F490751
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1144 | 635 | 927 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10047903|Ga0081455_100479032 |
| Length | 264 |
| Sequence | LTALRRCTNVLVHLWQALPAHTGIRMDQPVIAQRRVAPRSGGRLDRDRQAAPQVFERLRGMIIALELPPGSPLSRAALAEQFGVSSTPIRDALMRLEEEGLVEVFPQYATVVSRIDVHRAQQAHFLRQALELEIVRVLALKPDEALVTELNATIARQLQFAKAGAFEKFMAADNEFHAKLYEAADKQDIWTLVKSRSGHIDRLRRLHLPSPGKAQDIVRHHKLITKAIAGGEPEEAQKHLRTHLSGTLSELAKIRAQHPQYLND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 12 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 18 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 19 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 20 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 21 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 22 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 23 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 24 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 25 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 26 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 27 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 28 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 29 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 32 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 36 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 37 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 38 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 39 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 40 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 41 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 42 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 43 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 44 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 50 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 51 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 52 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 53 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 54 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 55 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 56 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 57 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 58 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 59 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 60 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 61 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 62 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 63 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 64 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 65 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 66 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 67 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 68 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 69 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 70 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 71 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 72 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 73 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 74 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 75 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 76 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 77 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 78 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 79 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 80 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 81 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 82 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 83 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 84 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 85 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 86 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 87 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 88 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 89 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 90 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 91 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 92 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 93 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 94 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 95 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 96 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 97 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 98 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 99 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 100 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 101 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 102 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 103 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 104 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 105 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 106 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 107 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 108 | 2922368715 | |||
| 109 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 110 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 111 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 112 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 113 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 114 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 115 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 116 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 117 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 118 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 119 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 120 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 121 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 122 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 123 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 124 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 125 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 126 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 127 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 128 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 129 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 130 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 131 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 132 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 133 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 134 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 135 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 136 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 137 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 138 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 139 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 140 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 141 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 142 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 143 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 144 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 145 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 146 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 147 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 148 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 149 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 150 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 151 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 152 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 153 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 154 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 155 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 156 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 157 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 158 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 159 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 160 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 161 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 162 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 163 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 164 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 165 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 166 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 167 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 168 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 169 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 170 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 171 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 172 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 173 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 174 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 175 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 176 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 177 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 178 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 179 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 180 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 181 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 182 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 183 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 184 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 185 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 186 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 187 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 189 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 191 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 194 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 195 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 197 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 198 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 213 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 214 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 218 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 220 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 223 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 225 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 226 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 227 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 229 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 230 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 231 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 232 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 233 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 234 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 235 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 236 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 237 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 238 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 239 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 240 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 241 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 242 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 243 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 244 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 245 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 246 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 247 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 248 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 249 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 251 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 252 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 253 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 254 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 255 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 257 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 271 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 272 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 273 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 274 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 292 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 293 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 294 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 296 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 298 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 304 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 359 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 360 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 361 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 365 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 366 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 367 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 368 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 369 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 370 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 371 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 372 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 373 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 374 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 375 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 376 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 377 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 378 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 379 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 380 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 381 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 382 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 383 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 384 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 385 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 386 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 387 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 388 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 389 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 390 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 391 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 392 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 393 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 394 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 395 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 396 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 397 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 398 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 399 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 400 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 401 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 402 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 403 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 404 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 405 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 406 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 407 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 408 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 409 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 410 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 411 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 412 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 413 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 414 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 415 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 416 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 417 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 495 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 496 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 497 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 498 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 499 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 500 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 501 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 502 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 503 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 504 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 505 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 506 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 507 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 508 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 509 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 510 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 511 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 512 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 513 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 514 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 515 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 516 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 517 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 518 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 519 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 520 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 521 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 529 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 530 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 533 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 535 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 536 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 537 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 539 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 540 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 541 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 547 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 550 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 553 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 554 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 555 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 556 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 557 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 558 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 559 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 560 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 561 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 562 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 564 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 565 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 566 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 567 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 568 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 569 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 570 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 571 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 572 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 574 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 575 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 576 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 577 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 578 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 579 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 580 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 581 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 582 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 583 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 584 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 585 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 586 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 587 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 588 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 589 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 590 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 591 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 592 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 593 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 594 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 595 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 596 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 597 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 598 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 599 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 600 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 601 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 602 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 603 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 604 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 605 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 606 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 607 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 608 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 609 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 610 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 611 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 612 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 613 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 614 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 615 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 616 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 617 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 618 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 619 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 620 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 621 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 622 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 623 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 624 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 625 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 626 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 627 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 628 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 629 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 630 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 631 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 632 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 633 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 634 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 635 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81 |
| Metatranscriptomes | 0.18 |
| Isolates | 18.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.51 |
| Nodule | 16.35 |
| Rhizoplane | 4.55 |
| Rhizosphere | 54.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10041752 | 3300002067 | Bacteria | 1336 |
| 2 | JGI25152J39213_1001108 | 3300002773 | Bacteria | 12593 |
| 3 | JGI25151J46595_10000451 | 3300003187 | Bacteria | 39770 |
| 4 | JGI25151J46595_10012763 | 3300003187 | Bacteria | 3808 |
| 5 | JGI25165J46597_1012936 | 3300003214 | Bacteria | 1158 |
| 6 | JGI25153J46596_10001849 | 3300003215 | Bacteria | 12551 |
| 7 | JGI25153J46596_10003596 | 3300003215 | Bacteria | 8611 |
| 8 | JGI25153J46596_10003675 | 3300003215 | Bacteria | 8492 |
| 9 | JGI25153J46596_10007159 | 3300003215 | Bacteria | 5534 |
| 10 | JGI25153J46596_10012613 | 3300003215 | Bacteria | 3629 |
| 11 | rootH1_10084142 | 3300003316 | Bacteria | 1774 |
| 12 | rootL2_10239686 | 3300003322 | Bacteria | 1200 |
| 13 | rootH1_10058417 | 3300003323 | Bacteria | 1887 |
| 14 | JGI25160J50197_1003782 | 3300003354 | Bacteria | 6662 |
| 15 | JGI25160J50197_1005043 | 3300003354 | Bacteria | 5580 |
| 16 | JGI25160J50197_1025211 | 3300003354 | Bacteria | 1669 |
| 17 | JGI25404J52841_10024642 | 3300003659 | Bacteria | 1296 |
| 18 | Ga0055539_1003001 | 3300003752 | Bacteria | 2434 |
| 19 | Ga0055531_10005144 | 3300003794 | Bacteria | 7716 |
| 20 | Ga0055543_1001103 | 3300004625 | Bacteria | 11670 |
| 21 | Ga0065165_1001646 | 3300005262 | Bacteria | 22707 |
| 22 | Ga0065165_1003743 | 3300005262 | Bacteria | 10239 |
| 23 | Ga0065165_1022241 | 3300005262 | Bacteria | 2180 |
| 24 | Ga0070658_10064511 | 3300005327 | Bacteria | 2987 |
| 25 | Ga0070658_10110967 | 3300005327 | Bacteria | 2272 |
| 26 | Ga0070658_10243097 | 3300005327 | Bacteria | 1526 |
| 27 | Ga0070690_100090747 | 3300005330 | Bacteria | 2012 |
| 28 | Ga0070670_100182032 | 3300005331 | Bacteria | 1825 |
| 29 | Ga0070670_100403626 | 3300005331 | Bacteria | 1207 |
| 30 | Ga0068869_100018682 | 3300005334 | Bacteria | 4723 |
| 31 | Ga0068869_100229158 | 3300005334 | Bacteria | 1475 |
| 32 | Ga0070666_10198145 | 3300005335 | Bacteria | 1412 |
| 33 | Ga0070680_100005214 | 3300005336 | Bacteria | 9831 |
| 34 | Ga0070680_100011561 | 3300005336 | Bacteria | 6834 |
| 35 | Ga0070680_100471625 | 3300005336 | Bacteria | 1073 |
| 36 | Ga0070682_100024236 | 3300005337 | Bacteria | 3609 |
| 37 | Ga0070682_100074067 | 3300005337 | Bacteria | 2186 |
| 38 | Ga0070682_100278192 | 3300005337 | Bacteria | 1219 |
| 39 | Ga0070682_100349336 | 3300005337 | Bacteria | 1102 |
| 40 | Ga0068868_100004833 | 3300005338 | Bacteria | 9459 |
| 41 | Ga0068868_100086679 | 3300005338 | Bacteria | 2517 |
| 42 | Ga0068868_100529731 | 3300005338 | Bacteria | 1035 |
| 43 | Ga0070660_100014405 | 3300005339 | Bacteria | 5694 |
| 44 | Ga0070660_100021819 | 3300005339 | Bacteria | 4727 |
| 45 | Ga0070660_100034372 | 3300005339 | Bacteria | 3830 |
| 46 | Ga0070660_100068342 | 3300005339 | Bacteria | 2769 |
| 47 | Ga0070660_100193274 | 3300005339 | Bacteria | 1649 |
| 48 | Ga0070660_100399953 | 3300005339 | Bacteria | 1136 |
| 49 | Ga0070689_100238269 | 3300005340 | Bacteria | 1498 |
| 50 | Ga0070687_100157363 | 3300005343 | Bacteria | 1340 |
| 51 | Ga0070661_100002881 | 3300005344 | Bacteria | 11836 |
| 52 | Ga0070661_100122108 | 3300005344 | Bacteria | 1952 |
| 53 | Ga0070668_100013201 | 3300005347 | Bacteria | 6160 |
| 54 | Ga0070668_100015674 | 3300005347 | Bacteria | 5668 |
| 55 | Ga0070668_100025268 | 3300005347 | Bacteria | 4502 |
| 56 | Ga0070668_100066527 | 3300005347 | Bacteria | 2797 |
| 57 | Ga0070668_100547921 | 3300005347 | Bacteria | 1006 |
| 58 | Ga0070675_100259455 | 3300005354 | Bacteria | 1522 |
| 59 | Ga0070675_100311874 | 3300005354 | Bacteria | 1388 |
| 60 | Ga0070675_100697504 | 3300005354 | Bacteria | 924 |
| 61 | Ga0070671_100015188 | 3300005355 | Bacteria | 6220 |
| 62 | Ga0070671_100063445 | 3300005355 | Bacteria | 3077 |
| 63 | Ga0070671_100171645 | 3300005355 | Bacteria | 1834 |
| 64 | Ga0070674_100199625 | 3300005356 | Bacteria | 1544 |
| 65 | Ga0070673_100125190 | 3300005364 | Bacteria | 2149 |
| 66 | Ga0070673_100213175 | 3300005364 | Bacteria | 1669 |
| 67 | Ga0070659_100050519 | 3300005366 | Bacteria | 3269 |
| 68 | Ga0070667_100149367 | 3300005367 | Bacteria | 2052 |
| 69 | Ga0070667_100200492 | 3300005367 | Bacteria | 1771 |
| 70 | Ga0070714_100231515 | 3300005435 | Bacteria | 1702 |
| 71 | Ga0070701_10143799 | 3300005438 | Bacteria | 1367 |
| 72 | Ga0070700_100070726 | 3300005441 | Bacteria | 2226 |
| 73 | Ga0070700_100223878 | 3300005441 | Bacteria | 1335 |
| 74 | Ga0070663_100000598 | 3300005455 | Bacteria | 19225 |
| 75 | Ga0070663_100017095 | 3300005455 | Bacteria | 4726 |
| 76 | Ga0070663_100019221 | 3300005455 | Bacteria | 4497 |
| 77 | Ga0070663_100083818 | 3300005455 | Bacteria | 2348 |
| 78 | Ga0070678_100024855 | 3300005456 | Bacteria | 4018 |
| 79 | Ga0070678_100078094 | 3300005456 | Bacteria | 2500 |
| 80 | Ga0070678_100134028 | 3300005456 | Bacteria | 1973 |
| 81 | Ga0070678_100142321 | 3300005456 | Bacteria | 1921 |
| 82 | Ga0070678_100158056 | 3300005456 | Bacteria | 1833 |
| 83 | Ga0070678_100278143 | 3300005456 | Bacteria | 1414 |
| 84 | Ga0070662_100007191 | 3300005457 | Bacteria | 7210 |
| 85 | Ga0070662_100015533 | 3300005457 | Bacteria | 5103 |
| 86 | Ga0070662_100073350 | 3300005457 | Bacteria | 2528 |
| 87 | Ga0070681_10104996 | 3300005458 | Bacteria | 2767 |
| 88 | Ga0070681_10139645 | 3300005458 | Bacteria | 2353 |
| 89 | Ga0070681_10141265 | 3300005458 | Bacteria | 2338 |
| 90 | Ga0068867_100164012 | 3300005459 | Bacteria | 1754 |
| 91 | Ga0068867_100387304 | 3300005459 | Bacteria | 1176 |
| 92 | Ga0070706_100159540 | 3300005467 | Bacteria | 2106 |
| 93 | Ga0070679_100240604 | 3300005530 | Bacteria | 1767 |
| 94 | Ga0070679_100262422 | 3300005530 | Bacteria | 1682 |
| 95 | Ga0070679_100354758 | 3300005530 | Bacteria | 1414 |
| 96 | Ga0070684_100122197 | 3300005535 | Bacteria | 2343 |
| 97 | Ga0070684_100408283 | 3300005535 | Bacteria | 1253 |
| 98 | Ga0070684_100588559 | 3300005535 | Bacteria | 1034 |
| 99 | Ga0068853_100051162 | 3300005539 | Bacteria | 3555 |
| 100 | Ga0068853_100068809 | 3300005539 | Bacteria | 3078 |
| 101 | Ga0068853_100175878 | 3300005539 | Bacteria | 1939 |
| 102 | Ga0068853_100201553 | 3300005539 | Bacteria | 1811 |
| 103 | Ga0068853_100257283 | 3300005539 | Bacteria | 1604 |
| 104 | Ga0070672_100104298 | 3300005543 | Bacteria | 2304 |
| 105 | Ga0070672_100127479 | 3300005543 | Bacteria | 2089 |
| 106 | Ga0070686_100042506 | 3300005544 | Bacteria | 2847 |
| 107 | Ga0070693_100040702 | 3300005547 | Bacteria | 2610 |
| 108 | Ga0070665_100010827 | 3300005548 | Bacteria | 9225 |
| 109 | Ga0070665_100015557 | 3300005548 | Bacteria | 7642 |
| 110 | Ga0070665_100015812 | 3300005548 | Bacteria | 7578 |
| 111 | Ga0070665_100123562 | 3300005548 | Bacteria | 2590 |
| 112 | Ga0070665_100134738 | 3300005548 | Bacteria | 2472 |
| 113 | Ga0070665_100368750 | 3300005548 | Bacteria | 1443 |
| 114 | Ga0070665_100370198 | 3300005548 | Bacteria | 1439 |
| 115 | Ga0070665_100370216 | 3300005548 | Bacteria | 1439 |
| 116 | Ga0068855_100019755 | 3300005563 | Bacteria | 8090 |
| 117 | Ga0068855_100110183 | 3300005563 | Bacteria | 3161 |
| 118 | Ga0068855_100134239 | 3300005563 | Bacteria | 2824 |
| 119 | Ga0068855_100355831 | 3300005563 | Bacteria | 1612 |
| 120 | Ga0068855_100454851 | 3300005563 | Bacteria | 1396 |
| 121 | Ga0068855_100565992 | 3300005563 | Bacteria | 1229 |
| 122 | Ga0070664_100003791 | 3300005564 | Bacteria | 12197 |
| 123 | Ga0070664_100082048 | 3300005564 | Bacteria | 2780 |
| 124 | Ga0070664_100089380 | 3300005564 | Bacteria | 2665 |
| 125 | Ga0068857_100085354 | 3300005577 | Bacteria | 2822 |
| 126 | Ga0068854_100805751 | 3300005578 | Bacteria | 819 |
| 127 | Ga0068856_100002355 | 3300005614 | Bacteria | 19438 |
| 128 | Ga0068856_100083923 | 3300005614 | Bacteria | 3164 |
| 129 | Ga0068856_100368275 | 3300005614 | Bacteria | 1456 |
| 130 | Ga0068856_100649046 | 3300005614 | Bacteria | 1076 |
| 131 | Ga0070702_100249769 | 3300005615 | Bacteria | 1202 |
| 132 | Ga0070702_100281751 | 3300005615 | Bacteria | 1142 |
| 133 | Ga0068852_100008549 | 3300005616 | Bacteria | 7551 |
| 134 | Ga0068852_100018956 | 3300005616 | Bacteria | 5435 |
| 135 | Ga0068852_100082923 | 3300005616 | Bacteria | 2850 |
| 136 | Ga0068852_100229094 | 3300005616 | Bacteria | 1770 |
| 137 | Ga0068852_100280195 | 3300005616 | Bacteria | 1607 |
| 138 | Ga0068852_100360141 | 3300005616 | Bacteria | 1422 |
| 139 | Ga0068852_100579129 | 3300005616 | Bacteria | 1125 |
| 140 | Ga0068852_100714906 | 3300005616 | Bacteria | 1012 |
| 141 | Ga0068859_100016877 | 3300005617 | Bacteria | 7328 |
| 142 | Ga0068859_100166317 | 3300005617 | Bacteria | 2285 |
| 143 | Ga0068859_100584304 | 3300005617 | Bacteria | 1211 |
| 144 | Ga0068864_100027680 | 3300005618 | Bacteria | 4789 |
| 145 | Ga0068864_100821211 | 3300005618 | Bacteria | 915 |
| 146 | Ga0068861_100064658 | 3300005719 | Bacteria | 2815 |
| 147 | Ga0068861_100092252 | 3300005719 | Bacteria | 2392 |
| 148 | Ga0068861_100096747 | 3300005719 | Bacteria | 2340 |
| 149 | Ga0068851_10129435 | 3300005834 | Bacteria | 1364 |
| 150 | Ga0068851_10324908 | 3300005834 | Bacteria | 890 |
| 151 | Ga0068870_10139812 | 3300005840 | Bacteria | 1416 |
| 152 | Ga0068870_10175109 | 3300005840 | Bacteria | 1283 |
| 153 | Ga0068863_100086085 | 3300005841 | Bacteria | 2978 |
| 154 | Ga0068858_100151471 | 3300005842 | Bacteria | 2181 |
| 155 | Ga0068858_100153798 | 3300005842 | Bacteria | 2164 |
| 156 | Ga0068858_100365844 | 3300005842 | Bacteria | 1382 |
| 157 | Ga0068858_100404129 | 3300005842 | Bacteria | 1312 |
| 158 | Ga0068858_101072092 | 3300005842 | Bacteria | 791 |
| 159 | Ga0068860_100000577 | 3300005843 | Bacteria | 44036 |
| 160 | Ga0068860_100177029 | 3300005843 | Bacteria | 2061 |
| 161 | Ga0068860_100222173 | 3300005843 | Bacteria | 1834 |
| 162 | Ga0068860_100296370 | 3300005843 | Bacteria | 1583 |
| 163 | Ga0068860_100337864 | 3300005843 | Bacteria | 1480 |
| 164 | Ga0068862_100012465 | 3300005844 | Bacteria | 7035 |
| 165 | Ga0068862_100036297 | 3300005844 | Bacteria | 4178 |
| 166 | Ga0068862_100052418 | 3300005844 | Bacteria | 3490 |
| 167 | Ga0068862_100253887 | 3300005844 | Bacteria | 1603 |
| 168 | Ga0068862_100489020 | 3300005844 | Bacteria | 1166 |
| 169 | Ga0081455_10004895 | 3300005937 | Bacteria | 14842 |
| 170 | Ga0081455_10013363 | 3300005937 | Bacteria | 8121 |
| 171 | Ga0081455_10047903 | 3300005937 | Bacteria | 3697 |
| 172 | Ga0081455_10065600 | 3300005937 | Bacteria | 3036 |
| 173 | Ga0081540_1004561 | 3300005983 | Bacteria | 10498 |
| 174 | Ga0081540_1005048 | 3300005983 | Bacteria | 9905 |
| 175 | Ga0081540_1010591 | 3300005983 | Bacteria | 6230 |
| 176 | Ga0081540_1011487 | 3300005983 | Bacteria | 5917 |
| 177 | Ga0081540_1011797 | 3300005983 | Bacteria | 5809 |
| 178 | Ga0081540_1013781 | 3300005983 | Bacteria | 5235 |
| 179 | Ga0081540_1031452 | 3300005983 | Bacteria | 2917 |
| 180 | Ga0081540_1036693 | 3300005983 | Bacteria | 2609 |
| 181 | Ga0081540_1051966 | 3300005983 | Bacteria | 2022 |
| 182 | Ga0081539_10019046 | 3300005985 | Bacteria | 4722 |
| 183 | Ga0075365_10004812 | 3300006038 | Bacteria | 7201 |
| 184 | Ga0075365_10011993 | 3300006038 | Bacteria | 5122 |
| 185 | Ga0075365_10093839 | 3300006038 | Bacteria | 2048 |
| 186 | Ga0075365_10116414 | 3300006038 | Bacteria | 1841 |
| 187 | Ga0075365_10199218 | 3300006038 | Bacteria | 1402 |
| 188 | Ga0075365_10311713 | 3300006038 | Unclassified | 1108 |
| 189 | Ga0075368_10035929 | 3300006042 | Bacteria | 1935 |
| 190 | Ga0075368_10141535 | 3300006042 | Bacteria | 1002 |
| 191 | Ga0075363_100003163 | 3300006048 | Bacteria | 6930 |
| 192 | Ga0075363_100070001 | 3300006048 | Bacteria | 1904 |
| 193 | Ga0075364_10011381 | 3300006051 | Bacteria | 5405 |
| 194 | Ga0075364_10020053 | 3300006051 | Bacteria | 4204 |
| 195 | Ga0075364_10044928 | 3300006051 | Bacteria | 2874 |
| 196 | Ga0075364_10223317 | 3300006051 | Unclassified | 1279 |
| 197 | Ga0075364_10287374 | 3300006051 | Bacteria | 1119 |
| 198 | Ga0075362_10177018 | 3300006177 | Bacteria | 1032 |
| 199 | Ga0075367_10018509 | 3300006178 | Bacteria | 3845 |
| 200 | Ga0075367_10159273 | 3300006178 | Bacteria | 1403 |
| 201 | Ga0075367_10186630 | 3300006178 | Bacteria | 1293 |
| 202 | Ga0075369_10063085 | 3300006186 | Bacteria | 1620 |
| 203 | Ga0075366_10138885 | 3300006195 | Bacteria | 1468 |
| 204 | Ga0075366_10205646 | 3300006195 | Bacteria | 1198 |
| 205 | Ga0097621_100079086 | 3300006237 | Bacteria | 2733 |
| 206 | Ga0075370_10012846 | 3300006353 | Bacteria | 4437 |
| 207 | Ga0075370_10058931 | 3300006353 | Bacteria | 2184 |
| 208 | Ga0068871_100221194 | 3300006358 | Bacteria | 1640 |
| 209 | Ga0068871_100302702 | 3300006358 | Bacteria | 1404 |
| 210 | Ga0068871_100508328 | 3300006358 | Bacteria | 1087 |
| 211 | Ga0075428_100014565 | 3300006844 | Bacteria | 8735 |
| 212 | Ga0075434_100669941 | 3300006871 | Bacteria | 1055 |
| 213 | Ga0068865_100077817 | 3300006881 | Bacteria | 2371 |
| 214 | Ga0068865_100425324 | 3300006881 | Bacteria | 1093 |
| 215 | Ga0097620_100016876 | 3300006931 | Bacteria | 7328 |
| 216 | Ga0097620_100166318 | 3300006931 | Bacteria | 2285 |
| 217 | Ga0097620_100584282 | 3300006931 | Bacteria | 1211 |
| 218 | Ga0075435_100222013 | 3300007076 | Bacteria | 1605 |
| 219 | Ga0075435_100416675 | 3300007076 | Bacteria | 1156 |
| 220 | Ga0105250_10069082 | 3300009092 | Bacteria | 1426 |
| 221 | Ga0105240_10015922 | 3300009093 | Bacteria | 10199 |
| 222 | Ga0105240_10199785 | 3300009093 | Bacteria | 2344 |
| 223 | Ga0105240_10575624 | 3300009093 | Bacteria | 1243 |
| 224 | Ga0111539_10042663 | 3300009094 | Bacteria | 5445 |
| 225 | Ga0105245_10009744 | 3300009098 | Bacteria | 8373 |
| 226 | Ga0105245_10041488 | 3300009098 | Bacteria | 4102 |
| 227 | Ga0105245_10044825 | 3300009098 | Bacteria | 3948 |
| 228 | Ga0105245_10183066 | 3300009098 | Bacteria | 2003 |
| 229 | Ga0105245_10262667 | 3300009098 | Bacteria | 1681 |
| 230 | Ga0105247_10009734 | 3300009101 | Bacteria | 5829 |
| 231 | Ga0105247_10187484 | 3300009101 | Bacteria | 1383 |
| 232 | Ga0105247_10348157 | 3300009101 | Bacteria | 1041 |
| 233 | Ga0114129_10209945 | 3300009147 | Bacteria | 2633 |
| 234 | Ga0114129_10364713 | 3300009147 | Bacteria | 1911 |
| 235 | Ga0105243_10138872 | 3300009148 | Bacteria | 2071 |
| 236 | Ga0105243_10249007 | 3300009148 | Bacteria | 1585 |
| 237 | Ga0105243_10504984 | 3300009148 | Bacteria | 1146 |
| 238 | Ga0105241_10174490 | 3300009174 | Bacteria | 1778 |
| 239 | Ga0105241_10412078 | 3300009174 | Bacteria | 1187 |
| 240 | Ga0105242_10018681 | 3300009176 | Bacteria | 5424 |
| 241 | Ga0105242_10087044 | 3300009176 | Bacteria | 2622 |
| 242 | Ga0105242_10632323 | 3300009176 | Bacteria | 1038 |
| 243 | Ga0105242_10928944 | 3300009176 | Bacteria | 872 |
| 244 | Ga0105248_10037824 | 3300009177 | Bacteria | 5400 |
| 245 | Ga0105248_10303341 | 3300009177 | Bacteria | 1798 |
| 246 | Ga0105248_10315684 | 3300009177 | Bacteria | 1760 |
| 247 | Ga0105248_10372403 | 3300009177 | Bacteria | 1608 |
| 248 | Ga0105248_10942923 | 3300009177 | Bacteria | 975 |
| 249 | Ga0105248_11196719 | 3300009177 | Bacteria | 859 |
| 250 | Ga0105237_10009776 | 3300009545 | Bacteria | 10257 |
| 251 | Ga0105237_10016276 | 3300009545 | Bacteria | 7729 |
| 252 | Ga0105237_10061924 | 3300009545 | Bacteria | 3740 |
| 253 | Ga0105237_10065294 | 3300009545 | Bacteria | 3636 |
| 254 | Ga0105237_10834968 | 3300009545 | Bacteria | 928 |
| 255 | Ga0105238_10116422 | 3300009551 | Bacteria | 2652 |
| 256 | Ga0105238_10351489 | 3300009551 | Bacteria | 1463 |
| 257 | Ga0105238_10685202 | 3300009551 | Bacteria | 1037 |
| 258 | Ga0105249_10369478 | 3300009553 | Bacteria | 1458 |
| 259 | Ga0123340_1000167 | 3300009763 | Bacteria | 33533 |
| 260 | Ga0123341_1010909 | 3300009765 | Bacteria | 8280 |
| 261 | Ga0123341_1063720 | 3300009765 | Bacteria | 1748 |
| 262 | Ga0123342_1018186 | 3300009766 | Bacteria | 5658 |
| 263 | Ga0099796_10011789 | 3300010159 | Bacteria | 2450 |
| 264 | Ga0105239_10032831 | 3300010375 | Bacteria | 5704 |
| 265 | Ga0105239_10040749 | 3300010375 | Bacteria | 5089 |
| 266 | Ga0105239_10046379 | 3300010375 | Bacteria | 4762 |
| 267 | Ga0105239_10060369 | 3300010375 | Bacteria | 4162 |
| 268 | Ga0105239_10094671 | 3300010375 | Bacteria | 3299 |
| 269 | Ga0105239_10120138 | 3300010375 | Bacteria | 2917 |
| 270 | Ga0105239_10371891 | 3300010375 | Bacteria | 1615 |
| 271 | Ga0105239_10620053 | 3300010375 | Bacteria | 1234 |
| 272 | Ga0105246_10022753 | 3300011119 | Bacteria | 4048 |
| 273 | Ga0105246_10081357 | 3300011119 | Bacteria | 2308 |
| 274 | Ga0105246_10203546 | 3300011119 | Bacteria | 1540 |
| 275 | Ga0105246_10386997 | 3300011119 | Bacteria | 1157 |
| 276 | Ga0157373_10000647 | 3300013100 | Bacteria | 27419 |
| 277 | Ga0157373_10049148 | 3300013100 | Bacteria | 3006 |
| 278 | Ga0157371_10028934 | 3300013102 | Bacteria | 4011 |
| 279 | Ga0157371_10173482 | 3300013102 | Bacteria | 1541 |
| 280 | Ga0157371_10436736 | 3300013102 | Bacteria | 961 |
| 281 | Ga0157370_10022331 | 3300013104 | Bacteria | 6296 |
| 282 | Ga0157370_10029317 | 3300013104 | Bacteria | 5403 |
| 283 | Ga0157370_10031768 | 3300013104 | Bacteria | 5161 |
| 284 | Ga0157370_10194746 | 3300013104 | Bacteria | 1881 |
| 285 | Ga0157369_10011194 | 3300013105 | Bacteria | 10195 |
| 286 | Ga0157369_10159097 | 3300013105 | Bacteria | 2385 |
| 287 | Ga0157369_10215276 | 3300013105 | Bacteria | 2012 |
| 288 | Ga0157374_10016521 | 3300013296 | Bacteria | 6489 |
| 289 | Ga0157374_10164035 | 3300013296 | Bacteria | 2165 |
| 290 | Ga0157378_10014932 | 3300013297 | Bacteria | 6797 |
| 291 | Ga0157378_10225469 | 3300013297 | Bacteria | 1783 |
| 292 | Ga0157378_10302560 | 3300013297 | Bacteria | 1548 |
| 293 | Ga0163162_10274922 | 3300013306 | Bacteria | 1816 |
| 294 | Ga0163162_10323237 | 3300013306 | Bacteria | 1675 |
| 295 | Ga0157372_10000593 | 3300013307 | Bacteria | 39451 |
| 296 | Ga0157372_10027954 | 3300013307 | Bacteria | 6149 |
| 297 | Ga0157375_10283930 | 3300013308 | Bacteria | 1818 |
| 298 | Ga0163163_10042519 | 3300014325 | Bacteria | 4451 |
| 299 | Ga0163163_10845215 | 3300014325 | Bacteria | 979 |
| 300 | Ga0157380_10152327 | 3300014326 | Bacteria | 2000 |
| 301 | Ga0157380_10534424 | 3300014326 | Bacteria | 1147 |
| 302 | Ga0157377_10027973 | 3300014745 | Bacteria | 3031 |
| 303 | Ga0157377_10214457 | 3300014745 | Bacteria | 1229 |
| 304 | Ga0157379_10053440 | 3300014968 | Bacteria | 3608 |
| 305 | Ga0157379_10112157 | 3300014968 | Bacteria | 2450 |
| 306 | Ga0157376_10009078 | 3300014969 | Bacteria | 7203 |
| 307 | Ga0157376_10023064 | 3300014969 | Bacteria | 4864 |
| 308 | Ga0157376_10032010 | 3300014969 | Bacteria | 4218 |
| 309 | Ga0157376_10160662 | 3300014969 | Bacteria | 2036 |
| 310 | Ga0157376_10713806 | 3300014969 | Bacteria | 1009 |
| 311 | Ga0163161_10079952 | 3300017792 | Bacteria | 2405 |
| 312 | Ga0163161_10145217 | 3300017792 | Bacteria | 1799 |
| 313 | Ga0206356_10161480 | 3300020070 | Bacteria | 2377 |
| 314 | Ga0206354_10602836 | 3300020081 | Bacteria | 882 |
| 315 | Ga0213876_10077997 | 3300021384 | Bacteria | 1750 |
| 316 | Ga0209563_100670 | 3300025230 | Bacteria | 10845 |
| 317 | Ga0207425_1010250 | 3300025245 | Bacteria | 2289 |
| 318 | Ga0207425_1017347 | 3300025245 | Bacteria | 1583 |
| 319 | Ga0209677_100221 | 3300025253 | Bacteria | 40837 |
| 320 | Ga0209677_101711 | 3300025253 | Bacteria | 9125 |
| 321 | Ga0209129_1000489 | 3300025258 | Bacteria | 28872 |
| 322 | Ga0209233_1002119 | 3300025261 | Bacteria | 7478 |
| 323 | Ga0209455_1022391 | 3300025272 | Bacteria | 1205 |
| 324 | Ga0209455_1031154 | 3300025272 | Bacteria | 900 |
| 325 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 326 | Ga0209025_1002657 | 3300025294 | Bacteria | 18286 |
| 327 | Ga0209564_1006843 | 3300025295 | Bacteria | 6021 |
| 328 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 329 | Ga0209758_1001470 | 3300025297 | Bacteria | 27657 |
| 330 | Ga0209758_1002448 | 3300025297 | Bacteria | 18947 |
| 331 | Ga0209758_1003221 | 3300025297 | Bacteria | 15206 |
| 332 | Ga0209758_1003848 | 3300025297 | Bacteria | 13172 |
| 333 | Ga0209758_1004001 | 3300025297 | Bacteria | 12754 |
| 334 | Ga0209758_1007239 | 3300025297 | Bacteria | 7632 |
| 335 | Ga0209758_1031807 | 3300025297 | Bacteria | 2156 |
| 336 | Ga0209758_1036140 | 3300025297 | Bacteria | 1934 |
| 337 | Ga0209758_1041277 | 3300025297 | Bacteria | 1727 |
| 338 | Ga0209758_1051646 | 3300025297 | Bacteria | 1429 |
| 339 | Ga0209256_1004427 | 3300025299 | Bacteria | 8829 |
| 340 | Ga0207426_1001583 | 3300025302 | Bacteria | 18291 |
| 341 | Ga0207426_1010110 | 3300025302 | Bacteria | 3686 |
| 342 | Ga0209257_1003693 | 3300025304 | Bacteria | 12738 |
| 343 | Ga0209257_1007061 | 3300025304 | Bacteria | 6941 |
| 344 | Ga0207697_10108442 | 3300025315 | Bacteria | 1188 |
| 345 | Ga0207710_10077684 | 3300025900 | Bacteria | 1534 |
| 346 | Ga0207710_10133009 | 3300025900 | Bacteria | 1196 |
| 347 | Ga0207688_10026849 | 3300025901 | Bacteria | 3168 |
| 348 | Ga0207688_10083585 | 3300025901 | Bacteria | 1826 |
| 349 | Ga0207688_10256468 | 3300025901 | Bacteria | 1060 |
| 350 | Ga0207647_10002968 | 3300025904 | Bacteria | 12759 |
| 351 | Ga0207645_10112693 | 3300025907 | Bacteria | 1762 |
| 352 | Ga0207645_10256861 | 3300025907 | Bacteria | 1157 |
| 353 | Ga0207643_10107871 | 3300025908 | Bacteria | 1638 |
| 354 | Ga0207705_10034198 | 3300025909 | Bacteria | 3634 |
| 355 | Ga0207705_10318544 | 3300025909 | Bacteria | 1195 |
| 356 | Ga0207705_10348081 | 3300025909 | Bacteria | 1141 |
| 357 | Ga0207654_10042739 | 3300025911 | Bacteria | 2566 |
| 358 | Ga0207707_10159207 | 3300025912 | Bacteria | 1974 |
| 359 | Ga0207707_10190557 | 3300025912 | Bacteria | 1789 |
| 360 | Ga0207695_10001156 | 3300025913 | Bacteria | 45753 |
| 361 | Ga0207695_10195650 | 3300025913 | Bacteria | 1938 |
| 362 | Ga0207695_10483740 | 3300025913 | Bacteria | 1120 |
| 363 | Ga0207671_10009815 | 3300025914 | Bacteria | 7966 |
| 364 | Ga0207671_10084741 | 3300025914 | Bacteria | 2380 |
| 365 | Ga0207671_10208480 | 3300025914 | Bacteria | 1528 |
| 366 | Ga0207671_10215184 | 3300025914 | Bacteria | 1504 |
| 367 | Ga0207671_10218399 | 3300025914 | Bacteria | 1493 |
| 368 | Ga0207660_10012643 | 3300025917 | Bacteria | 5527 |
| 369 | Ga0207660_10085154 | 3300025917 | Bacteria | 2331 |
| 370 | Ga0207660_10329673 | 3300025917 | Bacteria | 1220 |
| 371 | Ga0207657_10000510 | 3300025919 | Bacteria | 41051 |
| 372 | Ga0207657_10030292 | 3300025919 | Bacteria | 4912 |
| 373 | Ga0207657_10032543 | 3300025919 | Bacteria | 4710 |
| 374 | Ga0207657_10053216 | 3300025919 | Bacteria | 3507 |
| 375 | Ga0207657_10187229 | 3300025919 | Bacteria | 1671 |
| 376 | Ga0207657_10212004 | 3300025919 | Bacteria | 1554 |
| 377 | Ga0207657_10350377 | 3300025919 | Bacteria | 1164 |
| 378 | Ga0207649_10018858 | 3300025920 | Bacteria | 3934 |
| 379 | Ga0207649_10139777 | 3300025920 | Bacteria | 1655 |
| 380 | Ga0207652_10023363 | 3300025921 | Bacteria | 5121 |
| 381 | Ga0207652_10042542 | 3300025921 | Bacteria | 3867 |
| 382 | Ga0207652_10180515 | 3300025921 | Bacteria | 1897 |
| 383 | Ga0207652_10632312 | 3300025921 | Bacteria | 958 |
| 384 | Ga0207646_10639630 | 3300025922 | Bacteria | 953 |
| 385 | Ga0207681_10047401 | 3300025923 | Bacteria | 2895 |
| 386 | Ga0207681_10383193 | 3300025923 | Bacteria | 1132 |
| 387 | Ga0207694_10120369 | 3300025924 | Bacteria | 2095 |
| 388 | Ga0207694_10223641 | 3300025924 | Bacteria | 1536 |
| 389 | Ga0207650_10728091 | 3300025925 | Bacteria | 839 |
| 390 | Ga0207659_10500644 | 3300025926 | Bacteria | 1028 |
| 391 | Ga0207664_10270537 | 3300025929 | Bacteria | 1488 |
| 392 | Ga0207644_10003534 | 3300025931 | Bacteria | 10123 |
| 393 | Ga0207690_10000725 | 3300025932 | Bacteria | 21280 |
| 394 | Ga0207690_10079258 | 3300025932 | Bacteria | 2288 |
| 395 | Ga0207690_10566500 | 3300025932 | Bacteria | 925 |
| 396 | Ga0207706_10000093 | 3300025933 | Bacteria | 93173 |
| 397 | Ga0207706_10039680 | 3300025933 | Bacteria | 4174 |
| 398 | Ga0207706_10107804 | 3300025933 | Bacteria | 2451 |
| 399 | Ga0207686_10257785 | 3300025934 | Bacteria | 1277 |
| 400 | Ga0207709_10258685 | 3300025935 | Bacteria | 1275 |
| 401 | Ga0207709_10356389 | 3300025935 | Bacteria | 1106 |
| 402 | Ga0207709_10529046 | 3300025935 | Bacteria | 924 |
| 403 | Ga0207670_10344009 | 3300025936 | Bacteria | 1179 |
| 404 | Ga0207669_10042091 | 3300025937 | Bacteria | 2663 |
| 405 | Ga0207704_10087655 | 3300025938 | Bacteria | 2033 |
| 406 | Ga0207704_10455356 | 3300025938 | Bacteria | 1022 |
| 407 | Ga0207691_10056371 | 3300025940 | Bacteria | 3579 |
| 408 | Ga0207691_10419708 | 3300025940 | Bacteria | 1140 |
| 409 | Ga0207711_10023938 | 3300025941 | Bacteria | 5111 |
| 410 | Ga0207711_10056621 | 3300025941 | Bacteria | 3369 |
| 411 | Ga0207711_10310148 | 3300025941 | Bacteria | 1457 |
| 412 | Ga0207689_10009995 | 3300025942 | Bacteria | 8179 |
| 413 | Ga0207679_10068588 | 3300025945 | Bacteria | 2665 |
| 414 | Ga0207679_10139755 | 3300025945 | Bacteria | 1956 |
| 415 | Ga0207679_10352563 | 3300025945 | Bacteria | 1283 |
| 416 | Ga0207667_10003071 | 3300025949 | Bacteria | 20698 |
| 417 | Ga0207667_10076640 | 3300025949 | Bacteria | 3469 |
| 418 | Ga0207667_10091474 | 3300025949 | Bacteria | 3143 |
| 419 | Ga0207667_10375327 | 3300025949 | Bacteria | 1449 |
| 420 | Ga0207667_11023390 | 3300025949 | Bacteria | 812 |
| 421 | Ga0207651_10226524 | 3300025960 | Bacteria | 1515 |
| 422 | Ga0207651_10433481 | 3300025960 | Bacteria | 1124 |
| 423 | Ga0207712_10032642 | 3300025961 | Bacteria | 3515 |
| 424 | Ga0207668_10239790 | 3300025972 | Bacteria | 1466 |
| 425 | Ga0207640_10062308 | 3300025981 | Bacteria | 2474 |
| 426 | Ga0207658_10046691 | 3300025986 | Bacteria | 3165 |
| 427 | Ga0207658_10110777 | 3300025986 | Bacteria | 2170 |
| 428 | Ga0207658_10845704 | 3300025986 | Bacteria | 832 |
| 429 | Ga0207677_10068509 | 3300026023 | Bacteria | 2491 |
| 430 | Ga0207703_10036511 | 3300026035 | Bacteria | 3912 |
| 431 | Ga0207703_10075570 | 3300026035 | Bacteria | 2793 |
| 432 | Ga0207703_10307582 | 3300026035 | Bacteria | 1448 |
| 433 | Ga0207703_10599310 | 3300026035 | Bacteria | 1042 |
| 434 | Ga0207639_10051447 | 3300026041 | Bacteria | 3133 |
| 435 | Ga0207639_10123494 | 3300026041 | Bacteria | 2131 |
| 436 | Ga0207639_10139648 | 3300026041 | Bacteria | 2017 |
| 437 | Ga0207639_10182571 | 3300026041 | Bacteria | 1786 |
| 438 | Ga0207639_10303926 | 3300026041 | Bacteria | 1411 |
| 439 | Ga0207678_10019543 | 3300026067 | Bacteria | 5952 |
| 440 | Ga0207678_10030242 | 3300026067 | Bacteria | 4728 |
| 441 | Ga0207678_10320935 | 3300026067 | Bacteria | 1333 |
| 442 | Ga0207708_10011392 | 3300026075 | Bacteria | 6623 |
| 443 | Ga0207708_10072081 | 3300026075 | Bacteria | 2647 |
| 444 | Ga0207702_10004987 | 3300026078 | Bacteria | 11661 |
| 445 | Ga0207702_10052978 | 3300026078 | Bacteria | 3435 |
| 446 | Ga0207702_10263990 | 3300026078 | Bacteria | 1622 |
| 447 | Ga0207702_10452340 | 3300026078 | Bacteria | 1246 |
| 448 | Ga0207702_11196976 | 3300026078 | Bacteria | 754 |
| 449 | Ga0207641_10358026 | 3300026088 | Bacteria | 1392 |
| 450 | Ga0207641_10404061 | 3300026088 | Bacteria | 1312 |
| 451 | Ga0207648_10193731 | 3300026089 | Bacteria | 1802 |
| 452 | Ga0207648_10250267 | 3300026089 | Bacteria | 1580 |
| 453 | Ga0207648_10782948 | 3300026089 | Bacteria | 887 |
| 454 | Ga0207676_10098407 | 3300026095 | Bacteria | 2418 |
| 455 | Ga0207676_10680803 | 3300026095 | Bacteria | 995 |
| 456 | Ga0207674_10097268 | 3300026116 | Bacteria | 2927 |
| 457 | Ga0207675_100025561 | 3300026118 | Bacteria | 5495 |
| 458 | Ga0207675_100030002 | 3300026118 | Bacteria | 5062 |
| 459 | Ga0207683_10011692 | 3300026121 | Bacteria | 7493 |
| 460 | Ga0207683_10049887 | 3300026121 | Bacteria | 3664 |
| 461 | Ga0207683_10078177 | 3300026121 | Bacteria | 2932 |
| 462 | Ga0207683_10166455 | 3300026121 | Bacteria | 1995 |
| 463 | Ga0207683_10170942 | 3300026121 | Bacteria | 1968 |
| 464 | Ga0207683_10237400 | 3300026121 | Bacteria | 1663 |
| 465 | Ga0207698_10054572 | 3300026142 | Bacteria | 3075 |
| 466 | Ga0207698_10114172 | 3300026142 | Bacteria | 2271 |
| 467 | Ga0209389_1000163 | 3300027296 | Bacteria | 55041 |
| 468 | Ga0209489_101100 | 3300027361 | Bacteria | 55041 |
| 469 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 470 | Ga0268266_10004510 | 3300028379 | Bacteria | 13310 |
| 471 | Ga0268266_10014493 | 3300028379 | Bacteria | 6775 |
| 472 | Ga0268266_10250808 | 3300028379 | Bacteria | 1637 |
| 473 | Ga0268266_10263322 | 3300028379 | Bacteria | 1598 |
| 474 | Ga0268266_10688045 | 3300028379 | Bacteria | 985 |
| 475 | Ga0268265_10002012 | 3300028380 | Bacteria | 16001 |
| 476 | Ga0268265_10557746 | 3300028380 | Bacteria | 1088 |
| 477 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 478 | Ga0268264_10101045 | 3300028381 | Bacteria | 2506 |
| 479 | Ga0268264_10745597 | 3300028381 | Bacteria | 975 |
| 480 | Ga0265334_10017875 | 3300028573 | Bacteria | 2924 |
| 481 | Ga0265318_10009533 | 3300028577 | Bacteria | 4263 |
| 482 | Ga0265323_10000706 | 3300028653 | Bacteria | 18167 |
| 483 | Ga0265336_10000683 | 3300028666 | Bacteria | 18322 |
| 484 | Ga0307517_10001121 | 3300028786 | Bacteria | 45217 |
| 485 | Ga0307515_10048703 | 3300028794 | Bacteria | 6400 |
| 486 | Ga0265338_10001041 | 3300028800 | Bacteria | 46363 |
| 487 | Ga0265324_10004820 | 3300029957 | Bacteria | 5958 |
| 488 | Ga0316177_1142486 | 3300030731 | Bacteria | 4082 |
| 489 | Ga0316178_1062662 | 3300030735 | Bacteria | 1086 |
| 490 | Ga0307513_10170936 | 3300031456 | Bacteria | 2051 |
| 491 | Ga0307513_10238570 | 3300031456 | Bacteria | 1625 |
| 492 | Ga0307513_10326987 | 3300031456 | Bacteria | 1289 |
| 493 | Ga0307509_10032140 | 3300031507 | Bacteria | 5786 |
| 494 | Ga0307509_10306562 | 3300031507 | Bacteria | 1332 |
| 495 | Ga0307509_10355137 | 3300031507 | Bacteria | 1187 |
| 496 | Ga0307408_100000252 | 3300031548 | Bacteria | 54975 |
| 497 | Ga0265313_10085917 | 3300031595 | Bacteria | 1420 |
| 498 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 499 | Ga0307508_10144852 | 3300031616 | Bacteria | 1980 |
| 500 | Ga0307508_10199788 | 3300031616 | Bacteria | 1600 |
| 501 | Ga0307508_10284103 | 3300031616 | Bacteria | 1248 |
| 502 | Ga0265314_10084709 | 3300031711 | Bacteria | 2080 |
| 503 | Ga0265342_10000687 | 3300031712 | Bacteria | 35389 |
| 504 | Ga0307516_10009658 | 3300031730 | Bacteria | 10725 |
| 505 | Ga0307516_10046891 | 3300031730 | Bacteria | 4261 |
| 506 | Ga0307516_10048561 | 3300031730 | Bacteria | 4176 |
| 507 | Ga0307516_10058550 | 3300031730 | Bacteria | 3750 |
| 508 | Ga0307405_10166428 | 3300031731 | Bacteria | 1568 |
| 509 | Ga0307405_10239103 | 3300031731 | Bacteria | 1344 |
| 510 | Ga0307416_100250974 | 3300032002 | Bacteria | 1722 |
| 511 | Ga0307416_100369373 | 3300032002 | Bacteria | 1460 |
| 512 | Ga0307411_10079962 | 3300032005 | Bacteria | 2246 |
| 513 | Ga0307415_100195771 | 3300032126 | Bacteria | 1599 |
| 514 | Ga0307510_10020868 | 3300033180 | Bacteria | 7646 |
| 515 | Ga0307510_10035200 | 3300033180 | Bacteria | 5596 |
| 516 | Ga0307510_10210970 | 3300033180 | Bacteria | 1464 |
| 517 | Ga0307510_10229271 | 3300033180 | Bacteria | 1361 |
| 518 | Ga0373930_0038620 | 3300034816 | Bacteria | 1009 |
| 519 | Ga0373936_0034200 | 3300035113 | Bacteria | 2018 |
| 520 | Ga0373936_0050697 | 3300035113 | Bacteria | 1679 |
| 521 | Ga0373941_0018909 | 3300035115 | Bacteria | 1910 |
| 522 | Ga0373945_0023969 | 3300035116 | Bacteria | 2111 |
| 523 | Ga0373954_0049206 | 3300035118 | Bacteria | 1976 |
| 524 | Ga0373956_0016462 | 3300035119 | Bacteria | 3106 |
| 525 | Ga0373943_0019761 | 3300035170 | Bacteria | 3101 |
| 526 | Ga0373946_0077904 | 3300035171 | Bacteria | 1445 |
| 527 | Ga0373946_0156936 | 3300035171 | Bacteria | 1066 |
| 528 | Ga0373924_0105697 | 3300035410 | Bacteria | 1213 |
| 529 | Ga0373931_0000922 | 3300035691 | Bacteria | 12362 |
| 530 | Ga0373931_0069916 | 3300035691 | Bacteria | 1914 |
| 531 | Ga0373931_0401473 | 3300035691 | Bacteria | 868 |
| 532 | Ga0373935_0007139 | 3300035692 | Bacteria | 6669 |
| 533 | Ga0373935_0061490 | 3300035692 | Bacteria | 2404 |
| 534 | Ga0373927_0003207 | 3300035695 | Bacteria | 11783 |
| 535 | Ga0373927_0027031 | 3300035695 | Bacteria | 3750 |
| 536 | Ga0373927_0130679 | 3300035695 | Bacteria | 1640 |
| 537 | Ga0373927_0304999 | 3300035695 | Bacteria | 1048 |
| 538 | Ga0373927_0310865 | 3300035695 | Bacteria | 1037 |
| 539 | Ga0373927_0369211 | 3300035695 | Bacteria | 946 |
| 540 | Ga0373947_0016126 | 3300035725 | Bacteria | 4293 |
| 541 | Ga0373925_0051695 | 3300037068 | Bacteria | 3068 |
| 542 | Ga0373925_0386573 | 3300037068 | Bacteria | 1140 |
| 543 | Ga0373925_0448791 | 3300037068 | Bacteria | 1056 |
| 544 | Ga0395898_0333998 | 3300037466 | Bacteria | 1445 |
| 545 | Ga0395905_0003426 | 3300037471 | Bacteria | 16972 |
| 546 | Ga0395905_0072293 | 3300037471 | Bacteria | 3234 |
| 547 | Ga0395905_0177334 | 3300037471 | Bacteria | 2000 |
| 548 | Ga0395905_0213892 | 3300037471 | Bacteria | 1806 |
| 549 | Ga0436364_1376044 | 3300037853 | Bacteria | 1231 |
| 550 | Ga0436365_1627177 | 3300039437 | Bacteria | 3436 |
| 551 | Ga0436363_0270101 | 3300039450 | Bacteria | 4354 |
| 552 | Ga0439465_0010459 | 3300041413 | Bacteria | 2914 |
| 553 | Ga0451791_0655594 | 3300041451 | Bacteria | 961 |
| 554 | Ga0451849_1322946 | 3300041505 | Bacteria | 951 |
| 555 | Ga0439459_0008892 | 3300042438 | Bacteria | 1727 |
| 556 | Ga0466972_0078620 | 3300044658 | Bacteria | 1571 |
| 557 | Ga0466963_0274646 | 3300044694 | Unclassified | 1184 |
| 558 | Ga0466957_0195755 | 3300044842 | Bacteria | 1326 |
| 559 | Ga0466957_0380207 | 3300044842 | Bacteria | 963 |
| 560 | Ga0466960_0235099 | 3300044901 | Bacteria | 1013 |
| 561 | Ga0466959_0221764 | 3300045049 | Bacteria | 1311 |
| 562 | Ga0466958_0104327 | 3300045836 | Bacteria | 1766 |
| 563 | Ga0466967_0001133 | 3300045976 | Bacteria | 14847 |
| 564 | Ga0495617_058050 | 3300046452 | Bacteria | 1282 |
| 565 | Ga0495592_0037169 | 3300046454 | Bacteria | 3666 |
| 566 | Ga0495603_0000182 | 3300046455 | Bacteria | 32426 |
| 567 | Ga0495603_0004488 | 3300046455 | Bacteria | 8327 |
| 568 | Ga0495603_0030757 | 3300046455 | Bacteria | 3233 |
| 569 | Ga0495603_0148374 | 3300046455 | Bacteria | 1363 |
| 570 | Ga0495603_0363663 | 3300046455 | Bacteria | 830 |
| 571 | Ga0495629_0000314 | 3300046459 | Bacteria | 41394 |
| 572 | Ga0495641_0001508 | 3300046461 | Bacteria | 19835 |
| 573 | Ga0495641_0041135 | 3300046461 | Bacteria | 2148 |
| 574 | Ga0495651_0012151 | 3300046462 | Bacteria | 6629 |
| 575 | Ga0495651_0180065 | 3300046462 | Bacteria | 1497 |
| 576 | Ga0495653_0101966 | 3300046463 | Bacteria | 2078 |
| 577 | Ga0495653_0109029 | 3300046463 | Bacteria | 1993 |
| 578 | Ga0495580_0036094 | 3300046472 | Bacteria | 3550 |
| 579 | Ga0495582_0000597 | 3300046473 | Bacteria | 19925 |
| 580 | Ga0495582_0016511 | 3300046473 | Bacteria | 4044 |
| 581 | Ga0495605_0120213 | 3300046474 | Bacteria | 1191 |
| 582 | Ga0495639_0000235 | 3300046475 | Bacteria | 27682 |
| 583 | Ga0495639_0089101 | 3300046475 | Bacteria | 1445 |
| 584 | Ga0495662_0001470 | 3300046476 | Bacteria | 11662 |
| 585 | Ga0495664_0005693 | 3300046477 | Bacteria | 6856 |
| 586 | Ga0495664_0315894 | 3300046477 | Bacteria | 942 |
| 587 | Ga0495584_0015964 | 3300046491 | Bacteria | 3832 |
| 588 | Ga0495585_0048788 | 3300046492 | Bacteria | 2353 |
| 589 | Ga0495594_0000302 | 3300046499 | Bacteria | 24227 |
| 590 | Ga0495607_0142450 | 3300046501 | Bacteria | 1235 |
| 591 | Ga0495606_0047029 | 3300046507 | Bacteria | 2848 |
| 592 | Ga0495606_0106966 | 3300046507 | Bacteria | 1693 |
| 593 | Ga0495606_0116102 | 3300046507 | Bacteria | 1608 |
| 594 | Ga0495606_0159498 | 3300046507 | Bacteria | 1317 |
| 595 | Ga0495610_0099204 | 3300046512 | Bacteria | 1307 |
| 596 | Ga0495610_0136409 | 3300046512 | Bacteria | 1060 |
| 597 | Ga0495616_0020136 | 3300046513 | Bacteria | 3634 |
| 598 | Ga0495616_0032705 | 3300046513 | Bacteria | 2715 |
| 599 | Ga0495628_0029830 | 3300046516 | Bacteria | 4420 |
| 600 | Ga0495628_0274453 | 3300046516 | Bacteria | 1253 |
| 601 | Ga0495628_0294238 | 3300046516 | Bacteria | 1203 |
| 602 | Ga0495628_0376855 | 3300046516 | Bacteria | 1040 |
| 603 | Ga0495630_0002415 | 3300046517 | Bacteria | 12968 |
| 604 | Ga0495632_0067614 | 3300046519 | Bacteria | 1723 |
| 605 | Ga0495637_0087103 | 3300046520 | Bacteria | 1237 |
| 606 | Ga0495643_0208714 | 3300046522 | Bacteria | 933 |
| 607 | Ga0495644_0072945 | 3300046523 | Bacteria | 1291 |
| 608 | Ga0495648_0000619 | 3300046524 | Bacteria | 38032 |
| 609 | Ga0495648_0006267 | 3300046524 | Bacteria | 9733 |
| 610 | Ga0495666_0035782 | 3300046526 | Bacteria | 2419 |
| 611 | Ga0495652_0006258 | 3300046529 | Bacteria | 11097 |
| 612 | Ga0495652_0041525 | 3300046529 | Bacteria | 3970 |
| 613 | Ga0495652_0232304 | 3300046529 | Bacteria | 1378 |
| 614 | Ga0495665_0000619 | 3300046531 | Bacteria | 18044 |
| 615 | Ga0495640_0000308 | 3300046533 | Bacteria | 33750 |
| 616 | Ga0495640_0124019 | 3300046533 | Bacteria | 1676 |
| 617 | Ga0495640_0229529 | 3300046533 | Bacteria | 1168 |
| 618 | Ga0495587_0032889 | 3300046536 | Bacteria | 3132 |
| 619 | Ga0495609_0102427 | 3300046538 | Bacteria | 1240 |
| 620 | Ga0495609_0155626 | 3300046538 | Bacteria | 971 |
| 621 | Ga0495621_0064946 | 3300046539 | Bacteria | 1332 |
| 622 | Ga0495645_0002277 | 3300046543 | Bacteria | 13061 |
| 623 | Ga0495622_0033182 | 3300046557 | Bacteria | 2410 |
| 624 | Ga0495622_0056752 | 3300046557 | Bacteria | 1816 |
| 625 | Ga0495622_0072635 | 3300046557 | Bacteria | 1587 |
| 626 | Ga0495633_0012187 | 3300046558 | Bacteria | 4588 |
| 627 | Ga0495633_0063792 | 3300046558 | Bacteria | 1723 |
| 628 | Ga0495667_0008896 | 3300046559 | Bacteria | 6827 |
| 629 | Ga0495656_0042782 | 3300046615 | Bacteria | 1898 |
| 630 | Ga0495668_0017158 | 3300046616 | Bacteria | 4205 |
| 631 | Ga0495668_0052268 | 3300046616 | Bacteria | 2261 |
| 632 | Ga0495668_0069062 | 3300046616 | Bacteria | 1943 |
| 633 | Ga0495668_0131199 | 3300046616 | Bacteria | 1371 |
| 634 | Ga0495634_0001483 | 3300046642 | Bacteria | 20763 |
| 635 | Ga0495634_0047054 | 3300046642 | Bacteria | 2908 |
| 636 | Ga0495611_0113091 | 3300046648 | Bacteria | 1264 |
| 637 | Ga0495625_0123597 | 3300046660 | Bacteria | 1759 |
| 638 | Ga0495625_0134632 | 3300046660 | Bacteria | 1671 |
| 639 | Ga0495625_0164807 | 3300046660 | Bacteria | 1483 |
| 640 | Ga0495625_0195089 | 3300046660 | Bacteria | 1339 |
| 641 | Ga0495635_0003423 | 3300046663 | Bacteria | 10975 |
| 642 | Ga0495635_0045072 | 3300046663 | Bacteria | 3042 |
| 643 | Ga0495661_0102372 | 3300046665 | Bacteria | 1610 |
| 644 | Ga0495661_0137567 | 3300046665 | Bacteria | 1332 |
| 645 | Ga0495588_0004152 | 3300046674 | Bacteria | 6381 |
| 646 | Ga0495588_0006111 | 3300046674 | Bacteria | 5405 |
| 647 | Ga0495588_0081788 | 3300046674 | Bacteria | 1686 |
| 648 | Ga0495657_0021179 | 3300046675 | Bacteria | 4666 |
| 649 | Ga0495657_0060848 | 3300046675 | Bacteria | 2500 |
| 650 | Ga0495657_0135004 | 3300046675 | Bacteria | 1542 |
| 651 | Ga0495599_0032491 | 3300046678 | Bacteria | 3276 |
| 652 | Ga0495623_0124232 | 3300046679 | Bacteria | 1551 |
| 653 | Ga0495646_0077067 | 3300046680 | Bacteria | 1951 |
| 654 | Ga0495647_0000405 | 3300046681 | Bacteria | 12350 |
| 655 | Ga0495647_0047624 | 3300046681 | Bacteria | 1655 |
| 656 | Ga0495647_0119342 | 3300046681 | Bacteria | 1108 |
| 657 | Ga0495658_0000936 | 3300046683 | Bacteria | 15569 |
| 658 | Ga0495658_0259591 | 3300046683 | Bacteria | 1094 |
| 659 | Ga0495669_0035983 | 3300046684 | Bacteria | 2187 |
| 660 | Ga0495669_0096619 | 3300046684 | Bacteria | 1369 |
| 661 | Ga0495613_0004828 | 3300046689 | Bacteria | 10114 |
| 662 | Ga0495613_0082107 | 3300046689 | Bacteria | 2341 |
| 663 | Ga0495624_0000810 | 3300046690 | Bacteria | 24701 |
| 664 | Ga0495624_0116093 | 3300046690 | Bacteria | 1645 |
| 665 | Ga0495670_0076587 | 3300046691 | Bacteria | 1700 |
| 666 | Ga0495670_0276454 | 3300046691 | Bacteria | 898 |
| 667 | Ga0495671_0106338 | 3300046692 | Bacteria | 1370 |
| 668 | Ga0495589_0092108 | 3300046794 | Bacteria | 1472 |
| 669 | Ga0495600_0004756 | 3300046809 | Bacteria | 8148 |
| 670 | Ga0495600_0049276 | 3300046809 | Bacteria | 2748 |
| 671 | Ga0495600_0211607 | 3300046809 | Bacteria | 1242 |
| 672 | Ga0495660_0165806 | 3300046810 | Bacteria | 1080 |
| 673 | Ga0495581_0000683 | 3300047315 | Bacteria | 17799 |
| 674 | Ga0495581_0037772 | 3300047315 | Bacteria | 2795 |
| 675 | Ga0495604_0005707 | 3300047317 | Bacteria | 9871 |
| 676 | Ga0495604_0321556 | 3300047317 | Bacteria | 1034 |
| 677 | Ga0495604_0347989 | 3300047317 | Bacteria | 985 |
| 678 | Ga0495636_0027019 | 3300047318 | Bacteria | 2337 |
| 679 | Ga0495674_0033870 | 3300047319 | Bacteria | 4623 |
| 680 | Ga0495672_0018381 | 3300047320 | Bacteria | 4642 |
| 681 | Ga0495672_0091395 | 3300047320 | Bacteria | 1671 |
| 682 | Ga0495676_0005624 | 3300047321 | Bacteria | 11492 |
| 683 | Ga0495676_0146325 | 3300047321 | Bacteria | 1687 |
| 684 | Ga0495676_0165304 | 3300047321 | Bacteria | 1562 |
| 685 | Ga0495680_0181214 | 3300047322 | Bacteria | 1520 |
| 686 | Ga0495680_0201624 | 3300047322 | Bacteria | 1427 |
| 687 | Ga0495683_0026647 | 3300047323 | Bacteria | 2958 |
| 688 | Ga0495683_0048443 | 3300047323 | Bacteria | 2131 |
| 689 | Ga0495683_0068885 | 3300047323 | Bacteria | 1739 |
| 690 | Ga0495683_0203252 | 3300047323 | Bacteria | 892 |
| 691 | Ga0495687_003554 | 3300047443 | Bacteria | 11205 |
| 692 | Ga0495687_029783 | 3300047443 | Bacteria | 2521 |
| 693 | Ga0495675_0022183 | 3300047444 | Bacteria | 4046 |
| 694 | Ga0495677_0019823 | 3300047445 | Bacteria | 2439 |
| 695 | Ga0495673_0024196 | 3300047469 | Bacteria | 2940 |
| 696 | Ga0495684_0014657 | 3300047471 | Bacteria | 6032 |
| 697 | Ga0495686_0139174 | 3300047472 | Bacteria | 1433 |
| 698 | Ga0495686_0174065 | 3300047472 | Bacteria | 1251 |
| 699 | Ga0495686_0329425 | 3300047472 | Bacteria | 835 |
| 700 | Ga0495593_0000370 | 3300047673 | Bacteria | 24754 |
| 701 | Ga0495602_0055398 | 3300048088 | Bacteria | 3492 |
| 702 | Ga0495614_0067848 | 3300048089 | Bacteria | 1535 |
| 703 | Ga0496100_0057050 | 3300048903 | Bacteria | 2557 |
| 704 | Ga0496100_0059644 | 3300048903 | Bacteria | 2508 |
| 705 | Ga0496101_0011788 | 3300048904 | Bacteria | 5814 |
| 706 | Ga0496101_0079991 | 3300048904 | Bacteria | 2414 |
| 707 | Ga0496102_0035160 | 3300048905 | Bacteria | 4508 |
| 708 | Ga0496102_0039885 | 3300048905 | Bacteria | 4245 |
| 709 | Ga0496102_0182086 | 3300048905 | Bacteria | 1980 |
| 710 | Ga0496102_0296367 | 3300048905 | Bacteria | 1524 |
| 711 | Ga0496102_0650350 | 3300048905 | Bacteria | 977 |
| 712 | Ga0496103_0050386 | 3300048906 | Bacteria | 2576 |
| 713 | Ga0496103_0199871 | 3300048906 | Bacteria | 1285 |
| 714 | Ga0496104_0027452 | 3300048907 | Bacteria | 5267 |
| 715 | Ga0496104_0046793 | 3300048907 | Bacteria | 4075 |
| 716 | Ga0496104_0145388 | 3300048907 | Bacteria | 2277 |
| 717 | Ga0496104_0156640 | 3300048907 | Bacteria | 2186 |
| 718 | Ga0496104_0259136 | 3300048907 | Bacteria | 1652 |
| 719 | Ga0496105_0248534 | 3300048908 | Bacteria | 1441 |
| 720 | Ga0496105_0492742 | 3300048908 | Bacteria | 963 |
| 721 | Ga0496105_0636787 | 3300048908 | Bacteria | 824 |
| 722 | Ga0496106_0000788 | 3300048909 | Bacteria | 22899 |
| 723 | Ga0496106_0006629 | 3300048909 | Bacteria | 8572 |
| 724 | Ga0496106_0010327 | 3300048909 | Bacteria | 6902 |
| 725 | Ga0496106_0071909 | 3300048909 | Bacteria | 2644 |
| 726 | Ga0496106_0085959 | 3300048909 | Bacteria | 2422 |
| 727 | Ga0496106_0399575 | 3300048909 | Bacteria | 1104 |
| 728 | Ga0496107_0010427 | 3300048910 | Bacteria | 6455 |
| 729 | Ga0496107_0073394 | 3300048910 | Bacteria | 2488 |
| 730 | Ga0496108_0029240 | 3300048911 | Bacteria | 4562 |
| 731 | Ga0496108_0041613 | 3300048911 | Bacteria | 3836 |
| 732 | Ga0496108_0138390 | 3300048911 | Bacteria | 2097 |
| 733 | Ga0496108_0378606 | 3300048911 | Bacteria | 1236 |
| 734 | Ga0496108_0874853 | 3300048911 | Bacteria | 772 |
| 735 | Ga0496109_0074114 | 3300048912 | Bacteria | 3128 |
| 736 | Ga0496109_0216868 | 3300048912 | Bacteria | 1799 |
| 737 | Ga0496110_0009815 | 3300048913 | Bacteria | 7754 |
| 738 | Ga0496110_0035698 | 3300048913 | Bacteria | 4314 |
| 739 | Ga0496111_0002060 | 3300048914 | Bacteria | 11981 |
| 740 | Ga0496111_0021035 | 3300048914 | Bacteria | 4550 |
| 741 | Ga0496112_0074644 | 3300048915 | Bacteria | 3353 |
| 742 | Ga0496112_0150982 | 3300048915 | Bacteria | 2290 |
| 743 | Ga0496112_0168267 | 3300048915 | Bacteria | 2157 |
| 744 | Ga0496112_0242858 | 3300048915 | Bacteria | 1753 |
| 745 | Ga0496113_0005020 | 3300048916 | Bacteria | 8207 |
| 746 | Ga0496113_0048688 | 3300048916 | Bacteria | 3154 |
| 747 | Ga0496113_0049431 | 3300048916 | Bacteria | 3131 |
| 748 | Ga0496114_0002069 | 3300048917 | Bacteria | 15273 |
| 749 | Ga0496114_0117355 | 3300048917 | Bacteria | 2286 |
| 750 | Ga0496114_0519902 | 3300048917 | Bacteria | 1053 |
| 751 | Ga0496115_0005035 | 3300048918 | Bacteria | 9600 |
| 752 | Ga0496115_0051684 | 3300048918 | Bacteria | 3295 |
| 753 | Ga0496115_0081154 | 3300048918 | Bacteria | 2641 |
| 754 | Ga0496116_0026977 | 3300048919 | Bacteria | 4188 |
| 755 | Ga0496116_0135082 | 3300048919 | Bacteria | 1398 |
| 756 | Ga0496117_0008719 | 3300048920 | Bacteria | 9584 |
| 757 | Ga0496117_0105573 | 3300048920 | Bacteria | 1770 |
| 758 | Ga0496117_0139628 | 3300048920 | Bacteria | 1453 |
| 759 | Ga0496117_0148990 | 3300048920 | Bacteria | 1388 |
| 760 | Ga0496118_0004035 | 3300048921 | Bacteria | 17843 |
| 761 | Ga0496118_0067376 | 3300048921 | Bacteria | 2607 |
| 762 | Ga0496118_0104340 | 3300048921 | Bacteria | 1903 |
| 763 | Ga0496118_0243986 | 3300048921 | Bacteria | 1026 |
| 764 | Ga0496119_0022541 | 3300048922 | Bacteria | 4502 |
| 765 | Ga0496119_0140231 | 3300048922 | Bacteria | 1306 |
| 766 | Ga0496120_0111142 | 3300048923 | Bacteria | 1432 |
| 767 | Ga0496120_0223240 | 3300048923 | Bacteria | 899 |
| 768 | Ga0496121_0000640 | 3300048924 | Bacteria | 65295 |
| 769 | Ga0496121_0006350 | 3300048924 | Bacteria | 14731 |
| 770 | Ga0496121_0014968 | 3300048924 | Bacteria | 8170 |
| 771 | Ga0496121_0018042 | 3300048924 | Bacteria | 7147 |
| 772 | Ga0496121_0027740 | 3300048924 | Bacteria | 5292 |
| 773 | Ga0496121_0042560 | 3300048924 | Bacteria | 3947 |
| 774 | Ga0496121_0097728 | 3300048924 | Bacteria | 2274 |
| 775 | Ga0496121_0117532 | 3300048924 | Bacteria | 2014 |
| 776 | Ga0496121_0176268 | 3300048924 | Bacteria | 1547 |
| 777 | Ga0496121_0355383 | 3300048924 | Bacteria | 974 |
| 778 | Ga0496122_0000072 | 3300048925 | Bacteria | 222436 |
| 779 | Ga0496122_0096390 | 3300048925 | Bacteria | 1995 |
| 780 | Ga0496123_0000035 | 3300048926 | Bacteria | 267288 |
| 781 | Ga0496124_0000004 | 3300048927 | Bacteria | 976131 |
| 782 | Ga0496124_0007008 | 3300048927 | Bacteria | 12079 |
| 783 | Ga0496124_0049279 | 3300048927 | Bacteria | 3594 |
| 784 | Ga0496124_0051307 | 3300048927 | Bacteria | 3511 |
| 785 | Ga0496124_0068381 | 3300048927 | Bacteria | 2952 |
| 786 | Ga0496124_0340935 | 3300048927 | Unclassified | 1064 |
| 787 | Ga0496125_0000136 | 3300048928 | Bacteria | 160544 |
| 788 | Ga0496125_0049499 | 3300048928 | Bacteria | 3492 |
| 789 | Ga0496125_0052528 | 3300048928 | Bacteria | 3351 |
| 790 | Ga0496125_0063712 | 3300048928 | Bacteria | 2937 |
| 791 | Ga0496125_0071712 | 3300048928 | Bacteria | 2704 |
| 792 | Ga0496125_0124627 | 3300048928 | Bacteria | 1829 |
| 793 | Ga0496125_0379349 | 3300048928 | Unclassified | 834 |
| 794 | Ga0496126_0013134 | 3300048929 | Bacteria | 8447 |
| 795 | Ga0496126_0030491 | 3300048929 | Bacteria | 5108 |
| 796 | Ga0496126_0064381 | 3300048929 | Bacteria | 3284 |
| 797 | Ga0496126_0067186 | 3300048929 | Bacteria | 3204 |
| 798 | Ga0496126_0108383 | 3300048929 | Bacteria | 2422 |
| 799 | Ga0496126_0185856 | 3300048929 | Bacteria | 1762 |
| 800 | Ga0496126_0360985 | 3300048929 | Bacteria | 1186 |
| 801 | Ga0496126_0462019 | 3300048929 | Bacteria | 1020 |
| 802 | Ga0501036_0080390 | 3300049572 | Bacteria | 2756 |
| 803 | Ga0501036_0478362 | 3300049572 | Bacteria | 1037 |
| 804 | Ga0501038_0280696 | 3300049574 | Bacteria | 1311 |
| 805 | Ga0501039_0272995 | 3300049575 | Bacteria | 1329 |
| 806 | Ga0501042_0159742 | 3300049578 | Bacteria | 1626 |
| 807 | Ga0501047_0009703 | 3300049581 | Bacteria | 9102 |
| 808 | Ga0501047_0191466 | 3300049581 | Bacteria | 1908 |
| 809 | Ga0501069_0197914 | 3300049585 | Bacteria | 1164 |
| 810 | Ga0501076_0021084 | 3300049592 | Bacteria | 4994 |
| 811 | Ga0501222_019810 | 3300049662 | Unclassified | 899 |
| 812 | Ga0501227_002739 | 3300049665 | Bacteria | 3874 |
| 813 | Ga0501079_0125280 | 3300049741 | Bacteria | 1999 |
| 814 | Ga0501080_0452554 | 3300049742 | Bacteria | 1151 |
| 815 | Ga0501279_002614 | 3300049775 | Bacteria | 2353 |
| 816 | Ga0501279_005909 | 3300049775 | Unclassified | 1611 |
| 817 | Ga0501044_0214807 | 3300049823 | Bacteria | 1876 |
| 818 | nmdc:mga03683_144337_c1 | 3300050489 | Bacteria | 1071 |
| 819 | nmdc:mga03683_147991_c1 | 3300050489 | Unclassified | 1058 |
| 820 | nmdc:mga03683_82892_c1 | 3300050489 | Bacteria | 1387 |
| 821 | nmdc:mga03n38_989_c1 | 3300050490 | Bacteria | 7760 |
| 822 | nmdc:mga00v17_11205_c1 | 3300050491 | Bacteria | 4923 |
| 823 | nmdc:mga00v17_171917_c1 | 3300050491 | Bacteria | 1397 |
| 824 | nmdc:mga00v17_407537_c1 | 3300050491 | Bacteria | 883 |
| 825 | nmdc:mga00v17_51920_c1 | 3300050491 | Bacteria | 2493 |
| 826 | nmdc:mga0yw44_143278_c1 | 3300050492 | Bacteria | 1554 |
| 827 | nmdc:mga0yw44_15824_c1 | 3300050492 | Bacteria | 3350 |
| 828 | nmdc:mga0yw44_20383_c1 | 3300050492 | Bacteria | 3679 |
| 829 | nmdc:mga0yw44_24975_c1 | 3300050492 | Bacteria | 3390 |
| 830 | nmdc:mga0yw44_311142_c1 | 3300050492 | Bacteria | 1057 |
| 831 | nmdc:mga0yw44_331579_c1 | 3300050492 | Bacteria | 1023 |
| 832 | nmdc:mga0yw44_71313_c1 | 3300050492 | Bacteria | 2157 |
| 833 | nmdc:mga0k408_100771_c1 | 3300050493 | Bacteria | 1703 |
| 834 | nmdc:mga0k408_1944_c1 | 3300050493 | Bacteria | 11068 |
| 835 | nmdc:mga0k408_247264_c1 | 3300050493 | Bacteria | 1065 |
| 836 | nmdc:mga0k408_341162_c1 | 3300050493 | Bacteria | 893 |
| 837 | nmdc:mga06z11_3558_c1 | 3300050494 | Bacteria | 6033 |
| 838 | nmdc:mga06z11_47899_c1 | 3300050494 | Bacteria | 2173 |
| 839 | nmdc:mga06z11_94031_c1 | 3300050494 | Bacteria | 1633 |
| 840 | nmdc:mga07m45_115683_c1 | 3300050496 | Bacteria | 1546 |
| 841 | nmdc:mga07m45_130042_c1 | 3300050496 | Bacteria | 1457 |
| 842 | nmdc:mga07m45_269500_c1 | 3300050496 | Bacteria | 990 |
| 843 | nmdc:mga07m45_6373_c1 | 3300050496 | Bacteria | 4073 |
| 844 | nmdc:mga09592_656276_c1 | 3300050508 | Bacteria | 895 |
| 845 | nmdc:mga0qj67_354668_c1 | 3300050509 | Bacteria | 1185 |
| 846 | nmdc:mga0n895_196917_c1 | 3300050512 | Bacteria | 2046 |
| 847 | nmdc:mga0n895_243665_c1 | 3300050512 | Bacteria | 1824 |
| 848 | nmdc:mga0n895_80087_c1 | 3300050512 | Bacteria | 3253 |
| 849 | nmdc:mga0rr50_32574_c1 | 3300050513 | Bacteria | 3714 |
| 850 | nmdc:mga0a205_393136_c1 | 3300050515 | Bacteria | 1250 |
| 851 | nmdc:mga0sz30_102954_c1 | 3300050516 | Bacteria | 1248 |
| 852 | nmdc:mga0sz30_2977_c1 | 3300050516 | Bacteria | 6074 |
| 853 | nmdc:mga0sz30_37766_c1 | 3300050516 | Bacteria | 2022 |
| 854 | nmdc:mga0sz30_98394_c1 | 3300050516 | Bacteria | 1277 |
| 855 | Ga0495601_0170003 | 3300053077 | Bacteria | 1425 |
| 856 | Ga0495612_0037009 | 3300053078 | Bacteria | 1981 |
| 857 | Ga0500635_0001720 | 3300053080 | Bacteria | 5313 |
| 858 | Ga0500635_0019869 | 3300053080 | Bacteria | 2049 |
| 859 | Ga0500635_0141489 | 3300053080 | Bacteria | 913 |
| 860 | Ga0495595_0046772 | 3300053084 | Bacteria | 1994 |
| 861 | Ga0495619_0238218 | 3300053085 | Bacteria | 1261 |
| 862 | Ga0495619_0295850 | 3300053085 | Bacteria | 1121 |
| 863 | Ga0500578_0154790 | 3300053086 | Bacteria | 1426 |
| 864 | Ga0500578_0187342 | 3300053086 | Bacteria | 1272 |
| 865 | Ga0500578_0271687 | 3300053086 | Bacteria | 1014 |
| 866 | Ga0500643_000160 | 3300053087 | Bacteria | 66845 |
| 867 | Ga0500643_018379 | 3300053087 | Bacteria | 2320 |
| 868 | Ga0500581_145907 | 3300053089 | Bacteria | 1116 |
| 869 | Ga0500583_0171510 | 3300053092 | Bacteria | 1080 |
| 870 | Ga0500651_0010771 | 3300053093 | Bacteria | 5494 |
| 871 | Ga0500651_0272163 | 3300053093 | Bacteria | 979 |
| 872 | Ga0500566_0001345 | 3300053094 | Bacteria | 14355 |
| 873 | Ga0500566_0003268 | 3300053094 | Bacteria | 9688 |
| 874 | Ga0500566_0025753 | 3300053094 | Bacteria | 3446 |
| 875 | Ga0500566_0194611 | 3300053094 | Bacteria | 1029 |
| 876 | Ga0500640_027308 | 3300053095 | Bacteria | 2490 |
| 877 | Ga0500641_0004044 | 3300053096 | Bacteria | 5179 |
| 878 | Ga0500641_0028998 | 3300053096 | Bacteria | 2165 |
| 879 | Ga0500554_010606 | 3300053102 | Bacteria | 2253 |
| 880 | Ga0500555_049236 | 3300053103 | Bacteria | 1156 |
| 881 | Ga0500556_0008987 | 3300053104 | Bacteria | 2895 |
| 882 | Ga0500557_000128 | 3300053105 | Bacteria | 20005 |
| 883 | Ga0500562_021788 | 3300053108 | Bacteria | 1669 |
| 884 | Ga0500569_008127 | 3300053109 | Bacteria | 2388 |
| 885 | Ga0500572_003155 | 3300053111 | Bacteria | 3817 |
| 886 | Ga0500572_004302 | 3300053111 | Bacteria | 3235 |
| 887 | Ga0500572_022921 | 3300053111 | Bacteria | 1671 |
| 888 | Ga0500593_118304 | 3300053117 | Unclassified | 1078 |
| 889 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 890 | Ga0500595_003348 | 3300053119 | Bacteria | 7528 |
| 891 | Ga0500595_003752 | 3300053119 | Bacteria | 6999 |
| 892 | Ga0500595_012265 | 3300053119 | Bacteria | 3320 |
| 893 | Ga0500595_012487 | 3300053119 | Bacteria | 3284 |
| 894 | Ga0500595_037246 | 3300053119 | Bacteria | 1588 |
| 895 | Ga0500595_046973 | 3300053119 | Bacteria | 1355 |
| 896 | Ga0500607_059315 | 3300053121 | Bacteria | 2011 |
| 897 | Ga0500642_0000477 | 3300053130 | Bacteria | 12415 |
| 898 | Ga0500642_0045664 | 3300053130 | Bacteria | 1912 |
| 899 | Ga0500642_0061116 | 3300053130 | Bacteria | 1692 |
| 900 | Ga0500559_0059280 | 3300053136 | Bacteria | 1704 |
| 901 | Ga0500564_172143 | 3300053138 | Bacteria | 909 |
| 902 | Ga0500568_0027931 | 3300053139 | Bacteria | 2356 |
| 903 | Ga0500573_0027650 | 3300053140 | Bacteria | 3262 |
| 904 | Ga0500586_000452 | 3300053145 | Bacteria | 8178 |
| 905 | Ga0500590_000992 | 3300053148 | Bacteria | 10984 |
| 906 | Ga0500590_037623 | 3300053148 | Bacteria | 2499 |
| 907 | Ga0500603_000280 | 3300053150 | Bacteria | 13469 |
| 908 | Ga0500603_001503 | 3300053150 | Bacteria | 5312 |
| 909 | Ga0500616_0022308 | 3300053153 | Bacteria | 3537 |
| 910 | Ga0500619_105282 | 3300053154 | Bacteria | 958 |
| 911 | Ga0500638_007811 | 3300053162 | Bacteria | 4512 |
| 912 | Ga0500638_139429 | 3300053162 | Bacteria | 1091 |
| 913 | Ga0500639_013828 | 3300053163 | Bacteria | 4243 |
| 914 | Ga0500639_062419 | 3300053163 | Bacteria | 1918 |
| 915 | Ga0500639_073945 | 3300053163 | Bacteria | 1730 |
| 916 | Ga0500636_0001993 | 3300053177 | Bacteria | 11232 |
| 917 | Ga0500636_0005628 | 3300053177 | Bacteria | 7160 |
| 918 | Ga0500637_0000653 | 3300053178 | Bacteria | 13761 |
| 919 | Ga0500637_0032662 | 3300053178 | Bacteria | 2902 |
| 920 | Ga0500637_0144347 | 3300053178 | Bacteria | 1377 |
| 921 | Ga0500609_015376 | 3300053731 | Bacteria | 1036 |
| 922 | Ga0500596_005506 | 3300053735 | Bacteria | 2218 |
| 923 | Ga0500599_007382 | 3300053736 | Bacteria | 1413 |
| 924 | Ga0500601_000310 | 3300053737 | Bacteria | 9139 |
| 925 | Ga0500661_000198 | 3300055283 | Bacteria | 10649 |
| 926 | Ga0466962_0088477 | 3300061719 | Bacteria | 1483 |
| 927 | Ga0530510_0531238 | 3300061734 | Bacteria | 893 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100387304 | Ga0068867_1003873042 | 211 |
| 2 | 3300005937 | Ga0081455_10004895 | Ga0081455_1000489511 | 211 |
| 3 | 3300005983 | Ga0081540_1010591 | Ga0081540_10105914 | 211 |
| 4 | 3300046524 | Ga0495648_0000619 | Ga0495648_0000619_5493_6212 | 211 |
| 5 | 3300031616 | Ga0307508_10000154 | Ga0307508_1000015454 | 212 |
| 6 | 3300044842 | Ga0466957_0195755 | Ga0466957_0195755_380_1090 | 212 |
| 7 | iso_pu_bacteria | 2824704595 | 2824714418 | 212 |
| 8 | iso_pu_bacteria | 2824671348 | 2824678909 | 213 |
| 9 | iso_pu_bacteria | 2824687955 | 2824695431 | 213 |
| 10 | 3300037853 | Ga0436364_1376044 | Ga0436364_1376044_72_782 | 214 |
| 11 | iso_pu_bacteria | 2824696289 | 2824703809 | 214 |
| 12 | 3300005339 | Ga0070660_100014405 | Ga0070660_1000144055 | 215 |
| 13 | 3300005366 | Ga0070659_100050519 | Ga0070659_1000505192 | 215 |
| 14 | 3300005530 | Ga0070679_100354758 | Ga0070679_1003547582 | 215 |
| 15 | 3300005539 | Ga0068853_100201553 | Ga0068853_1002015533 | 215 |
| 16 | 3300005616 | Ga0068852_100579129 | Ga0068852_1005791292 | 215 |
| 17 | 3300013104 | Ga0157370_10031768 | Ga0157370_100317681 | 215 |
| 18 | 3300013307 | Ga0157372_10027954 | Ga0157372_100279543 | 215 |
| 19 | 3300025919 | Ga0207657_10350377 | Ga0207657_103503771 | 215 |
| 20 | 3300025921 | Ga0207652_10632312 | Ga0207652_106323121 | 215 |
| 21 | 3300026041 | Ga0207639_10139648 | Ga0207639_101396482 | 215 |
| 22 | iso_pu_bacteria | 2824773399 | 2824781310 | 215 |
| 23 | 3300049775 | Ga0501279_005909 | Ga0501279_005909_660_1358 | 216 |
| 24 | 3300021384 | Ga0213876_10077997 | Ga0213876_100779973 | 217 |
| 25 | 3300039437 | Ga0436365_1627177 | Ga0436365_1627177_585_1295 | 217 |
| 26 | 3300025272 | Ga0209455_1031154 | Ga0209455_10311541 | 219 |
| 27 | 3300048906 | Ga0496103_0199871 | Ga0496103_0199871_500_1243 | 219 |
| 28 | 3300005339 | Ga0070660_100034372 | Ga0070660_1000343722 | 221 |
| 29 | 3300025919 | Ga0207657_10032543 | Ga0207657_100325434 | 221 |
| 30 | iso_pu_bacteria | 2857542790 | 2857547434 | 221 |
| 31 | iso_pu_bacteria | 8055225921 | 8055227679 | 221 |
| 32 | 3300044842 | Ga0466957_0380207 | Ga0466957_0380207_53_751 | 222 |
| 33 | 3300046455 | Ga0495603_0148374 | Ga0495603_0148374_224_943 | 222 |
| 34 | 3300046523 | Ga0495644_0072945 | Ga0495644_0072945_394_1113 | 222 |
| 35 | 3300047472 | Ga0495686_0329425 | Ga0495686_0329425_63_782 | 222 |
| 36 | 3300061719 | Ga0466962_0088477 | Ga0466962_0088477_192_890 | 222 |
| 37 | iso_pu_bacteria | 2643221558 | 2643814134 | 222 |
| 38 | 3300049665 | Ga0501227_002739 | Ga0501227_002739_2544_3227 | 223 |
| 39 | iso_pu_bacteria | 2855730933 | 2855734093 | 223 |
| 40 | iso_pu_bacteria | 2855767633 | 2855769683 | 223 |
| 41 | iso_pu_bacteria | 2881412998 | 2881414021 | 223 |
| 42 | iso_pu_bacteria | 8055431914 | 8055436055 | 224 |
| 43 | 3300003214 | JGI25165J46597_1012936 | JGI25165J46597_10129362 | 225 |
| 44 | 3300025261 | Ga0209233_1002119 | Ga0209233_10021195 | 225 |
| 45 | 3300048927 | Ga0496124_0000004 | Ga0496124_0000004_927089_927775 | 225 |
| 46 | 3300049572 | Ga0501036_0478362 | Ga0501036_0478362_252_953 | 225 |
| 47 | iso_pu_bacteria | 2718217997 | 2719669412 | 225 |
| 48 | iso_pu_bacteria | 2718218199 | 2720494428 | 225 |
| 49 | iso_pu_bacteria | 2718218232 | 2720610765 | 225 |
| 50 | iso_pu_bacteria | 2718218233 | 2720616643 | 225 |
| 51 | iso_pu_bacteria | 2718218235 | 2720628000 | 225 |
| 52 | iso_pu_bacteria | 2718218269 | 2720771580 | 225 |
| 53 | iso_pu_bacteria | 2721755684 | 2723563343 | 225 |
| 54 | iso_pu_bacteria | 2721755685 | 2723571334 | 225 |
| 55 | iso_pu_bacteria | 2721755819 | 2724087129 | 225 |
| 56 | iso_pu_bacteria | 2721755822 | 2724100840 | 225 |
| 57 | iso_pu_bacteria | 2721755823 | 2724108081 | 225 |
| 58 | iso_pu_bacteria | 2791355256 | 2793296096 | 225 |
| 59 | iso_pu_bacteria | 2791355261 | 2793328629 | 225 |
| 60 | iso_pu_bacteria | 2791355262 | 2793334728 | 225 |
| 61 | iso_pu_bacteria | 2791355264 | 2793348682 | 225 |
| 62 | iso_pu_bacteria | 2791355265 | 2793357190 | 225 |
| 63 | iso_pu_bacteria | 2802429605 | 2805929688 | 225 |
| 64 | iso_pu_bacteria | 2802429606 | 2805933036 | 225 |
| 65 | iso_pu_bacteria | 2838016132 | 2838019532 | 225 |
| 66 | iso_pu_bacteria | 2838061910 | 2838066316 | 225 |
| 67 | iso_pu_bacteria | 2838068647 | 2838072696 | 225 |
| 68 | iso_pu_bacteria | 2842205361 | 2842208620 | 225 |
| 69 | iso_pu_bacteria | 2842278818 | 2842282034 | 225 |
| 70 | iso_pu_bacteria | 2842285085 | 2842289080 | 225 |
| 71 | iso_pu_bacteria | 2842311132 | 2842313122 | 225 |
| 72 | iso_pu_bacteria | 2842402390 | 2842407286 | 225 |
| 73 | iso_pu_bacteria | 2842409023 | 2842413465 | 225 |
| 74 | iso_pu_bacteria | 2842415677 | 2842420108 | 225 |
| 75 | iso_pu_bacteria | 2842422224 | 2842426206 | 225 |
| 76 | iso_pu_bacteria | 2842428310 | 2842430009 | 225 |
| 77 | iso_pu_bacteria | 2842441272 | 2842442750 | 225 |
| 78 | iso_pu_bacteria | 2842447887 | 2842453813 | 225 |
| 79 | iso_pu_bacteria | 2842462802 | 2842464626 | 225 |
| 80 | iso_pu_bacteria | 2842469257 | 2842471006 | 225 |
| 81 | iso_pu_bacteria | 2842489311 | 2842490798 | 225 |
| 82 | iso_pu_bacteria | 2996887358 | 2996887414 | 225 |
| 83 | iso_pu_bacteria | 2996893221 | 2996895469 | 225 |
| 84 | iso_pu_bacteria | 8005258706 | 8005261976 | 225 |
| 85 | iso_pu_bacteria | 8005282627 | 8005287517 | 225 |
| 86 | iso_pu_bacteria | 8005289223 | 8005292323 | 225 |
| 87 | iso_pu_bacteria | 8005321885 | 8005321941 | 225 |
| 88 | iso_pu_bacteria | 8005382845 | 8005384299 | 225 |
| 89 | iso_pu_bacteria | 8005395548 | 8005401504 | 225 |
| 90 | iso_pu_bacteria | 8005430974 | 8005435996 | 225 |
| 91 | iso_pu_bacteria | 8005497431 | 8005503668 | 225 |
| 92 | iso_pu_bacteria | 8005619151 | 8005625669 | 225 |
| 93 | iso_pu_bacteria | 8005626139 | 8005632215 | 225 |
| 94 | iso_pu_bacteria | 8005668836 | 8005675546 | 225 |
| 95 | iso_pu_bacteria | 8024501048 | 8024507098 | 225 |
| 96 | iso_pu_bacteria | 8056382006 | 8056383013 | 225 |
| 97 | 3300009551 | Ga0105238_10351489 | Ga0105238_103514891 | 226 |
| 98 | 3300010375 | Ga0105239_10094671 | Ga0105239_100946713 | 226 |
| 99 | 3300041413 | Ga0439465_0010459 | Ga0439465_0010459_1598_2281 | 226 |
| 100 | 3300046507 | Ga0495606_0047029 | Ga0495606_0047029_1342_2025 | 226 |
| 101 | 3300046809 | Ga0495600_0211607 | Ga0495600_0211607_17_712 | 226 |
| 102 | 3300048927 | Ga0496124_0049279 | Ga0496124_0049279_965_1648 | 226 |
| 103 | 3300049575 | Ga0501039_0272995 | Ga0501039_0272995_190_894 | 226 |
| 104 | 3300049578 | Ga0501042_0159742 | Ga0501042_0159742_506_1210 | 226 |
| 105 | 3300049741 | Ga0501079_0125280 | Ga0501079_0125280_1005_1709 | 226 |
| 106 | 3300053148 | Ga0500590_000992 | Ga0500590_000992_8558_9253 | 226 |
| 107 | 3300003187 | JGI25151J46595_10000451 | JGI25151J46595_1000045127 | 227 |
| 108 | 3300005456 | Ga0070678_100078094 | Ga0070678_1000780943 | 227 |
| 109 | 3300005840 | Ga0068870_10139812 | Ga0068870_101398122 | 227 |
| 110 | 3300006051 | Ga0075364_10011381 | Ga0075364_100113813 | 227 |
| 111 | 3300014326 | Ga0157380_10534424 | Ga0157380_105344242 | 227 |
| 112 | 3300025294 | Ga0209025_1000003 | Ga0209025_1000003911 | 227 |
| 113 | 3300025908 | Ga0207643_10107871 | Ga0207643_101078712 | 227 |
| 114 | 3300026121 | Ga0207683_10049887 | Ga0207683_100498873 | 227 |
| 115 | 3300049572 | Ga0501036_0080390 | Ga0501036_0080390_1608_2330 | 227 |
| 116 | 3300050491 | nmdc:mga00v17_11205_c1 | nmdc:mga00v17_11205_c1_2375_3121 | 227 |
| 117 | 3300028379 | Ga0268266_10263322 | Ga0268266_102633221 | 228 |
| 118 | 3300049592 | Ga0501076_0021084 | Ga0501076_0021084_129_851 | 228 |
| 119 | 3300053096 | Ga0500641_0004044 | Ga0500641_0004044_4144_4863 | 228 |
| 120 | iso_pu_bacteria | 2511231028 | 2511397412 | 228 |
| 121 | iso_pu_bacteria | 2841957949 | 2841964872 | 228 |
| 122 | iso_pu_bacteria | 3005594810 | 3005595304 | 228 |
| 123 | 3300005262 | Ga0065165_1022241 | Ga0065165_10222412 | 229 |
| 124 | 3300005548 | Ga0070665_100134738 | Ga0070665_1001347382 | 229 |
| 125 | 3300009763 | Ga0123340_1000167 | Ga0123340_100016711 | 229 |
| 126 | 3300009765 | Ga0123341_1010909 | Ga0123341_10109092 | 229 |
| 127 | 3300009765 | Ga0123341_1063720 | Ga0123341_10637202 | 229 |
| 128 | 3300009766 | Ga0123342_1018186 | Ga0123342_10181865 | 229 |
| 129 | 3300013100 | Ga0157373_10049148 | Ga0157373_100491484 | 229 |
| 130 | 3300025245 | Ga0207425_1010250 | Ga0207425_10102502 | 229 |
| 131 | 3300025258 | Ga0209129_1000489 | Ga0209129_10004898 | 229 |
| 132 | 3300025294 | Ga0209025_1002657 | Ga0209025_10026578 | 229 |
| 133 | 3300025297 | Ga0209758_1003221 | Ga0209758_10032214 | 229 |
| 134 | 3300025297 | Ga0209758_1004001 | Ga0209758_10040019 | 229 |
| 135 | 3300048925 | Ga0496122_0000072 | Ga0496122_0000072_203162_203893 | 229 |
| 136 | 3300048926 | Ga0496123_0000035 | Ga0496123_0000035_248014_248745 | 229 |
| 137 | 3300048927 | Ga0496124_0340935 | Ga0496124_0340935_113_844 | 229 |
| 138 | 3300048928 | Ga0496125_0379349 | Ga0496125_0379349_82_813 | 229 |
| 139 | 3300050489 | nmdc:mga03683_82892_c1 | nmdc:mga03683_82892_c1_445_1164 | 229 |
| 140 | 3300053096 | Ga0500641_0028998 | Ga0500641_0028998_1180_1899 | 229 |
| 141 | 3300053111 | Ga0500572_022921 | Ga0500572_022921_769_1461 | 229 |
| 142 | 3300053117 | Ga0500593_118304 | Ga0500593_118304_124_864 | 229 |
| 143 | 3300053140 | Ga0500573_0027650 | Ga0500573_0027650_1725_2438 | 229 |
| 144 | 3300053177 | Ga0500636_0005628 | Ga0500636_0005628_568_1260 | 229 |
| 145 | iso_pu_bacteria | 2882456835 | 2882458745 | 229 |
| 146 | 3300005844 | Ga0068862_100012465 | Ga0068862_1000124652 | 230 |
| 147 | 3300005844 | Ga0068862_100489020 | Ga0068862_1004890201 | 230 |
| 148 | 3300006038 | Ga0075365_10093839 | Ga0075365_100938392 | 230 |
| 149 | 3300006038 | Ga0075365_10311713 | Ga0075365_103117131 | 230 |
| 150 | 3300006042 | Ga0075368_10035929 | Ga0075368_100359292 | 230 |
| 151 | 3300006051 | Ga0075364_10223317 | Ga0075364_102233171 | 230 |
| 152 | 3300028380 | Ga0268265_10002012 | Ga0268265_100020127 | 230 |
| 153 | 3300030731 | Ga0316177_1142486 | Ga0316177_11424861 | 230 |
| 154 | 3300030735 | Ga0316178_1062662 | Ga0316178_10626622 | 230 |
| 155 | 3300031548 | Ga0307408_100000252 | Ga0307408_10000025218 | 230 |
| 156 | 3300048917 | Ga0496114_0117355 | Ga0496114_0117355_1070_1789 | 230 |
| 157 | 3300050489 | nmdc:mga03683_147991_c1 | nmdc:mga03683_147991_c1_321_1022 | 230 |
| 158 | 3300050516 | nmdc:mga0sz30_37766_c1 | nmdc:mga0sz30_37766_c1_669_1370 | 230 |
| 159 | 3300053087 | Ga0500643_018379 | Ga0500643_018379_902_1603 | 230 |
| 160 | iso_pu_bacteria | 2513237095 | 2513652611 | 230 |
| 161 | iso_pu_bacteria | 2517093001 | 2517107618 | 230 |
| 162 | iso_pu_bacteria | 2816332527 | 2818239028 | 230 |
| 163 | iso_pu_bacteria | 2824753945 | 2824761398 | 230 |
| 164 | iso_pu_bacteria | 2824763712 | 2824768529 | 230 |
| 165 | iso_pu_bacteria | 2874612657 | 2874619948 | 230 |
| 166 | iso_pu_bacteria | 2879099564 | 2879106863 | 230 |
| 167 | iso_pu_bacteria | 2888378607 | 2888379326 | 230 |
| 168 | iso_pu_bacteria | 2904711408 | 2904714030 | 230 |
| 169 | iso_pu_bacteria | 2932784394 | 2932791058 | 230 |
| 170 | iso_pu_bacteria | 2932794094 | 2932800044 | 230 |
| 171 | iso_pu_bacteria | 2932801729 | 2932809053 | 230 |
| 172 | iso_pu_bacteria | 2932809354 | 2932817942 | 230 |
| 173 | iso_pu_bacteria | 2932818245 | 2932820573 | 230 |
| 174 | iso_pu_bacteria | 2932828146 | 2932837136 | 230 |
| 175 | iso_pu_bacteria | 2935616580 | 2935624367 | 230 |
| 176 | iso_pu_bacteria | 2935638405 | 2935644358 | 230 |
| 177 | iso_pu_bacteria | 2935665750 | 2935674727 | 230 |
| 178 | iso_pu_bacteria | 2935694250 | 2935701663 | 230 |
| 179 | iso_pu_bacteria | 2935703347 | 2935710391 | 230 |
| 180 | iso_pu_bacteria | 2935760218 | 2935764945 | 230 |
| 181 | iso_pu_bacteria | 2935801545 | 2935810511 | 230 |
| 182 | iso_pu_bacteria | 2935827899 | 2935833398 | 230 |
| 183 | iso_pu_bacteria | 2935837841 | 2935846046 | 230 |
| 184 | iso_pu_bacteria | 2935855204 | 2935863086 | 230 |
| 185 | iso_pu_bacteria | 2935864058 | 2935873458 | 230 |
| 186 | iso_pu_bacteria | 2935873716 | 2935879980 | 230 |
| 187 | iso_pu_bacteria | 2935883170 | 2935888260 | 230 |
| 188 | iso_pu_bacteria | 2935992306 | 2935997798 | 230 |
| 189 | iso_pu_bacteria | 2936002035 | 2936010994 | 230 |
| 190 | iso_pu_bacteria | 2941531003 | 2941537946 | 230 |
| 191 | iso_pu_bacteria | 2941538514 | 2941547073 | 230 |
| 192 | iso_pu_bacteria | 8016511872 | 8016517909 | 230 |
| 193 | iso_pu_bacteria | 8017057580 | 8017058727 | 230 |
| 194 | iso_pu_bacteria | 8019576017 | 8019576926 | 230 |
| 195 | iso_pu_bacteria | 8019586578 | 8019594988 | 230 |
| 196 | iso_pu_bacteria | 8019597564 | 8019606752 | 230 |
| 197 | iso_pu_bacteria | 8019608314 | 8019611756 | 230 |
| 198 | iso_pu_bacteria | 8056967851 | 8056975788 | 230 |
| 199 | 3300005337 | Ga0070682_100349336 | Ga0070682_1003493361 | 231 |
| 200 | 3300005344 | Ga0070661_100002881 | Ga0070661_10000288112 | 231 |
| 201 | 3300005347 | Ga0070668_100066527 | Ga0070668_1000665272 | 231 |
| 202 | 3300005354 | Ga0070675_100697504 | Ga0070675_1006975041 | 231 |
| 203 | 3300005455 | Ga0070663_100000598 | Ga0070663_1000005983 | 231 |
| 204 | 3300005543 | Ga0070672_100127479 | Ga0070672_1001274792 | 231 |
| 205 | 3300005563 | Ga0068855_100019755 | Ga0068855_1000197554 | 231 |
| 206 | 3300005564 | Ga0070664_100003791 | Ga0070664_1000037915 | 231 |
| 207 | 3300005614 | Ga0068856_100002355 | Ga0068856_1000023555 | 231 |
| 208 | 3300005616 | Ga0068852_100018956 | Ga0068852_1000189562 | 231 |
| 209 | 3300007076 | Ga0075435_100222013 | Ga0075435_1002220132 | 231 |
| 210 | 3300025907 | Ga0207645_10112693 | Ga0207645_101126932 | 231 |
| 211 | 3300025912 | Ga0207707_10190557 | Ga0207707_101905572 | 231 |
| 212 | 3300025919 | Ga0207657_10000510 | Ga0207657_100005104 | 231 |
| 213 | 3300025920 | Ga0207649_10018858 | Ga0207649_100188584 | 231 |
| 214 | 3300025923 | Ga0207681_10047401 | Ga0207681_100474012 | 231 |
| 215 | 3300025926 | Ga0207659_10500644 | Ga0207659_105006442 | 231 |
| 216 | 3300025931 | Ga0207644_10003534 | Ga0207644_100035344 | 231 |
| 217 | 3300025932 | Ga0207690_10000725 | Ga0207690_1000072517 | 231 |
| 218 | 3300025933 | Ga0207706_10000093 | Ga0207706_1000009311 | 231 |
| 219 | 3300025940 | Ga0207691_10056371 | Ga0207691_100563714 | 231 |
| 220 | 3300025945 | Ga0207679_10139755 | Ga0207679_101397552 | 231 |
| 221 | 3300025949 | Ga0207667_10003071 | Ga0207667_1000307111 | 231 |
| 222 | 3300025981 | Ga0207640_10062308 | Ga0207640_100623082 | 231 |
| 223 | 3300025986 | Ga0207658_10046691 | Ga0207658_100466912 | 231 |
| 224 | 3300026023 | Ga0207677_10068509 | Ga0207677_100685092 | 231 |
| 225 | 3300026067 | Ga0207678_10030242 | Ga0207678_100302422 | 231 |
| 226 | 3300026121 | Ga0207683_10078177 | Ga0207683_100781773 | 231 |
| 227 | 3300026142 | Ga0207698_10114172 | Ga0207698_101141722 | 231 |
| 228 | 3300031616 | Ga0307508_10144852 | Ga0307508_101448522 | 231 |
| 229 | 3300049662 | Ga0501222_019810 | Ga0501222_019810_44_751 | 231 |
| 230 | 3300049775 | Ga0501279_002614 | Ga0501279_002614_647_1354 | 231 |
| 231 | 3300003323 | rootH1_10058417 | rootH1_100584173 | 232 |
| 232 | 3300005327 | Ga0070658_10110967 | Ga0070658_101109673 | 232 |
| 233 | 3300005336 | Ga0070680_100005214 | Ga0070680_1000052142 | 232 |
| 234 | 3300005338 | Ga0068868_100086679 | Ga0068868_1000866792 | 232 |
| 235 | 3300005339 | Ga0070660_100021819 | Ga0070660_1000218192 | 232 |
| 236 | 3300005339 | Ga0070660_100068342 | Ga0070660_1000683423 | 232 |
| 237 | 3300005355 | Ga0070671_100015188 | Ga0070671_1000151883 | 232 |
| 238 | 3300005367 | Ga0070667_100149367 | Ga0070667_1001493672 | 232 |
| 239 | 3300005435 | Ga0070714_100231515 | Ga0070714_1002315152 | 232 |
| 240 | 3300005456 | Ga0070678_100024855 | Ga0070678_1000248553 | 232 |
| 241 | 3300005457 | Ga0070662_100007191 | Ga0070662_1000071914 | 232 |
| 242 | 3300005458 | Ga0070681_10104996 | Ga0070681_101049963 | 232 |
| 243 | 3300005458 | Ga0070681_10139645 | Ga0070681_101396452 | 232 |
| 244 | 3300005530 | Ga0070679_100262422 | Ga0070679_1002624221 | 232 |
| 245 | 3300005535 | Ga0070684_100588559 | Ga0070684_1005885592 | 232 |
| 246 | 3300005563 | Ga0068855_100355831 | Ga0068855_1003558311 | 232 |
| 247 | 3300005563 | Ga0068855_100454851 | Ga0068855_1004548512 | 232 |
| 248 | 3300005614 | Ga0068856_100368275 | Ga0068856_1003682752 | 232 |
| 249 | 3300005616 | Ga0068852_100082923 | Ga0068852_1000829232 | 232 |
| 250 | 3300005616 | Ga0068852_100360141 | Ga0068852_1003601412 | 232 |
| 251 | 3300005983 | Ga0081540_1004561 | Ga0081540_10045619 | 232 |
| 252 | 3300013100 | Ga0157373_10000647 | Ga0157373_100006474 | 232 |
| 253 | 3300013102 | Ga0157371_10028934 | Ga0157371_100289342 | 232 |
| 254 | 3300013105 | Ga0157369_10159097 | Ga0157369_101590972 | 232 |
| 255 | 3300013307 | Ga0157372_10000593 | Ga0157372_1000059330 | 232 |
| 256 | 3300025297 | Ga0209758_1051646 | Ga0209758_10516462 | 232 |
| 257 | 3300025909 | Ga0207705_10348081 | Ga0207705_103480812 | 232 |
| 258 | 3300025917 | Ga0207660_10012643 | Ga0207660_100126431 | 232 |
| 259 | 3300025919 | Ga0207657_10053216 | Ga0207657_100532165 | 232 |
| 260 | 3300025921 | Ga0207652_10042542 | Ga0207652_100425425 | 232 |
| 261 | 3300025929 | Ga0207664_10270537 | Ga0207664_102705372 | 232 |
| 262 | 3300025949 | Ga0207667_10076640 | Ga0207667_100766402 | 232 |
| 263 | 3300025949 | Ga0207667_10091474 | Ga0207667_100914741 | 232 |
| 264 | 3300026041 | Ga0207639_10051447 | Ga0207639_100514471 | 232 |
| 265 | 3300026078 | Ga0207702_10004987 | Ga0207702_100049871 | 232 |
| 266 | 3300026078 | Ga0207702_11196976 | Ga0207702_111969761 | 232 |
| 267 | 3300026142 | Ga0207698_10054572 | Ga0207698_100545722 | 232 |
| 268 | 3300031595 | Ga0265313_10085917 | Ga0265313_100859172 | 232 |
| 269 | 3300031711 | Ga0265314_10084709 | Ga0265314_100847092 | 232 |
| 270 | 3300031712 | Ga0265342_10000687 | Ga0265342_1000068726 | 232 |
| 271 | 3300048909 | Ga0496106_0006629 | Ga0496106_0006629_188_892 | 232 |
| 272 | 3300049581 | Ga0501047_0191466 | Ga0501047_0191466_65_763 | 232 |
| 273 | 3300049742 | Ga0501080_0452554 | Ga0501080_0452554_254_952 | 232 |
| 274 | 3300049823 | Ga0501044_0214807 | Ga0501044_0214807_740_1438 | 232 |
| 275 | iso_pu_bacteria | 2929615660 | 2929618869 | 232 |
| 276 | iso_pu_bacteria | 2929624759 | 2929630946 | 232 |
| 277 | iso_pu_bacteria | 2933577622 | 2933580421 | 232 |
| 278 | iso_pu_bacteria | 8055742211 | 8055742718 | 232 |
| 279 | 3300002773 | JGI25152J39213_1001108 | JGI25152J39213_10011087 | 233 |
| 280 | 3300003187 | JGI25151J46595_10012763 | JGI25151J46595_100127632 | 233 |
| 281 | 3300003215 | JGI25153J46596_10001849 | JGI25153J46596_100018497 | 233 |
| 282 | 3300005336 | Ga0070680_100011561 | Ga0070680_1000115615 | 233 |
| 283 | 3300005339 | Ga0070660_100193274 | Ga0070660_1001932742 | 233 |
| 284 | 3300005530 | Ga0070679_100240604 | Ga0070679_1002406042 | 233 |
| 285 | 3300005614 | Ga0068856_100083923 | Ga0068856_1000839233 | 233 |
| 286 | 3300009093 | Ga0105240_10575624 | Ga0105240_105756242 | 233 |
| 287 | 3300013102 | Ga0157371_10173482 | Ga0157371_101734821 | 233 |
| 288 | 3300013104 | Ga0157370_10029317 | Ga0157370_100293174 | 233 |
| 289 | 3300013105 | Ga0157369_10215276 | Ga0157369_102152762 | 233 |
| 290 | 3300020070 | Ga0206356_10161480 | Ga0206356_101614803 | 233 |
| 291 | 3300025230 | Ga0209563_100670 | Ga0209563_1006703 | 233 |
| 292 | 3300025253 | Ga0209677_101711 | Ga0209677_1017119 | 233 |
| 293 | 3300025297 | Ga0209758_1036140 | Ga0209758_10361402 | 233 |
| 294 | 3300025909 | Ga0207705_10034198 | Ga0207705_100341982 | 233 |
| 295 | 3300025912 | Ga0207707_10159207 | Ga0207707_101592072 | 233 |
| 296 | 3300025913 | Ga0207695_10195650 | Ga0207695_101956502 | 233 |
| 297 | 3300025917 | Ga0207660_10329673 | Ga0207660_103296732 | 233 |
| 298 | 3300025919 | Ga0207657_10187229 | Ga0207657_101872292 | 233 |
| 299 | 3300025921 | Ga0207652_10023363 | Ga0207652_100233632 | 233 |
| 300 | 3300025949 | Ga0207667_10375327 | Ga0207667_103753271 | 233 |
| 301 | 3300026078 | Ga0207702_10452340 | Ga0207702_104523401 | 233 |
| 302 | 3300037471 | Ga0395905_0003426 | Ga0395905_0003426_8345_9061 | 233 |
| 303 | 3300046683 | Ga0495658_0259591 | Ga0495658_0259591_331_1035 | 233 |
| 304 | 3300053087 | Ga0500643_000160 | Ga0500643_000160_8037_8744 | 233 |
| 305 | iso_pu_bacteria | 2513237139 | 2513879266 | 233 |
| 306 | iso_pu_bacteria | 2617270735 | 2617354363 | 233 |
| 307 | iso_pu_bacteria | 2802429603 | 2805921586 | 233 |
| 308 | iso_pu_bacteria | 2838122688 | 2838130159 | 233 |
| 309 | iso_pu_bacteria | 2841983080 | 2841990707 | 233 |
| 310 | iso_pu_bacteria | 2847930680 | 2847931313 | 233 |
| 311 | iso_pu_bacteria | 2847939898 | 2847942404 | 233 |
| 312 | iso_pu_bacteria | 2879083081 | 2879087646 | 233 |
| 313 | 3300005331 | Ga0070670_100403626 | Ga0070670_1004036261 | 234 |
| 314 | 3300005347 | Ga0070668_100025268 | Ga0070668_1000252682 | 234 |
| 315 | 3300005354 | Ga0070675_100311874 | Ga0070675_1003118742 | 234 |
| 316 | 3300005355 | Ga0070671_100063445 | Ga0070671_1000634452 | 234 |
| 317 | 3300005455 | Ga0070663_100017095 | Ga0070663_1000170952 | 234 |
| 318 | 3300005539 | Ga0068853_100175878 | Ga0068853_1001758782 | 234 |
| 319 | 3300005548 | Ga0070665_100015557 | Ga0070665_1000155572 | 234 |
| 320 | 3300005564 | Ga0070664_100082048 | Ga0070664_1000820482 | 234 |
| 321 | 3300005578 | Ga0068854_100805751 | Ga0068854_1008057511 | 234 |
| 322 | 3300005616 | Ga0068852_100008549 | Ga0068852_1000085495 | 234 |
| 323 | 3300005618 | Ga0068864_100821211 | Ga0068864_1008212111 | 234 |
| 324 | 3300005834 | Ga0068851_10324908 | Ga0068851_103249081 | 234 |
| 325 | 3300005842 | Ga0068858_100365844 | Ga0068858_1003658442 | 234 |
| 326 | 3300005983 | Ga0081540_1036693 | Ga0081540_10366932 | 234 |
| 327 | 3300006051 | Ga0075364_10020053 | Ga0075364_100200533 | 234 |
| 328 | 3300006178 | Ga0075367_10159273 | Ga0075367_101592731 | 234 |
| 329 | 3300006353 | Ga0075370_10012846 | Ga0075370_100128464 | 234 |
| 330 | 3300006881 | Ga0068865_100425324 | Ga0068865_1004253242 | 234 |
| 331 | 3300009093 | Ga0105240_10015922 | Ga0105240_100159226 | 234 |
| 332 | 3300009098 | Ga0105245_10044825 | Ga0105245_100448254 | 234 |
| 333 | 3300009098 | Ga0105245_10183066 | Ga0105245_101830662 | 234 |
| 334 | 3300009148 | Ga0105243_10249007 | Ga0105243_102490072 | 234 |
| 335 | 3300009174 | Ga0105241_10174490 | Ga0105241_101744902 | 234 |
| 336 | 3300009174 | Ga0105241_10412078 | Ga0105241_104120781 | 234 |
| 337 | 3300009177 | Ga0105248_10942923 | Ga0105248_109429232 | 234 |
| 338 | 3300009545 | Ga0105237_10009776 | Ga0105237_100097767 | 234 |
| 339 | 3300009545 | Ga0105237_10016276 | Ga0105237_100162764 | 234 |
| 340 | 3300009551 | Ga0105238_10685202 | Ga0105238_106852021 | 234 |
| 341 | 3300010375 | Ga0105239_10040749 | Ga0105239_100407493 | 234 |
| 342 | 3300013296 | Ga0157374_10164035 | Ga0157374_101640351 | 234 |
| 343 | 3300014745 | Ga0157377_10027973 | Ga0157377_100279732 | 234 |
| 344 | 3300014969 | Ga0157376_10713806 | Ga0157376_107138062 | 234 |
| 345 | 3300025304 | Ga0209257_1007061 | Ga0209257_10070614 | 234 |
| 346 | 3300025904 | Ga0207647_10002968 | Ga0207647_1000296812 | 234 |
| 347 | 3300025913 | Ga0207695_10001156 | Ga0207695_1000115610 | 234 |
| 348 | 3300025914 | Ga0207671_10009815 | Ga0207671_100098158 | 234 |
| 349 | 3300025925 | Ga0207650_10728091 | Ga0207650_107280912 | 234 |
| 350 | 3300025932 | Ga0207690_10566500 | Ga0207690_105665002 | 234 |
| 351 | 3300025938 | Ga0207704_10455356 | Ga0207704_104553562 | 234 |
| 352 | 3300025945 | Ga0207679_10352563 | Ga0207679_103525631 | 234 |
| 353 | 3300025949 | Ga0207667_11023390 | Ga0207667_110233901 | 234 |
| 354 | 3300026035 | Ga0207703_10075570 | Ga0207703_100755702 | 234 |
| 355 | 3300026041 | Ga0207639_10303926 | Ga0207639_103039262 | 234 |
| 356 | 3300026067 | Ga0207678_10019543 | Ga0207678_100195434 | 234 |
| 357 | 3300026088 | Ga0207641_10404061 | Ga0207641_104040612 | 234 |
| 358 | 3300026095 | Ga0207676_10680803 | Ga0207676_106808031 | 234 |
| 359 | 3300028379 | Ga0268266_10688045 | Ga0268266_106880451 | 234 |
| 360 | 3300033180 | Ga0307510_10020868 | Ga0307510_100208682 | 234 |
| 361 | 3300044694 | Ga0466963_0274646 | Ga0466963_0274646_34_738 | 234 |
| 362 | 3300045836 | Ga0466958_0104327 | Ga0466958_0104327_144_848 | 234 |
| 363 | 3300045976 | Ga0466967_0001133 | Ga0466967_0001133_11248_11952 | 234 |
| 364 | 3300046462 | Ga0495651_0012151 | Ga0495651_0012151_1964_2668 | 234 |
| 365 | 3300046463 | Ga0495653_0101966 | Ga0495653_0101966_307_1011 | 234 |
| 366 | 3300046477 | Ga0495664_0315894 | Ga0495664_0315894_121_825 | 234 |
| 367 | 3300046507 | Ga0495606_0106966 | Ga0495606_0106966_203_913 | 234 |
| 368 | 3300046512 | Ga0495610_0136409 | Ga0495610_0136409_285_989 | 234 |
| 369 | 3300046513 | Ga0495616_0032705 | Ga0495616_0032705_1995_2699 | 234 |
| 370 | 3300046516 | Ga0495628_0029830 | Ga0495628_0029830_2078_2782 | 234 |
| 371 | 3300046516 | Ga0495628_0294238 | Ga0495628_0294238_254_958 | 234 |
| 372 | 3300046519 | Ga0495632_0067614 | Ga0495632_0067614_850_1554 | 234 |
| 373 | 3300046524 | Ga0495648_0006267 | Ga0495648_0006267_666_1370 | 234 |
| 374 | 3300046529 | Ga0495652_0006258 | Ga0495652_0006258_9685_10389 | 234 |
| 375 | 3300046529 | Ga0495652_0232304 | Ga0495652_0232304_107_811 | 234 |
| 376 | 3300046533 | Ga0495640_0124019 | Ga0495640_0124019_21_725 | 234 |
| 377 | 3300046533 | Ga0495640_0229529 | Ga0495640_0229529_88_792 | 234 |
| 378 | 3300046536 | Ga0495587_0032889 | Ga0495587_0032889_87_791 | 234 |
| 379 | 3300046543 | Ga0495645_0002277 | Ga0495645_0002277_1769_2473 | 234 |
| 380 | 3300046557 | Ga0495622_0033182 | Ga0495622_0033182_192_902 | 234 |
| 381 | 3300046557 | Ga0495622_0072635 | Ga0495622_0072635_529_1233 | 234 |
| 382 | 3300046642 | Ga0495634_0047054 | Ga0495634_0047054_36_740 | 234 |
| 383 | 3300046663 | Ga0495635_0045072 | Ga0495635_0045072_1707_2411 | 234 |
| 384 | 3300046665 | Ga0495661_0137567 | Ga0495661_0137567_149_859 | 234 |
| 385 | 3300046674 | Ga0495588_0081788 | Ga0495588_0081788_569_1279 | 234 |
| 386 | 3300046675 | Ga0495657_0021179 | Ga0495657_0021179_1703_2407 | 234 |
| 387 | 3300046675 | Ga0495657_0060848 | Ga0495657_0060848_1781_2485 | 234 |
| 388 | 3300046680 | Ga0495646_0077067 | Ga0495646_0077067_401_1105 | 234 |
| 389 | 3300046689 | Ga0495613_0082107 | Ga0495613_0082107_515_1219 | 234 |
| 390 | 3300046809 | Ga0495600_0004756 | Ga0495600_0004756_5954_6658 | 234 |
| 391 | 3300046810 | Ga0495660_0165806 | Ga0495660_0165806_302_1012 | 234 |
| 392 | 3300047315 | Ga0495581_0037772 | Ga0495581_0037772_1969_2673 | 234 |
| 393 | 3300047317 | Ga0495604_0005707 | Ga0495604_0005707_6602_7306 | 234 |
| 394 | 3300047317 | Ga0495604_0347989 | Ga0495604_0347989_229_933 | 234 |
| 395 | 3300047319 | Ga0495674_0033870 | Ga0495674_0033870_285_989 | 234 |
| 396 | 3300047321 | Ga0495676_0165304 | Ga0495676_0165304_360_1070 | 234 |
| 397 | 3300047322 | Ga0495680_0181214 | Ga0495680_0181214_412_1116 | 234 |
| 398 | 3300047323 | Ga0495683_0026647 | Ga0495683_0026647_1377_2081 | 234 |
| 399 | 3300047443 | Ga0495687_003554 | Ga0495687_003554_7069_7773 | 234 |
| 400 | 3300047444 | Ga0495675_0022183 | Ga0495675_0022183_2625_3329 | 234 |
| 401 | 3300047471 | Ga0495684_0014657 | Ga0495684_0014657_4007_4711 | 234 |
| 402 | 3300048088 | Ga0495602_0055398 | Ga0495602_0055398_2320_3024 | 234 |
| 403 | 3300048903 | Ga0496100_0057050 | Ga0496100_0057050_1406_2110 | 234 |
| 404 | 3300048904 | Ga0496101_0079991 | Ga0496101_0079991_652_1362 | 234 |
| 405 | 3300048907 | Ga0496104_0259136 | Ga0496104_0259136_109_819 | 234 |
| 406 | 3300048908 | Ga0496105_0248534 | Ga0496105_0248534_689_1399 | 234 |
| 407 | 3300048908 | Ga0496105_0636787 | Ga0496105_0636787_90_800 | 234 |
| 408 | 3300048911 | Ga0496108_0874853 | Ga0496108_0874853_11_721 | 234 |
| 409 | 3300048914 | Ga0496111_0021035 | Ga0496111_0021035_2572_3276 | 234 |
| 410 | 3300048915 | Ga0496112_0074644 | Ga0496112_0074644_338_1042 | 234 |
| 411 | 3300048916 | Ga0496113_0048688 | Ga0496113_0048688_2198_2902 | 234 |
| 412 | 3300048918 | Ga0496115_0081154 | Ga0496115_0081154_579_1289 | 234 |
| 413 | 3300048920 | Ga0496117_0139628 | Ga0496117_0139628_397_1101 | 234 |
| 414 | 3300048920 | Ga0496117_0148990 | Ga0496117_0148990_647_1351 | 234 |
| 415 | 3300048921 | Ga0496118_0104340 | Ga0496118_0104340_1065_1775 | 234 |
| 416 | 3300048922 | Ga0496119_0022541 | Ga0496119_0022541_117_821 | 234 |
| 417 | 3300048923 | Ga0496120_0111142 | Ga0496120_0111142_106_810 | 234 |
| 418 | 3300048924 | Ga0496121_0014968 | Ga0496121_0014968_5096_5806 | 234 |
| 419 | 3300048924 | Ga0496121_0176268 | Ga0496121_0176268_51_755 | 234 |
| 420 | 3300048927 | Ga0496124_0051307 | Ga0496124_0051307_1031_1735 | 234 |
| 421 | 3300048929 | Ga0496126_0030491 | Ga0496126_0030491_300_1004 | 234 |
| 422 | 3300050492 | nmdc:mga0yw44_71313_c1 | nmdc:mga0yw44_71313_c1_401_1105 | 234 |
| 423 | 3300053084 | Ga0495595_0046772 | Ga0495595_0046772_37_741 | 234 |
| 424 | 3300053085 | Ga0495619_0295850 | Ga0495619_0295850_280_984 | 234 |
| 425 | 3300053086 | Ga0500578_0271687 | Ga0500578_0271687_79_789 | 234 |
| 426 | 3300053092 | Ga0500583_0171510 | Ga0500583_0171510_71_781 | 234 |
| 427 | 3300053104 | Ga0500556_0008987 | Ga0500556_0008987_270_980 | 234 |
| 428 | 3300053119 | Ga0500595_012265 | Ga0500595_012265_2379_3083 | 234 |
| 429 | 3300053130 | Ga0500642_0045664 | Ga0500642_0045664_830_1540 | 234 |
| 430 | 3300053153 | Ga0500616_0022308 | Ga0500616_0022308_24_734 | 234 |
| 431 | 3300053162 | Ga0500638_139429 | Ga0500638_139429_144_848 | 234 |
| 432 | 3300053736 | Ga0500599_007382 | Ga0500599_007382_353_1063 | 234 |
| 433 | iso_pu_bacteria | 2507262055 | 2507505509 | 234 |
| 434 | iso_pu_bacteria | 2508501009 | 2508539394 | 234 |
| 435 | iso_pu_bacteria | 2508501042 | 2508695725 | 234 |
| 436 | iso_pu_bacteria | 2513237094 | 2513642384 | 234 |
| 437 | iso_pu_bacteria | 2513237101 | 2513698872 | 234 |
| 438 | iso_pu_bacteria | 2513237104 | 2513721907 | 234 |
| 439 | iso_pu_bacteria | 2513237161 | 2514016903 | 234 |
| 440 | iso_pu_bacteria | 2515154112 | 2515630195 | 234 |
| 441 | iso_pu_bacteria | 2524023205 | 2524441949 | 234 |
| 442 | iso_pu_bacteria | 2524023210 | 2524468123 | 234 |
| 443 | iso_pu_bacteria | 2528768022 | 2528851899 | 234 |
| 444 | iso_pu_bacteria | 2721755755 | 2723841887 | 234 |
| 445 | iso_pu_bacteria | 2744054633 | 2745082749 | 234 |
| 446 | iso_pu_bacteria | 2791355196 | 2793065716 | 234 |
| 447 | iso_pu_bacteria | 2791355199 | 2793079183 | 234 |
| 448 | iso_pu_bacteria | 2824653114 | 2824660248 | 234 |
| 449 | iso_pu_bacteria | 2841941048 | 2841949206 | 234 |
| 450 | iso_pu_bacteria | 2841949485 | 2841956988 | 234 |
| 451 | iso_pu_bacteria | 2841966195 | 2841974462 | 234 |
| 452 | iso_pu_bacteria | 2841974524 | 2841977394 | 234 |
| 453 | iso_pu_bacteria | 2842038055 | 2842041240 | 234 |
| 454 | iso_pu_bacteria | 2842045827 | 2842049282 | 234 |
| 455 | iso_pu_bacteria | 2857509624 | 2857516435 | 234 |
| 456 | iso_pu_bacteria | 2874590934 | 2874592584 | 234 |
| 457 | iso_pu_bacteria | 2874604998 | 2874610517 | 234 |
| 458 | iso_pu_bacteria | 2874620515 | 2874622988 | 234 |
| 459 | iso_pu_bacteria | 2874645413 | 2874647408 | 234 |
| 460 | iso_pu_bacteria | 2876761206 | 2876763769 | 234 |
| 461 | iso_pu_bacteria | 2876771140 | 2876772708 | 234 |
| 462 | iso_pu_bacteria | 2876808645 | 2876818214 | 234 |
| 463 | iso_pu_bacteria | 2876818435 | 2876820041 | 234 |
| 464 | iso_pu_bacteria | 2879074833 | 2879076546 | 234 |
| 465 | iso_pu_bacteria | 2879110137 | 2879115161 | 234 |
| 466 | iso_pu_bacteria | 2879127579 | 2879129180 | 234 |
| 467 | iso_pu_bacteria | 2879142872 | 2879144819 | 234 |
| 468 | iso_pu_bacteria | 2885383462 | 2885388425 | 234 |
| 469 | iso_pu_bacteria | 2888419890 | 2888420018 | 234 |
| 470 | iso_pu_bacteria | 2889033259 | 2889035199 | 234 |
| 471 | iso_pu_bacteria | 2904666416 | 2904668950 | 234 |
| 472 | iso_pu_bacteria | 2922361189 | 2922363274 | 234 |
| 473 | iso_pu_bacteria | 2922368715 | 2922369231 | 234 |
| 474 | iso_pu_bacteria | 2922386360 | 2922388801 | 234 |
| 475 | iso_pu_bacteria | 2935608549 | 2935614565 | 234 |
| 476 | iso_pu_bacteria | 2935648319 | 2935654728 | 234 |
| 477 | iso_pu_bacteria | 2935656913 | 2935663608 | 234 |
| 478 | iso_pu_bacteria | 2935675223 | 2935684713 | 234 |
| 479 | iso_pu_bacteria | 2935684952 | 2935686659 | 234 |
| 480 | iso_pu_bacteria | 2935713505 | 2935716347 | 234 |
| 481 | iso_pu_bacteria | 2935722832 | 2935723528 | 234 |
| 482 | iso_pu_bacteria | 2935732158 | 2935735084 | 234 |
| 483 | iso_pu_bacteria | 2935741537 | 2935744125 | 234 |
| 484 | iso_pu_bacteria | 2935750917 | 2935752625 | 234 |
| 485 | iso_pu_bacteria | 2935777560 | 2935778272 | 234 |
| 486 | iso_pu_bacteria | 2935785616 | 2935789056 | 234 |
| 487 | iso_pu_bacteria | 2935793552 | 2935796806 | 234 |
| 488 | iso_pu_bacteria | 2935810662 | 2935816823 | 234 |
| 489 | iso_pu_bacteria | 2935819856 | 2935826403 | 234 |
| 490 | iso_pu_bacteria | 2935847175 | 2935853890 | 234 |
| 491 | iso_pu_bacteria | 2935908558 | 2935915432 | 234 |
| 492 | iso_pu_bacteria | 2935916978 | 2935925092 | 234 |
| 493 | iso_pu_bacteria | 2935926038 | 2935933327 | 234 |
| 494 | iso_pu_bacteria | 2935934488 | 2935941419 | 234 |
| 495 | iso_pu_bacteria | 2935942939 | 2935949522 | 234 |
| 496 | iso_pu_bacteria | 2935951376 | 2935958303 | 234 |
| 497 | iso_pu_bacteria | 2935959822 | 2935966552 | 234 |
| 498 | iso_pu_bacteria | 2935967501 | 2935974891 | 234 |
| 499 | iso_pu_bacteria | 2935975950 | 2935983154 | 234 |
| 500 | iso_pu_bacteria | 2935984226 | 2935985219 | 234 |
| 501 | iso_pu_bacteria | 2936011229 | 2936017764 | 234 |
| 502 | iso_pu_bacteria | 2936019824 | 2936026267 | 234 |
| 503 | iso_pu_bacteria | 2936028420 | 2936035014 | 234 |
| 504 | iso_pu_bacteria | 2936037263 | 2936043814 | 234 |
| 505 | iso_pu_bacteria | 2936046547 | 2936053229 | 234 |
| 506 | iso_pu_bacteria | 2936055302 | 2936057020 | 234 |
| 507 | iso_pu_bacteria | 2940556831 | 2940558538 | 234 |
| 508 | iso_pu_bacteria | 3005506211 | 3005511457 | 234 |
| 509 | iso_pu_bacteria | 8006926726 | 8006930251 | 234 |
| 510 | iso_pu_bacteria | 8006964411 | 8006969418 | 234 |
| 511 | iso_pu_bacteria | 8006984368 | 8006988467 | 234 |
| 512 | iso_pu_bacteria | 8006994254 | 8007000710 | 234 |
| 513 | iso_pu_bacteria | 8016530956 | 8016531464 | 234 |
| 514 | iso_pu_bacteria | 8016539877 | 8016544674 | 234 |
| 515 | iso_pu_bacteria | 8016548790 | 8016557405 | 234 |
| 516 | iso_pu_bacteria | 8016557553 | 8016565759 | 234 |
| 517 | iso_pu_bacteria | 8016566248 | 8016569732 | 234 |
| 518 | iso_pu_bacteria | 8016575299 | 8016582335 | 234 |
| 519 | iso_pu_bacteria | 8016595262 | 8016603363 | 234 |
| 520 | iso_pu_bacteria | 8016603502 | 8016606295 | 234 |
| 521 | iso_pu_bacteria | 8016613128 | 8016618202 | 234 |
| 522 | iso_pu_bacteria | 8016630954 | 8016635363 | 234 |
| 523 | iso_pu_bacteria | 8019538911 | 8019540262 | 234 |
| 524 | iso_pu_bacteria | 8019619141 | 8019623231 | 234 |
| 525 | iso_pu_bacteria | 8019629233 | 8019629866 | 234 |
| 526 | iso_pu_bacteria | 8019638758 | 8019640744 | 234 |
| 527 | iso_pu_bacteria | 8019659431 | 8019666704 | 234 |
| 528 | iso_pu_bacteria | 8019678201 | 8019679526 | 234 |
| 529 | iso_pu_bacteria | 8019687851 | 8019695985 | 234 |
| 530 | iso_pu_bacteria | 8056673599 | 8056678600 | 234 |
| 531 | 3300005842 | Ga0068858_100153798 | Ga0068858_1001537982 | 235 |
| 532 | 3300009101 | Ga0105247_10009734 | Ga0105247_100097342 | 235 |
| 533 | 3300009545 | Ga0105237_10834968 | Ga0105237_108349681 | 235 |
| 534 | 3300025900 | Ga0207710_10077684 | Ga0207710_100776842 | 235 |
| 535 | 3300025914 | Ga0207671_10218399 | Ga0207671_102183992 | 235 |
| 536 | 3300028573 | Ga0265334_10017875 | Ga0265334_100178752 | 235 |
| 537 | 3300028577 | Ga0265318_10009533 | Ga0265318_100095333 | 235 |
| 538 | 3300028653 | Ga0265323_10000706 | Ga0265323_100007065 | 235 |
| 539 | 3300028666 | Ga0265336_10000683 | Ga0265336_1000068312 | 235 |
| 540 | 3300028800 | Ga0265338_10001041 | Ga0265338_1000104123 | 235 |
| 541 | 3300029957 | Ga0265324_10004820 | Ga0265324_100048203 | 235 |
| 542 | 3300045049 | Ga0466959_0221764 | Ga0466959_0221764_505_1215 | 235 |
| 543 | 3300046522 | Ga0495643_0208714 | Ga0495643_0208714_78_794 | 235 |
| 544 | 3300047469 | Ga0495673_0024196 | Ga0495673_0024196_2205_2921 | 235 |
| 545 | 3300053086 | Ga0500578_0187342 | Ga0500578_0187342_71_787 | 235 |
| 546 | iso_pu_bacteria | 2773857925 | 2774869488 | 235 |
| 547 | 3300003752 | Ga0055539_1003001 | Ga0055539_10030013 | 236 |
| 548 | 3300005842 | Ga0068858_101072092 | Ga0068858_1010720921 | 236 |
| 549 | 3300020081 | Ga0206354_10602836 | Ga0206354_106028361 | 236 |
| 550 | 3300025253 | Ga0209677_100221 | Ga0209677_10022125 | 236 |
| 551 | 3300025272 | Ga0209455_1022391 | Ga0209455_10223911 | 236 |
| 552 | 3300025921 | Ga0207652_10180515 | Ga0207652_101805151 | 236 |
| 553 | 3300031507 | Ga0307509_10032140 | Ga0307509_100321405 | 236 |
| 554 | 3300031507 | Ga0307509_10306562 | Ga0307509_103065622 | 236 |
| 555 | 3300048920 | Ga0496117_0105573 | Ga0496117_0105573_549_1262 | 236 |
| 556 | 3300048923 | Ga0496120_0223240 | Ga0496120_0223240_67_783 | 236 |
| 557 | 3300048924 | Ga0496121_0027740 | Ga0496121_0027740_4517_5233 | 236 |
| 558 | 3300048924 | Ga0496121_0355383 | Ga0496121_0355383_60_776 | 236 |
| 559 | 3300048928 | Ga0496125_0124627 | Ga0496125_0124627_742_1455 | 236 |
| 560 | 3300048929 | Ga0496126_0108383 | Ga0496126_0108383_105_821 | 236 |
| 561 | 3300053094 | Ga0500566_0001345 | Ga0500566_0001345_10713_11429 | 236 |
| 562 | 3300053145 | Ga0500586_000452 | Ga0500586_000452_5027_5743 | 236 |
| 563 | 3300003354 | JGI25160J50197_1005043 | JGI25160J50197_10050435 | 237 |
| 564 | 3300003354 | JGI25160J50197_1025211 | JGI25160J50197_10252112 | 237 |
| 565 | 3300005344 | Ga0070661_100122108 | Ga0070661_1001221082 | 237 |
| 566 | 3300005843 | Ga0068860_100000577 | Ga0068860_10000057729 | 237 |
| 567 | 3300005937 | Ga0081455_10013363 | Ga0081455_100133634 | 237 |
| 568 | 3300009101 | Ga0105247_10348157 | Ga0105247_103481571 | 237 |
| 569 | 3300009545 | Ga0105237_10065294 | Ga0105237_100652941 | 237 |
| 570 | 3300010375 | Ga0105239_10120138 | Ga0105239_101201383 | 237 |
| 571 | 3300013104 | Ga0157370_10022331 | Ga0157370_100223312 | 237 |
| 572 | 3300013105 | Ga0157369_10011194 | Ga0157369_100111942 | 237 |
| 573 | 3300025297 | Ga0209758_1031807 | Ga0209758_10318072 | 237 |
| 574 | 3300025297 | Ga0209758_1041277 | Ga0209758_10412772 | 237 |
| 575 | 3300025302 | Ga0207426_1010110 | Ga0207426_10101102 | 237 |
| 576 | 3300025900 | Ga0207710_10133009 | Ga0207710_101330092 | 237 |
| 577 | 3300025914 | Ga0207671_10208480 | Ga0207671_102084801 | 237 |
| 578 | 3300025919 | Ga0207657_10030292 | Ga0207657_100302923 | 237 |
| 579 | 3300025920 | Ga0207649_10139777 | Ga0207649_101397772 | 237 |
| 580 | 3300026035 | Ga0207703_10307582 | Ga0207703_103075821 | 237 |
| 581 | 3300026078 | Ga0207702_10263990 | Ga0207702_102639902 | 237 |
| 582 | 3300027296 | Ga0209389_1000163 | Ga0209389_100016343 | 237 |
| 583 | 3300027361 | Ga0209489_101100 | Ga0209489_10110043 | 237 |
| 584 | 3300027363 | Ga0209700_100014 | Ga0209700_100014254 | 237 |
| 585 | 3300028381 | Ga0268264_10000107 | Ga0268264_10000107181 | 237 |
| 586 | 3300031730 | Ga0307516_10009658 | Ga0307516_1000965810 | 237 |
| 587 | 3300035113 | Ga0373936_0034200 | Ga0373936_0034200_781_1497 | 237 |
| 588 | 3300035171 | Ga0373946_0156936 | Ga0373946_0156936_117_833 | 237 |
| 589 | 3300035692 | Ga0373935_0007139 | Ga0373935_0007139_5363_6079 | 237 |
| 590 | 3300035695 | Ga0373927_0310865 | Ga0373927_0310865_110_826 | 237 |
| 591 | 3300037068 | Ga0373925_0051695 | Ga0373925_0051695_1047_1763 | 237 |
| 592 | 3300039450 | Ga0436363_0270101 | Ga0436363_0270101_1506_2222 | 237 |
| 593 | 3300041505 | Ga0451849_1322946 | Ga0451849_1322946_75_791 | 237 |
| 594 | 3300046516 | Ga0495628_0376855 | Ga0495628_0376855_141_857 | 237 |
| 595 | 3300046557 | Ga0495622_0056752 | Ga0495622_0056752_691_1407 | 237 |
| 596 | 3300047443 | Ga0495687_029783 | Ga0495687_029783_955_1671 | 237 |
| 597 | 3300048909 | Ga0496106_0000788 | Ga0496106_0000788_329_1045 | 237 |
| 598 | 3300048919 | Ga0496116_0135082 | Ga0496116_0135082_654_1370 | 237 |
| 599 | 3300048920 | Ga0496117_0008719 | Ga0496117_0008719_5189_5905 | 237 |
| 600 | 3300048921 | Ga0496118_0004035 | Ga0496118_0004035_2323_3039 | 237 |
| 601 | 3300048924 | Ga0496121_0000640 | Ga0496121_0000640_44301_45017 | 237 |
| 602 | 3300048925 | Ga0496122_0096390 | Ga0496122_0096390_690_1406 | 237 |
| 603 | 3300048927 | Ga0496124_0007008 | Ga0496124_0007008_88_804 | 237 |
| 604 | 3300048928 | Ga0496125_0000136 | Ga0496125_0000136_19085_19801 | 237 |
| 605 | 3300048928 | Ga0496125_0049499 | Ga0496125_0049499_317_1033 | 237 |
| 606 | 3300048929 | Ga0496126_0185856 | Ga0496126_0185856_709_1425 | 237 |
| 607 | 3300048929 | Ga0496126_0360985 | Ga0496126_0360985_281_997 | 237 |
| 608 | 3300048929 | Ga0496126_0462019 | Ga0496126_0462019_46_762 | 237 |
| 609 | 3300050492 | nmdc:mga0yw44_15824_c1 | nmdc:mga0yw44_15824_c1_972_1697 | 237 |
| 610 | 3300053078 | Ga0495612_0037009 | Ga0495612_0037009_994_1710 | 237 |
| 611 | 3300053080 | Ga0500635_0019869 | Ga0500635_0019869_95_811 | 237 |
| 612 | 3300053080 | Ga0500635_0141489 | Ga0500635_0141489_12_728 | 237 |
| 613 | 3300053094 | Ga0500566_0003268 | Ga0500566_0003268_5938_6654 | 237 |
| 614 | 3300053094 | Ga0500566_0194611 | Ga0500566_0194611_91_807 | 237 |
| 615 | 3300053095 | Ga0500640_027308 | Ga0500640_027308_1505_2221 | 237 |
| 616 | 3300053109 | Ga0500569_008127 | Ga0500569_008127_1356_2072 | 237 |
| 617 | 3300053111 | Ga0500572_003155 | Ga0500572_003155_20_736 | 237 |
| 618 | 3300053119 | Ga0500595_012487 | Ga0500595_012487_433_1149 | 237 |
| 619 | 3300053148 | Ga0500590_037623 | Ga0500590_037623_226_942 | 237 |
| 620 | 3300053150 | Ga0500603_001503 | Ga0500603_001503_3188_3904 | 237 |
| 621 | 3300053163 | Ga0500639_013828 | Ga0500639_013828_1925_2641 | 237 |
| 622 | 3300053163 | Ga0500639_062419 | Ga0500639_062419_262_978 | 237 |
| 623 | 3300053163 | Ga0500639_073945 | Ga0500639_073945_332_1048 | 237 |
| 624 | 3300053178 | Ga0500637_0032662 | Ga0500637_0032662_1753_2469 | 237 |
| 625 | 3300053731 | Ga0500609_015376 | Ga0500609_015376_156_872 | 237 |
| 626 | 3300053735 | Ga0500596_005506 | Ga0500596_005506_764_1480 | 237 |
| 627 | 3300002067 | JGI24735J21928_10041752 | JGI24735J21928_100417522 | 238 |
| 628 | 3300003215 | JGI25153J46596_10003596 | JGI25153J46596_100035964 | 238 |
| 629 | 3300003215 | JGI25153J46596_10003675 | JGI25153J46596_100036752 | 238 |
| 630 | 3300003215 | JGI25153J46596_10007159 | JGI25153J46596_100071593 | 238 |
| 631 | 3300003215 | JGI25153J46596_10012613 | JGI25153J46596_100126132 | 238 |
| 632 | 3300003316 | rootH1_10084142 | rootH1_100841422 | 238 |
| 633 | 3300003322 | rootL2_10239686 | rootL2_102396862 | 238 |
| 634 | 3300003354 | JGI25160J50197_1003782 | JGI25160J50197_10037825 | 238 |
| 635 | 3300003659 | JGI25404J52841_10024642 | JGI25404J52841_100246421 | 238 |
| 636 | 3300003794 | Ga0055531_10005144 | Ga0055531_100051441 | 238 |
| 637 | 3300004625 | Ga0055543_1001103 | Ga0055543_10011035 | 238 |
| 638 | 3300005262 | Ga0065165_1001646 | Ga0065165_100164610 | 238 |
| 639 | 3300005262 | Ga0065165_1003743 | Ga0065165_10037437 | 238 |
| 640 | 3300005327 | Ga0070658_10064511 | Ga0070658_100645113 | 238 |
| 641 | 3300005327 | Ga0070658_10243097 | Ga0070658_102430972 | 238 |
| 642 | 3300005330 | Ga0070690_100090747 | Ga0070690_1000907471 | 238 |
| 643 | 3300005331 | Ga0070670_100182032 | Ga0070670_1001820322 | 238 |
| 644 | 3300005334 | Ga0068869_100018682 | Ga0068869_1000186823 | 238 |
| 645 | 3300005334 | Ga0068869_100229158 | Ga0068869_1002291582 | 238 |
| 646 | 3300005335 | Ga0070666_10198145 | Ga0070666_101981452 | 238 |
| 647 | 3300005336 | Ga0070680_100471625 | Ga0070680_1004716251 | 238 |
| 648 | 3300005337 | Ga0070682_100024236 | Ga0070682_1000242363 | 238 |
| 649 | 3300005337 | Ga0070682_100074067 | Ga0070682_1000740673 | 238 |
| 650 | 3300005337 | Ga0070682_100278192 | Ga0070682_1002781921 | 238 |
| 651 | 3300005338 | Ga0068868_100004833 | Ga0068868_1000048338 | 238 |
| 652 | 3300005338 | Ga0068868_100529731 | Ga0068868_1005297311 | 238 |
| 653 | 3300005339 | Ga0070660_100399953 | Ga0070660_1003999531 | 238 |
| 654 | 3300005340 | Ga0070689_100238269 | Ga0070689_1002382692 | 238 |
| 655 | 3300005343 | Ga0070687_100157363 | Ga0070687_1001573631 | 238 |
| 656 | 3300005347 | Ga0070668_100013201 | Ga0070668_1000132013 | 238 |
| 657 | 3300005347 | Ga0070668_100015674 | Ga0070668_1000156743 | 238 |
| 658 | 3300005347 | Ga0070668_100547921 | Ga0070668_1005479211 | 238 |
| 659 | 3300005354 | Ga0070675_100259455 | Ga0070675_1002594552 | 238 |
| 660 | 3300005355 | Ga0070671_100171645 | Ga0070671_1001716451 | 238 |
| 661 | 3300005356 | Ga0070674_100199625 | Ga0070674_1001996251 | 238 |
| 662 | 3300005364 | Ga0070673_100125190 | Ga0070673_1001251902 | 238 |
| 663 | 3300005364 | Ga0070673_100213175 | Ga0070673_1002131752 | 238 |
| 664 | 3300005367 | Ga0070667_100200492 | Ga0070667_1002004922 | 238 |
| 665 | 3300005438 | Ga0070701_10143799 | Ga0070701_101437992 | 238 |
| 666 | 3300005441 | Ga0070700_100070726 | Ga0070700_1000707262 | 238 |
| 667 | 3300005441 | Ga0070700_100223878 | Ga0070700_1002238782 | 238 |
| 668 | 3300005455 | Ga0070663_100019221 | Ga0070663_1000192212 | 238 |
| 669 | 3300005455 | Ga0070663_100083818 | Ga0070663_1000838182 | 238 |
| 670 | 3300005456 | Ga0070678_100134028 | Ga0070678_1001340282 | 238 |
| 671 | 3300005456 | Ga0070678_100142321 | Ga0070678_1001423212 | 238 |
| 672 | 3300005456 | Ga0070678_100158056 | Ga0070678_1001580562 | 238 |
| 673 | 3300005456 | Ga0070678_100278143 | Ga0070678_1002781431 | 238 |
| 674 | 3300005457 | Ga0070662_100015533 | Ga0070662_1000155331 | 238 |
| 675 | 3300005457 | Ga0070662_100073350 | Ga0070662_1000733503 | 238 |
| 676 | 3300005458 | Ga0070681_10141265 | Ga0070681_101412652 | 238 |
| 677 | 3300005459 | Ga0068867_100164012 | Ga0068867_1001640121 | 238 |
| 678 | 3300005467 | Ga0070706_100159540 | Ga0070706_1001595402 | 238 |
| 679 | 3300005535 | Ga0070684_100122197 | Ga0070684_1001221973 | 238 |
| 680 | 3300005535 | Ga0070684_100408283 | Ga0070684_1004082832 | 238 |
| 681 | 3300005539 | Ga0068853_100051162 | Ga0068853_1000511622 | 238 |
| 682 | 3300005539 | Ga0068853_100068809 | Ga0068853_1000688093 | 238 |
| 683 | 3300005539 | Ga0068853_100257283 | Ga0068853_1002572832 | 238 |
| 684 | 3300005543 | Ga0070672_100104298 | Ga0070672_1001042983 | 238 |
| 685 | 3300005544 | Ga0070686_100042506 | Ga0070686_1000425062 | 238 |
| 686 | 3300005547 | Ga0070693_100040702 | Ga0070693_1000407023 | 238 |
| 687 | 3300005548 | Ga0070665_100010827 | Ga0070665_10001082710 | 238 |
| 688 | 3300005548 | Ga0070665_100015812 | Ga0070665_1000158125 | 238 |
| 689 | 3300005548 | Ga0070665_100123562 | Ga0070665_1001235623 | 238 |
| 690 | 3300005548 | Ga0070665_100368750 | Ga0070665_1003687502 | 238 |
| 691 | 3300005548 | Ga0070665_100370198 | Ga0070665_1003701982 | 238 |
| 692 | 3300005548 | Ga0070665_100370216 | Ga0070665_1003702162 | 238 |
| 693 | 3300005563 | Ga0068855_100110183 | Ga0068855_1001101833 | 238 |
| 694 | 3300005563 | Ga0068855_100134239 | Ga0068855_1001342392 | 238 |
| 695 | 3300005563 | Ga0068855_100565992 | Ga0068855_1005659921 | 238 |
| 696 | 3300005564 | Ga0070664_100089380 | Ga0070664_1000893802 | 238 |
| 697 | 3300005577 | Ga0068857_100085354 | Ga0068857_1000853543 | 238 |
| 698 | 3300005614 | Ga0068856_100649046 | Ga0068856_1006490461 | 238 |
| 699 | 3300005615 | Ga0070702_100249769 | Ga0070702_1002497692 | 238 |
| 700 | 3300005615 | Ga0070702_100281751 | Ga0070702_1002817511 | 238 |
| 701 | 3300005616 | Ga0068852_100229094 | Ga0068852_1002290941 | 238 |
| 702 | 3300005616 | Ga0068852_100280195 | Ga0068852_1002801952 | 238 |
| 703 | 3300005616 | Ga0068852_100714906 | Ga0068852_1007149061 | 238 |
| 704 | 3300005617 | Ga0068859_100016877 | Ga0068859_1000168771 | 238 |
| 705 | 3300005617 | Ga0068859_100166317 | Ga0068859_1001663172 | 238 |
| 706 | 3300005617 | Ga0068859_100584304 | Ga0068859_1005843042 | 238 |
| 707 | 3300005618 | Ga0068864_100027680 | Ga0068864_1000276803 | 238 |
| 708 | 3300005719 | Ga0068861_100064658 | Ga0068861_1000646582 | 238 |
| 709 | 3300005719 | Ga0068861_100092252 | Ga0068861_1000922523 | 238 |
| 710 | 3300005719 | Ga0068861_100096747 | Ga0068861_1000967473 | 238 |
| 711 | 3300005834 | Ga0068851_10129435 | Ga0068851_101294352 | 238 |
| 712 | 3300005840 | Ga0068870_10175109 | Ga0068870_101751092 | 238 |
| 713 | 3300005841 | Ga0068863_100086085 | Ga0068863_1000860853 | 238 |
| 714 | 3300005842 | Ga0068858_100151471 | Ga0068858_1001514712 | 238 |
| 715 | 3300005842 | Ga0068858_100404129 | Ga0068858_1004041292 | 238 |
| 716 | 3300005843 | Ga0068860_100177029 | Ga0068860_1001770293 | 238 |
| 717 | 3300005843 | Ga0068860_100222173 | Ga0068860_1002221732 | 238 |
| 718 | 3300005843 | Ga0068860_100296370 | Ga0068860_1002963701 | 238 |
| 719 | 3300005843 | Ga0068860_100337864 | Ga0068860_1003378642 | 238 |
| 720 | 3300005844 | Ga0068862_100036297 | Ga0068862_1000362973 | 238 |
| 721 | 3300005844 | Ga0068862_100052418 | Ga0068862_1000524183 | 238 |
| 722 | 3300005844 | Ga0068862_100253887 | Ga0068862_1002538871 | 238 |
| 723 | 3300005937 | Ga0081455_10047903 | Ga0081455_100479032 | 238 |
| 724 | 3300005937 | Ga0081455_10065600 | Ga0081455_100656002 | 238 |
| 725 | 3300005983 | Ga0081540_1005048 | Ga0081540_10050485 | 238 |
| 726 | 3300005983 | Ga0081540_1011487 | Ga0081540_10114873 | 238 |
| 727 | 3300005983 | Ga0081540_1011797 | Ga0081540_10117973 | 238 |
| 728 | 3300005983 | Ga0081540_1013781 | Ga0081540_10137815 | 238 |
| 729 | 3300005983 | Ga0081540_1031452 | Ga0081540_10314523 | 238 |
| 730 | 3300005983 | Ga0081540_1051966 | Ga0081540_10519662 | 238 |
| 731 | 3300005985 | Ga0081539_10019046 | Ga0081539_100190463 | 238 |
| 732 | 3300006038 | Ga0075365_10004812 | Ga0075365_100048125 | 238 |
| 733 | 3300006038 | Ga0075365_10011993 | Ga0075365_100119932 | 238 |
| 734 | 3300006038 | Ga0075365_10116414 | Ga0075365_101164142 | 238 |
| 735 | 3300006038 | Ga0075365_10199218 | Ga0075365_101992182 | 238 |
| 736 | 3300006042 | Ga0075368_10141535 | Ga0075368_101415352 | 238 |
| 737 | 3300006048 | Ga0075363_100003163 | Ga0075363_1000031634 | 238 |
| 738 | 3300006048 | Ga0075363_100070001 | Ga0075363_1000700012 | 238 |
| 739 | 3300006051 | Ga0075364_10044928 | Ga0075364_100449283 | 238 |
| 740 | 3300006051 | Ga0075364_10287374 | Ga0075364_102873741 | 238 |
| 741 | 3300006177 | Ga0075362_10177018 | Ga0075362_101770181 | 238 |
| 742 | 3300006178 | Ga0075367_10018509 | Ga0075367_100185092 | 238 |
| 743 | 3300006178 | Ga0075367_10186630 | Ga0075367_101866302 | 238 |
| 744 | 3300006186 | Ga0075369_10063085 | Ga0075369_100630851 | 238 |
| 745 | 3300006195 | Ga0075366_10138885 | Ga0075366_101388852 | 238 |
| 746 | 3300006195 | Ga0075366_10205646 | Ga0075366_102056461 | 238 |
| 747 | 3300006237 | Ga0097621_100079086 | Ga0097621_1000790862 | 238 |
| 748 | 3300006353 | Ga0075370_10058931 | Ga0075370_100589313 | 238 |
| 749 | 3300006358 | Ga0068871_100221194 | Ga0068871_1002211942 | 238 |
| 750 | 3300006358 | Ga0068871_100302702 | Ga0068871_1003027022 | 238 |
| 751 | 3300006358 | Ga0068871_100508328 | Ga0068871_1005083281 | 238 |
| 752 | 3300006844 | Ga0075428_100014565 | Ga0075428_1000145659 | 238 |
| 753 | 3300006871 | Ga0075434_100669941 | Ga0075434_1006699411 | 238 |
| 754 | 3300006881 | Ga0068865_100077817 | Ga0068865_1000778172 | 238 |
| 755 | 3300006931 | Ga0097620_100016876 | Ga0097620_1000168761 | 238 |
| 756 | 3300006931 | Ga0097620_100166318 | Ga0097620_1001663182 | 238 |
| 757 | 3300006931 | Ga0097620_100584282 | Ga0097620_1005842821 | 238 |
| 758 | 3300007076 | Ga0075435_100416675 | Ga0075435_1004166751 | 238 |
| 759 | 3300009092 | Ga0105250_10069082 | Ga0105250_100690822 | 238 |
| 760 | 3300009093 | Ga0105240_10199785 | Ga0105240_101997853 | 238 |
| 761 | 3300009094 | Ga0111539_10042663 | Ga0111539_100426632 | 238 |
| 762 | 3300009098 | Ga0105245_10009744 | Ga0105245_100097447 | 238 |
| 763 | 3300009098 | Ga0105245_10041488 | Ga0105245_100414883 | 238 |
| 764 | 3300009098 | Ga0105245_10262667 | Ga0105245_102626672 | 238 |
| 765 | 3300009101 | Ga0105247_10187484 | Ga0105247_101874842 | 238 |
| 766 | 3300009147 | Ga0114129_10209945 | Ga0114129_102099453 | 238 |
| 767 | 3300009147 | Ga0114129_10364713 | Ga0114129_103647132 | 238 |
| 768 | 3300009148 | Ga0105243_10138872 | Ga0105243_101388722 | 238 |
| 769 | 3300009148 | Ga0105243_10504984 | Ga0105243_105049842 | 238 |
| 770 | 3300009176 | Ga0105242_10018681 | Ga0105242_100186812 | 238 |
| 771 | 3300009176 | Ga0105242_10087044 | Ga0105242_100870443 | 238 |
| 772 | 3300009176 | Ga0105242_10632323 | Ga0105242_106323231 | 238 |
| 773 | 3300009176 | Ga0105242_10928944 | Ga0105242_109289441 | 238 |
| 774 | 3300009177 | Ga0105248_10037824 | Ga0105248_100378243 | 238 |
| 775 | 3300009177 | Ga0105248_10303341 | Ga0105248_103033412 | 238 |
| 776 | 3300009177 | Ga0105248_10315684 | Ga0105248_103156842 | 238 |
| 777 | 3300009177 | Ga0105248_10372403 | Ga0105248_103724032 | 238 |
| 778 | 3300009177 | Ga0105248_11196719 | Ga0105248_111967191 | 238 |
| 779 | 3300009545 | Ga0105237_10061924 | Ga0105237_100619243 | 238 |
| 780 | 3300009551 | Ga0105238_10116422 | Ga0105238_101164223 | 238 |
| 781 | 3300009553 | Ga0105249_10369478 | Ga0105249_103694782 | 238 |
| 782 | 3300010159 | Ga0099796_10011789 | Ga0099796_100117893 | 238 |
| 783 | 3300010375 | Ga0105239_10032831 | Ga0105239_100328314 | 238 |
| 784 | 3300010375 | Ga0105239_10046379 | Ga0105239_100463793 | 238 |
| 785 | 3300010375 | Ga0105239_10060369 | Ga0105239_100603692 | 238 |
| 786 | 3300010375 | Ga0105239_10371891 | Ga0105239_103718914 | 238 |
| 787 | 3300010375 | Ga0105239_10620053 | Ga0105239_106200532 | 238 |
| 788 | 3300011119 | Ga0105246_10022753 | Ga0105246_100227532 | 238 |
| 789 | 3300011119 | Ga0105246_10081357 | Ga0105246_100813572 | 238 |
| 790 | 3300011119 | Ga0105246_10203546 | Ga0105246_102035462 | 238 |
| 791 | 3300011119 | Ga0105246_10386997 | Ga0105246_103869971 | 238 |
| 792 | 3300013102 | Ga0157371_10436736 | Ga0157371_104367362 | 238 |
| 793 | 3300013104 | Ga0157370_10194746 | Ga0157370_101947462 | 238 |
| 794 | 3300013296 | Ga0157374_10016521 | Ga0157374_100165215 | 238 |
| 795 | 3300013297 | Ga0157378_10014932 | Ga0157378_100149323 | 238 |
| 796 | 3300013297 | Ga0157378_10225469 | Ga0157378_102254692 | 238 |
| 797 | 3300013297 | Ga0157378_10302560 | Ga0157378_103025602 | 238 |
| 798 | 3300013306 | Ga0163162_10274922 | Ga0163162_102749222 | 238 |
| 799 | 3300013306 | Ga0163162_10323237 | Ga0163162_103232372 | 238 |
| 800 | 3300013308 | Ga0157375_10283930 | Ga0157375_102839302 | 238 |
| 801 | 3300014325 | Ga0163163_10042519 | Ga0163163_100425193 | 238 |
| 802 | 3300014325 | Ga0163163_10845215 | Ga0163163_108452151 | 238 |
| 803 | 3300014326 | Ga0157380_10152327 | Ga0157380_101523273 | 238 |
| 804 | 3300014745 | Ga0157377_10214457 | Ga0157377_102144572 | 238 |
| 805 | 3300014968 | Ga0157379_10053440 | Ga0157379_100534403 | 238 |
| 806 | 3300014968 | Ga0157379_10112157 | Ga0157379_101121573 | 238 |
| 807 | 3300014969 | Ga0157376_10009078 | Ga0157376_100090782 | 238 |
| 808 | 3300014969 | Ga0157376_10023064 | Ga0157376_100230642 | 238 |
| 809 | 3300014969 | Ga0157376_10032010 | Ga0157376_100320103 | 238 |
| 810 | 3300014969 | Ga0157376_10160662 | Ga0157376_101606624 | 238 |
| 811 | 3300017792 | Ga0163161_10079952 | Ga0163161_100799523 | 238 |
| 812 | 3300017792 | Ga0163161_10145217 | Ga0163161_101452172 | 238 |
| 813 | 3300025245 | Ga0207425_1017347 | Ga0207425_10173471 | 238 |
| 814 | 3300025295 | Ga0209564_1006843 | Ga0209564_10068436 | 238 |
| 815 | 3300025297 | Ga0209758_1000030 | Ga0209758_100003032 | 238 |
| 816 | 3300025297 | Ga0209758_1001470 | Ga0209758_100147013 | 238 |
| 817 | 3300025297 | Ga0209758_1002448 | Ga0209758_10024483 | 238 |
| 818 | 3300025297 | Ga0209758_1003848 | Ga0209758_10038483 | 238 |
| 819 | 3300025297 | Ga0209758_1007239 | Ga0209758_10072395 | 238 |
| 820 | 3300025299 | Ga0209256_1004427 | Ga0209256_10044271 | 238 |
| 821 | 3300025302 | Ga0207426_1001583 | Ga0207426_100158311 | 238 |
| 822 | 3300025304 | Ga0209257_1003693 | Ga0209257_100369312 | 238 |
| 823 | 3300025315 | Ga0207697_10108442 | Ga0207697_101084422 | 238 |
| 824 | 3300025901 | Ga0207688_10026849 | Ga0207688_100268492 | 238 |
| 825 | 3300025901 | Ga0207688_10083585 | Ga0207688_100835853 | 238 |
| 826 | 3300025901 | Ga0207688_10256468 | Ga0207688_102564681 | 238 |
| 827 | 3300025907 | Ga0207645_10256861 | Ga0207645_102568612 | 238 |
| 828 | 3300025909 | Ga0207705_10318544 | Ga0207705_103185441 | 238 |
| 829 | 3300025911 | Ga0207654_10042739 | Ga0207654_100427392 | 238 |
| 830 | 3300025913 | Ga0207695_10483740 | Ga0207695_104837401 | 238 |
| 831 | 3300025914 | Ga0207671_10084741 | Ga0207671_100847413 | 238 |
| 832 | 3300025914 | Ga0207671_10215184 | Ga0207671_102151842 | 238 |
| 833 | 3300025917 | Ga0207660_10085154 | Ga0207660_100851542 | 238 |
| 834 | 3300025919 | Ga0207657_10212004 | Ga0207657_102120042 | 238 |
| 835 | 3300025922 | Ga0207646_10639630 | Ga0207646_106396301 | 238 |
| 836 | 3300025923 | Ga0207681_10383193 | Ga0207681_103831932 | 238 |
| 837 | 3300025924 | Ga0207694_10120369 | Ga0207694_101203692 | 238 |
| 838 | 3300025924 | Ga0207694_10223641 | Ga0207694_102236412 | 238 |
| 839 | 3300025932 | Ga0207690_10079258 | Ga0207690_100792582 | 238 |
| 840 | 3300025933 | Ga0207706_10039680 | Ga0207706_100396802 | 238 |
| 841 | 3300025933 | Ga0207706_10107804 | Ga0207706_101078042 | 238 |
| 842 | 3300025934 | Ga0207686_10257785 | Ga0207686_102577853 | 238 |
| 843 | 3300025935 | Ga0207709_10258685 | Ga0207709_102586852 | 238 |
| 844 | 3300025935 | Ga0207709_10356389 | Ga0207709_103563892 | 238 |
| 845 | 3300025935 | Ga0207709_10529046 | Ga0207709_105290461 | 238 |
| 846 | 3300025936 | Ga0207670_10344009 | Ga0207670_103440092 | 238 |
| 847 | 3300025937 | Ga0207669_10042091 | Ga0207669_100420913 | 238 |
| 848 | 3300025938 | Ga0207704_10087655 | Ga0207704_100876553 | 238 |
| 849 | 3300025940 | Ga0207691_10419708 | Ga0207691_104197082 | 238 |
| 850 | 3300025941 | Ga0207711_10023938 | Ga0207711_100239382 | 238 |
| 851 | 3300025941 | Ga0207711_10056621 | Ga0207711_100566212 | 238 |
| 852 | 3300025941 | Ga0207711_10310148 | Ga0207711_103101482 | 238 |
| 853 | 3300025942 | Ga0207689_10009995 | Ga0207689_100099953 | 238 |
| 854 | 3300025945 | Ga0207679_10068588 | Ga0207679_100685883 | 238 |
| 855 | 3300025960 | Ga0207651_10226524 | Ga0207651_102265242 | 238 |
| 856 | 3300025960 | Ga0207651_10433481 | Ga0207651_104334812 | 238 |
| 857 | 3300025961 | Ga0207712_10032642 | Ga0207712_100326422 | 238 |
| 858 | 3300025972 | Ga0207668_10239790 | Ga0207668_102397902 | 238 |
| 859 | 3300025986 | Ga0207658_10110777 | Ga0207658_101107773 | 238 |
| 860 | 3300025986 | Ga0207658_10845704 | Ga0207658_108457041 | 238 |
| 861 | 3300026035 | Ga0207703_10036511 | Ga0207703_100365113 | 238 |
| 862 | 3300026035 | Ga0207703_10599310 | Ga0207703_105993102 | 238 |
| 863 | 3300026041 | Ga0207639_10123494 | Ga0207639_101234943 | 238 |
| 864 | 3300026041 | Ga0207639_10182571 | Ga0207639_101825711 | 238 |
| 865 | 3300026067 | Ga0207678_10320935 | Ga0207678_103209351 | 238 |
| 866 | 3300026075 | Ga0207708_10011392 | Ga0207708_100113925 | 238 |
| 867 | 3300026075 | Ga0207708_10072081 | Ga0207708_100720812 | 238 |
| 868 | 3300026078 | Ga0207702_10052978 | Ga0207702_100529782 | 238 |
| 869 | 3300026088 | Ga0207641_10358026 | Ga0207641_103580262 | 238 |
| 870 | 3300026089 | Ga0207648_10193731 | Ga0207648_101937311 | 238 |
| 871 | 3300026089 | Ga0207648_10250267 | Ga0207648_102502672 | 238 |
| 872 | 3300026089 | Ga0207648_10782948 | Ga0207648_107829481 | 238 |
| 873 | 3300026095 | Ga0207676_10098407 | Ga0207676_100984072 | 238 |
| 874 | 3300026116 | Ga0207674_10097268 | Ga0207674_100972683 | 238 |
| 875 | 3300026118 | Ga0207675_100025561 | Ga0207675_1000255612 | 238 |
| 876 | 3300026118 | Ga0207675_100030002 | Ga0207675_1000300023 | 238 |
| 877 | 3300026121 | Ga0207683_10011692 | Ga0207683_100116926 | 238 |
| 878 | 3300026121 | Ga0207683_10166455 | Ga0207683_101664552 | 238 |
| 879 | 3300026121 | Ga0207683_10170942 | Ga0207683_101709422 | 238 |
| 880 | 3300026121 | Ga0207683_10237400 | Ga0207683_102374001 | 238 |
| 881 | 3300028379 | Ga0268266_10004510 | Ga0268266_100045106 | 238 |
| 882 | 3300028379 | Ga0268266_10014493 | Ga0268266_100144935 | 238 |
| 883 | 3300028379 | Ga0268266_10250808 | Ga0268266_102508082 | 238 |
| 884 | 3300028380 | Ga0268265_10557746 | Ga0268265_105577461 | 238 |
| 885 | 3300028381 | Ga0268264_10101045 | Ga0268264_101010452 | 238 |
| 886 | 3300028381 | Ga0268264_10745597 | Ga0268264_107455971 | 238 |
| 887 | 3300028786 | Ga0307517_10001121 | Ga0307517_100011219 | 238 |
| 888 | 3300028794 | Ga0307515_10048703 | Ga0307515_100487032 | 238 |
| 889 | 3300031456 | Ga0307513_10170936 | Ga0307513_101709361 | 238 |
| 890 | 3300031456 | Ga0307513_10238570 | Ga0307513_102385702 | 238 |
| 891 | 3300031456 | Ga0307513_10326987 | Ga0307513_103269871 | 238 |
| 892 | 3300031507 | Ga0307509_10355137 | Ga0307509_103551372 | 238 |
| 893 | 3300031616 | Ga0307508_10199788 | Ga0307508_101997882 | 238 |
| 894 | 3300031616 | Ga0307508_10284103 | Ga0307508_102841032 | 238 |
| 895 | 3300031730 | Ga0307516_10046891 | Ga0307516_100468915 | 238 |
| 896 | 3300031730 | Ga0307516_10048561 | Ga0307516_100485615 | 238 |
| 897 | 3300031730 | Ga0307516_10058550 | Ga0307516_100585504 | 238 |
| 898 | 3300031731 | Ga0307405_10166428 | Ga0307405_101664282 | 238 |
| 899 | 3300031731 | Ga0307405_10239103 | Ga0307405_102391032 | 238 |
| 900 | 3300032002 | Ga0307416_100250974 | Ga0307416_1002509742 | 238 |
| 901 | 3300032002 | Ga0307416_100369373 | Ga0307416_1003693732 | 238 |
| 902 | 3300032005 | Ga0307411_10079962 | Ga0307411_100799622 | 238 |
| 903 | 3300032126 | Ga0307415_100195771 | Ga0307415_1001957712 | 238 |
| 904 | 3300033180 | Ga0307510_10035200 | Ga0307510_100352004 | 238 |
| 905 | 3300033180 | Ga0307510_10210970 | Ga0307510_102109702 | 238 |
| 906 | 3300033180 | Ga0307510_10229271 | Ga0307510_102292711 | 238 |
| 907 | 3300034816 | Ga0373930_0038620 | Ga0373930_0038620_179_898 | 238 |
| 908 | 3300035113 | Ga0373936_0050697 | Ga0373936_0050697_53_772 | 238 |
| 909 | 3300035115 | Ga0373941_0018909 | Ga0373941_0018909_471_1190 | 238 |
| 910 | 3300035116 | Ga0373945_0023969 | Ga0373945_0023969_144_863 | 238 |
| 911 | 3300035118 | Ga0373954_0049206 | Ga0373954_0049206_1056_1775 | 238 |
| 912 | 3300035119 | Ga0373956_0016462 | Ga0373956_0016462_296_1015 | 238 |
| 913 | 3300035170 | Ga0373943_0019761 | Ga0373943_0019761_1860_2579 | 238 |
| 914 | 3300035171 | Ga0373946_0077904 | Ga0373946_0077904_676_1395 | 238 |
| 915 | 3300035410 | Ga0373924_0105697 | Ga0373924_0105697_314_1033 | 238 |
| 916 | 3300035691 | Ga0373931_0000922 | Ga0373931_0000922_8297_9016 | 238 |
| 917 | 3300035691 | Ga0373931_0069916 | Ga0373931_0069916_1104_1823 | 238 |
| 918 | 3300035691 | Ga0373931_0401473 | Ga0373931_0401473_102_821 | 238 |
| 919 | 3300035692 | Ga0373935_0061490 | Ga0373935_0061490_778_1497 | 238 |
| 920 | 3300035695 | Ga0373927_0003207 | Ga0373927_0003207_9533_10252 | 238 |
| 921 | 3300035695 | Ga0373927_0027031 | Ga0373927_0027031_403_1122 | 238 |
| 922 | 3300035695 | Ga0373927_0130679 | Ga0373927_0130679_471_1190 | 238 |
| 923 | 3300035695 | Ga0373927_0304999 | Ga0373927_0304999_277_996 | 238 |
| 924 | 3300035695 | Ga0373927_0369211 | Ga0373927_0369211_163_882 | 238 |
| 925 | 3300035725 | Ga0373947_0016126 | Ga0373947_0016126_998_1717 | 238 |
| 926 | 3300037068 | Ga0373925_0386573 | Ga0373925_0386573_406_1125 | 238 |
| 927 | 3300037068 | Ga0373925_0448791 | Ga0373925_0448791_167_886 | 238 |
| 928 | 3300037466 | Ga0395898_0333998 | Ga0395898_0333998_177_896 | 238 |
| 929 | 3300037471 | Ga0395905_0072293 | Ga0395905_0072293_1304_2023 | 238 |
| 930 | 3300037471 | Ga0395905_0177334 | Ga0395905_0177334_741_1463 | 238 |
| 931 | 3300037471 | Ga0395905_0213892 | Ga0395905_0213892_513_1232 | 238 |
| 932 | 3300041451 | Ga0451791_0655594 | Ga0451791_0655594_25_744 | 238 |
| 933 | 3300042438 | Ga0439459_0008892 | Ga0439459_0008892_160_879 | 238 |
| 934 | 3300044658 | Ga0466972_0078620 | Ga0466972_0078620_755_1471 | 238 |
| 935 | 3300044901 | Ga0466960_0235099 | Ga0466960_0235099_255_974 | 238 |
| 936 | 3300046452 | Ga0495617_058050 | Ga0495617_058050_469_1188 | 238 |
| 937 | 3300046454 | Ga0495592_0037169 | Ga0495592_0037169_1664_2383 | 238 |
| 938 | 3300046455 | Ga0495603_0000182 | Ga0495603_0000182_23788_24507 | 238 |
| 939 | 3300046455 | Ga0495603_0004488 | Ga0495603_0004488_6517_7236 | 238 |
| 940 | 3300046455 | Ga0495603_0030757 | Ga0495603_0030757_293_1012 | 238 |
| 941 | 3300046455 | Ga0495603_0363663 | Ga0495603_0363663_32_751 | 238 |
| 942 | 3300046459 | Ga0495629_0000314 | Ga0495629_0000314_31327_32046 | 238 |
| 943 | 3300046461 | Ga0495641_0001508 | Ga0495641_0001508_7934_8653 | 238 |
| 944 | 3300046461 | Ga0495641_0041135 | Ga0495641_0041135_1322_2041 | 238 |
| 945 | 3300046462 | Ga0495651_0180065 | Ga0495651_0180065_460_1179 | 238 |
| 946 | 3300046463 | Ga0495653_0109029 | Ga0495653_0109029_973_1692 | 238 |
| 947 | 3300046472 | Ga0495580_0036094 | Ga0495580_0036094_1517_2236 | 238 |
| 948 | 3300046473 | Ga0495582_0000597 | Ga0495582_0000597_14724_15443 | 238 |
| 949 | 3300046473 | Ga0495582_0016511 | Ga0495582_0016511_2386_3105 | 238 |
| 950 | 3300046474 | Ga0495605_0120213 | Ga0495605_0120213_119_838 | 238 |
| 951 | 3300046475 | Ga0495639_0000235 | Ga0495639_0000235_3087_3806 | 238 |
| 952 | 3300046475 | Ga0495639_0089101 | Ga0495639_0089101_606_1325 | 238 |
| 953 | 3300046476 | Ga0495662_0001470 | Ga0495662_0001470_3239_3958 | 238 |
| 954 | 3300046477 | Ga0495664_0005693 | Ga0495664_0005693_3549_4268 | 238 |
| 955 | 3300046491 | Ga0495584_0015964 | Ga0495584_0015964_1866_2585 | 238 |
| 956 | 3300046492 | Ga0495585_0048788 | Ga0495585_0048788_1227_1946 | 238 |
| 957 | 3300046499 | Ga0495594_0000302 | Ga0495594_0000302_8004_8723 | 238 |
| 958 | 3300046501 | Ga0495607_0142450 | Ga0495607_0142450_245_964 | 238 |
| 959 | 3300046507 | Ga0495606_0116102 | Ga0495606_0116102_218_952 | 238 |
| 960 | 3300046507 | Ga0495606_0159498 | Ga0495606_0159498_61_777 | 238 |
| 961 | 3300046512 | Ga0495610_0099204 | Ga0495610_0099204_136_855 | 238 |
| 962 | 3300046513 | Ga0495616_0020136 | Ga0495616_0020136_2289_3008 | 238 |
| 963 | 3300046516 | Ga0495628_0274453 | Ga0495628_0274453_423_1142 | 238 |
| 964 | 3300046517 | Ga0495630_0002415 | Ga0495630_0002415_1215_1934 | 238 |
| 965 | 3300046520 | Ga0495637_0087103 | Ga0495637_0087103_249_968 | 238 |
| 966 | 3300046526 | Ga0495666_0035782 | Ga0495666_0035782_418_1137 | 238 |
| 967 | 3300046529 | Ga0495652_0041525 | Ga0495652_0041525_302_1021 | 238 |
| 968 | 3300046531 | Ga0495665_0000619 | Ga0495665_0000619_9522_10241 | 238 |
| 969 | 3300046533 | Ga0495640_0000308 | Ga0495640_0000308_31521_32240 | 238 |
| 970 | 3300046538 | Ga0495609_0102427 | Ga0495609_0102427_393_1112 | 238 |
| 971 | 3300046538 | Ga0495609_0155626 | Ga0495609_0155626_12_728 | 238 |
| 972 | 3300046539 | Ga0495621_0064946 | Ga0495621_0064946_70_789 | 238 |
| 973 | 3300046558 | Ga0495633_0012187 | Ga0495633_0012187_2539_3258 | 238 |
| 974 | 3300046558 | Ga0495633_0063792 | Ga0495633_0063792_481_1200 | 238 |
| 975 | 3300046559 | Ga0495667_0008896 | Ga0495667_0008896_1781_2500 | 238 |
| 976 | 3300046615 | Ga0495656_0042782 | Ga0495656_0042782_846_1565 | 238 |
| 977 | 3300046616 | Ga0495668_0017158 | Ga0495668_0017158_28_747 | 238 |
| 978 | 3300046616 | Ga0495668_0052268 | Ga0495668_0052268_1025_1744 | 238 |
| 979 | 3300046616 | Ga0495668_0069062 | Ga0495668_0069062_236_955 | 238 |
| 980 | 3300046616 | Ga0495668_0131199 | Ga0495668_0131199_47_766 | 238 |
| 981 | 3300046642 | Ga0495634_0001483 | Ga0495634_0001483_12138_12857 | 238 |
| 982 | 3300046648 | Ga0495611_0113091 | Ga0495611_0113091_29_748 | 238 |
| 983 | 3300046660 | Ga0495625_0123597 | Ga0495625_0123597_551_1270 | 238 |
| 984 | 3300046660 | Ga0495625_0134632 | Ga0495625_0134632_405_1124 | 238 |
| 985 | 3300046660 | Ga0495625_0164807 | Ga0495625_0164807_338_1057 | 238 |
| 986 | 3300046660 | Ga0495625_0195089 | Ga0495625_0195089_236_955 | 238 |
| 987 | 3300046663 | Ga0495635_0003423 | Ga0495635_0003423_6611_7330 | 238 |
| 988 | 3300046665 | Ga0495661_0102372 | Ga0495661_0102372_314_1033 | 238 |
| 989 | 3300046674 | Ga0495588_0004152 | Ga0495588_0004152_4161_4880 | 238 |
| 990 | 3300046674 | Ga0495588_0006111 | Ga0495588_0006111_1218_1937 | 238 |
| 991 | 3300046675 | Ga0495657_0135004 | Ga0495657_0135004_786_1505 | 238 |
| 992 | 3300046678 | Ga0495599_0032491 | Ga0495599_0032491_99_818 | 238 |
| 993 | 3300046679 | Ga0495623_0124232 | Ga0495623_0124232_259_978 | 238 |
| 994 | 3300046681 | Ga0495647_0000405 | Ga0495647_0000405_8248_8967 | 238 |
| 995 | 3300046681 | Ga0495647_0047624 | Ga0495647_0047624_201_920 | 238 |
| 996 | 3300046681 | Ga0495647_0119342 | Ga0495647_0119342_308_1027 | 238 |
| 997 | 3300046683 | Ga0495658_0000936 | Ga0495658_0000936_7886_8605 | 238 |
| 998 | 3300046684 | Ga0495669_0035983 | Ga0495669_0035983_621_1340 | 238 |
| 999 | 3300046684 | Ga0495669_0096619 | Ga0495669_0096619_415_1134 | 238 |
| 1000 | 3300046689 | Ga0495613_0004828 | Ga0495613_0004828_6422_7141 | 238 |
| 1001 | 3300046690 | Ga0495624_0000810 | Ga0495624_0000810_7926_8645 | 238 |
| 1002 | 3300046690 | Ga0495624_0116093 | Ga0495624_0116093_330_1049 | 238 |
| 1003 | 3300046691 | Ga0495670_0076587 | Ga0495670_0076587_363_1082 | 238 |
| 1004 | 3300046691 | Ga0495670_0276454 | Ga0495670_0276454_55_774 | 238 |
| 1005 | 3300046692 | Ga0495671_0106338 | Ga0495671_0106338_427_1146 | 238 |
| 1006 | 3300046794 | Ga0495589_0092108 | Ga0495589_0092108_627_1349 | 238 |
| 1007 | 3300046809 | Ga0495600_0049276 | Ga0495600_0049276_953_1672 | 238 |
| 1008 | 3300047315 | Ga0495581_0000683 | Ga0495581_0000683_7935_8654 | 238 |
| 1009 | 3300047317 | Ga0495604_0321556 | Ga0495604_0321556_21_740 | 238 |
| 1010 | 3300047318 | Ga0495636_0027019 | Ga0495636_0027019_267_986 | 238 |
| 1011 | 3300047320 | Ga0495672_0018381 | Ga0495672_0018381_1679_2398 | 238 |
| 1012 | 3300047320 | Ga0495672_0091395 | Ga0495672_0091395_267_986 | 238 |
| 1013 | 3300047321 | Ga0495676_0005624 | Ga0495676_0005624_7532_8251 | 238 |
| 1014 | 3300047321 | Ga0495676_0146325 | Ga0495676_0146325_258_977 | 238 |
| 1015 | 3300047322 | Ga0495680_0201624 | Ga0495680_0201624_225_944 | 238 |
| 1016 | 3300047323 | Ga0495683_0048443 | Ga0495683_0048443_844_1566 | 238 |
| 1017 | 3300047323 | Ga0495683_0068885 | Ga0495683_0068885_683_1402 | 238 |
| 1018 | 3300047323 | Ga0495683_0203252 | Ga0495683_0203252_56_775 | 238 |
| 1019 | 3300047445 | Ga0495677_0019823 | Ga0495677_0019823_1509_2231 | 238 |
| 1020 | 3300047472 | Ga0495686_0139174 | Ga0495686_0139174_102_821 | 238 |
| 1021 | 3300047472 | Ga0495686_0174065 | Ga0495686_0174065_301_1020 | 238 |
| 1022 | 3300047673 | Ga0495593_0000370 | Ga0495593_0000370_7806_8525 | 238 |
| 1023 | 3300048089 | Ga0495614_0067848 | Ga0495614_0067848_212_931 | 238 |
| 1024 | 3300048903 | Ga0496100_0059644 | Ga0496100_0059644_1345_2064 | 238 |
| 1025 | 3300048904 | Ga0496101_0011788 | Ga0496101_0011788_2579_3313 | 238 |
| 1026 | 3300048905 | Ga0496102_0035160 | Ga0496102_0035160_2335_3069 | 238 |
| 1027 | 3300048905 | Ga0496102_0039885 | Ga0496102_0039885_1926_2645 | 238 |
| 1028 | 3300048905 | Ga0496102_0182086 | Ga0496102_0182086_909_1628 | 238 |
| 1029 | 3300048905 | Ga0496102_0296367 | Ga0496102_0296367_537_1256 | 238 |
| 1030 | 3300048905 | Ga0496102_0650350 | Ga0496102_0650350_28_747 | 238 |
| 1031 | 3300048906 | Ga0496103_0050386 | Ga0496103_0050386_330_1064 | 238 |
| 1032 | 3300048907 | Ga0496104_0027452 | Ga0496104_0027452_344_1066 | 238 |
| 1033 | 3300048907 | Ga0496104_0046793 | Ga0496104_0046793_2510_3244 | 238 |
| 1034 | 3300048907 | Ga0496104_0145388 | Ga0496104_0145388_264_983 | 238 |
| 1035 | 3300048907 | Ga0496104_0156640 | Ga0496104_0156640_424_1143 | 238 |
| 1036 | 3300048908 | Ga0496105_0492742 | Ga0496105_0492742_192_911 | 238 |
| 1037 | 3300048909 | Ga0496106_0010327 | Ga0496106_0010327_4218_4952 | 238 |
| 1038 | 3300048909 | Ga0496106_0071909 | Ga0496106_0071909_1595_2314 | 238 |
| 1039 | 3300048909 | Ga0496106_0085959 | Ga0496106_0085959_1176_1895 | 238 |
| 1040 | 3300048909 | Ga0496106_0399575 | Ga0496106_0399575_185_904 | 238 |
| 1041 | 3300048910 | Ga0496107_0010427 | Ga0496107_0010427_1883_2617 | 238 |
| 1042 | 3300048910 | Ga0496107_0073394 | Ga0496107_0073394_765_1484 | 238 |
| 1043 | 3300048911 | Ga0496108_0029240 | Ga0496108_0029240_2693_3409 | 238 |
| 1044 | 3300048911 | Ga0496108_0041613 | Ga0496108_0041613_2400_3134 | 238 |
| 1045 | 3300048911 | Ga0496108_0138390 | Ga0496108_0138390_326_1045 | 238 |
| 1046 | 3300048911 | Ga0496108_0378606 | Ga0496108_0378606_154_873 | 238 |
| 1047 | 3300048912 | Ga0496109_0074114 | Ga0496109_0074114_172_906 | 238 |
| 1048 | 3300048912 | Ga0496109_0216868 | Ga0496109_0216868_1058_1777 | 238 |
| 1049 | 3300048913 | Ga0496110_0009815 | Ga0496110_0009815_6008_6742 | 238 |
| 1050 | 3300048913 | Ga0496110_0035698 | Ga0496110_0035698_1624_2343 | 238 |
| 1051 | 3300048914 | Ga0496111_0002060 | Ga0496111_0002060_7329_8048 | 238 |
| 1052 | 3300048915 | Ga0496112_0150982 | Ga0496112_0150982_457_1176 | 238 |
| 1053 | 3300048915 | Ga0496112_0168267 | Ga0496112_0168267_955_1689 | 238 |
| 1054 | 3300048915 | Ga0496112_0242858 | Ga0496112_0242858_43_765 | 238 |
| 1055 | 3300048916 | Ga0496113_0005020 | Ga0496113_0005020_371_1090 | 238 |
| 1056 | 3300048916 | Ga0496113_0049431 | Ga0496113_0049431_2210_2944 | 238 |
| 1057 | 3300048917 | Ga0496114_0002069 | Ga0496114_0002069_14196_14930 | 238 |
| 1058 | 3300048917 | Ga0496114_0519902 | Ga0496114_0519902_119_838 | 238 |
| 1059 | 3300048918 | Ga0496115_0005035 | Ga0496115_0005035_1273_2007 | 238 |
| 1060 | 3300048918 | Ga0496115_0051684 | Ga0496115_0051684_319_1038 | 238 |
| 1061 | 3300048919 | Ga0496116_0026977 | Ga0496116_0026977_3044_3766 | 238 |
| 1062 | 3300048921 | Ga0496118_0067376 | Ga0496118_0067376_1770_2486 | 238 |
| 1063 | 3300048921 | Ga0496118_0243986 | Ga0496118_0243986_257_976 | 238 |
| 1064 | 3300048922 | Ga0496119_0140231 | Ga0496119_0140231_358_1080 | 238 |
| 1065 | 3300048924 | Ga0496121_0006350 | Ga0496121_0006350_6542_7261 | 238 |
| 1066 | 3300048924 | Ga0496121_0018042 | Ga0496121_0018042_1736_2455 | 238 |
| 1067 | 3300048924 | Ga0496121_0042560 | Ga0496121_0042560_2778_3497 | 238 |
| 1068 | 3300048924 | Ga0496121_0097728 | Ga0496121_0097728_494_1213 | 238 |
| 1069 | 3300048924 | Ga0496121_0117532 | Ga0496121_0117532_899_1618 | 238 |
| 1070 | 3300048927 | Ga0496124_0068381 | Ga0496124_0068381_2128_2847 | 238 |
| 1071 | 3300048928 | Ga0496125_0052528 | Ga0496125_0052528_1179_1895 | 238 |
| 1072 | 3300048928 | Ga0496125_0063712 | Ga0496125_0063712_1019_1738 | 238 |
| 1073 | 3300048928 | Ga0496125_0071712 | Ga0496125_0071712_1528_2247 | 238 |
| 1074 | 3300048929 | Ga0496126_0013134 | Ga0496126_0013134_2749_3468 | 238 |
| 1075 | 3300048929 | Ga0496126_0064381 | Ga0496126_0064381_849_1568 | 238 |
| 1076 | 3300048929 | Ga0496126_0067186 | Ga0496126_0067186_136_852 | 238 |
| 1077 | 3300049574 | Ga0501038_0280696 | Ga0501038_0280696_101_820 | 238 |
| 1078 | 3300049581 | Ga0501047_0009703 | Ga0501047_0009703_7339_8058 | 238 |
| 1079 | 3300049585 | Ga0501069_0197914 | Ga0501069_0197914_316_1035 | 238 |
| 1080 | 3300050489 | nmdc:mga03683_144337_c1 | nmdc:mga03683_144337_c1_225_944 | 238 |
| 1081 | 3300050490 | nmdc:mga03n38_989_c1 | nmdc:mga03n38_989_c1_3106_3825 | 238 |
| 1082 | 3300050491 | nmdc:mga00v17_171917_c1 | nmdc:mga00v17_171917_c1_262_981 | 238 |
| 1083 | 3300050491 | nmdc:mga00v17_407537_c1 | nmdc:mga00v17_407537_c1_100_822 | 238 |
| 1084 | 3300050491 | nmdc:mga00v17_51920_c1 | nmdc:mga00v17_51920_c1_1488_2207 | 238 |
| 1085 | 3300050492 | nmdc:mga0yw44_143278_c1 | nmdc:mga0yw44_143278_c1_375_1094 | 238 |
| 1086 | 3300050492 | nmdc:mga0yw44_20383_c1 | nmdc:mga0yw44_20383_c1_358_1077 | 238 |
| 1087 | 3300050492 | nmdc:mga0yw44_24975_c1 | nmdc:mga0yw44_24975_c1_1468_2190 | 238 |
| 1088 | 3300050492 | nmdc:mga0yw44_311142_c1 | nmdc:mga0yw44_311142_c1_212_931 | 238 |
| 1089 | 3300050492 | nmdc:mga0yw44_331579_c1 | nmdc:mga0yw44_331579_c1_273_992 | 238 |
| 1090 | 3300050493 | nmdc:mga0k408_100771_c1 | nmdc:mga0k408_100771_c1_318_1037 | 238 |
| 1091 | 3300050493 | nmdc:mga0k408_1944_c1 | nmdc:mga0k408_1944_c1_2605_3324 | 238 |
| 1092 | 3300050493 | nmdc:mga0k408_247264_c1 | nmdc:mga0k408_247264_c1_269_988 | 238 |
| 1093 | 3300050493 | nmdc:mga0k408_341162_c1 | nmdc:mga0k408_341162_c1_14_733 | 238 |
| 1094 | 3300050494 | nmdc:mga06z11_3558_c1 | nmdc:mga06z11_3558_c1_2488_3207 | 238 |
| 1095 | 3300050494 | nmdc:mga06z11_47899_c1 | nmdc:mga06z11_47899_c1_1168_1887 | 238 |
| 1096 | 3300050494 | nmdc:mga06z11_94031_c1 | nmdc:mga06z11_94031_c1_309_1028 | 238 |
| 1097 | 3300050496 | nmdc:mga07m45_115683_c1 | nmdc:mga07m45_115683_c1_611_1330 | 238 |
| 1098 | 3300050496 | nmdc:mga07m45_130042_c1 | nmdc:mga07m45_130042_c1_70_789 | 238 |
| 1099 | 3300050496 | nmdc:mga07m45_269500_c1 | nmdc:mga07m45_269500_c1_65_784 | 238 |
| 1100 | 3300050496 | nmdc:mga07m45_6373_c1 | nmdc:mga07m45_6373_c1_69_788 | 238 |
| 1101 | 3300050508 | nmdc:mga09592_656276_c1 | nmdc:mga09592_656276_c1_31_750 | 238 |
| 1102 | 3300050509 | nmdc:mga0qj67_354668_c1 | nmdc:mga0qj67_354668_c1_318_1037 | 238 |
| 1103 | 3300050512 | nmdc:mga0n895_196917_c1 | nmdc:mga0n895_196917_c1_878_1597 | 238 |
| 1104 | 3300050512 | nmdc:mga0n895_243665_c1 | nmdc:mga0n895_243665_c1_783_1502 | 238 |
| 1105 | 3300050512 | nmdc:mga0n895_80087_c1 | nmdc:mga0n895_80087_c1_1417_2136 | 238 |
| 1106 | 3300050513 | nmdc:mga0rr50_32574_c1 | nmdc:mga0rr50_32574_c1_211_930 | 238 |
| 1107 | 3300050515 | nmdc:mga0a205_393136_c1 | nmdc:mga0a205_393136_c1_77_796 | 238 |
| 1108 | 3300050516 | nmdc:mga0sz30_102954_c1 | nmdc:mga0sz30_102954_c1_60_779 | 238 |
| 1109 | 3300050516 | nmdc:mga0sz30_2977_c1 | nmdc:mga0sz30_2977_c1_1080_1799 | 238 |
| 1110 | 3300050516 | nmdc:mga0sz30_98394_c1 | nmdc:mga0sz30_98394_c1_95_811 | 238 |
| 1111 | 3300053077 | Ga0495601_0170003 | Ga0495601_0170003_315_1034 | 238 |
| 1112 | 3300053080 | Ga0500635_0001720 | Ga0500635_0001720_2999_3718 | 238 |
| 1113 | 3300053085 | Ga0495619_0238218 | Ga0495619_0238218_58_777 | 238 |
| 1114 | 3300053086 | Ga0500578_0154790 | Ga0500578_0154790_81_800 | 238 |
| 1115 | 3300053089 | Ga0500581_145907 | Ga0500581_145907_148_867 | 238 |
| 1116 | 3300053093 | Ga0500651_0010771 | Ga0500651_0010771_1647_2363 | 238 |
| 1117 | 3300053093 | Ga0500651_0272163 | Ga0500651_0272163_205_921 | 238 |
| 1118 | 3300053094 | Ga0500566_0025753 | Ga0500566_0025753_1639_2358 | 238 |
| 1119 | 3300053102 | Ga0500554_010606 | Ga0500554_010606_43_762 | 238 |
| 1120 | 3300053103 | Ga0500555_049236 | Ga0500555_049236_427_1146 | 238 |
| 1121 | 3300053105 | Ga0500557_000128 | Ga0500557_000128_7860_8576 | 238 |
| 1122 | 3300053108 | Ga0500562_021788 | Ga0500562_021788_372_1091 | 238 |
| 1123 | 3300053111 | Ga0500572_004302 | Ga0500572_004302_194_916 | 238 |
| 1124 | 3300053119 | Ga0500595_000095 | Ga0500595_000095_53046_53765 | 238 |
| 1125 | 3300053119 | Ga0500595_003348 | Ga0500595_003348_636_1355 | 238 |
| 1126 | 3300053119 | Ga0500595_003752 | Ga0500595_003752_3499_4215 | 238 |
| 1127 | 3300053119 | Ga0500595_037246 | Ga0500595_037246_347_1063 | 238 |
| 1128 | 3300053119 | Ga0500595_046973 | Ga0500595_046973_504_1226 | 238 |
| 1129 | 3300053121 | Ga0500607_059315 | Ga0500607_059315_151_873 | 238 |
| 1130 | 3300053130 | Ga0500642_0000477 | Ga0500642_0000477_7865_8581 | 238 |
| 1131 | 3300053130 | Ga0500642_0061116 | Ga0500642_0061116_667_1383 | 238 |
| 1132 | 3300053136 | Ga0500559_0059280 | Ga0500559_0059280_693_1412 | 238 |
| 1133 | 3300053138 | Ga0500564_172143 | Ga0500564_172143_47_763 | 238 |
| 1134 | 3300053139 | Ga0500568_0027931 | Ga0500568_0027931_1226_1945 | 238 |
| 1135 | 3300053150 | Ga0500603_000280 | Ga0500603_000280_8606_9325 | 238 |
| 1136 | 3300053154 | Ga0500619_105282 | Ga0500619_105282_63_785 | 238 |
| 1137 | 3300053162 | Ga0500638_007811 | Ga0500638_007811_1539_2258 | 238 |
| 1138 | 3300053177 | Ga0500636_0001993 | Ga0500636_0001993_7946_8668 | 238 |
| 1139 | 3300053178 | Ga0500637_0000653 | Ga0500637_0000653_11458_12177 | 238 |
| 1140 | 3300053178 | Ga0500637_0144347 | Ga0500637_0144347_539_1261 | 238 |
| 1141 | 3300053737 | Ga0500601_000310 | Ga0500601_000310_4167_4889 | 238 |
| 1142 | 3300055283 | Ga0500661_000198 | Ga0500661_000198_7550_8269 | 238 |
| 1143 | 3300061734 | Ga0530510_0531238 | Ga0530510_0531238_125_847 | 238 |
| 1144 | iso_pu_bacteria | 2757320392 | 2757571902 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7u5q-assembly2.cif.gz_B | crystal structure of transcriptional regulator, gntr family, from brucella melitensis | 0.951 | 23 | 237 |
| 7u5q-assembly2.cif.gz_B | crystal structure of transcriptional regulator, gntr family, from brucella melitensis | 0.9467 | 23 | 237 |
| 4egz-assembly1.cif.gz_B | crystal structure of arar(dbd) in complex with operator orr3 | 0.9275 | 24 | 87 |
| 4wwc-assembly1.cif.gz_A | crystal structure of full length yvoa in complex with palindromic operator dna | 0.9201 | 25 | 87 |
| 5d4r-assembly1.cif.gz_A | crystal structure of arar(dbd) in complex with operator ore1 | 0.9189 | 22 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACM2_11_76_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9928 | 22 | 87 | 1.10.10.10 |
| af_P0ACM2_11_76_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9781 | 22 | 87 | 1.10.10.10 |
| 2hs5A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.972 | 25 | 87 | 1.10.10.10 |
| af_P0ACM2_81_217_1.20.120.530 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like | 0.959 | 93 | 227 | 1.20.120.530 |
| af_Q79G00_16_82_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9565 | 23 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7EVA1-F1-model_v4 | GntR family transcriptional regulator | 0.999 | 26 | 238 |
GO:0003677
GO:0003700 |
| AF-A0A4Q7EVA1-F1-model_v4 | GntR family transcriptional regulator | 0.9943 | 26 | 238 |
GO:0003677
GO:0003700 |
| AF-A0A2S8VD96-F1-model_v4 | GntR family transcriptional regulator | 0.9942 | 17 | 238 |
GO:0003677
GO:0003700 |
| AF-A0A1H7UXU4-F1-model_v4 | DNA-binding transcriptional regulator, GntR family | 0.9936 | 17 | 238 |
GO:0003677
GO:0003700 |
| AF-A0A7X4KI93-F1-model_v4 | FCD domain-containing protein | 0.9933 | 17 | 238 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar