F490744

General Info

Members Datasets Scaffolds Average Seq Length
1143 423 2286 188

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0570193|Ga0466960_0570193_29_649
Length 206
Sequence VLFCVLPSKCKMVWTGRFDMLLMIDNYDSFTYNLVQYFGELGEEVRTYRNDEITLDEIAAMNPDRICISPGPCTPHEAGISVPLLQHFAGKTPILGVCLGHQSIGAAFGGKVIRAKQVMHGKTSVIAHTGVGVFKDLPSPYTVIRYHSLAIERASLPDCLEVTAWTDDGEIMGVRHKEFNIQGVQFHPESILSEHGHALLKNFLSA

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
145 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
146 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
147 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
148 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
181 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
288 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
315 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
320 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
321 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
322 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
323 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
324 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
325 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
326 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
327 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
331 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
332 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
340 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
344 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
345 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
350 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
356 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
357 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
358 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
359 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
360 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
361 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
362 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
363 2643221556 Massilia sp. Root1485 Isolate Unclassified
364 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
365 2643221638 Duganella sp. Root336D2 Isolate Unclassified
366 2643221645 Massilia sp. Root351 Isolate Unclassified
367 2643221664 Massilia sp. Root418 Isolate Unclassified
368 2643221684 Massilia sp. Root133 Isolate Unclassified
369 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
370 2738541280 Massilia sp. GV090 Isolate Unclassified
371 2738541297 Duganella sp. GV083 Isolate Unclassified
372 2738541300 Massilia sp. GV016 Isolate Unclassified
373 2738541357 Duganella sp. GV053 Isolate Unclassified
374 2738543003 Duganella sp. GV066 Isolate Unclassified
375 2738543018 Massilia sp. GV045 Isolate Unclassified
376 2738543026 Duganella sp. GV089 Isolate Unclassified
377 2738543029 Duganella sp. GV039 Isolate Unclassified
378 2738543030 Massilia sp. GV097 Isolate Unclassified
379 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
380 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
381 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
382 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
383 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
384 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
385 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
386 2818991436 Collimonas arenae 515 Isolate Unclassified
387 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
388 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
389 2821131069 Duganella sp. 1224 Isolate Unclassified
390 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
391 2842711865 Duganella sp. R-73148 Isolate Unclassified
392 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
393 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
394 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
395 2857553236 Duganella sp. R-74557 Isolate Unclassified
396 2857558681 Duganella sp. R-74565 Isolate Unclassified
397 2857564685 Duganella sp. R-74599 Isolate Unclassified
398 2858950400 Achromobacter sp. K91 Isolate Unclassified
399 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
400 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
401 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
402 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
403 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
404 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
405 2904424332 Duganella sp. 1411 Isolate Rhizosphere
406 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
407 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
408 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
409 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
410 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
411 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
412 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
413 2919476304 Duganella sp. 3397 Isolate Unclassified
414 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
415 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
416 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
417 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
418 639633007 Azoarcus olearius BH72 Isolate Unclassified
419 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
420 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
421 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
422 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
423 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.83
Metatranscriptomes 1.14
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 0.7
Rhizoplane 2.8
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0570193 3300044901 Bacteria 669
2 JGI25155J39150_1000336 3300002704 Bacteria 15086
3 JGI25155J39150_1000485 3300002704 Bacteria 9807
4 JGI25156J39149_1000267 3300002705 Bacteria 35297
5 JGI25156J39149_1013381 3300002705 Bacteria 1744
6 JGI25154J39366_1000739 3300002738 Bacteria 14651
7 JGI25154J39366_1001209 3300002738 Bacteria 9784
8 JGI25154J39366_1002200 3300002738 Bacteria 5398
9 JGI25158J39367_1003079 3300002739 Bacteria 2624
10 JGI25157J39369_1000372 3300002741 Bacteria 30863
11 JGI25157J39369_1000495 3300002741 Bacteria 24307
12 JGI25164J39214_1003913 3300002772 Bacteria 1791
13 JGI25150J39212_1000910 3300002774 Bacteria 9622
14 JGI25150J39212_1003626 3300002774 Bacteria 3583
15 JGI25159J45721_1002200 3300002987 Bacteria 7576
16 JGI25159J45721_1005724 3300002987 Bacteria 3849
17 JGI25165J46597_1000713 3300003214 Bacteria 26161
18 JGI25153J46596_10018531 3300003215 Bacteria 2700
19 JGI25160J50197_1003453 3300003354 Bacteria 7072
20 JGI25161J50226_1006300 3300003374 Bacteria 2165
21 Ga0007410J51695_1015624 3300003574 Bacteria 2390
22 Ga0007410J51695_1044871 3300003574 Bacteria 2302
23 Ga0007409J51694_1007308 3300003575 Bacteria 2829
24 Ga0007409J51694_1023914 3300003575 Bacteria 3351
25 Ga0007416J51690_1029024 3300003577 Bacteria 2453
26 Ga0032354_1058597 3300003693 Bacteria 1089
27 Ga0055538_1000062 3300003751 Bacteria 105260
28 Ga0055538_1000281 3300003751 Bacteria 26161
29 Ga0055539_1000093 3300003752 Bacteria 105260
30 Ga0055539_1000305 3300003752 Bacteria 26161
31 Ga0055533_1000105 3300003756 Bacteria 105260
32 Ga0055533_1000286 3300003756 Bacteria 26161
33 Ga0055532_1000034 3300003758 Bacteria 210984
34 Ga0055525_1000018 3300003759 Bacteria 393974
35 Ga0055525_1000137 3300003759 Bacteria 105260
36 Ga0055525_1000405 3300003759 Bacteria 26891
37 Ga0055526_1001033 3300003771 Bacteria 20365
38 Ga0055526_1005708 3300003771 Bacteria 7051
39 Ga0055537_1000580 3300003773 Bacteria 20336
40 Ga0055537_1009165 3300003773 Bacteria 2210
41 Ga0055524_1002755 3300003775 Bacteria 8837
42 Ga0055524_1010041 3300003775 Bacteria 3798
43 Ga0055534_1000283 3300003784 Bacteria 34520
44 Ga0055528_1000495 3300003790 Bacteria 31111
45 Ga0055530_10050684 3300003791 Bacteria 966
46 Ga0055541_1000063 3300003841 Bacteria 105260
47 Ga0055541_1000198 3300003841 Bacteria 26161
48 Ga0055543_1003826 3300004625 Bacteria 4273
49 Ga0065165_1002857 3300005262 Bacteria 13394
50 Ga0065165_1004075 3300005262 Bacteria 9468
51 Ga0065714_10171696 3300005288 Bacteria 999
52 Ga0065715_10042333 3300005293 Bacteria 959
53 Ga0070658_10710717 3300005327 Bacteria 872
54 Ga0070670_100086718 3300005331 Bacteria 2690
55 Ga0070682_100098361 3300005337 Bacteria 1927
56 Ga0070682_100577228 3300005337 Bacteria 884
57 Ga0070660_100016657 3300005339 Bacteria 5341
58 Ga0070660_100044451 3300005339 Bacteria 3398
59 Ga0070661_100051855 3300005344 Bacteria 3003
60 Ga0070659_100001752 3300005366 Bacteria 15587
61 Ga0070659_100082019 3300005366 Bacteria 2576
62 Ga0070659_100216063 3300005366 Bacteria 1581
63 Ga0070662_100057197 3300005457 Bacteria 2833
64 Ga0070662_100692878 3300005457 Bacteria 861
65 Ga0068867_100056392 3300005459 Bacteria 2907
66 Ga0070706_100007456 3300005467 Bacteria 10255
67 Ga0070707_100111118 3300005468 Bacteria 2658
68 Ga0070699_100042824 3300005518 Bacteria 3918
69 Ga0070679_100691385 3300005530 Bacteria 963
70 Ga0070697_100618561 3300005536 Bacteria 953
71 Ga0068855_100016570 3300005563 Bacteria 8864
72 Ga0068855_100035272 3300005563 Bacteria 5958
73 Ga0068855_101052987 3300005563 Bacteria 852
74 Ga0068855_101571899 3300005563 Bacteria 673
75 Ga0070664_100003553 3300005564 Bacteria 12597
76 Ga0070664_100298359 3300005564 Bacteria 1456
77 Ga0068857_100326958 3300005577 Bacteria 1417
78 Ga0068854_100017165 3300005578 Bacteria 4840
79 Ga0068856_100163375 3300005614 Bacteria 2238
80 Ga0068852_100004237 3300005616 Bacteria 10127
81 Ga0068852_100004430 3300005616 Bacteria 9925
82 Ga0068863_100298029 3300005841 Bacteria 1564
83 Ga0070717_10473844 3300006028 Bacteria 1130
84 Ga0075366_10002981 3300006195 Bacteria 8821
85 Ga0075428_100377519 3300006844 Bacteria 1520
86 Ga0075430_100258757 3300006846 Bacteria 1442
87 Ga0075431_100002888 3300006847 Bacteria 16633
88 Ga0079104_1005592 3300006946 Bacteria 4978
89 Ga0079104_1008552 3300006946 Bacteria 3567
90 Ga0099826_10000010 3300006948 Bacteria 314346
91 Ga0105244_10002041 3300009036 Bacteria 15556
92 Ga0105244_10003441 3300009036 Bacteria 11284
93 Ga0105244_10035827 3300009036 Bacteria 2604
94 Ga0105244_10110311 3300009036 Bacteria 1339
95 Ga0105244_10174679 3300009036 Bacteria 1021
96 Ga0105250_10120377 3300009092 Bacteria 1079
97 Ga0105240_10001608 3300009093 Bacteria 38292
98 Ga0105240_10016336 3300009093 Bacteria 10052
99 Ga0105240_10190542 3300009093 Bacteria 2412
100 Ga0105241_10120376 3300009174 Bacteria 2113
101 Ga0105242_10037198 3300009176 Bacteria 3909
102 Ga0105242_10180899 3300009176 Bacteria 1860
103 Ga0105237_10010944 3300009545 Bacteria 9627
104 Ga0105238_10000763 3300009551 Bacteria 33477
105 Ga0105239_10010387 3300010375 Bacteria 10421
106 Ga0105239_10368622 3300010375 Bacteria 1623
107 Ga0105239_10961472 3300010375 Bacteria 981
108 Ga0157373_10711950 3300013100 Bacteria 736
109 Ga0157371_10039633 3300013102 Bacteria 3369
110 Ga0157370_11246340 3300013104 Bacteria 671
111 Ga0157369_10000804 3300013105 Bacteria 40126
112 Ga0157369_10574078 3300013105 Bacteria 1165
113 Ga0157374_10000924 3300013296 Bacteria 25554
114 Ga0157374_11006092 3300013296 Bacteria 853
115 Ga0157378_10091922 3300013297 Bacteria 2760
116 Ga0157378_11144502 3300013297 Bacteria 816
117 Ga0163162_10379875 3300013306 Bacteria 1546
118 Ga0182008_10003605 3300014497 Bacteria 9271
119 Ga0182008_10056599 3300014497 Bacteria 1937
120 Ga0182006_1000033 3300015261 Bacteria 238180
121 Ga0182006_1000080 3300015261 Bacteria 122163
122 Ga0182006_1058779 3300015261 Bacteria 1457
123 Ga0182007_10000042 3300015262 Bacteria 111840
124 Ga0182007_10030574 3300015262 Bacteria 1839
125 Ga0182005_1000016 3300015265 Bacteria 346889
126 Ga0182005_1000024 3300015265 Bacteria 238256
127 Ga0182005_1001434 3300015265 Bacteria 9601
128 Ga0163161_10012023 3300017792 Bacteria 6004
129 Ga0163161_10012229 3300017792 Bacteria 5953
130 Ga0163161_10087249 3300017792 Bacteria 2304
131 Ga0213872_10000430 3300021361 Bacteria 34377
132 Ga0213872_10001856 3300021361 Bacteria 13064
133 Ga0213872_10002336 3300021361 Bacteria 11273
134 Ga0213872_10004434 3300021361 Bacteria 7457
135 Ga0213872_10024411 3300021361 Bacteria 2781
136 Ga0213872_10115807 3300021361 Bacteria 1187
137 Ga0209435_100007 3300025206 Bacteria 516857
138 Ga0209435_100176 3300025206 Bacteria 19214
139 Ga0209436_100769 3300025208 Bacteria 13300
140 Ga0209784_100010 3300025224 Bacteria 683664
141 Ga0209784_100021 3300025224 Bacteria 408534
142 Ga0209566_100008 3300025225 Bacteria 683664
143 Ga0209566_100119 3300025225 Bacteria 105312
144 Ga0209674_100019 3300025226 Bacteria 683664
145 Ga0209674_100036 3300025226 Bacteria 408534
146 Ga0209147_100017 3300025229 Bacteria 516857
147 Ga0209563_100011 3300025230 Bacteria 1187808
148 Ga0209563_100021 3300025230 Bacteria 683764
149 Ga0209563_100040 3300025230 Bacteria 408534
150 Ga0207427_100759 3300025231 Bacteria 14690
151 Ga0209437_100019 3300025233 Bacteria 683764
152 Ga0209437_100332 3300025233 Bacteria 58796
153 Ga0209437_105938 3300025233 Bacteria 2056
154 Ga0209437_107841 3300025233 Bacteria 1720
155 Ga0209258_101277 3300025242 Bacteria 9457
156 Ga0207425_1000021 3300025245 Bacteria 367537
157 Ga0207425_1000829 3300025245 Bacteria 15420
158 Ga0209646_1000044 3300025246 Bacteria 334596
159 Ga0209646_1000107 3300025246 Bacteria 163112
160 Ga0209646_1000190 3300025246 Bacteria 75772
161 Ga0209026_1000063 3300025250 Bacteria 211324
162 Ga0209026_1005858 3300025250 Bacteria 3170
163 Ga0209026_1012017 3300025250 Bacteria 1527
164 Ga0209677_100011 3300025253 Bacteria 683664
165 Ga0209677_100023 3300025253 Bacteria 408534
166 Ga0209677_101699 3300025253 Bacteria 9186
167 Ga0209148_1000237 3300025254 Bacteria 88748
168 Ga0209759_1000048 3300025256 Bacteria 224817
169 Ga0209759_1000198 3300025256 Bacteria 95052
170 Ga0209129_1000020 3300025258 Bacteria 457053
171 Ga0209233_1000025 3300025261 Bacteria 683764
172 Ga0209565_1000055 3300025263 Bacteria 201184
173 Ga0209565_1000677 3300025263 Bacteria 21295
174 Ga0209565_1002957 3300025263 Bacteria 5775
175 Ga0209565_1003264 3300025263 Bacteria 5342
176 Ga0209455_1000070 3300025272 Bacteria 307867
177 Ga0209455_1029838 3300025272 Bacteria 936
178 Ga0209673_1000040 3300025273 Bacteria 312633
179 Ga0209673_1003338 3300025273 Bacteria 9600
180 Ga0209130_1000169 3300025284 Bacteria 95167
181 Ga0209130_1002260 3300025284 Bacteria 9942
182 Ga0209675_1000052 3300025291 Bacteria 201332
183 Ga0209675_1001299 3300025291 Bacteria 14837
184 Ga0209025_1000473 3300025294 Bacteria 78078
185 Ga0209025_1001876 3300025294 Bacteria 24626
186 Ga0209564_1000027 3300025295 Bacteria 518458
187 Ga0209564_1000047 3300025295 Bacteria 368031
188 Ga0209564_1000063 3300025295 Bacteria 318515
189 Ga0209564_1000271 3300025295 Bacteria 108422
190 Ga0209564_1001666 3300025295 Bacteria 21297
191 Ga0209564_1028858 3300025295 Bacteria 1761
192 Ga0209758_1000288 3300025297 Bacteria 99096
193 Ga0209758_1000436 3300025297 Bacteria 70342
194 Ga0209050_1000050 3300025298 Bacteria 362578
195 Ga0209256_1000054 3300025299 Bacteria 298431
196 Ga0209256_1000100 3300025299 Bacteria 201246
197 Ga0209256_1000754 3300025299 Bacteria 42096
198 Ga0207426_1003112 3300025302 Bacteria 9466
199 Ga0209051_1028245 3300025303 Bacteria 2219
200 Ga0207656_10071281 3300025321 Bacteria 1544
201 Ga0207655_1001651 3300025728 Bacteria 19767
202 Ga0207655_1016701 3300025728 Bacteria 3999
203 Ga0207655_1064734 3300025728 Bacteria 1392
204 Ga0207705_10034051 3300025909 Bacteria 3641
205 Ga0207684_10008262 3300025910 Bacteria 9268
206 Ga0207654_10022625 3300025911 Bacteria 3356
207 Ga0207695_10008939 3300025913 Bacteria 12470
208 Ga0207695_10012318 3300025913 Bacteria 10275
209 Ga0207695_10136114 3300025913 Bacteria 2409
210 Ga0207671_10004652 3300025914 Bacteria 12996
211 Ga0207671_10309446 3300025914 Bacteria 1249
212 Ga0207657_10012688 3300025919 Bacteria 8304
213 Ga0207657_10231476 3300025919 Bacteria 1478
214 Ga0207657_10525715 3300025919 Bacteria 926
215 Ga0207649_10024118 3300025920 Bacteria 3532
216 Ga0207649_10493530 3300025920 Bacteria 930
217 Ga0207652_10464901 3300025921 Bacteria 1140
218 Ga0207694_10000343 3300025924 Bacteria 44142
219 Ga0207694_10858659 3300025924 Bacteria 767
220 Ga0207650_10063319 3300025925 Bacteria 2765
221 Ga0207690_10000951 3300025932 Bacteria 18563
222 Ga0207690_10323880 3300025932 Bacteria 1212
223 Ga0207690_10330334 3300025932 Bacteria 1201
224 Ga0207686_10036176 3300025934 Bacteria 2970
225 Ga0207709_10388720 3300025935 Bacteria 1063
226 Ga0207679_10004406 3300025945 Bacteria 8766
227 Ga0207667_10000912 3300025949 Bacteria 37632
228 Ga0207667_10007366 3300025949 Bacteria 13242
229 Ga0207667_10317294 3300025949 Bacteria 1592
230 Ga0207667_10550318 3300025949 Bacteria 1167
231 Ga0207640_10041316 3300025981 Bacteria 2932
232 Ga0207639_10170095 3300026041 Bacteria 1844
233 Ga0207678_10439887 3300026067 Bacteria 1132
234 Ga0207702_10168886 3300026078 Bacteria 2004
235 Ga0207641_10366349 3300026088 Bacteria 1377
236 Ga0207648_10086029 3300026089 Bacteria 2742
237 Ga0207674_10182190 3300026116 Bacteria 2052
238 Ga0207674_10281988 3300026116 Bacteria 1609
239 Ga0207698_10044764 3300026142 Bacteria 3329
240 Ga0207698_10095163 3300026142 Bacteria 2451
241 Ga0207698_10385474 3300026142 Bacteria 1335
242 Ga0209281_1005374 3300027111 Bacteria 3569
243 Ga0209282_1000009 3300027666 Bacteria 233366
244 Ga0209974_10027183 3300027876 Bacteria 1892
245 Ga0265336_10006403 3300028666 Bacteria 4244
246 Ga0265336_10048575 3300028666 Bacteria 1286
247 Ga0265338_10066959 3300028800 Bacteria 3105
248 Ga0265324_10000002 3300029957 Bacteria 382754
249 Ga0265324_10000616 3300029957 Bacteria 24232
250 Ga0268256_1004381 3300030500 Bacteria 5881
251 Ga0316177_1075487 3300030731 Bacteria 5574
252 Ga0316178_1172473 3300030735 Bacteria 1017
253 Ga0316180_1064742 3300030736 Bacteria 1510
254 Ga0316181_1137224 3300030744 Bacteria 4539
255 Ga0316182_1021746 3300030745 Bacteria 1163
256 Ga0316182_1361262 3300030745 Bacteria 1173
257 Ga0265332_10000030 3300031238 Bacteria 175141
258 Ga0265332_10001445 3300031238 Bacteria 13313
259 Ga0265328_10000016 3300031239 Bacteria 132959
260 Ga0265325_10002841 3300031241 Bacteria 11549
261 Ga0265325_10007848 3300031241 Bacteria 6354
262 Ga0265331_10009812 3300031250 Bacteria 5340
263 Ga0265331_10013920 3300031250 Bacteria 4303
264 Ga0265331_10054133 3300031250 Bacteria 1911
265 Ga0265331_10089997 3300031250 Bacteria 1419
266 Ga0265331_10158693 3300031250 Bacteria 1025
267 Ga0265327_10000528 3300031251 Bacteria 65837
268 Ga0265327_10000674 3300031251 Bacteria 54882
269 Ga0265327_10001509 3300031251 Bacteria 28791
270 Ga0265327_10015618 3300031251 Bacteria 4886
271 Ga0265327_10018721 3300031251 Bacteria 4281
272 Ga0265327_10059966 3300031251 Bacteria 1947
273 Ga0265327_10123875 3300031251 Bacteria 1222
274 Ga0265327_10216212 3300031251 Bacteria 863
275 Ga0265316_10090702 3300031344 Bacteria 2332
276 Ga0265316_10158523 3300031344 Bacteria 1693
277 Ga0265316_10376779 3300031344 Bacteria 1024
278 Ga0307509_10000076 3300031507 Bacteria 138855
279 Ga0307408_100000432 3300031548 Bacteria 37289
280 Ga0307408_100002407 3300031548 Bacteria 13173
281 Ga0307408_100010617 3300031548 Bacteria 6076
282 Ga0265313_10040874 3300031595 Bacteria 2289
283 Ga0316575_10003832 3300031665 Bacteria 5243
284 Ga0265314_10001144 3300031711 Bacteria 30747
285 Ga0265314_10008929 3300031711 Bacteria 8538
286 Ga0265314_10118654 3300031711 Bacteria 1669
287 Ga0307405_10084076 3300031731 Bacteria 2088
288 Ga0307405_10270046 3300031731 Bacteria 1275
289 Ga0307413_10141496 3300031824 Bacteria 1663
290 Ga0307518_10057653 3300031838 Bacteria 2821
291 Ga0307412_10000169 3300031911 Bacteria 46494
292 Ga0307416_100000975 3300032002 Bacteria 15137
293 Ga0307416_100104940 3300032002 Bacteria 2472
294 Ga0307414_10174903 3300032004 Bacteria 1720
295 Ga0307414_10285519 3300032004 Bacteria 1389
296 Ga0307411_10541983 3300032005 Bacteria 991
297 Ga0316583_10021200 3300032133 Bacteria 2330
298 Ga0316583_10069475 3300032133 Bacteria 1232
299 Ga0316582_0049684 3300036647 Bacteria 2654
300 Ga0395899_0000521 3300037312 Bacteria 42304
301 Ga0395899_0002474 3300037312 Bacteria 14991
302 Ga0395899_0002806 3300037312 Bacteria 14038
303 Ga0395899_0003830 3300037312 Bacteria 11871
304 Ga0395899_0018674 3300037312 Bacteria 5269
305 Ga0395899_0125972 3300037312 Bacteria 1832
306 Ga0395899_0126723 3300037312 Bacteria 1825
307 Ga0395900_0006506 3300037418 Bacteria 12173
308 Ga0395900_0010081 3300037418 Bacteria 9664
309 Ga0395900_0014022 3300037418 Bacteria 8184
310 Ga0395900_0031672 3300037418 Bacteria 5435
311 Ga0395900_0035466 3300037418 Bacteria 5137
312 Ga0395900_0113125 3300037418 Bacteria 2786
313 Ga0395900_0181240 3300037418 Bacteria 2140
314 Ga0395900_0285610 3300037418 Bacteria 1640
315 Ga0395900_0289530 3300037418 Bacteria 1627
316 Ga0395900_0622000 3300037418 Bacteria 1018
317 Ga0395898_0000559 3300037466 Bacteria 69751
318 Ga0395898_0089880 3300037466 Bacteria 2955
319 Ga0395898_0478763 3300037466 Bacteria 1184
320 Ga0395898_0508579 3300037466 Bacteria 1145
321 Ga0395898_0690689 3300037466 Bacteria 962
322 Ga0395898_0892151 3300037466 Bacteria 827
323 Ga0395905_0010442 3300037471 Bacteria 9034
324 Ga0395905_0013127 3300037471 Bacteria 7952
325 Ga0395905_0036632 3300037471 Bacteria 4608
326 Ga0395905_0036694 3300037471 Bacteria 4604
327 Ga0395905_0055914 3300037471 Bacteria 3693
328 Ga0395905_0093364 3300037471 Bacteria 2822
329 Ga0395901_0000328 3300038443 Bacteria 58470
330 Ga0395901_0000824 3300038443 Bacteria 34332
331 Ga0395901_0002710 3300038443 Bacteria 17843
332 Ga0395901_0002897 3300038443 Bacteria 17321
333 Ga0395901_0020765 3300038443 Bacteria 6723
334 Ga0395901_0066242 3300038443 Bacteria 3762
335 Ga0395901_0117619 3300038443 Bacteria 2793
336 Ga0400483_005643 3300039062 Bacteria 2692
337 Ga0400483_266454 3300039062 Bacteria 3843
338 Ga0436361_0013073 3300039447 Bacteria 17617
339 Ga0436361_0303014 3300039447 Bacteria 21994
340 Ga0436361_0314274 3300039447 Bacteria 1808
341 Ga0436361_0512442 3300039447 Bacteria 20430
342 Ga0436361_0544664 3300039447 Bacteria 11764
343 Ga0436361_0930389 3300039447 Bacteria 10390
344 Ga0436361_1012850 3300039447 Bacteria 830
345 Ga0436361_1027676 3300039447 Bacteria 838
346 Ga0436361_1072133 3300039447 Bacteria 3944
347 Ga0436361_1091442 3300039447 Bacteria 27914
348 Ga0436361_1097952 3300039447 Bacteria 1349
349 Ga0436361_1206124 3300039447 Bacteria 9470
350 Ga0439436_0086795 3300041404 Bacteria 871
351 Ga0451837_0319601 3300041494 Bacteria 1101
352 Ga0439448_0000161 3300042005 Bacteria 13290
353 Ga0439449_0009520 3300042007 Bacteria 3681
354 Ga0439450_017711 3300042008 Bacteria 1489
355 Ga0439450_042434 3300042008 Bacteria 1060
356 Ga0439450_053924 3300042008 Bacteria 960
357 Ga0450904_007543 3300042139 Bacteria 1079
358 Ga0451577_0000002 3300042876 Bacteria 1731375
359 Ga0451577_0000345 3300042876 Bacteria 87020
360 Ga0451577_0071284 3300042876 Bacteria 3099
361 Ga0451577_0219478 3300042876 Bacteria 1718
362 Ga0451577_0407278 3300042876 Bacteria 1234
363 Ga0451577_0689600 3300042876 Bacteria 925
364 Ga0451577_0743976 3300042876 Bacteria 887
365 Ga0451577_0944695 3300042876 Bacteria 775
366 Ga0466969_0250847 3300044656 Bacteria 802
367 Ga0466972_0000420 3300044658 Bacteria 22023
368 Ga0466972_0003973 3300044658 Bacteria 7370
369 Ga0466972_0011040 3300044658 Bacteria 4535
370 Ga0466977_0107028 3300044666 Bacteria 1834
371 Ga0453683_0000013 3300044673 Bacteria 371932
372 Ga0466965_0002121 3300044683 Bacteria 8329
373 Ga0466965_0028860 3300044683 Bacteria 2697
374 Ga0466965_0029552 3300044683 Bacteria 2667
375 Ga0466965_0031596 3300044683 Bacteria 2582
376 Ga0466965_0036795 3300044683 Bacteria 2402
377 Ga0466965_0073626 3300044683 Bacteria 1720
378 Ga0466966_0001854 3300044684 Bacteria 13710
379 Ga0466966_0006887 3300044684 Bacteria 7530
380 Ga0466966_0029262 3300044684 Bacteria 3584
381 Ga0466966_0082568 3300044684 Bacteria 1999
382 Ga0466961_0068851 3300044693 Bacteria 2247
383 Ga0466964_0007888 3300044706 Bacteria 3987
384 Ga0466964_0018884 3300044706 Bacteria 2647
385 Ga0466964_0260780 3300044706 Bacteria 858
386 Ga0453684_0000002 3300044712 Bacteria 1731375
387 Ga0453684_0000040 3300044712 Bacteria 690210
388 Ga0453684_0000065 3300044712 Bacteria 468481
389 Ga0453684_0000694 3300044712 Bacteria 119688
390 Ga0453684_0010268 3300044712 Bacteria 16038
391 Ga0453684_0109392 3300044712 Bacteria 3362
392 Ga0453684_1610308 3300044712 Bacteria 666
393 Ga0466971_0002015 3300044719 Bacteria 8591
394 Ga0466971_0162361 3300044719 Bacteria 1046
395 Ga0466968_0009040 3300044735 Bacteria 3831
396 Ga0466968_0210388 3300044735 Bacteria 913
397 Ga0466957_0001920 3300044842 Bacteria 11037
398 Ga0466957_0018243 3300044842 Bacteria 4119
399 Ga0466957_0076144 3300044842 Bacteria 2083
400 Ga0466960_0257561 3300044901 Bacteria 971
401 Ga0466959_0002185 3300045049 Bacteria 12440
402 Ga0466959_0025858 3300045049 Bacteria 4353
403 Ga0466959_0155315 3300045049 Bacteria 1611
404 Ga0451576_0000006 3300045051 Bacteria 949698
405 Ga0451576_0000037 3300045051 Bacteria 372173
406 Ga0451576_0002868 3300045051 Bacteria 24693
407 Ga0451576_0005999 3300045051 Bacteria 15024
408 Ga0451576_0199277 3300045051 Bacteria 2091
409 Ga0451576_0359886 3300045051 Bacteria 1524
410 Ga0466958_0000123 3300045836 Bacteria 25381
411 Ga0466967_0652134 3300045976 Bacteria 1041
412 Ga0495617_000022 3300046452 Bacteria 185975
413 Ga0495617_000075 3300046452 Bacteria 78250
414 Ga0495617_001209 3300046452 Bacteria 11631
415 Ga0495617_018396 3300046452 Bacteria 2362
416 Ga0495617_101153 3300046452 Bacteria 936
417 Ga0495627_000011 3300046453 Bacteria 354522
418 Ga0495627_000398 3300046453 Bacteria 38966
419 Ga0495627_028660 3300046453 Bacteria 1777
420 Ga0495627_030153 3300046453 Bacteria 1720
421 Ga0495592_0002825 3300046454 Bacteria 12317
422 Ga0495603_0219775 3300046455 Bacteria 1096
423 Ga0495603_0333361 3300046455 Bacteria 870
424 Ga0495590_0000057 3300046457 Bacteria 93720
425 Ga0495590_0000143 3300046457 Bacteria 43197
426 Ga0495590_0003098 3300046457 Bacteria 6801
427 Ga0495590_0005737 3300046457 Bacteria 4877
428 Ga0495629_0020396 3300046459 Bacteria 4733
429 Ga0495629_0041378 3300046459 Bacteria 3242
430 Ga0495638_0001680 3300046460 Bacteria 19581
431 Ga0495638_0005569 3300046460 Bacteria 9312
432 Ga0495638_0029512 3300046460 Bacteria 3537
433 Ga0495638_0142822 3300046460 Bacteria 1395
434 Ga0495638_0279409 3300046460 Bacteria 908
435 Ga0495638_0294735 3300046460 Bacteria 876
436 Ga0495638_0350140 3300046460 Bacteria 780
437 Ga0495638_0469701 3300046460 Bacteria 639
438 Ga0495653_0000044 3300046463 Bacteria 115591
439 Ga0495653_0003313 3300046463 Bacteria 12931
440 Ga0495653_0028893 3300046463 Bacteria 4432
441 Ga0495653_0030963 3300046463 Bacteria 4256
442 Ga0495653_0062600 3300046463 Bacteria 2810
443 Ga0495653_0142416 3300046463 Bacteria 1684
444 Ga0495653_0220831 3300046463 Bacteria 1274
445 Ga0495650_0000082 3300046471 Bacteria 239477
446 Ga0495650_0000254 3300046471 Bacteria 103512
447 Ga0495650_0001173 3300046471 Bacteria 27987
448 Ga0495650_0001749 3300046471 Bacteria 19780
449 Ga0495650_0003298 3300046471 Bacteria 11915
450 Ga0495650_0005094 3300046471 Bacteria 8689
451 Ga0495650_0012103 3300046471 Bacteria 4666
452 Ga0495580_0291017 3300046472 Bacteria 1113
453 Ga0495582_0027191 3300046473 Bacteria 3134
454 Ga0495582_0317982 3300046473 Bacteria 896
455 Ga0495605_0000098 3300046474 Bacteria 109816
456 Ga0495605_0000102 3300046474 Bacteria 107430
457 Ga0495605_0000153 3300046474 Bacteria 88955
458 Ga0495605_0002046 3300046474 Bacteria 12721
459 Ga0495605_0020353 3300046474 Bacteria 3526
460 Ga0495605_0037236 3300046474 Bacteria 2448
461 Ga0495605_0051571 3300046474 Bacteria 2003
462 Ga0495605_0118230 3300046474 Bacteria 1203
463 Ga0495605_0119063 3300046474 Bacteria 1198
464 Ga0495605_0127029 3300046474 Bacteria 1152
465 Ga0495605_0176519 3300046474 Bacteria 941
466 Ga0495605_0185627 3300046474 Bacteria 912
467 Ga0495639_0099019 3300046475 Bacteria 1375
468 Ga0495584_0000005 3300046491 Bacteria 306957
469 Ga0495584_0000232 3300046491 Bacteria 40218
470 Ga0495584_0000729 3300046491 Bacteria 21708
471 Ga0495584_0002317 3300046491 Bacteria 10849
472 Ga0495584_0008319 3300046491 Bacteria 5372
473 Ga0495584_0009911 3300046491 Bacteria 4896
474 Ga0495584_0016425 3300046491 Bacteria 3774
475 Ga0495584_0050942 3300046491 Bacteria 2085
476 Ga0495584_0072746 3300046491 Bacteria 1727
477 Ga0495584_0142839 3300046491 Bacteria 1215
478 Ga0495584_0263303 3300046491 Bacteria 876
479 Ga0495584_0480564 3300046491 Bacteria 632
480 Ga0495585_0000023 3300046492 Bacteria 149218
481 Ga0495585_0000152 3300046492 Bacteria 74325
482 Ga0495585_0000444 3300046492 Bacteria 39574
483 Ga0495585_0004011 3300046492 Bacteria 9694
484 Ga0495585_0022356 3300046492 Bacteria 3630
485 Ga0495585_0036679 3300046492 Bacteria 2763
486 Ga0495585_0063062 3300046492 Bacteria 2034
487 Ga0495585_0065031 3300046492 Bacteria 1998
488 Ga0495585_0081256 3300046492 Bacteria 1755
489 Ga0495585_0086044 3300046492 Bacteria 1698
490 Ga0495585_0093181 3300046492 Bacteria 1620
491 Ga0495585_0110487 3300046492 Bacteria 1462
492 Ga0495585_0120150 3300046492 Bacteria 1390
493 Ga0495585_0124453 3300046492 Bacteria 1361
494 Ga0495585_0127601 3300046492 Bacteria 1341
495 Ga0495585_0130882 3300046492 Bacteria 1320
496 Ga0495585_0198599 3300046492 Bacteria 1022
497 Ga0495594_0014891 3300046499 Bacteria 4081
498 Ga0495594_0067330 3300046499 Bacteria 1987
499 Ga0495594_0068128 3300046499 Bacteria 1976
500 Ga0495594_0111098 3300046499 Bacteria 1545
501 Ga0495594_0203838 3300046499 Bacteria 1127
502 Ga0495596_0000032 3300046500 Bacteria 102282
503 Ga0495596_0001270 3300046500 Bacteria 14619
504 Ga0495596_0004904 3300046500 Bacteria 6418
505 Ga0495596_0019014 3300046500 Bacteria 2826
506 Ga0495596_0019824 3300046500 Bacteria 2758
507 Ga0495596_0064880 3300046500 Bacteria 1420
508 Ga0495596_0104091 3300046500 Bacteria 1102
509 Ga0495596_0140228 3300046500 Bacteria 938
510 Ga0495596_0215517 3300046500 Bacteria 745
511 Ga0495596_0219493 3300046500 Bacteria 738
512 Ga0495607_0018756 3300046501 Bacteria 4400
513 Ga0495607_0021757 3300046501 Bacteria 4032
514 Ga0495607_0034462 3300046501 Bacteria 3071
515 Ga0495607_0053231 3300046501 Bacteria 2340
516 Ga0495607_0071833 3300046501 Bacteria 1928
517 Ga0495607_0075941 3300046501 Bacteria 1860
518 Ga0495607_0082535 3300046501 Bacteria 1763
519 Ga0495607_0094427 3300046501 Bacteria 1613
520 Ga0495607_0142834 3300046501 Bacteria 1233
521 Ga0495607_0156528 3300046501 Bacteria 1161
522 Ga0495607_0170248 3300046501 Bacteria 1100
523 Ga0495607_0201691 3300046501 Bacteria 984
524 Ga0495607_0304687 3300046501 Bacteria 749
525 Ga0495583_0000106 3300046506 Bacteria 140932
526 Ga0495583_0000150 3300046506 Bacteria 117772
527 Ga0495583_0000597 3300046506 Bacteria 49120
528 Ga0495583_0001383 3300046506 Bacteria 24824
529 Ga0495583_0001918 3300046506 Bacteria 19228
530 Ga0495583_0002413 3300046506 Bacteria 16045
531 Ga0495583_0016522 3300046506 Bacteria 3962
532 Ga0495583_0019473 3300046506 Bacteria 3541
533 Ga0495583_0032678 3300046506 Bacteria 2509
534 Ga0495583_0055535 3300046506 Bacteria 1789
535 Ga0495583_0153492 3300046506 Bacteria 953
536 Ga0495583_0208027 3300046506 Bacteria 793
537 Ga0495606_0000080 3300046507 Bacteria 161866
538 Ga0495606_0000090 3300046507 Bacteria 154737
539 Ga0495606_0000099 3300046507 Bacteria 150950
540 Ga0495606_0000524 3300046507 Bacteria 62049
541 Ga0495606_0001629 3300046507 Bacteria 29255
542 Ga0495606_0002603 3300046507 Bacteria 20634
543 Ga0495606_0002891 3300046507 Bacteria 18970
544 Ga0495606_0003267 3300046507 Bacteria 17378
545 Ga0495606_0086803 3300046507 Bacteria 1932
546 Ga0495606_0156832 3300046507 Bacteria 1331
547 Ga0495606_0167075 3300046507 Bacteria 1279
548 Ga0495606_0167282 3300046507 Bacteria 1278
549 Ga0495606_0177366 3300046507 Bacteria 1231
550 Ga0495606_0273276 3300046507 Bacteria 927
551 Ga0495606_0287086 3300046507 Bacteria 897
552 Ga0495606_0360638 3300046507 Bacteria 768
553 Ga0495606_0482262 3300046507 Bacteria 629
554 Ga0495608_0026533 3300046511 Bacteria 3948
555 Ga0495610_0000017 3300046512 Bacteria 365675
556 Ga0495610_0000668 3300046512 Bacteria 33359
557 Ga0495610_0051728 3300046512 Bacteria 1997
558 Ga0495610_0056760 3300046512 Bacteria 1881
559 Ga0495610_0094937 3300046512 Bacteria 1345
560 Ga0495610_0149659 3300046512 Bacteria 997
561 Ga0495616_0000490 3300046513 Bacteria 30167
562 Ga0495616_0002388 3300046513 Bacteria 12495
563 Ga0495616_0004647 3300046513 Bacteria 8621
564 Ga0495616_0006823 3300046513 Bacteria 6878
565 Ga0495616_0016924 3300046513 Bacteria 4026
566 Ga0495616_0018127 3300046513 Bacteria 3872
567 Ga0495616_0018885 3300046513 Bacteria 3769
568 Ga0495616_0027167 3300046513 Bacteria 3039
569 Ga0495616_0029168 3300046513 Bacteria 2915
570 Ga0495616_0052218 3300046513 Bacteria 2035
571 Ga0495616_0140557 3300046513 Bacteria 1099
572 Ga0495616_0166939 3300046513 Bacteria 986
573 Ga0495616_0209388 3300046513 Bacteria 853
574 Ga0495620_0025372 3300046515 Bacteria 2805
575 Ga0495628_0000382 3300046516 Bacteria 40502
576 Ga0495630_0290113 3300046517 Bacteria 1250
577 Ga0495631_0001332 3300046518 Bacteria 15128
578 Ga0495631_0001436 3300046518 Bacteria 14479
579 Ga0495631_0017621 3300046518 Bacteria 3374
580 Ga0495631_0021527 3300046518 Bacteria 3002
581 Ga0495631_0089877 3300046518 Bacteria 1322
582 Ga0495631_0108701 3300046518 Bacteria 1192
583 Ga0495631_0132606 3300046518 Bacteria 1070
584 Ga0495631_0178075 3300046518 Bacteria 911
585 Ga0495631_0256240 3300046518 Bacteria 745
586 Ga0495631_0264638 3300046518 Bacteria 732
587 Ga0495631_0348127 3300046518 Bacteria 630
588 Ga0495632_0000052 3300046519 Bacteria 132992
589 Ga0495632_0000396 3300046519 Bacteria 40964
590 Ga0495632_0001555 3300046519 Bacteria 18930
591 Ga0495632_0003734 3300046519 Bacteria 10656
592 Ga0495632_0012494 3300046519 Bacteria 4897
593 Ga0495632_0077299 3300046519 Bacteria 1591
594 Ga0495632_0229594 3300046519 Bacteria 837
595 Ga0495637_0000018 3300046520 Bacteria 186671
596 Ga0495637_0000195 3300046520 Bacteria 47191
597 Ga0495637_0025136 3300046520 Bacteria 2686
598 Ga0495637_0157208 3300046520 Bacteria 854
599 Ga0495643_0000109 3300046522 Bacteria 135859
600 Ga0495643_0000250 3300046522 Bacteria 78905
601 Ga0495643_0000914 3300046522 Bacteria 31057
602 Ga0495643_0001163 3300046522 Bacteria 25714
603 Ga0495643_0014484 3300046522 Bacteria 4691
604 Ga0495643_0020420 3300046522 Bacteria 3817
605 Ga0495643_0074658 3300046522 Bacteria 1775
606 Ga0495643_0167799 3300046522 Bacteria 1075
607 Ga0495643_0169250 3300046522 Bacteria 1069
608 Ga0495643_0173777 3300046522 Bacteria 1051
609 Ga0495643_0288040 3300046522 Bacteria 753
610 Ga0495644_0001124 3300046523 Bacteria 10982
611 Ga0495644_0003935 3300046523 Bacteria 5846
612 Ga0495644_0012464 3300046523 Bacteria 3269
613 Ga0495644_0033210 3300046523 Bacteria 1949
614 Ga0495644_0036962 3300046523 Bacteria 1842
615 Ga0495644_0049248 3300046523 Bacteria 1581
616 Ga0495644_0105342 3300046523 Bacteria 1068
617 Ga0495644_0131017 3300046523 Bacteria 955
618 Ga0495644_0138769 3300046523 Bacteria 928
619 Ga0495644_0161425 3300046523 Bacteria 859
620 Ga0495648_0001108 3300046524 Bacteria 27307
621 Ga0495648_0001296 3300046524 Bacteria 24870
622 Ga0495648_0001297 3300046524 Bacteria 24870
623 Ga0495648_0001425 3300046524 Bacteria 23386
624 Ga0495648_0003753 3300046524 Bacteria 13223
625 Ga0495648_0012427 3300046524 Bacteria 6353
626 Ga0495648_0015868 3300046524 Bacteria 5445
627 Ga0495648_0030615 3300046524 Bacteria 3555
628 Ga0495648_0049127 3300046524 Bacteria 2589
629 Ga0495648_0081899 3300046524 Bacteria 1834
630 Ga0495648_0103442 3300046524 Bacteria 1566
631 Ga0495648_0120682 3300046524 Bacteria 1409
632 Ga0495648_0124831 3300046524 Bacteria 1377
633 Ga0495648_0169639 3300046524 Bacteria 1120
634 Ga0495648_0221552 3300046524 Bacteria 932
635 Ga0495663_0018991 3300046525 Bacteria 1961
636 Ga0495663_0027435 3300046525 Bacteria 1671
637 Ga0495663_0080205 3300046525 Bacteria 1050
638 Ga0495663_0097680 3300046525 Bacteria 964
639 Ga0495666_0006871 3300046526 Bacteria 5714
640 Ga0495666_0007557 3300046526 Bacteria 5437
641 Ga0495666_0089356 3300046526 Bacteria 1454
642 Ga0495666_0136337 3300046526 Bacteria 1145
643 Ga0495642_0000529 3300046528 Bacteria 19421
644 Ga0495642_0003891 3300046528 Bacteria 5852
645 Ga0495642_0004563 3300046528 Bacteria 5366
646 Ga0495642_0022005 3300046528 Bacteria 2509
647 Ga0495642_0049932 3300046528 Bacteria 1719
648 Ga0495642_0055624 3300046528 Bacteria 1633
649 Ga0495642_0091444 3300046528 Bacteria 1288
650 Ga0495642_0095315 3300046528 Bacteria 1262
651 Ga0495642_0097224 3300046528 Bacteria 1250
652 Ga0495642_0128850 3300046528 Bacteria 1088
653 Ga0495642_0135331 3300046528 Bacteria 1062
654 Ga0495652_0195423 3300046529 Bacteria 1540
655 Ga0495652_0225042 3300046529 Bacteria 1407
656 Ga0495654_0000030 3300046530 Bacteria 216715
657 Ga0495654_0018430 3300046530 Bacteria 3658
658 Ga0495654_0021405 3300046530 Bacteria 3363
659 Ga0495654_0154397 3300046530 Bacteria 1012
660 Ga0495665_0001301 3300046531 Bacteria 13308
661 Ga0495665_0034596 3300046531 Bacteria 2701
662 Ga0495640_0244079 3300046533 Bacteria 1126
663 Ga0495586_0003956 3300046535 Bacteria 7954
664 Ga0495586_0348397 3300046535 Bacteria 850
665 Ga0495587_0106740 3300046536 Bacteria 1610
666 Ga0495587_0212022 3300046536 Bacteria 1093
667 Ga0495598_0015527 3300046537 Bacteria 1925
668 Ga0495609_0000007 3300046538 Bacteria 398812
669 Ga0495609_0001531 3300046538 Bacteria 15203
670 Ga0495609_0002820 3300046538 Bacteria 10412
671 Ga0495609_0005405 3300046538 Bacteria 6723
672 Ga0495609_0006790 3300046538 Bacteria 5791
673 Ga0495609_0053145 3300046538 Bacteria 1801
674 Ga0495609_0087078 3300046538 Bacteria 1361
675 Ga0495609_0090129 3300046538 Bacteria 1333
676 Ga0495609_0094483 3300046538 Bacteria 1298
677 Ga0495609_0112477 3300046538 Bacteria 1174
678 Ga0495609_0167361 3300046538 Bacteria 929
679 Ga0495621_0167216 3300046539 Bacteria 872
680 Ga0495597_0001115 3300046542 Bacteria 20308
681 Ga0495597_0001285 3300046542 Bacteria 18457
682 Ga0495597_0001411 3300046542 Bacteria 17326
683 Ga0495597_0002378 3300046542 Bacteria 12035
684 Ga0495597_0004502 3300046542 Bacteria 7634
685 Ga0495597_0018041 3300046542 Bacteria 3315
686 Ga0495597_0018630 3300046542 Bacteria 3255
687 Ga0495597_0059212 3300046542 Bacteria 1672
688 Ga0495597_0176075 3300046542 Bacteria 866
689 Ga0495597_0217646 3300046542 Bacteria 759
690 Ga0495645_0068890 3300046543 Bacteria 2554
691 Ga0495622_0000044 3300046557 Bacteria 115528
692 Ga0495622_0002393 3300046557 Bacteria 9126
693 Ga0495622_0004973 3300046557 Bacteria 6157
694 Ga0495622_0031549 3300046557 Bacteria 2476
695 Ga0495622_0031647 3300046557 Bacteria 2471
696 Ga0495622_0185930 3300046557 Bacteria 930
697 Ga0495622_0271346 3300046557 Bacteria 743
698 Ga0495633_0000917 3300046558 Bacteria 24985
699 Ga0495633_0003343 3300046558 Bacteria 10770
700 Ga0495633_0006937 3300046558 Bacteria 6622
701 Ga0495633_0008903 3300046558 Bacteria 5597
702 Ga0495633_0018586 3300046558 Bacteria 3527
703 Ga0495633_0023285 3300046558 Bacteria 3069
704 Ga0495633_0059388 3300046558 Bacteria 1793
705 Ga0495633_0097204 3300046558 Bacteria 1367
706 Ga0495633_0195396 3300046558 Bacteria 929
707 Ga0495633_0237567 3300046558 Bacteria 832
708 Ga0495633_0349354 3300046558 Bacteria 670
709 Ga0495656_0052339 3300046615 Bacteria 1750
710 Ga0495656_0090382 3300046615 Bacteria 1399
711 Ga0495656_0176549 3300046615 Bacteria 1047
712 Ga0495668_0000035 3300046616 Bacteria 240241
713 Ga0495668_0000211 3300046616 Bacteria 84615
714 Ga0495668_0000286 3300046616 Bacteria 69771
715 Ga0495668_0000939 3300046616 Bacteria 32535
716 Ga0495668_0001545 3300046616 Bacteria 21835
717 Ga0495668_0004452 3300046616 Bacteria 9939
718 Ga0495668_0007872 3300046616 Bacteria 6738
719 Ga0495668_0066663 3300046616 Bacteria 1980
720 Ga0495668_0069634 3300046616 Bacteria 1934
721 Ga0495668_0110644 3300046616 Bacteria 1502
722 Ga0495668_0111339 3300046616 Bacteria 1497
723 Ga0495668_0124532 3300046616 Bacteria 1410
724 Ga0495668_0157375 3300046616 Bacteria 1244
725 Ga0495668_0251588 3300046616 Bacteria 967
726 Ga0495634_0029850 3300046642 Bacteria 3771
727 Ga0495634_0185328 3300046642 Bacteria 1301
728 Ga0495611_0001030 3300046648 Bacteria 14761
729 Ga0495611_0003988 3300046648 Bacteria 6425
730 Ga0495611_0006487 3300046648 Bacteria 4986
731 Ga0495611_0012387 3300046648 Bacteria 3626
732 Ga0495611_0019917 3300046648 Bacteria 2884
733 Ga0495611_0024927 3300046648 Bacteria 2603
734 Ga0495611_0030738 3300046648 Bacteria 2362
735 Ga0495611_0058343 3300046648 Bacteria 1750
736 Ga0495611_0184440 3300046648 Bacteria 974
737 Ga0495611_0245871 3300046648 Bacteria 830
738 Ga0495625_0000338 3300046660 Bacteria 71524
739 Ga0495625_0001765 3300046660 Bacteria 25007
740 Ga0495625_0016076 3300046660 Bacteria 5897
741 Ga0495625_0032153 3300046660 Bacteria 3895
742 Ga0495625_0032657 3300046660 Bacteria 3857
743 Ga0495625_0159609 3300046660 Bacteria 1511
744 Ga0495625_0229305 3300046660 Bacteria 1213
745 Ga0495625_0244011 3300046660 Bacteria 1168
746 Ga0495625_0464422 3300046660 Bacteria 780
747 Ga0495635_0008609 3300046663 Bacteria 7123
748 Ga0495635_0117569 3300046663 Bacteria 1814
749 Ga0495659_0000139 3300046664 Bacteria 32158
750 Ga0495659_0006513 3300046664 Bacteria 3687
751 Ga0495659_0012720 3300046664 Bacteria 2731
752 Ga0495659_0021812 3300046664 Bacteria 2161
753 Ga0495661_0000074 3300046665 Bacteria 120402
754 Ga0495661_0014026 3300046665 Bacteria 5371
755 Ga0495661_0024464 3300046665 Bacteria 3908
756 Ga0495661_0024989 3300046665 Bacteria 3865
757 Ga0495661_0050895 3300046665 Bacteria 2504
758 Ga0495661_0056989 3300046665 Bacteria 2334
759 Ga0495661_0081170 3300046665 Bacteria 1869
760 Ga0495661_0090282 3300046665 Bacteria 1744
761 Ga0495661_0095657 3300046665 Bacteria 1681
762 Ga0495661_0097206 3300046665 Bacteria 1663
763 Ga0495661_0170266 3300046665 Bacteria 1162
764 Ga0495661_0170462 3300046665 Bacteria 1161
765 Ga0495661_0178616 3300046665 Bacteria 1126
766 Ga0495661_0194602 3300046665 Bacteria 1065
767 Ga0495661_0218634 3300046665 Bacteria 988
768 Ga0495661_0276444 3300046665 Bacteria 848
769 Ga0495661_0465967 3300046665 Bacteria 606
770 Ga0495588_0000451 3300046674 Bacteria 20713
771 Ga0495588_0012930 3300046674 Bacteria 3961
772 Ga0495588_0037807 3300046674 Bacteria 2453
773 Ga0495588_0056552 3300046674 Bacteria 2025
774 Ga0495588_0124955 3300046674 Bacteria 1356
775 Ga0495588_0136992 3300046674 Bacteria 1292
776 Ga0495588_0183519 3300046674 Bacteria 1106
777 Ga0495588_0209771 3300046674 Bacteria 1028
778 Ga0495599_0009879 3300046678 Bacteria 5840
779 Ga0495599_0302397 3300046678 Bacteria 965
780 Ga0495623_0010353 3300046679 Bacteria 6037
781 Ga0495623_0089894 3300046679 Bacteria 1886
782 Ga0495623_0186117 3300046679 Bacteria 1203
783 Ga0495623_0264807 3300046679 Bacteria 961
784 Ga0495646_0315081 3300046680 Bacteria 825
785 Ga0495669_0000101 3300046684 Bacteria 53876
786 Ga0495669_0000495 3300046684 Bacteria 18130
787 Ga0495669_0001145 3300046684 Bacteria 10993
788 Ga0495669_0081917 3300046684 Bacteria 1482
789 Ga0495669_0093504 3300046684 Bacteria 1390
790 Ga0495669_0174437 3300046684 Bacteria 1023
791 Ga0495613_0026824 3300046689 Bacteria 4290
792 Ga0495613_0392189 3300046689 Bacteria 948
793 Ga0495624_0004359 3300046690 Bacteria 10375
794 Ga0495624_0020490 3300046690 Bacteria 4400
795 Ga0495624_0124437 3300046690 Bacteria 1583
796 Ga0495670_0000859 3300046691 Bacteria 14714
797 Ga0495670_0013263 3300046691 Bacteria 4053
798 Ga0495670_0044778 3300046691 Bacteria 2209
799 Ga0495670_0087076 3300046691 Bacteria 1596
800 Ga0495670_0155332 3300046691 Bacteria 1200
801 Ga0495670_0158563 3300046691 Bacteria 1188
802 Ga0495670_0238538 3300046691 Bacteria 968
803 Ga0495671_0000087 3300046692 Bacteria 87327
804 Ga0495671_0000605 3300046692 Bacteria 26398
805 Ga0495671_0003550 3300046692 Bacteria 9532
806 Ga0495671_0212145 3300046692 Bacteria 938
807 Ga0495671_0219143 3300046692 Bacteria 921
808 Ga0495671_0249224 3300046692 Bacteria 857
809 Ga0495649_0000194 3300046694 Bacteria 53689
810 Ga0495649_0008705 3300046694 Bacteria 6087
811 Ga0495649_0016852 3300046694 Bacteria 4136
812 Ga0495649_0082460 3300046694 Bacteria 1718
813 Ga0495649_0148011 3300046694 Bacteria 1234
814 Ga0495649_0183663 3300046694 Bacteria 1090
815 Ga0495649_0243124 3300046694 Bacteria 926
816 Ga0495649_0280284 3300046694 Bacteria 852
817 Ga0495649_0331277 3300046694 Bacteria 771
818 Ga0495649_0408167 3300046694 Bacteria 681
819 Ga0495589_0000086 3300046794 Bacteria 86130
820 Ga0495589_0000132 3300046794 Bacteria 68363
821 Ga0495589_0018768 3300046794 Bacteria 3545
822 Ga0495589_0051939 3300046794 Bacteria 2025
823 Ga0495589_0075941 3300046794 Bacteria 1638
824 Ga0495589_0081465 3300046794 Bacteria 1574
825 Ga0495589_0106770 3300046794 Bacteria 1352
826 Ga0495589_0139767 3300046794 Bacteria 1160
827 Ga0495589_0182429 3300046794 Bacteria 995
828 Ga0495589_0253560 3300046794 Bacteria 821
829 Ga0495600_0002033 3300046809 Bacteria 11394
830 Ga0495600_0161897 3300046809 Bacteria 1446
831 Ga0495600_0388825 3300046809 Bacteria 869
832 Ga0495660_0001930 3300046810 Bacteria 13528
833 Ga0495660_0003563 3300046810 Bacteria 9601
834 Ga0495660_0007681 3300046810 Bacteria 6335
835 Ga0495660_0028271 3300046810 Bacteria 3169
836 Ga0495660_0097121 3300046810 Bacteria 1521
837 Ga0495660_0102255 3300046810 Bacteria 1473
838 Ga0495660_0204625 3300046810 Bacteria 940
839 Ga0495660_0207146 3300046810 Bacteria 932
840 Ga0495660_0216121 3300046810 Bacteria 906
841 Ga0495660_0216966 3300046810 Bacteria 904
842 Ga0495660_0232356 3300046810 Bacteria 863
843 Ga0495660_0262214 3300046810 Bacteria 797
844 Ga0495581_0197328 3300047315 Bacteria 1177
845 Ga0495581_0387533 3300047315 Bacteria 815
846 Ga0495604_0032878 3300047317 Bacteria 4108
847 Ga0495604_0053804 3300047317 Bacteria 3109
848 Ga0495604_0108518 3300047317 Bacteria 2027
849 Ga0495636_0003424 3300047318 Bacteria 6152
850 Ga0495636_0004254 3300047318 Bacteria 5617
851 Ga0495636_0011954 3300047318 Bacteria 3439
852 Ga0495636_0093780 3300047318 Bacteria 1306
853 Ga0495636_0182706 3300047318 Bacteria 952
854 Ga0495674_0011663 3300047319 Bacteria 8289
855 Ga0495672_0000013 3300047320 Bacteria 511827
856 Ga0495672_0000278 3300047320 Bacteria 71017
857 Ga0495672_0000512 3300047320 Bacteria 44570
858 Ga0495672_0001189 3300047320 Bacteria 26357
859 Ga0495672_0033064 3300047320 Bacteria 3208
860 Ga0495672_0110608 3300047320 Bacteria 1475
861 Ga0495672_0149142 3300047320 Bacteria 1214
862 Ga0495672_0192288 3300047320 Bacteria 1025
863 Ga0495672_0270825 3300047320 Bacteria 815
864 Ga0495676_0000015 3300047321 Bacteria 199492
865 Ga0495676_0068178 3300047321 Bacteria 2750
866 Ga0495676_0478428 3300047321 Bacteria 819
867 Ga0495680_0663530 3300047322 Bacteria 692
868 Ga0495683_0000036 3300047323 Bacteria 144974
869 Ga0495683_0005881 3300047323 Bacteria 6742
870 Ga0495683_0006168 3300047323 Bacteria 6571
871 Ga0495683_0015050 3300047323 Bacteria 4029
872 Ga0495683_0043476 3300047323 Bacteria 2261
873 Ga0495683_0069970 3300047323 Bacteria 1724
874 Ga0495683_0085180 3300047323 Bacteria 1537
875 Ga0495683_0118925 3300047323 Bacteria 1255
876 Ga0495683_0287733 3300047323 Bacteria 709
877 Ga0495687_000038 3300047443 Bacteria 251616
878 Ga0495687_000057 3300047443 Bacteria 186224
879 Ga0495687_000165 3300047443 Bacteria 99031
880 Ga0495687_001055 3300047443 Bacteria 27247
881 Ga0495687_001122 3300047443 Bacteria 26027
882 Ga0495687_001809 3300047443 Bacteria 18804
883 Ga0495687_007401 3300047443 Bacteria 6469
884 Ga0495687_070205 3300047443 Bacteria 1407
885 Ga0495675_0296286 3300047444 Bacteria 961
886 Ga0495677_0000004 3300047445 Bacteria 248210
887 Ga0495677_0000948 3300047445 Bacteria 11680
888 Ga0495677_0005204 3300047445 Bacteria 4948
889 Ga0495677_0005995 3300047445 Bacteria 4600
890 Ga0495677_0030645 3300047445 Bacteria 1957
891 Ga0495677_0069528 3300047445 Bacteria 1311
892 Ga0495677_0074959 3300047445 Bacteria 1263
893 Ga0495677_0086085 3300047445 Bacteria 1181
894 Ga0495677_0149704 3300047445 Bacteria 898
895 Ga0495677_0170223 3300047445 Bacteria 842
896 Ga0495677_0178619 3300047445 Bacteria 822
897 Ga0495679_001332 3300047446 Bacteria 14284
898 Ga0495679_063648 3300047446 Bacteria 1076
899 Ga0495685_000299 3300047447 Bacteria 16305
900 Ga0495685_021233 3300047447 Bacteria 2234
901 Ga0495685_023768 3300047447 Bacteria 2110
902 Ga0495685_039572 3300047447 Bacteria 1613
903 Ga0495685_082816 3300047447 Bacteria 1067
904 Ga0495673_0000069 3300047469 Bacteria 218170
905 Ga0495673_0000203 3300047469 Bacteria 89918
906 Ga0495673_0000236 3300047469 Bacteria 79618
907 Ga0495673_0046695 3300047469 Bacteria 1918
908 Ga0495673_0185264 3300047469 Bacteria 786
909 Ga0495681_0001009 3300047470 Bacteria 21583
910 Ga0495681_0015607 3300047470 Bacteria 4291
911 Ga0495681_0051862 3300047470 Bacteria 1927
912 Ga0495681_0074195 3300047470 Bacteria 1534
913 Ga0495681_0076968 3300047470 Bacteria 1498
914 Ga0495681_0120190 3300047470 Bacteria 1128
915 Ga0495686_0000620 3300047472 Bacteria 48981
916 Ga0495686_0001028 3300047472 Bacteria 33622
917 Ga0495686_0006069 3300047472 Bacteria 9368
918 Ga0495686_0048133 3300047472 Bacteria 2689
919 Ga0495686_0053203 3300047472 Bacteria 2537
920 Ga0495686_0132978 3300047472 Bacteria 1473
921 Ga0495686_0264985 3300047472 Bacteria 960
922 Ga0495593_0041261 3300047673 Bacteria 2482
923 Ga0495602_0123252 3300048088 Bacteria 2081
924 Ga0495602_0124621 3300048088 Bacteria 2066
925 Ga0495602_0236664 3300048088 Bacteria 1368
926 Ga0495614_0037921 3300048089 Bacteria 2068
927 Ga0495614_0106892 3300048089 Bacteria 1227
928 Ga0495615_0004412 3300048090 Bacteria 2456
929 Ga0495615_0108744 3300048090 Bacteria 791
930 Ga0495615_0130685 3300048090 Bacteria 734
931 Ga0495626_0000048 3300048091 Bacteria 161634
932 Ga0495626_0000279 3300048091 Bacteria 56185
933 Ga0495626_0000998 3300048091 Bacteria 24336
934 Ga0495626_0001757 3300048091 Bacteria 16497
935 Ga0495626_0002805 3300048091 Bacteria 11678
936 Ga0495626_0005031 3300048091 Bacteria 7893
937 Ga0495626_0010181 3300048091 Bacteria 5042
938 Ga0495626_0021084 3300048091 Bacteria 3239
939 Ga0495626_0049285 3300048091 Bacteria 1950
940 Ga0495626_0052127 3300048091 Bacteria 1886
941 Ga0495626_0057384 3300048091 Bacteria 1781
942 Ga0495626_0065425 3300048091 Bacteria 1645
943 Ga0495626_0111765 3300048091 Bacteria 1182
944 Ga0495626_0156595 3300048091 Bacteria 957
945 Ga0495626_0173292 3300048091 Bacteria 898
946 Ga0495626_0180387 3300048091 Bacteria 875
947 Ga0495626_0192718 3300048091 Bacteria 839
948 Ga0495626_0223047 3300048091 Bacteria 765
949 Ga0496100_0037867 3300048903 Bacteria 3053
950 Ga0496100_0154562 3300048903 Bacteria 1639
951 Ga0496101_0070873 3300048904 Bacteria 2553
952 Ga0496101_0088835 3300048904 Bacteria 2296
953 Ga0496101_0344823 3300048904 Bacteria 1170
954 Ga0496102_0000478 3300048905 Bacteria 44372
955 Ga0496102_0008640 3300048905 Bacteria 8741
956 Ga0496102_0017344 3300048905 Bacteria 6306
957 Ga0496102_0060082 3300048905 Bacteria 3477
958 Ga0496102_0215355 3300048905 Bacteria 1810
959 Ga0496102_0844309 3300048905 Bacteria 838
960 Ga0496103_0039346 3300048906 Bacteria 2905
961 Ga0496103_0066485 3300048906 Bacteria 2250
962 Ga0496103_0146237 3300048906 Bacteria 1513
963 Ga0496104_0443679 3300048907 Bacteria 1210
964 Ga0496105_0674294 3300048908 Bacteria 796
965 Ga0496106_0335160 3300048909 Bacteria 1215
966 Ga0496106_0830783 3300048909 Bacteria 732
967 Ga0496107_0131596 3300048910 Bacteria 1847
968 Ga0496107_0227084 3300048910 Bacteria 1389
969 Ga0496109_0233913 3300048912 Bacteria 1729
970 Ga0496110_0000092 3300048913 Bacteria 48035
971 Ga0496110_0223501 3300048913 Bacteria 1712
972 Ga0496111_0104260 3300048914 Bacteria 2086
973 Ga0496113_0097164 3300048916 Bacteria 2278
974 Ga0496113_1025587 3300048916 Bacteria 649
975 Ga0496114_0117903 3300048917 Bacteria 2280
976 Ga0496115_0186034 3300048918 Bacteria 1716
977 Ga0496115_0530364 3300048918 Bacteria 943
978 Ga0496115_0702750 3300048918 Bacteria 795
979 Ga0496115_0713328 3300048918 Bacteria 787
980 Ga0496116_0010336 3300048919 Bacteria 7838
981 Ga0496116_0044055 3300048919 Bacteria 3034
982 Ga0496116_0201000 3300048919 Bacteria 1043
983 Ga0496117_0000005 3300048920 Bacteria 777468
984 Ga0496118_0000031 3300048921 Bacteria 339329
985 Ga0496121_0002018 3300048924 Bacteria 32204
986 Ga0496121_0057712 3300048924 Bacteria 3215
987 Ga0496121_0236502 3300048924 Bacteria 1276
988 Ga0496121_0333285 3300048924 Bacteria 1017
989 Ga0496121_0439019 3300048924 Bacteria 844
990 Ga0496122_0003525 3300048925 Bacteria 20479
991 Ga0496122_0020064 3300048925 Bacteria 6067
992 Ga0496122_0042085 3300048925 Bacteria 3598
993 Ga0496123_0000084 3300048926 Bacteria 187479
994 Ga0496123_0001425 3300048926 Bacteria 33435
995 Ga0496123_0003683 3300048926 Bacteria 16896
996 Ga0496123_0004216 3300048926 Bacteria 15340
997 Ga0496124_0010436 3300048927 Bacteria 9401
998 Ga0496124_0134060 3300048927 Bacteria 1964
999 Ga0496124_0233802 3300048927 Bacteria 1372
1000 Ga0496124_0258140 3300048927 Bacteria 1284
1001 Ga0496124_0468886 3300048927 Bacteria 853
1002 Ga0496124_0521428 3300048927 Bacteria 791
1003 Ga0496125_0000368 3300048928 Bacteria 84924
1004 Ga0496125_0089020 3300048928 Bacteria 2323
1005 Ga0496125_0204119 3300048928 Bacteria 1290
1006 Ga0496126_0027941 3300048929 Bacteria 5380
1007 Ga0496126_0114487 3300048929 Bacteria 2346
1008 Ga0496126_0287297 3300048929 Bacteria 1361
1009 Ga0495678_000010 3300049459 Bacteria 357896
1010 Ga0495678_000034 3300049459 Bacteria 207827
1011 Ga0495678_000095 3300049459 Bacteria 109532
1012 Ga0495678_000383 3300049459 Bacteria 44894
1013 Ga0495678_001376 3300049459 Bacteria 19384
1014 Ga0495678_001441 3300049459 Bacteria 18715
1015 Ga0495678_009739 3300049459 Bacteria 4722
1016 Ga0495678_056982 3300049459 Bacteria 1482
1017 Ga0495678_083062 3300049459 Bacteria 1145
1018 Ga0495682_0000089 3300049460 Bacteria 80020
1019 Ga0495682_0000432 3300049460 Bacteria 29176
1020 Ga0495682_0022370 3300049460 Bacteria 2364
1021 Ga0495682_0058762 3300049460 Bacteria 1390
1022 Ga0495682_0078158 3300049460 Bacteria 1190
1023 Ga0495682_0084149 3300049460 Bacteria 1143
1024 Ga0495682_0093822 3300049460 Bacteria 1078
1025 Ga0495682_0208689 3300049460 Bacteria 692
1026 Ga0501295_001090 3300049518 Bacteria 2671
1027 Ga0501315_008783 3300049531 Bacteria 1182
1028 Ga0501316_007461 3300049532 Bacteria 1188
1029 Ga0501323_018249 3300049539 Bacteria 907
1030 Ga0501034_0000134 3300049571 Bacteria 137745
1031 Ga0501034_1031688 3300049571 Bacteria 705
1032 Ga0501075_0111296 3300049591 Bacteria 2082
1033 Ga0501202_066870 3300049652 Bacteria 822
1034 Ga0501211_003557 3300049658 Bacteria 1603
1035 Ga0501211_012123 3300049658 Bacteria 851
1036 Ga0501216_079505 3300049660 Bacteria 691
1037 Ga0501227_184370 3300049665 Bacteria 587
1038 Ga0501230_014418 3300049667 Bacteria 1297
1039 Ga0501238_001560 3300049671 Bacteria 2659
1040 Ga0501240_041629 3300049673 Bacteria 765
1041 Ga0501249_036722 3300049679 Bacteria 1104
1042 Ga0501081_0134001 3300049743 Bacteria 1772
1043 Ga0501083_0049975 3300049744 Bacteria 2816
1044 Ga0501269_000473 3300049766 Bacteria 8609
1045 Ga0501269_038157 3300049766 Bacteria 633
1046 Ga0501280_000153 3300049776 Bacteria 17816
1047 Ga0501283_049195 3300049779 Bacteria 744
1048 Ga0501035_0006010 3300049822 Bacteria 11433
1049 Ga0501044_0252781 3300049823 Bacteria 1703
1050 Ga0501045_0552537 3300049824 Bacteria 854
1051 nmdc:mga0k408_2236_c1 3300050493 Bacteria 10354
1052 nmdc:mga0qj67_246743_c1 3300050509 Bacteria 1449
1053 nmdc:mga0qj67_484271_c1 3300050509 Bacteria 995
1054 Ga0495601_0011317 3300053077 Bacteria 5332
1055 Ga0500572_034944 3300053111 Bacteria 1427
1056 Ga0500594_0114301 3300053118 Bacteria 842
1057 Ga0500595_022717 3300053119 Bacteria 2214
1058 Ga0500618_000653 3300053125 Bacteria 20633
1059 Ga0500618_062749 3300053125 Bacteria 835
1060 Ga0500618_071845 3300053125 Bacteria 776
1061 Ga0500574_000047 3300053141 Bacteria 14143
1062 Ga0500586_000912 3300053145 Bacteria 6084
1063 Ga0500619_003631 3300053154 Bacteria 3193
1064 Ga0500622_0204456 3300053156 Bacteria 896
1065 Ga0500636_0000203 3300053177 Bacteria 32197
1066 Ga0500637_0148477 3300053178 Bacteria 1355
1067 Ga0500625_005119 3300053729 Bacteria 5443
1068 Ga0587082_018912 3300059504 Bacteria 1101
1069 Ga0587083_0076817 3300059505 Bacteria 787
1070 Ga0587106_019270 3300059605 Bacteria 994
1071 Ga0587068_008109 3300059641 Bacteria 1514
1072 Ga0466962_0000755 3300061719 Bacteria 14519
1073 Ga0466962_0015221 3300061719 Bacteria 3709
1074 Ga0466962_0085214 3300061719 Bacteria 1512
1075 2511250316 2511231003 Bacteria 5606035
1076 2511387578 2511231026 Bacteria 5225445
1077 2521559828 2521172590 Bacteria 5047645
1078 2550693195 2548876994 Bacteria 4904866
1079 2553007038 2551306416 Bacteria 6152985
1080 2585294009 2582581311 Bacteria 6763856
1081 2601672277 2600255292 Bacteria 6300551
1082 2643791754 2643221554 Bacteria 6603920
1083 2643796623 2643221556 Bacteria 7251154
1084 2644027059 2643221603 Bacteria 6147767
1085 2644216767 2643221638 Bacteria 6579467
1086 2644254523 2643221645 Bacteria 7207331
1087 2644360070 2643221664 Bacteria 7272945
1088 2644472745 2643221684 Bacteria 7145183
1089 2735816544 2734482258 Unclassified 2930739
1090 2738742905 2738541280 Bacteria 6630198
1091 2738827056 2738541297 Bacteria 6549566
1092 2738845993 2738541300 Bacteria 6675882
1093 2739150853 2738541357 Bacteria 6549408
1094 2739192772 2738543003 Bacteria 6549560
1095 2739276901 2738543018 Bacteria 6718814
1096 2739319249 2738543026 Bacteria 6549408
1097 2739337490 2738543029 Bacteria 6549249
1098 2739345945 2738543030 Bacteria 6719714
1099 2765571084 2765235838 Bacteria 5445269
1100 2808984992 2808606386 Bacteria 4471946
1101 2809130124 2808606415 Bacteria 4576710
1102 2809145549 2808606418 Bacteria 6724496
1103 2809150399 2808606419 Bacteria 4576925
1104 2817259865 2816332253 Bacteria 6764532
1105 2817456660 2816332286 Bacteria 6853759
1106 2819544567 2818991436 Bacteria 5376622
1107 2819594069 2818991445 Bacteria 4955017
1108 2819618263 2818991449 Bacteria 5518009
1109 2821136476 2821131069 Bacteria 6108407
1110 2839096680 2839094727 Bacteria 5534556
1111 2842713691 2842711865 Bacteria 7155354
1112 2852621377 2852618963 Bacteria 4577824
1113 2857541724 2857537821 Bacteria 5248181
1114 2857549308 2857547612 Bacteria 6179999
1115 2857558525 2857553236 Bacteria 6166726
1116 2857562340 2857558681 Bacteria 6617694
1117 2857568293 2857564685 Bacteria 6290584
1118 2858953932 2858950400 Bacteria 6783797
1119 2884815180 2884811622 Bacteria 5552861
1120 2884839896 2884836552 Bacteria 5219991
1121 2884856293 2884852848 Bacteria 5221161
1122 2885081346 2885080285 Bacteria 6355622
1123 2891635436 2891633521 Bacteria 4602265
1124 2896158658 2896154374 Bacteria 5221518
1125 2904428566 2904424332 Bacteria 7633521
1126 2904444394 2904439833 Bacteria 5931679
1127 2904535547 2904530477 Bacteria 5876334
1128 2904588119 2904584206 Bacteria 6028872
1129 2904595155 2904589729 Bacteria 6113573
1130 2904606068 2904601388 Bacteria 5884906
1131 2919051306 2919046199 Bacteria 5567169
1132 2919084266 2919079590 Bacteria 5946433
1133 2919477225 2919476304 Bacteria 5888696
1134 2923513595 2923510766 Bacteria 5926163
1135 2928135288 2928130867 Bacteria 5467269
1136 2932416362 2932410948 Bacteria 6312192
1137 2932422245 2932416698 Bacteria 6315112
1138 639788486 639633007 Bacteria 4376040
1139 8020810836 8020807995 Bacteria 6801506
1140 8040172684 8040167225 Bacteria 6542727
1141 8040176359 8040173305 Bacteria 6827067
1142 8047675702 8047673197 Bacteria 7395230
1143 8055225935 8055225921 Bacteria 3341787
1144 Ga0466960_0570193
1145 JGI25155J39150_1000336
1146 JGI25155J39150_1000485
1147 JGI25156J39149_1000267
1148 JGI25156J39149_1013381
1149 JGI25154J39366_1000739
1150 JGI25154J39366_1001209
1151 JGI25154J39366_1002200
1152 JGI25158J39367_1003079
1153 JGI25157J39369_1000372
1154 JGI25157J39369_1000495
1155 JGI25164J39214_1003913
1156 JGI25150J39212_1000910
1157 JGI25150J39212_1003626
1158 JGI25159J45721_1002200
1159 JGI25159J45721_1005724
1160 JGI25165J46597_1000713
1161 JGI25153J46596_10018531
1162 JGI25160J50197_1003453
1163 JGI25161J50226_1006300
1164 Ga0007410J51695_1015624
1165 Ga0007410J51695_1044871
1166 Ga0007409J51694_1007308
1167 Ga0007409J51694_1023914
1168 Ga0007416J51690_1029024
1169 Ga0032354_1058597
1170 Ga0055538_1000062
1171 Ga0055538_1000281
1172 Ga0055539_1000093
1173 Ga0055539_1000305
1174 Ga0055533_1000105
1175 Ga0055533_1000286
1176 Ga0055532_1000034
1177 Ga0055525_1000018
1178 Ga0055525_1000137
1179 Ga0055525_1000405
1180 Ga0055526_1001033
1181 Ga0055526_1005708
1182 Ga0055537_1000580
1183 Ga0055537_1009165
1184 Ga0055524_1002755
1185 Ga0055524_1010041
1186 Ga0055534_1000283
1187 Ga0055528_1000495
1188 Ga0055530_10050684
1189 Ga0055541_1000063
1190 Ga0055541_1000198
1191 Ga0055543_1003826
1192 Ga0065165_1002857
1193 Ga0065165_1004075
1194 Ga0065714_10171696
1195 Ga0065715_10042333
1196 Ga0070658_10710717
1197 Ga0070670_100086718
1198 Ga0070682_100098361
1199 Ga0070682_100577228
1200 Ga0070660_100016657
1201 Ga0070660_100044451
1202 Ga0070661_100051855
1203 Ga0070659_100001752
1204 Ga0070659_100082019
1205 Ga0070659_100216063
1206 Ga0070662_100057197
1207 Ga0070662_100692878
1208 Ga0068867_100056392
1209 Ga0070706_100007456
1210 Ga0070707_100111118
1211 Ga0070699_100042824
1212 Ga0070679_100691385
1213 Ga0070697_100618561
1214 Ga0068855_100016570
1215 Ga0068855_100035272
1216 Ga0068855_101052987
1217 Ga0068855_101571899
1218 Ga0070664_100003553
1219 Ga0070664_100298359
1220 Ga0068857_100326958
1221 Ga0068854_100017165
1222 Ga0068856_100163375
1223 Ga0068852_100004237
1224 Ga0068852_100004430
1225 Ga0068863_100298029
1226 Ga0070717_10473844
1227 Ga0075366_10002981
1228 Ga0075428_100377519
1229 Ga0075430_100258757
1230 Ga0075431_100002888
1231 Ga0079104_1005592
1232 Ga0079104_1008552
1233 Ga0099826_10000010
1234 Ga0105244_10002041
1235 Ga0105244_10003441
1236 Ga0105244_10035827
1237 Ga0105244_10110311
1238 Ga0105244_10174679
1239 Ga0105250_10120377
1240 Ga0105240_10001608
1241 Ga0105240_10016336
1242 Ga0105240_10190542
1243 Ga0105241_10120376
1244 Ga0105242_10037198
1245 Ga0105242_10180899
1246 Ga0105237_10010944
1247 Ga0105238_10000763
1248 Ga0105239_10010387
1249 Ga0105239_10368622
1250 Ga0105239_10961472
1251 Ga0157373_10711950
1252 Ga0157371_10039633
1253 Ga0157370_11246340
1254 Ga0157369_10000804
1255 Ga0157369_10574078
1256 Ga0157374_10000924
1257 Ga0157374_11006092
1258 Ga0157378_10091922
1259 Ga0157378_11144502
1260 Ga0163162_10379875
1261 Ga0182008_10003605
1262 Ga0182008_10056599
1263 Ga0182006_1000033
1264 Ga0182006_1000080
1265 Ga0182006_1058779
1266 Ga0182007_10000042
1267 Ga0182007_10030574
1268 Ga0182005_1000016
1269 Ga0182005_1000024
1270 Ga0182005_1001434
1271 Ga0163161_10012023
1272 Ga0163161_10012229
1273 Ga0163161_10087249
1274 Ga0213872_10000430
1275 Ga0213872_10001856
1276 Ga0213872_10002336
1277 Ga0213872_10004434
1278 Ga0213872_10024411
1279 Ga0213872_10115807
1280 Ga0209435_100007
1281 Ga0209435_100176
1282 Ga0209436_100769
1283 Ga0209784_100010
1284 Ga0209784_100021
1285 Ga0209566_100008
1286 Ga0209566_100119
1287 Ga0209674_100019
1288 Ga0209674_100036
1289 Ga0209147_100017
1290 Ga0209563_100011
1291 Ga0209563_100021
1292 Ga0209563_100040
1293 Ga0207427_100759
1294 Ga0209437_100019
1295 Ga0209437_100332
1296 Ga0209437_105938
1297 Ga0209437_107841
1298 Ga0209258_101277
1299 Ga0207425_1000021
1300 Ga0207425_1000829
1301 Ga0209646_1000044
1302 Ga0209646_1000107
1303 Ga0209646_1000190
1304 Ga0209026_1000063
1305 Ga0209026_1005858
1306 Ga0209026_1012017
1307 Ga0209677_100011
1308 Ga0209677_100023
1309 Ga0209677_101699
1310 Ga0209148_1000237
1311 Ga0209759_1000048
1312 Ga0209759_1000198
1313 Ga0209129_1000020
1314 Ga0209233_1000025
1315 Ga0209565_1000055
1316 Ga0209565_1000677
1317 Ga0209565_1002957
1318 Ga0209565_1003264
1319 Ga0209455_1000070
1320 Ga0209455_1029838
1321 Ga0209673_1000040
1322 Ga0209673_1003338
1323 Ga0209130_1000169
1324 Ga0209130_1002260
1325 Ga0209675_1000052
1326 Ga0209675_1001299
1327 Ga0209025_1000473
1328 Ga0209025_1001876
1329 Ga0209564_1000027
1330 Ga0209564_1000047
1331 Ga0209564_1000063
1332 Ga0209564_1000271
1333 Ga0209564_1001666
1334 Ga0209564_1028858
1335 Ga0209758_1000288
1336 Ga0209758_1000436
1337 Ga0209050_1000050
1338 Ga0209256_1000054
1339 Ga0209256_1000100
1340 Ga0209256_1000754
1341 Ga0207426_1003112
1342 Ga0209051_1028245
1343 Ga0207656_10071281
1344 Ga0207655_1001651
1345 Ga0207655_1016701
1346 Ga0207655_1064734
1347 Ga0207705_10034051
1348 Ga0207684_10008262
1349 Ga0207654_10022625
1350 Ga0207695_10008939
1351 Ga0207695_10012318
1352 Ga0207695_10136114
1353 Ga0207671_10004652
1354 Ga0207671_10309446
1355 Ga0207657_10012688
1356 Ga0207657_10231476
1357 Ga0207657_10525715
1358 Ga0207649_10024118
1359 Ga0207649_10493530
1360 Ga0207652_10464901
1361 Ga0207694_10000343
1362 Ga0207694_10858659
1363 Ga0207650_10063319
1364 Ga0207690_10000951
1365 Ga0207690_10323880
1366 Ga0207690_10330334
1367 Ga0207686_10036176
1368 Ga0207709_10388720
1369 Ga0207679_10004406
1370 Ga0207667_10000912
1371 Ga0207667_10007366
1372 Ga0207667_10317294
1373 Ga0207667_10550318
1374 Ga0207640_10041316
1375 Ga0207639_10170095
1376 Ga0207678_10439887
1377 Ga0207702_10168886
1378 Ga0207641_10366349
1379 Ga0207648_10086029
1380 Ga0207674_10182190
1381 Ga0207674_10281988
1382 Ga0207698_10044764
1383 Ga0207698_10095163
1384 Ga0207698_10385474
1385 Ga0209281_1005374
1386 Ga0209282_1000009
1387 Ga0209974_10027183
1388 Ga0265336_10006403
1389 Ga0265336_10048575
1390 Ga0265338_10066959
1391 Ga0265324_10000002
1392 Ga0265324_10000616
1393 Ga0268256_1004381
1394 Ga0316177_1075487
1395 Ga0316178_1172473
1396 Ga0316180_1064742
1397 Ga0316181_1137224
1398 Ga0316182_1021746
1399 Ga0316182_1361262
1400 Ga0265332_10000030
1401 Ga0265332_10001445
1402 Ga0265328_10000016
1403 Ga0265325_10002841
1404 Ga0265325_10007848
1405 Ga0265331_10009812
1406 Ga0265331_10013920
1407 Ga0265331_10054133
1408 Ga0265331_10089997
1409 Ga0265331_10158693
1410 Ga0265327_10000528
1411 Ga0265327_10000674
1412 Ga0265327_10001509
1413 Ga0265327_10015618
1414 Ga0265327_10018721
1415 Ga0265327_10059966
1416 Ga0265327_10123875
1417 Ga0265327_10216212
1418 Ga0265316_10090702
1419 Ga0265316_10158523
1420 Ga0265316_10376779
1421 Ga0307509_10000076
1422 Ga0307408_100000432
1423 Ga0307408_100002407
1424 Ga0307408_100010617
1425 Ga0265313_10040874
1426 Ga0316575_10003832
1427 Ga0265314_10001144
1428 Ga0265314_10008929
1429 Ga0265314_10118654
1430 Ga0307405_10084076
1431 Ga0307405_10270046
1432 Ga0307413_10141496
1433 Ga0307518_10057653
1434 Ga0307412_10000169
1435 Ga0307416_100000975
1436 Ga0307416_100104940
1437 Ga0307414_10174903
1438 Ga0307414_10285519
1439 Ga0307411_10541983
1440 Ga0316583_10021200
1441 Ga0316583_10069475
1442 Ga0316582_0049684
1443 Ga0395899_0000521
1444 Ga0395899_0002474
1445 Ga0395899_0002806
1446 Ga0395899_0003830
1447 Ga0395899_0018674
1448 Ga0395899_0125972
1449 Ga0395899_0126723
1450 Ga0395900_0006506
1451 Ga0395900_0010081
1452 Ga0395900_0014022
1453 Ga0395900_0031672
1454 Ga0395900_0035466
1455 Ga0395900_0113125
1456 Ga0395900_0181240
1457 Ga0395900_0285610
1458 Ga0395900_0289530
1459 Ga0395900_0622000
1460 Ga0395898_0000559
1461 Ga0395898_0089880
1462 Ga0395898_0478763
1463 Ga0395898_0508579
1464 Ga0395898_0690689
1465 Ga0395898_0892151
1466 Ga0395905_0010442
1467 Ga0395905_0013127
1468 Ga0395905_0036632
1469 Ga0395905_0036694
1470 Ga0395905_0055914
1471 Ga0395905_0093364
1472 Ga0395901_0000328
1473 Ga0395901_0000824
1474 Ga0395901_0002710
1475 Ga0395901_0002897
1476 Ga0395901_0020765
1477 Ga0395901_0066242
1478 Ga0395901_0117619
1479 Ga0400483_005643
1480 Ga0400483_266454
1481 Ga0436361_0013073
1482 Ga0436361_0303014
1483 Ga0436361_0314274
1484 Ga0436361_0512442
1485 Ga0436361_0544664
1486 Ga0436361_0930389
1487 Ga0436361_1012850
1488 Ga0436361_1027676
1489 Ga0436361_1072133
1490 Ga0436361_1091442
1491 Ga0436361_1097952
1492 Ga0436361_1206124
1493 Ga0439436_0086795
1494 Ga0451837_0319601
1495 Ga0439448_0000161
1496 Ga0439449_0009520
1497 Ga0439450_017711
1498 Ga0439450_042434
1499 Ga0439450_053924
1500 Ga0450904_007543
1501 Ga0451577_0000002
1502 Ga0451577_0000345
1503 Ga0451577_0071284
1504 Ga0451577_0219478
1505 Ga0451577_0407278
1506 Ga0451577_0689600
1507 Ga0451577_0743976
1508 Ga0451577_0944695
1509 Ga0466969_0250847
1510 Ga0466972_0000420
1511 Ga0466972_0003973
1512 Ga0466972_0011040
1513 Ga0466977_0107028
1514 Ga0453683_0000013
1515 Ga0466965_0002121
1516 Ga0466965_0028860
1517 Ga0466965_0029552
1518 Ga0466965_0031596
1519 Ga0466965_0036795
1520 Ga0466965_0073626
1521 Ga0466966_0001854
1522 Ga0466966_0006887
1523 Ga0466966_0029262
1524 Ga0466966_0082568
1525 Ga0466961_0068851
1526 Ga0466964_0007888
1527 Ga0466964_0018884
1528 Ga0466964_0260780
1529 Ga0453684_0000002
1530 Ga0453684_0000040
1531 Ga0453684_0000065
1532 Ga0453684_0000694
1533 Ga0453684_0010268
1534 Ga0453684_0109392
1535 Ga0453684_1610308
1536 Ga0466971_0002015
1537 Ga0466971_0162361
1538 Ga0466968_0009040
1539 Ga0466968_0210388
1540 Ga0466957_0001920
1541 Ga0466957_0018243
1542 Ga0466957_0076144
1543 Ga0466960_0257561
1544 Ga0466959_0002185
1545 Ga0466959_0025858
1546 Ga0466959_0155315
1547 Ga0451576_0000006
1548 Ga0451576_0000037
1549 Ga0451576_0002868
1550 Ga0451576_0005999
1551 Ga0451576_0199277
1552 Ga0451576_0359886
1553 Ga0466958_0000123
1554 Ga0466967_0652134
1555 Ga0495617_000022
1556 Ga0495617_000075
1557 Ga0495617_001209
1558 Ga0495617_018396
1559 Ga0495617_101153
1560 Ga0495627_000011
1561 Ga0495627_000398
1562 Ga0495627_028660
1563 Ga0495627_030153
1564 Ga0495592_0002825
1565 Ga0495603_0219775
1566 Ga0495603_0333361
1567 Ga0495590_0000057
1568 Ga0495590_0000143
1569 Ga0495590_0003098
1570 Ga0495590_0005737
1571 Ga0495629_0020396
1572 Ga0495629_0041378
1573 Ga0495638_0001680
1574 Ga0495638_0005569
1575 Ga0495638_0029512
1576 Ga0495638_0142822
1577 Ga0495638_0279409
1578 Ga0495638_0294735
1579 Ga0495638_0350140
1580 Ga0495638_0469701
1581 Ga0495653_0000044
1582 Ga0495653_0003313
1583 Ga0495653_0028893
1584 Ga0495653_0030963
1585 Ga0495653_0062600
1586 Ga0495653_0142416
1587 Ga0495653_0220831
1588 Ga0495650_0000082
1589 Ga0495650_0000254
1590 Ga0495650_0001173
1591 Ga0495650_0001749
1592 Ga0495650_0003298
1593 Ga0495650_0005094
1594 Ga0495650_0012103
1595 Ga0495580_0291017
1596 Ga0495582_0027191
1597 Ga0495582_0317982
1598 Ga0495605_0000098
1599 Ga0495605_0000102
1600 Ga0495605_0000153
1601 Ga0495605_0002046
1602 Ga0495605_0020353
1603 Ga0495605_0037236
1604 Ga0495605_0051571
1605 Ga0495605_0118230
1606 Ga0495605_0119063
1607 Ga0495605_0127029
1608 Ga0495605_0176519
1609 Ga0495605_0185627
1610 Ga0495639_0099019
1611 Ga0495584_0000005
1612 Ga0495584_0000232
1613 Ga0495584_0000729
1614 Ga0495584_0002317
1615 Ga0495584_0008319
1616 Ga0495584_0009911
1617 Ga0495584_0016425
1618 Ga0495584_0050942
1619 Ga0495584_0072746
1620 Ga0495584_0142839
1621 Ga0495584_0263303
1622 Ga0495584_0480564
1623 Ga0495585_0000023
1624 Ga0495585_0000152
1625 Ga0495585_0000444
1626 Ga0495585_0004011
1627 Ga0495585_0022356
1628 Ga0495585_0036679
1629 Ga0495585_0063062
1630 Ga0495585_0065031
1631 Ga0495585_0081256
1632 Ga0495585_0086044
1633 Ga0495585_0093181
1634 Ga0495585_0110487
1635 Ga0495585_0120150
1636 Ga0495585_0124453
1637 Ga0495585_0127601
1638 Ga0495585_0130882
1639 Ga0495585_0198599
1640 Ga0495594_0014891
1641 Ga0495594_0067330
1642 Ga0495594_0068128
1643 Ga0495594_0111098
1644 Ga0495594_0203838
1645 Ga0495596_0000032
1646 Ga0495596_0001270
1647 Ga0495596_0004904
1648 Ga0495596_0019014
1649 Ga0495596_0019824
1650 Ga0495596_0064880
1651 Ga0495596_0104091
1652 Ga0495596_0140228
1653 Ga0495596_0215517
1654 Ga0495596_0219493
1655 Ga0495607_0018756
1656 Ga0495607_0021757
1657 Ga0495607_0034462
1658 Ga0495607_0053231
1659 Ga0495607_0071833
1660 Ga0495607_0075941
1661 Ga0495607_0082535
1662 Ga0495607_0094427
1663 Ga0495607_0142834
1664 Ga0495607_0156528
1665 Ga0495607_0170248
1666 Ga0495607_0201691
1667 Ga0495607_0304687
1668 Ga0495583_0000106
1669 Ga0495583_0000150
1670 Ga0495583_0000597
1671 Ga0495583_0001383
1672 Ga0495583_0001918
1673 Ga0495583_0002413
1674 Ga0495583_0016522
1675 Ga0495583_0019473
1676 Ga0495583_0032678
1677 Ga0495583_0055535
1678 Ga0495583_0153492
1679 Ga0495583_0208027
1680 Ga0495606_0000080
1681 Ga0495606_0000090
1682 Ga0495606_0000099
1683 Ga0495606_0000524
1684 Ga0495606_0001629
1685 Ga0495606_0002603
1686 Ga0495606_0002891
1687 Ga0495606_0003267
1688 Ga0495606_0086803
1689 Ga0495606_0156832
1690 Ga0495606_0167075
1691 Ga0495606_0167282
1692 Ga0495606_0177366
1693 Ga0495606_0273276
1694 Ga0495606_0287086
1695 Ga0495606_0360638
1696 Ga0495606_0482262
1697 Ga0495608_0026533
1698 Ga0495610_0000017
1699 Ga0495610_0000668
1700 Ga0495610_0051728
1701 Ga0495610_0056760
1702 Ga0495610_0094937
1703 Ga0495610_0149659
1704 Ga0495616_0000490
1705 Ga0495616_0002388
1706 Ga0495616_0004647
1707 Ga0495616_0006823
1708 Ga0495616_0016924
1709 Ga0495616_0018127
1710 Ga0495616_0018885
1711 Ga0495616_0027167
1712 Ga0495616_0029168
1713 Ga0495616_0052218
1714 Ga0495616_0140557
1715 Ga0495616_0166939
1716 Ga0495616_0209388
1717 Ga0495620_0025372
1718 Ga0495628_0000382
1719 Ga0495630_0290113
1720 Ga0495631_0001332
1721 Ga0495631_0001436
1722 Ga0495631_0017621
1723 Ga0495631_0021527
1724 Ga0495631_0089877
1725 Ga0495631_0108701
1726 Ga0495631_0132606
1727 Ga0495631_0178075
1728 Ga0495631_0256240
1729 Ga0495631_0264638
1730 Ga0495631_0348127
1731 Ga0495632_0000052
1732 Ga0495632_0000396
1733 Ga0495632_0001555
1734 Ga0495632_0003734
1735 Ga0495632_0012494
1736 Ga0495632_0077299
1737 Ga0495632_0229594
1738 Ga0495637_0000018
1739 Ga0495637_0000195
1740 Ga0495637_0025136
1741 Ga0495637_0157208
1742 Ga0495643_0000109
1743 Ga0495643_0000250
1744 Ga0495643_0000914
1745 Ga0495643_0001163
1746 Ga0495643_0014484
1747 Ga0495643_0020420
1748 Ga0495643_0074658
1749 Ga0495643_0167799
1750 Ga0495643_0169250
1751 Ga0495643_0173777
1752 Ga0495643_0288040
1753 Ga0495644_0001124
1754 Ga0495644_0003935
1755 Ga0495644_0012464
1756 Ga0495644_0033210
1757 Ga0495644_0036962
1758 Ga0495644_0049248
1759 Ga0495644_0105342
1760 Ga0495644_0131017
1761 Ga0495644_0138769
1762 Ga0495644_0161425
1763 Ga0495648_0001108
1764 Ga0495648_0001296
1765 Ga0495648_0001297
1766 Ga0495648_0001425
1767 Ga0495648_0003753
1768 Ga0495648_0012427
1769 Ga0495648_0015868
1770 Ga0495648_0030615
1771 Ga0495648_0049127
1772 Ga0495648_0081899
1773 Ga0495648_0103442
1774 Ga0495648_0120682
1775 Ga0495648_0124831
1776 Ga0495648_0169639
1777 Ga0495648_0221552
1778 Ga0495663_0018991
1779 Ga0495663_0027435
1780 Ga0495663_0080205
1781 Ga0495663_0097680
1782 Ga0495666_0006871
1783 Ga0495666_0007557
1784 Ga0495666_0089356
1785 Ga0495666_0136337
1786 Ga0495642_0000529
1787 Ga0495642_0003891
1788 Ga0495642_0004563
1789 Ga0495642_0022005
1790 Ga0495642_0049932
1791 Ga0495642_0055624
1792 Ga0495642_0091444
1793 Ga0495642_0095315
1794 Ga0495642_0097224
1795 Ga0495642_0128850
1796 Ga0495642_0135331
1797 Ga0495652_0195423
1798 Ga0495652_0225042
1799 Ga0495654_0000030
1800 Ga0495654_0018430
1801 Ga0495654_0021405
1802 Ga0495654_0154397
1803 Ga0495665_0001301
1804 Ga0495665_0034596
1805 Ga0495640_0244079
1806 Ga0495586_0003956
1807 Ga0495586_0348397
1808 Ga0495587_0106740
1809 Ga0495587_0212022
1810 Ga0495598_0015527
1811 Ga0495609_0000007
1812 Ga0495609_0001531
1813 Ga0495609_0002820
1814 Ga0495609_0005405
1815 Ga0495609_0006790
1816 Ga0495609_0053145
1817 Ga0495609_0087078
1818 Ga0495609_0090129
1819 Ga0495609_0094483
1820 Ga0495609_0112477
1821 Ga0495609_0167361
1822 Ga0495621_0167216
1823 Ga0495597_0001115
1824 Ga0495597_0001285
1825 Ga0495597_0001411
1826 Ga0495597_0002378
1827 Ga0495597_0004502
1828 Ga0495597_0018041
1829 Ga0495597_0018630
1830 Ga0495597_0059212
1831 Ga0495597_0176075
1832 Ga0495597_0217646
1833 Ga0495645_0068890
1834 Ga0495622_0000044
1835 Ga0495622_0002393
1836 Ga0495622_0004973
1837 Ga0495622_0031549
1838 Ga0495622_0031647
1839 Ga0495622_0185930
1840 Ga0495622_0271346
1841 Ga0495633_0000917
1842 Ga0495633_0003343
1843 Ga0495633_0006937
1844 Ga0495633_0008903
1845 Ga0495633_0018586
1846 Ga0495633_0023285
1847 Ga0495633_0059388
1848 Ga0495633_0097204
1849 Ga0495633_0195396
1850 Ga0495633_0237567
1851 Ga0495633_0349354
1852 Ga0495656_0052339
1853 Ga0495656_0090382
1854 Ga0495656_0176549
1855 Ga0495668_0000035
1856 Ga0495668_0000211
1857 Ga0495668_0000286
1858 Ga0495668_0000939
1859 Ga0495668_0001545
1860 Ga0495668_0004452
1861 Ga0495668_0007872
1862 Ga0495668_0066663
1863 Ga0495668_0069634
1864 Ga0495668_0110644
1865 Ga0495668_0111339
1866 Ga0495668_0124532
1867 Ga0495668_0157375
1868 Ga0495668_0251588
1869 Ga0495634_0029850
1870 Ga0495634_0185328
1871 Ga0495611_0001030
1872 Ga0495611_0003988
1873 Ga0495611_0006487
1874 Ga0495611_0012387
1875 Ga0495611_0019917
1876 Ga0495611_0024927
1877 Ga0495611_0030738
1878 Ga0495611_0058343
1879 Ga0495611_0184440
1880 Ga0495611_0245871
1881 Ga0495625_0000338
1882 Ga0495625_0001765
1883 Ga0495625_0016076
1884 Ga0495625_0032153
1885 Ga0495625_0032657
1886 Ga0495625_0159609
1887 Ga0495625_0229305
1888 Ga0495625_0244011
1889 Ga0495625_0464422
1890 Ga0495635_0008609
1891 Ga0495635_0117569
1892 Ga0495659_0000139
1893 Ga0495659_0006513
1894 Ga0495659_0012720
1895 Ga0495659_0021812
1896 Ga0495661_0000074
1897 Ga0495661_0014026
1898 Ga0495661_0024464
1899 Ga0495661_0024989
1900 Ga0495661_0050895
1901 Ga0495661_0056989
1902 Ga0495661_0081170
1903 Ga0495661_0090282
1904 Ga0495661_0095657
1905 Ga0495661_0097206
1906 Ga0495661_0170266
1907 Ga0495661_0170462
1908 Ga0495661_0178616
1909 Ga0495661_0194602
1910 Ga0495661_0218634
1911 Ga0495661_0276444
1912 Ga0495661_0465967
1913 Ga0495588_0000451
1914 Ga0495588_0012930
1915 Ga0495588_0037807
1916 Ga0495588_0056552
1917 Ga0495588_0124955
1918 Ga0495588_0136992
1919 Ga0495588_0183519
1920 Ga0495588_0209771
1921 Ga0495599_0009879
1922 Ga0495599_0302397
1923 Ga0495623_0010353
1924 Ga0495623_0089894
1925 Ga0495623_0186117
1926 Ga0495623_0264807
1927 Ga0495646_0315081
1928 Ga0495669_0000101
1929 Ga0495669_0000495
1930 Ga0495669_0001145
1931 Ga0495669_0081917
1932 Ga0495669_0093504
1933 Ga0495669_0174437
1934 Ga0495613_0026824
1935 Ga0495613_0392189
1936 Ga0495624_0004359
1937 Ga0495624_0020490
1938 Ga0495624_0124437
1939 Ga0495670_0000859
1940 Ga0495670_0013263
1941 Ga0495670_0044778
1942 Ga0495670_0087076
1943 Ga0495670_0155332
1944 Ga0495670_0158563
1945 Ga0495670_0238538
1946 Ga0495671_0000087
1947 Ga0495671_0000605
1948 Ga0495671_0003550
1949 Ga0495671_0212145
1950 Ga0495671_0219143
1951 Ga0495671_0249224
1952 Ga0495649_0000194
1953 Ga0495649_0008705
1954 Ga0495649_0016852
1955 Ga0495649_0082460
1956 Ga0495649_0148011
1957 Ga0495649_0183663
1958 Ga0495649_0243124
1959 Ga0495649_0280284
1960 Ga0495649_0331277
1961 Ga0495649_0408167
1962 Ga0495589_0000086
1963 Ga0495589_0000132
1964 Ga0495589_0018768
1965 Ga0495589_0051939
1966 Ga0495589_0075941
1967 Ga0495589_0081465
1968 Ga0495589_0106770
1969 Ga0495589_0139767
1970 Ga0495589_0182429
1971 Ga0495589_0253560
1972 Ga0495600_0002033
1973 Ga0495600_0161897
1974 Ga0495600_0388825
1975 Ga0495660_0001930
1976 Ga0495660_0003563
1977 Ga0495660_0007681
1978 Ga0495660_0028271
1979 Ga0495660_0097121
1980 Ga0495660_0102255
1981 Ga0495660_0204625
1982 Ga0495660_0207146
1983 Ga0495660_0216121
1984 Ga0495660_0216966
1985 Ga0495660_0232356
1986 Ga0495660_0262214
1987 Ga0495581_0197328
1988 Ga0495581_0387533
1989 Ga0495604_0032878
1990 Ga0495604_0053804
1991 Ga0495604_0108518
1992 Ga0495636_0003424
1993 Ga0495636_0004254
1994 Ga0495636_0011954
1995 Ga0495636_0093780
1996 Ga0495636_0182706
1997 Ga0495674_0011663
1998 Ga0495672_0000013
1999 Ga0495672_0000278
2000 Ga0495672_0000512
2001 Ga0495672_0001189
2002 Ga0495672_0033064
2003 Ga0495672_0110608
2004 Ga0495672_0149142
2005 Ga0495672_0192288
2006 Ga0495672_0270825
2007 Ga0495676_0000015
2008 Ga0495676_0068178
2009 Ga0495676_0478428
2010 Ga0495680_0663530
2011 Ga0495683_0000036
2012 Ga0495683_0005881
2013 Ga0495683_0006168
2014 Ga0495683_0015050
2015 Ga0495683_0043476
2016 Ga0495683_0069970
2017 Ga0495683_0085180
2018 Ga0495683_0118925
2019 Ga0495683_0287733
2020 Ga0495687_000038
2021 Ga0495687_000057
2022 Ga0495687_000165
2023 Ga0495687_001055
2024 Ga0495687_001122
2025 Ga0495687_001809
2026 Ga0495687_007401
2027 Ga0495687_070205
2028 Ga0495675_0296286
2029 Ga0495677_0000004
2030 Ga0495677_0000948
2031 Ga0495677_0005204
2032 Ga0495677_0005995
2033 Ga0495677_0030645
2034 Ga0495677_0069528
2035 Ga0495677_0074959
2036 Ga0495677_0086085
2037 Ga0495677_0149704
2038 Ga0495677_0170223
2039 Ga0495677_0178619
2040 Ga0495679_001332
2041 Ga0495679_063648
2042 Ga0495685_000299
2043 Ga0495685_021233
2044 Ga0495685_023768
2045 Ga0495685_039572
2046 Ga0495685_082816
2047 Ga0495673_0000069
2048 Ga0495673_0000203
2049 Ga0495673_0000236
2050 Ga0495673_0046695
2051 Ga0495673_0185264
2052 Ga0495681_0001009
2053 Ga0495681_0015607
2054 Ga0495681_0051862
2055 Ga0495681_0074195
2056 Ga0495681_0076968
2057 Ga0495681_0120190
2058 Ga0495686_0000620
2059 Ga0495686_0001028
2060 Ga0495686_0006069
2061 Ga0495686_0048133
2062 Ga0495686_0053203
2063 Ga0495686_0132978
2064 Ga0495686_0264985
2065 Ga0495593_0041261
2066 Ga0495602_0123252
2067 Ga0495602_0124621
2068 Ga0495602_0236664
2069 Ga0495614_0037921
2070 Ga0495614_0106892
2071 Ga0495615_0004412
2072 Ga0495615_0108744
2073 Ga0495615_0130685
2074 Ga0495626_0000048
2075 Ga0495626_0000279
2076 Ga0495626_0000998
2077 Ga0495626_0001757
2078 Ga0495626_0002805
2079 Ga0495626_0005031
2080 Ga0495626_0010181
2081 Ga0495626_0021084
2082 Ga0495626_0049285
2083 Ga0495626_0052127
2084 Ga0495626_0057384
2085 Ga0495626_0065425
2086 Ga0495626_0111765
2087 Ga0495626_0156595
2088 Ga0495626_0173292
2089 Ga0495626_0180387
2090 Ga0495626_0192718
2091 Ga0495626_0223047
2092 Ga0496100_0037867
2093 Ga0496100_0154562
2094 Ga0496101_0070873
2095 Ga0496101_0088835
2096 Ga0496101_0344823
2097 Ga0496102_0000478
2098 Ga0496102_0008640
2099 Ga0496102_0017344
2100 Ga0496102_0060082
2101 Ga0496102_0215355
2102 Ga0496102_0844309
2103 Ga0496103_0039346
2104 Ga0496103_0066485
2105 Ga0496103_0146237
2106 Ga0496104_0443679
2107 Ga0496105_0674294
2108 Ga0496106_0335160
2109 Ga0496106_0830783
2110 Ga0496107_0131596
2111 Ga0496107_0227084
2112 Ga0496109_0233913
2113 Ga0496110_0000092
2114 Ga0496110_0223501
2115 Ga0496111_0104260
2116 Ga0496113_0097164
2117 Ga0496113_1025587
2118 Ga0496114_0117903
2119 Ga0496115_0186034
2120 Ga0496115_0530364
2121 Ga0496115_0702750
2122 Ga0496115_0713328
2123 Ga0496116_0010336
2124 Ga0496116_0044055
2125 Ga0496116_0201000
2126 Ga0496117_0000005
2127 Ga0496118_0000031
2128 Ga0496121_0002018
2129 Ga0496121_0057712
2130 Ga0496121_0236502
2131 Ga0496121_0333285
2132 Ga0496121_0439019
2133 Ga0496122_0003525
2134 Ga0496122_0020064
2135 Ga0496122_0042085
2136 Ga0496123_0000084
2137 Ga0496123_0001425
2138 Ga0496123_0003683
2139 Ga0496123_0004216
2140 Ga0496124_0010436
2141 Ga0496124_0134060
2142 Ga0496124_0233802
2143 Ga0496124_0258140
2144 Ga0496124_0468886
2145 Ga0496124_0521428
2146 Ga0496125_0000368
2147 Ga0496125_0089020
2148 Ga0496125_0204119
2149 Ga0496126_0027941
2150 Ga0496126_0114487
2151 Ga0496126_0287297
2152 Ga0495678_000010
2153 Ga0495678_000034
2154 Ga0495678_000095
2155 Ga0495678_000383
2156 Ga0495678_001376
2157 Ga0495678_001441
2158 Ga0495678_009739
2159 Ga0495678_056982
2160 Ga0495678_083062
2161 Ga0495682_0000089
2162 Ga0495682_0000432
2163 Ga0495682_0022370
2164 Ga0495682_0058762
2165 Ga0495682_0078158
2166 Ga0495682_0084149
2167 Ga0495682_0093822
2168 Ga0495682_0208689
2169 Ga0501295_001090
2170 Ga0501315_008783
2171 Ga0501316_007461
2172 Ga0501323_018249
2173 Ga0501034_0000134
2174 Ga0501034_1031688
2175 Ga0501075_0111296
2176 Ga0501202_066870
2177 Ga0501211_003557
2178 Ga0501211_012123
2179 Ga0501216_079505
2180 Ga0501227_184370
2181 Ga0501230_014418
2182 Ga0501238_001560
2183 Ga0501240_041629
2184 Ga0501249_036722
2185 Ga0501081_0134001
2186 Ga0501083_0049975
2187 Ga0501269_000473
2188 Ga0501269_038157
2189 Ga0501280_000153
2190 Ga0501283_049195
2191 Ga0501035_0006010
2192 Ga0501044_0252781
2193 Ga0501045_0552537
2194 nmdc:mga0k408_2236_c1
2195 nmdc:mga0qj67_246743_c1
2196 nmdc:mga0qj67_484271_c1
2197 Ga0495601_0011317
2198 Ga0500572_034944
2199 Ga0500594_0114301
2200 Ga0500595_022717
2201 Ga0500618_000653
2202 Ga0500618_062749
2203 Ga0500618_071845
2204 Ga0500574_000047
2205 Ga0500586_000912
2206 Ga0500619_003631
2207 Ga0500622_0204456
2208 Ga0500636_0000203
2209 Ga0500637_0148477
2210 Ga0500625_005119
2211 Ga0587082_018912
2212 Ga0587083_0076817
2213 Ga0587106_019270
2214 Ga0587068_008109
2215 Ga0466962_0000755
2216 Ga0466962_0015221
2217 Ga0466962_0085214
2218 2511250316
2219 2511387578
2220 2521559828
2221 2550693195
2222 2553007038
2223 2585294009
2224 2601672277
2225 2643791754
2226 2643796623
2227 2644027059
2228 2644216767
2229 2644254523
2230 2644360070
2231 2644472745
2232 2735816544
2233 2738742905
2234 2738827056
2235 2738845993
2236 2739150853
2237 2739192772
2238 2739276901
2239 2739319249
2240 2739337490
2241 2739345945
2242 2765571084
2243 2808984992
2244 2809130124
2245 2809145549
2246 2809150399
2247 2817259865
2248 2817456660
2249 2819544567
2250 2819594069
2251 2819618263
2252 2821136476
2253 2839096680
2254 2842713691
2255 2852621377
2256 2857541724
2257 2857549308
2258 2857558525
2259 2857562340
2260 2857568293
2261 2858953932
2262 2884815180
2263 2884839896
2264 2884856293
2265 2885081346
2266 2891635436
2267 2896158658
2268 2904428566
2269 2904444394
2270 2904535547
2271 2904588119
2272 2904595155
2273 2904606068
2274 2919051306
2275 2919084266
2276 2919477225
2277 2923513595
2278 2928135288
2279 2932416362
2280 2932422245
2281 639788486
2282 8020810836
2283 8040172684
2284 8040176359
2285 8047675702
2286 8055225935

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

22

206

0.96

PF07722

Peptidase_C26

Peptidase C26

69

189

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9641 2 186
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9477 2 184
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9466 2 185
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9454 2 184
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9417 1 185
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9981 1 185 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9852 2 185 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9822 1 185 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9797 1 186 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9693 2 186 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A5C7X5A9-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 1 1 185 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2N2T822-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 1 1 169 GO:0000162
GO:0004049
GO:0005829
AF-A0A516WDN0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 1 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A231HJD2-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 1 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A259CX94-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II 0.9996 1 185 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Map