456 | |||
| 2208 | Ga0500636_0000203 | |||
| 2209 | Ga0500637_0148477 | |||
| 2210 | Ga0500625_005119 | |||
| 2211 | Ga0587082_018912 | |||
| 2212 | Ga0587083_0076817 | |||
| 2213 | Ga0587106_019270 | |||
| 2214 | Ga0587068_008109 | |||
| 2215 | Ga0466962_0000755 | |||
| 2216 | Ga0466962_0015221 | |||
| 2217 | Ga0466962_0085214 | |||
| 2218 | 2511250316 | |||
| 2219 | 2511387578 | |||
| 2220 | 2521559828 | |||
| 2221 | 2550693195 | |||
| 2222 | 2553007038 | |||
| 2223 | 2585294009 | |||
| 2224 | 2601672277 | |||
| 2225 | 2643791754 | |||
| 2226 | 2643796623 | |||
| 2227 | 2644027059 | |||
| 2228 | 2644216767 | |||
| 2229 | 2644254523 | |||
| 2230 | 2644360070 | |||
| 2231 | 2644472745 | |||
| 2232 | 2735816544 | |||
| 2233 | 2738742905 | |||
| 2234 | 2738827056 | |||
| 2235 | 2738845993 | |||
| 2236 | 2739150853 | |||
| 2237 | 2739192772 | |||
| 2238 | 2739276901 | |||
| 2239 | 2739319249 | |||
| 2240 | 2739337490 | |||
| 2241 | 2739345945 | |||
| 2242 | 2765571084 | |||
| 2243 | 2808984992 | |||
| 2244 | 2809130124 | |||
| 2245 | 2809145549 | |||
| 2246 | 2809150399 | |||
| 2247 | 2817259865 | |||
| 2248 | 2817456660 | |||
| 2249 | 2819544567 | |||
| 2250 | 2819594069 | |||
| 2251 | 2819618263 | |||
| 2252 | 2821136476 | |||
| 2253 | 2839096680 | |||
| 2254 | 2842713691 | |||
| 2255 | 2852621377 | |||
| 2256 | 2857541724 | |||
| 2257 | 2857549308 | |||
| 2258 | 2857558525 | |||
| 2259 | 2857562340 | |||
| 2260 | 2857568293 | |||
| 2261 | 2858953932 | |||
| 2262 | 2884815180 | |||
| 2263 | 2884839896 | |||
| 2264 | 2884856293 | |||
| 2265 | 2885081346 | |||
| 2266 | 2891635436 | |||
| 2267 | 2896158658 | |||
| 2268 | 2904428566 | |||
| 2269 | 2904444394 | |||
| 2270 | 2904535547 | |||
| 2271 | 2904588119 | |||
| 2272 | 2904595155 | |||
| 2273 | 2904606068 | |||
| 2274 | 2919051306 | |||
| 2275 | 2919084266 | |||
| 2276 | 2919477225 | |||
| 2277 | 2923513595 | |||
| 2278 | 2928135288 | |||
| 2279 | 2932416362 | |||
| 2280 | 2932422245 | |||
| 2281 | 639788486 | |||
| 2282 | 8020810836 | |||
| 2283 | 8040172684 | |||
| 2284 | 8040176359 | |||
| 2285 | 8047675702 | |||
| 2286 | 8055225935 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.9641 | 2 | 186 |
| 8hx6-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae | 0.9477 | 2 | 184 |
| 8hx7-assembly1.cif.gz_A | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9466 | 2 | 185 |
| 8hx7-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9454 | 2 | 184 |
| 1wl8-assembly1.cif.gz_A | crystal structure of ph1346 protein from pyrococcus horikoshii | 0.9417 | 1 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9981 | 1 | 185 | 3.40.50.880 |
| af_K7L2D7_74_267_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9852 | 2 | 185 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9822 | 1 | 185 | 3.40.50.880 |
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9797 | 1 | 186 | 3.40.50.880 |
| af_P9WN35_1_200_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9693 | 2 | 186 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C7X5A9-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 1 | 1 | 185 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A2N2T822-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) | 1 | 1 | 169 |
GO:0000162
GO:0004049 GO:0005829 |
| AF-A0A516WDN0-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 1 | 1 | 186 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A231HJD2-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) | 1 | 1 | 186 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A259CX94-F1-model_v4 | Anthranilate/aminodeoxychorismate synthase component II | 0.9996 | 1 | 185 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |