F490751

General Info

Members Datasets Scaffolds Average Seq Length
1144 635 927 236

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10047903|Ga0081455_100479032
Length 264
Sequence LTALRRCTNVLVHLWQALPAHTGIRMDQPVIAQRRVAPRSGGRLDRDRQAAPQVFERLRGMIIALELPPGSPLSRAALAEQFGVSSTPIRDALMRLEEEGLVEVFPQYATVVSRIDVHRAQQAHFLRQALELEIVRVLALKPDEALVTELNATIARQLQFAKAGAFEKFMAADNEFHAKLYEAADKQDIWTLVKSRSGHIDRLRRLHLPSPGKAQDIVRHHKLITKAIAGGEPEEAQKHLRTHLSGTLSELAKIRAQHPQYLND

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2643221558 Rhizobium sp. Root149 Isolate Unclassified
18 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
19 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
20 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
21 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
22 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
23 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
24 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
25 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
28 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
29 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
32 2773857925 Microvirga vignae BR3299 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355199
35 2791355256 Rhizobium sp. M10 Isolate Nodule
36 2791355261 Rhizobium sp. J15 Isolate Nodule
37 2791355262 Rhizobium sp. M1 Isolate Nodule
38 2791355264 Rhizobium sp. S9 Isolate Nodule
39 2791355265 Rhizobium sp. H4 Isolate Nodule
40 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
41 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
42 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
43 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
53 2838061910 Rhizobium phaseoli L15 Isolate Nodule
54 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
55 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
56 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
57 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
58 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
59 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
60 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
61 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
62 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
63 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
64 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
65 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
66 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
67 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
68 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
69 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
70 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
71 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
72 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
73 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
74 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
75 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
76 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
77 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
78 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
79 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
80 2855730933 Achromobacter sp. HZ28 Isolate Nodule
81 2855767633 Achromobacter sp. HZ34 Isolate Nodule
82 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
83 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
84 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
85 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
86 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
87 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
88 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
89 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
90 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
91 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
92 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
93 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
94 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
95 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
96 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
97 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
98 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
99 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
100 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
101 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
102 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
103 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
104 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
105 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
106 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
107 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
108 2922368715
109 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
110 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
111 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
112 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
113 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
114 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
115 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
116 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
117 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
118 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
119 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
120 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
121 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
122 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
123 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
124 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
125 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
126 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
127 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
128 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
129 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
130 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
131 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
132 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
133 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
134 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
135 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
136 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
137 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
138 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
139 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
140 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
141 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
142 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
143 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
144 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
145 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
146 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
147 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
148 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
149 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
150 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
151 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
152 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
153 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
154 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
155 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
156 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
157 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
158 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
159 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
160 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
161 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
162 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
163 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
164 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
165 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
166 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
167 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
168 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
169 2996887358 Rhizobium sp. R711 Isolate Nodule
170 2996893221 Rhizobium sp. R635 Isolate Nodule
171 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
172 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
173 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
174 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
175 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
176 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
177 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
178 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
179 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
180 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
181 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
182 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
183 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
188 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
189 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
190 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
191 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
192 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
193 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
194 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
195 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
196 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
197 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
198 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
199 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
200 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
201 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
202 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
203 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
204 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
205 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
206 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
207 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
208 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
209 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
210 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
211 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
212 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
213 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
214 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
215 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
216 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
219 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
220 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
221 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
222 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
223 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
224 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
225 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
226 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
227 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
228 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
229 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
230 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
231 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
232 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
233 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
234 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
235 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
236 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
237 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
238 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
239 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
240 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
245 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
246 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
247 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
248 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
249 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
251 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
252 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
253 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
254 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
255 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
256 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
257 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
258 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
259 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
260 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
261 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
262 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
264 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
265 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
266 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
267 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
268 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
269 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
270 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
271 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
272 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
273 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
286 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
287 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
288 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
289 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
290 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
291 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
292 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
293 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
294 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
296 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
301 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
303 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
359 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
360 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
361 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
365 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
366 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
367 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
368 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
369 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
370 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
371 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
372 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
373 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
376 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
377 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
378 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
379 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
380 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
381 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
382 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
383 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
384 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
385 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
386 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
387 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
388 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
389 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
390 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
391 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
392 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
393 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
394 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
395 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
396 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
397 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
398 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
399 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
400 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
401 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
402 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
403 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
404 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
405 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
406 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
407 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
408 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
409 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
410 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
411 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
412 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
413 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
414 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
415 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
416 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
417 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
418 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
419 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
420 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
421 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
422 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
423 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
424 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
425 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
426 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
427 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
428 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
429 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
430 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
431 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
432 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
433 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
434 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
437 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
438 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
439 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
440 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
445 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
446 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
447 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
448 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
449 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
450 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
451 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
452 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
453 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
454 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
462 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
463 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
464 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
465 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
466 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
467 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
468 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
469 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
470 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
471 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
472 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
473 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
474 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
475 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
476 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
477 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
478 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
479 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
480 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
481 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
482 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
483 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
484 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
485 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
486 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
487 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
488 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
489 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
490 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
491 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
492 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
493 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
494 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
495 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
496 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
497 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
498 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
499 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
500 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
501 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
502 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
503 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
504 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
505 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
506 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
507 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
508 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
509 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
510 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
511 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
512 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
513 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
514 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
515 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
516 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
517 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
518 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
519 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
520 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
521 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
523 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
524 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
527 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
528 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
529 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
530 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
531 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
532 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
533 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
534 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
535 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
536 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
537 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
538 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
539 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
540 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
541 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
542 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
543 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
544 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
545 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
546 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
547 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
548 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
549 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
550 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
551 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
552 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
553 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
554 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
555 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
556 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
557 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
558 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
559 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
560 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
561 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
562 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
563 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
564 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
565 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
566 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
567 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
568 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
569 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
570 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
571 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
572 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
573 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
574 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
575 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
576 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
577 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
578 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
579 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
580 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
581 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
582 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
583 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
584 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
585 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
586 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
587 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
588 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
589 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
590 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
591 8005258706 Rhizobium sp. R693 Isolate Nodule
592 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
593 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
594 8005321885 Rhizobium sp. R72 Isolate Nodule
595 8005382845 Rhizobium sp. R634 Isolate Nodule
596 8005395548 Rhizobium sp. R339 Isolate Nodule
597 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
598 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
599 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
600 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
601 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
602 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
603 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
604 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
605 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
606 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
607 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
608 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
609 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
610 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
611 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
612 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
613 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
614 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
615 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
616 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
617 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
618 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
619 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
620 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
621 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
622 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
623 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
624 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
625 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
626 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
627 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
628 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
629 8024501048 Rhizobium sp. H4 Isolate Nodule
630 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
631 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
632 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
633 8056382006 Rhizobium croatiense 13T Isolate Nodule
634 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
635 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81
Metatranscriptomes 0.18
Isolates 18.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.51
Nodule 16.35
Rhizoplane 4.55
Rhizosphere 54.9
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10041752 3300002067 Bacteria 1336
2 JGI25152J39213_1001108 3300002773 Bacteria 12593
3 JGI25151J46595_10000451 3300003187 Bacteria 39770
4 JGI25151J46595_10012763 3300003187 Bacteria 3808
5 JGI25165J46597_1012936 3300003214 Bacteria 1158
6 JGI25153J46596_10001849 3300003215 Bacteria 12551
7 JGI25153J46596_10003596 3300003215 Bacteria 8611
8 JGI25153J46596_10003675 3300003215 Bacteria 8492
9 JGI25153J46596_10007159 3300003215 Bacteria 5534
10 JGI25153J46596_10012613 3300003215 Bacteria 3629
11 rootH1_10084142 3300003316 Bacteria 1774
12 rootL2_10239686 3300003322 Bacteria 1200
13 rootH1_10058417 3300003323 Bacteria 1887
14 JGI25160J50197_1003782 3300003354 Bacteria 6662
15 JGI25160J50197_1005043 3300003354 Bacteria 5580
16 JGI25160J50197_1025211 3300003354 Bacteria 1669
17 JGI25404J52841_10024642 3300003659 Bacteria 1296
18 Ga0055539_1003001 3300003752 Bacteria 2434
19 Ga0055531_10005144 3300003794 Bacteria 7716
20 Ga0055543_1001103 3300004625 Bacteria 11670
21 Ga0065165_1001646 3300005262 Bacteria 22707
22 Ga0065165_1003743 3300005262 Bacteria 10239
23 Ga0065165_1022241 3300005262 Bacteria 2180
24 Ga0070658_10064511 3300005327 Bacteria 2987
25 Ga0070658_10110967 3300005327 Bacteria 2272
26 Ga0070658_10243097 3300005327 Bacteria 1526
27 Ga0070690_100090747 3300005330 Bacteria 2012
28 Ga0070670_100182032 3300005331 Bacteria 1825
29 Ga0070670_100403626 3300005331 Bacteria 1207
30 Ga0068869_100018682 3300005334 Bacteria 4723
31 Ga0068869_100229158 3300005334 Bacteria 1475
32 Ga0070666_10198145 3300005335 Bacteria 1412
33 Ga0070680_100005214 3300005336 Bacteria 9831
34 Ga0070680_100011561 3300005336 Bacteria 6834
35 Ga0070680_100471625 3300005336 Bacteria 1073
36 Ga0070682_100024236 3300005337 Bacteria 3609
37 Ga0070682_100074067 3300005337 Bacteria 2186
38 Ga0070682_100278192 3300005337 Bacteria 1219
39 Ga0070682_100349336 3300005337 Bacteria 1102
40 Ga0068868_100004833 3300005338 Bacteria 9459
41 Ga0068868_100086679 3300005338 Bacteria 2517
42 Ga0068868_100529731 3300005338 Bacteria 1035
43 Ga0070660_100014405 3300005339 Bacteria 5694
44 Ga0070660_100021819 3300005339 Bacteria 4727
45 Ga0070660_100034372 3300005339 Bacteria 3830
46 Ga0070660_100068342 3300005339 Bacteria 2769
47 Ga0070660_100193274 3300005339 Bacteria 1649
48 Ga0070660_100399953 3300005339 Bacteria 1136
49 Ga0070689_100238269 3300005340 Bacteria 1498
50 Ga0070687_100157363 3300005343 Bacteria 1340
51 Ga0070661_100002881 3300005344 Bacteria 11836
52 Ga0070661_100122108 3300005344 Bacteria 1952
53 Ga0070668_100013201 3300005347 Bacteria 6160
54 Ga0070668_100015674 3300005347 Bacteria 5668
55 Ga0070668_100025268 3300005347 Bacteria 4502
56 Ga0070668_100066527 3300005347 Bacteria 2797
57 Ga0070668_100547921 3300005347 Bacteria 1006
58 Ga0070675_100259455 3300005354 Bacteria 1522
59 Ga0070675_100311874 3300005354 Bacteria 1388
60 Ga0070675_100697504 3300005354 Bacteria 924
61 Ga0070671_100015188 3300005355 Bacteria 6220
62 Ga0070671_100063445 3300005355 Bacteria 3077
63 Ga0070671_100171645 3300005355 Bacteria 1834
64 Ga0070674_100199625 3300005356 Bacteria 1544
65 Ga0070673_100125190 3300005364 Bacteria 2149
66 Ga0070673_100213175 3300005364 Bacteria 1669
67 Ga0070659_100050519 3300005366 Bacteria 3269
68 Ga0070667_100149367 3300005367 Bacteria 2052
69 Ga0070667_100200492 3300005367 Bacteria 1771
70 Ga0070714_100231515 3300005435 Bacteria 1702
71 Ga0070701_10143799 3300005438 Bacteria 1367
72 Ga0070700_100070726 3300005441 Bacteria 2226
73 Ga0070700_100223878 3300005441 Bacteria 1335
74 Ga0070663_100000598 3300005455 Bacteria 19225
75 Ga0070663_100017095 3300005455 Bacteria 4726
76 Ga0070663_100019221 3300005455 Bacteria 4497
77 Ga0070663_100083818 3300005455 Bacteria 2348
78 Ga0070678_100024855 3300005456 Bacteria 4018
79 Ga0070678_100078094 3300005456 Bacteria 2500
80 Ga0070678_100134028 3300005456 Bacteria 1973
81 Ga0070678_100142321 3300005456 Bacteria 1921
82 Ga0070678_100158056 3300005456 Bacteria 1833
83 Ga0070678_100278143 3300005456 Bacteria 1414
84 Ga0070662_100007191 3300005457 Bacteria 7210
85 Ga0070662_100015533 3300005457 Bacteria 5103
86 Ga0070662_100073350 3300005457 Bacteria 2528
87 Ga0070681_10104996 3300005458 Bacteria 2767
88 Ga0070681_10139645 3300005458 Bacteria 2353
89 Ga0070681_10141265 3300005458 Bacteria 2338
90 Ga0068867_100164012 3300005459 Bacteria 1754
91 Ga0068867_100387304 3300005459 Bacteria 1176
92 Ga0070706_100159540 3300005467 Bacteria 2106
93 Ga0070679_100240604 3300005530 Bacteria 1767
94 Ga0070679_100262422 3300005530 Bacteria 1682
95 Ga0070679_100354758 3300005530 Bacteria 1414
96 Ga0070684_100122197 3300005535 Bacteria 2343
97 Ga0070684_100408283 3300005535 Bacteria 1253
98 Ga0070684_100588559 3300005535 Bacteria 1034
99 Ga0068853_100051162 3300005539 Bacteria 3555
100 Ga0068853_100068809 3300005539 Bacteria 3078
101 Ga0068853_100175878 3300005539 Bacteria 1939
102 Ga0068853_100201553 3300005539 Bacteria 1811
103 Ga0068853_100257283 3300005539 Bacteria 1604
104 Ga0070672_100104298 3300005543 Bacteria 2304
105 Ga0070672_100127479 3300005543 Bacteria 2089
106 Ga0070686_100042506 3300005544 Bacteria 2847
107 Ga0070693_100040702 3300005547 Bacteria 2610
108 Ga0070665_100010827 3300005548 Bacteria 9225
109 Ga0070665_100015557 3300005548 Bacteria 7642
110 Ga0070665_100015812 3300005548 Bacteria 7578
111 Ga0070665_100123562 3300005548 Bacteria 2590
112 Ga0070665_100134738 3300005548 Bacteria 2472
113 Ga0070665_100368750 3300005548 Bacteria 1443
114 Ga0070665_100370198 3300005548 Bacteria 1439
115 Ga0070665_100370216 3300005548 Bacteria 1439
116 Ga0068855_100019755 3300005563 Bacteria 8090
117 Ga0068855_100110183 3300005563 Bacteria 3161
118 Ga0068855_100134239 3300005563 Bacteria 2824
119 Ga0068855_100355831 3300005563 Bacteria 1612
120 Ga0068855_100454851 3300005563 Bacteria 1396
121 Ga0068855_100565992 3300005563 Bacteria 1229
122 Ga0070664_100003791 3300005564 Bacteria 12197
123 Ga0070664_100082048 3300005564 Bacteria 2780
124 Ga0070664_100089380 3300005564 Bacteria 2665
125 Ga0068857_100085354 3300005577 Bacteria 2822
126 Ga0068854_100805751 3300005578 Bacteria 819
127 Ga0068856_100002355 3300005614 Bacteria 19438
128 Ga0068856_100083923 3300005614 Bacteria 3164
129 Ga0068856_100368275 3300005614 Bacteria 1456
130 Ga0068856_100649046 3300005614 Bacteria 1076
131 Ga0070702_100249769 3300005615 Bacteria 1202
132 Ga0070702_100281751 3300005615 Bacteria 1142
133 Ga0068852_100008549 3300005616 Bacteria 7551
134 Ga0068852_100018956 3300005616 Bacteria 5435
135 Ga0068852_100082923 3300005616 Bacteria 2850
136 Ga0068852_100229094 3300005616 Bacteria 1770
137 Ga0068852_100280195 3300005616 Bacteria 1607
138 Ga0068852_100360141 3300005616 Bacteria 1422
139 Ga0068852_100579129 3300005616 Bacteria 1125
140 Ga0068852_100714906 3300005616 Bacteria 1012
141 Ga0068859_100016877 3300005617 Bacteria 7328
142 Ga0068859_100166317 3300005617 Bacteria 2285
143 Ga0068859_100584304 3300005617 Bacteria 1211
144 Ga0068864_100027680 3300005618 Bacteria 4789
145 Ga0068864_100821211 3300005618 Bacteria 915
146 Ga0068861_100064658 3300005719 Bacteria 2815
147 Ga0068861_100092252 3300005719 Bacteria 2392
148 Ga0068861_100096747 3300005719 Bacteria 2340
149 Ga0068851_10129435 3300005834 Bacteria 1364
150 Ga0068851_10324908 3300005834 Bacteria 890
151 Ga0068870_10139812 3300005840 Bacteria 1416
152 Ga0068870_10175109 3300005840 Bacteria 1283
153 Ga0068863_100086085 3300005841 Bacteria 2978
154 Ga0068858_100151471 3300005842 Bacteria 2181
155 Ga0068858_100153798 3300005842 Bacteria 2164
156 Ga0068858_100365844 3300005842 Bacteria 1382
157 Ga0068858_100404129 3300005842 Bacteria 1312
158 Ga0068858_101072092 3300005842 Bacteria 791
159 Ga0068860_100000577 3300005843 Bacteria 44036
160 Ga0068860_100177029 3300005843 Bacteria 2061
161 Ga0068860_100222173 3300005843 Bacteria 1834
162 Ga0068860_100296370 3300005843 Bacteria 1583
163 Ga0068860_100337864 3300005843 Bacteria 1480
164 Ga0068862_100012465 3300005844 Bacteria 7035
165 Ga0068862_100036297 3300005844 Bacteria 4178
166 Ga0068862_100052418 3300005844 Bacteria 3490
167 Ga0068862_100253887 3300005844 Bacteria 1603
168 Ga0068862_100489020 3300005844 Bacteria 1166
169 Ga0081455_10004895 3300005937 Bacteria 14842
170 Ga0081455_10013363 3300005937 Bacteria 8121
171 Ga0081455_10047903 3300005937 Bacteria 3697
172 Ga0081455_10065600 3300005937 Bacteria 3036
173 Ga0081540_1004561 3300005983 Bacteria 10498
174 Ga0081540_1005048 3300005983 Bacteria 9905
175 Ga0081540_1010591 3300005983 Bacteria 6230
176 Ga0081540_1011487 3300005983 Bacteria 5917
177 Ga0081540_1011797 3300005983 Bacteria 5809
178 Ga0081540_1013781 3300005983 Bacteria 5235
179 Ga0081540_1031452 3300005983 Bacteria 2917
180 Ga0081540_1036693 3300005983 Bacteria 2609
181 Ga0081540_1051966 3300005983 Bacteria 2022
182 Ga0081539_10019046 3300005985 Bacteria 4722
183 Ga0075365_10004812 3300006038 Bacteria 7201
184 Ga0075365_10011993 3300006038 Bacteria 5122
185 Ga0075365_10093839 3300006038 Bacteria 2048
186 Ga0075365_10116414 3300006038 Bacteria 1841
187 Ga0075365_10199218 3300006038 Bacteria 1402
188 Ga0075365_10311713 3300006038 Unclassified 1108
189 Ga0075368_10035929 3300006042 Bacteria 1935
190 Ga0075368_10141535 3300006042 Bacteria 1002
191 Ga0075363_100003163 3300006048 Bacteria 6930
192 Ga0075363_100070001 3300006048 Bacteria 1904
193 Ga0075364_10011381 3300006051 Bacteria 5405
194 Ga0075364_10020053 3300006051 Bacteria 4204
195 Ga0075364_10044928 3300006051 Bacteria 2874
196 Ga0075364_10223317 3300006051 Unclassified 1279
197 Ga0075364_10287374 3300006051 Bacteria 1119
198 Ga0075362_10177018 3300006177 Bacteria 1032
199 Ga0075367_10018509 3300006178 Bacteria 3845
200 Ga0075367_10159273 3300006178 Bacteria 1403
201 Ga0075367_10186630 3300006178 Bacteria 1293
202 Ga0075369_10063085 3300006186 Bacteria 1620
203 Ga0075366_10138885 3300006195 Bacteria 1468
204 Ga0075366_10205646 3300006195 Bacteria 1198
205 Ga0097621_100079086 3300006237 Bacteria 2733
206 Ga0075370_10012846 3300006353 Bacteria 4437
207 Ga0075370_10058931 3300006353 Bacteria 2184
208 Ga0068871_100221194 3300006358 Bacteria 1640
209 Ga0068871_100302702 3300006358 Bacteria 1404
210 Ga0068871_100508328 3300006358 Bacteria 1087
211 Ga0075428_100014565 3300006844 Bacteria 8735
212 Ga0075434_100669941 3300006871 Bacteria 1055
213 Ga0068865_100077817 3300006881 Bacteria 2371
214 Ga0068865_100425324 3300006881 Bacteria 1093
215 Ga0097620_100016876 3300006931 Bacteria 7328
216 Ga0097620_100166318 3300006931 Bacteria 2285
217 Ga0097620_100584282 3300006931 Bacteria 1211
218 Ga0075435_100222013 3300007076 Bacteria 1605
219 Ga0075435_100416675 3300007076 Bacteria 1156
220 Ga0105250_10069082 3300009092 Bacteria 1426
221 Ga0105240_10015922 3300009093 Bacteria 10199
222 Ga0105240_10199785 3300009093 Bacteria 2344
223 Ga0105240_10575624 3300009093 Bacteria 1243
224 Ga0111539_10042663 3300009094 Bacteria 5445
225 Ga0105245_10009744 3300009098 Bacteria 8373
226 Ga0105245_10041488 3300009098 Bacteria 4102
227 Ga0105245_10044825 3300009098 Bacteria 3948
228 Ga0105245_10183066 3300009098 Bacteria 2003
229 Ga0105245_10262667 3300009098 Bacteria 1681
230 Ga0105247_10009734 3300009101 Bacteria 5829
231 Ga0105247_10187484 3300009101 Bacteria 1383
232 Ga0105247_10348157 3300009101 Bacteria 1041
233 Ga0114129_10209945 3300009147 Bacteria 2633
234 Ga0114129_10364713 3300009147 Bacteria 1911
235 Ga0105243_10138872 3300009148 Bacteria 2071
236 Ga0105243_10249007 3300009148 Bacteria 1585
237 Ga0105243_10504984 3300009148 Bacteria 1146
238 Ga0105241_10174490 3300009174 Bacteria 1778
239 Ga0105241_10412078 3300009174 Bacteria 1187
240 Ga0105242_10018681 3300009176 Bacteria 5424
241 Ga0105242_10087044 3300009176 Bacteria 2622
242 Ga0105242_10632323 3300009176 Bacteria 1038
243 Ga0105242_10928944 3300009176 Bacteria 872
244 Ga0105248_10037824 3300009177 Bacteria 5400
245 Ga0105248_10303341 3300009177 Bacteria 1798
246 Ga0105248_10315684 3300009177 Bacteria 1760
247 Ga0105248_10372403 3300009177 Bacteria 1608
248 Ga0105248_10942923 3300009177 Bacteria 975
249 Ga0105248_11196719 3300009177 Bacteria 859
250 Ga0105237_10009776 3300009545 Bacteria 10257
251 Ga0105237_10016276 3300009545 Bacteria 7729
252 Ga0105237_10061924 3300009545 Bacteria 3740
253 Ga0105237_10065294 3300009545 Bacteria 3636
254 Ga0105237_10834968 3300009545 Bacteria 928
255 Ga0105238_10116422 3300009551 Bacteria 2652
256 Ga0105238_10351489 3300009551 Bacteria 1463
257 Ga0105238_10685202 3300009551 Bacteria 1037
258 Ga0105249_10369478 3300009553 Bacteria 1458
259 Ga0123340_1000167 3300009763 Bacteria 33533
260 Ga0123341_1010909 3300009765 Bacteria 8280
261 Ga0123341_1063720 3300009765 Bacteria 1748
262 Ga0123342_1018186 3300009766 Bacteria 5658
263 Ga0099796_10011789 3300010159 Bacteria 2450
264 Ga0105239_10032831 3300010375 Bacteria 5704
265 Ga0105239_10040749 3300010375 Bacteria 5089
266 Ga0105239_10046379 3300010375 Bacteria 4762
267 Ga0105239_10060369 3300010375 Bacteria 4162
268 Ga0105239_10094671 3300010375 Bacteria 3299
269 Ga0105239_10120138 3300010375 Bacteria 2917
270 Ga0105239_10371891 3300010375 Bacteria 1615
271 Ga0105239_10620053 3300010375 Bacteria 1234
272 Ga0105246_10022753 3300011119 Bacteria 4048
273 Ga0105246_10081357 3300011119 Bacteria 2308
274 Ga0105246_10203546 3300011119 Bacteria 1540
275 Ga0105246_10386997 3300011119 Bacteria 1157
276 Ga0157373_10000647 3300013100 Bacteria 27419
277 Ga0157373_10049148 3300013100 Bacteria 3006
278 Ga0157371_10028934 3300013102 Bacteria 4011
279 Ga0157371_10173482 3300013102 Bacteria 1541
280 Ga0157371_10436736 3300013102 Bacteria 961
281 Ga0157370_10022331 3300013104 Bacteria 6296
282 Ga0157370_10029317 3300013104 Bacteria 5403
283 Ga0157370_10031768 3300013104 Bacteria 5161
284 Ga0157370_10194746 3300013104 Bacteria 1881
285 Ga0157369_10011194 3300013105 Bacteria 10195
286 Ga0157369_10159097 3300013105 Bacteria 2385
287 Ga0157369_10215276 3300013105 Bacteria 2012
288 Ga0157374_10016521 3300013296 Bacteria 6489
289 Ga0157374_10164035 3300013296 Bacteria 2165
290 Ga0157378_10014932 3300013297 Bacteria 6797
291 Ga0157378_10225469 3300013297 Bacteria 1783
292 Ga0157378_10302560 3300013297 Bacteria 1548
293 Ga0163162_10274922 3300013306 Bacteria 1816
294 Ga0163162_10323237 3300013306 Bacteria 1675
295 Ga0157372_10000593 3300013307 Bacteria 39451
296 Ga0157372_10027954 3300013307 Bacteria 6149
297 Ga0157375_10283930 3300013308 Bacteria 1818
298 Ga0163163_10042519 3300014325 Bacteria 4451
299 Ga0163163_10845215 3300014325 Bacteria 979
300 Ga0157380_10152327 3300014326 Bacteria 2000
301 Ga0157380_10534424 3300014326 Bacteria 1147
302 Ga0157377_10027973 3300014745 Bacteria 3031
303 Ga0157377_10214457 3300014745 Bacteria 1229
304 Ga0157379_10053440 3300014968 Bacteria 3608
305 Ga0157379_10112157 3300014968 Bacteria 2450
306 Ga0157376_10009078 3300014969 Bacteria 7203
307 Ga0157376_10023064 3300014969 Bacteria 4864
308 Ga0157376_10032010 3300014969 Bacteria 4218
309 Ga0157376_10160662 3300014969 Bacteria 2036
310 Ga0157376_10713806 3300014969 Bacteria 1009
311 Ga0163161_10079952 3300017792 Bacteria 2405
312 Ga0163161_10145217 3300017792 Bacteria 1799
313 Ga0206356_10161480 3300020070 Bacteria 2377
314 Ga0206354_10602836 3300020081 Bacteria 882
315 Ga0213876_10077997 3300021384 Bacteria 1750
316 Ga0209563_100670 3300025230 Bacteria 10845
317 Ga0207425_1010250 3300025245 Bacteria 2289
318 Ga0207425_1017347 3300025245 Bacteria 1583
319 Ga0209677_100221 3300025253 Bacteria 40837
320 Ga0209677_101711 3300025253 Bacteria 9125
321 Ga0209129_1000489 3300025258 Bacteria 28872
322 Ga0209233_1002119 3300025261 Bacteria 7478
323 Ga0209455_1022391 3300025272 Bacteria 1205
324 Ga0209455_1031154 3300025272 Bacteria 900
325 Ga0209025_1000003 3300025294 Bacteria 1366495
326 Ga0209025_1002657 3300025294 Bacteria 18286
327 Ga0209564_1006843 3300025295 Bacteria 6021
328 Ga0209758_1000030 3300025297 Bacteria 509217
329 Ga0209758_1001470 3300025297 Bacteria 27657
330 Ga0209758_1002448 3300025297 Bacteria 18947
331 Ga0209758_1003221 3300025297 Bacteria 15206
332 Ga0209758_1003848 3300025297 Bacteria 13172
333 Ga0209758_1004001 3300025297 Bacteria 12754
334 Ga0209758_1007239 3300025297 Bacteria 7632
335 Ga0209758_1031807 3300025297 Bacteria 2156
336 Ga0209758_1036140 3300025297 Bacteria 1934
337 Ga0209758_1041277 3300025297 Bacteria 1727
338 Ga0209758_1051646 3300025297 Bacteria 1429
339 Ga0209256_1004427 3300025299 Bacteria 8829
340 Ga0207426_1001583 3300025302 Bacteria 18291
341 Ga0207426_1010110 3300025302 Bacteria 3686
342 Ga0209257_1003693 3300025304 Bacteria 12738
343 Ga0209257_1007061 3300025304 Bacteria 6941
344 Ga0207697_10108442 3300025315 Bacteria 1188
345 Ga0207710_10077684 3300025900 Bacteria 1534
346 Ga0207710_10133009 3300025900 Bacteria 1196
347 Ga0207688_10026849 3300025901 Bacteria 3168
348 Ga0207688_10083585 3300025901 Bacteria 1826
349 Ga0207688_10256468 3300025901 Bacteria 1060
350 Ga0207647_10002968 3300025904 Bacteria 12759
351 Ga0207645_10112693 3300025907 Bacteria 1762
352 Ga0207645_10256861 3300025907 Bacteria 1157
353 Ga0207643_10107871 3300025908 Bacteria 1638
354 Ga0207705_10034198 3300025909 Bacteria 3634
355 Ga0207705_10318544 3300025909 Bacteria 1195
356 Ga0207705_10348081 3300025909 Bacteria 1141
357 Ga0207654_10042739 3300025911 Bacteria 2566
358 Ga0207707_10159207 3300025912 Bacteria 1974
359 Ga0207707_10190557 3300025912 Bacteria 1789
360 Ga0207695_10001156 3300025913 Bacteria 45753
361 Ga0207695_10195650 3300025913 Bacteria 1938
362 Ga0207695_10483740 3300025913 Bacteria 1120
363 Ga0207671_10009815 3300025914 Bacteria 7966
364 Ga0207671_10084741 3300025914 Bacteria 2380
365 Ga0207671_10208480 3300025914 Bacteria 1528
366 Ga0207671_10215184 3300025914 Bacteria 1504
367 Ga0207671_10218399 3300025914 Bacteria 1493
368 Ga0207660_10012643 3300025917 Bacteria 5527
369 Ga0207660_10085154 3300025917 Bacteria 2331
370 Ga0207660_10329673 3300025917 Bacteria 1220
371 Ga0207657_10000510 3300025919 Bacteria 41051
372 Ga0207657_10030292 3300025919 Bacteria 4912
373 Ga0207657_10032543 3300025919 Bacteria 4710
374 Ga0207657_10053216 3300025919 Bacteria 3507
375 Ga0207657_10187229 3300025919 Bacteria 1671
376 Ga0207657_10212004 3300025919 Bacteria 1554
377 Ga0207657_10350377 3300025919 Bacteria 1164
378 Ga0207649_10018858 3300025920 Bacteria 3934
379 Ga0207649_10139777 3300025920 Bacteria 1655
380 Ga0207652_10023363 3300025921 Bacteria 5121
381 Ga0207652_10042542 3300025921 Bacteria 3867
382 Ga0207652_10180515 3300025921 Bacteria 1897
383 Ga0207652_10632312 3300025921 Bacteria 958
384 Ga0207646_10639630 3300025922 Bacteria 953
385 Ga0207681_10047401 3300025923 Bacteria 2895
386 Ga0207681_10383193 3300025923 Bacteria 1132
387 Ga0207694_10120369 3300025924 Bacteria 2095
388 Ga0207694_10223641 3300025924 Bacteria 1536
389 Ga0207650_10728091 3300025925 Bacteria 839
390 Ga0207659_10500644 3300025926 Bacteria 1028
391 Ga0207664_10270537 3300025929 Bacteria 1488
392 Ga0207644_10003534 3300025931 Bacteria 10123
393 Ga0207690_10000725 3300025932 Bacteria 21280
394 Ga0207690_10079258 3300025932 Bacteria 2288
395 Ga0207690_10566500 3300025932 Bacteria 925
396 Ga0207706_10000093 3300025933 Bacteria 93173
397 Ga0207706_10039680 3300025933 Bacteria 4174
398 Ga0207706_10107804 3300025933 Bacteria 2451
399 Ga0207686_10257785 3300025934 Bacteria 1277
400 Ga0207709_10258685 3300025935 Bacteria 1275
401 Ga0207709_10356389 3300025935 Bacteria 1106
402 Ga0207709_10529046 3300025935 Bacteria 924
403 Ga0207670_10344009 3300025936 Bacteria 1179
404 Ga0207669_10042091 3300025937 Bacteria 2663
405 Ga0207704_10087655 3300025938 Bacteria 2033
406 Ga0207704_10455356 3300025938 Bacteria 1022
407 Ga0207691_10056371 3300025940 Bacteria 3579
408 Ga0207691_10419708 3300025940 Bacteria 1140
409 Ga0207711_10023938 3300025941 Bacteria 5111
410 Ga0207711_10056621 3300025941 Bacteria 3369
411 Ga0207711_10310148 3300025941 Bacteria 1457
412 Ga0207689_10009995 3300025942 Bacteria 8179
413 Ga0207679_10068588 3300025945 Bacteria 2665
414 Ga0207679_10139755 3300025945 Bacteria 1956
415 Ga0207679_10352563 3300025945 Bacteria 1283
416 Ga0207667_10003071 3300025949 Bacteria 20698
417 Ga0207667_10076640 3300025949 Bacteria 3469
418 Ga0207667_10091474 3300025949 Bacteria 3143
419 Ga0207667_10375327 3300025949 Bacteria 1449
420 Ga0207667_11023390 3300025949 Bacteria 812
421 Ga0207651_10226524 3300025960 Bacteria 1515
422 Ga0207651_10433481 3300025960 Bacteria 1124
423 Ga0207712_10032642 3300025961 Bacteria 3515
424 Ga0207668_10239790 3300025972 Bacteria 1466
425 Ga0207640_10062308 3300025981 Bacteria 2474
426 Ga0207658_10046691 3300025986 Bacteria 3165
427 Ga0207658_10110777 3300025986 Bacteria 2170
428 Ga0207658_10845704 3300025986 Bacteria 832
429 Ga0207677_10068509 3300026023 Bacteria 2491
430 Ga0207703_10036511 3300026035 Bacteria 3912
431 Ga0207703_10075570 3300026035 Bacteria 2793
432 Ga0207703_10307582 3300026035 Bacteria 1448
433 Ga0207703_10599310 3300026035 Bacteria 1042
434 Ga0207639_10051447 3300026041 Bacteria 3133
435 Ga0207639_10123494 3300026041 Bacteria 2131
436 Ga0207639_10139648 3300026041 Bacteria 2017
437 Ga0207639_10182571 3300026041 Bacteria 1786
438 Ga0207639_10303926 3300026041 Bacteria 1411
439 Ga0207678_10019543 3300026067 Bacteria 5952
440 Ga0207678_10030242 3300026067 Bacteria 4728
441 Ga0207678_10320935 3300026067 Bacteria 1333
442 Ga0207708_10011392 3300026075 Bacteria 6623
443 Ga0207708_10072081 3300026075 Bacteria 2647
444 Ga0207702_10004987 3300026078 Bacteria 11661
445 Ga0207702_10052978 3300026078 Bacteria 3435
446 Ga0207702_10263990 3300026078 Bacteria 1622
447 Ga0207702_10452340 3300026078 Bacteria 1246
448 Ga0207702_11196976 3300026078 Bacteria 754
449 Ga0207641_10358026 3300026088 Bacteria 1392
450 Ga0207641_10404061 3300026088 Bacteria 1312
451 Ga0207648_10193731 3300026089 Bacteria 1802
452 Ga0207648_10250267 3300026089 Bacteria 1580
453 Ga0207648_10782948 3300026089 Bacteria 887
454 Ga0207676_10098407 3300026095 Bacteria 2418
455 Ga0207676_10680803 3300026095 Bacteria 995
456 Ga0207674_10097268 3300026116 Bacteria 2927
457 Ga0207675_100025561 3300026118 Bacteria 5495
458 Ga0207675_100030002 3300026118 Bacteria 5062
459 Ga0207683_10011692 3300026121 Bacteria 7493
460 Ga0207683_10049887 3300026121 Bacteria 3664
461 Ga0207683_10078177 3300026121 Bacteria 2932
462 Ga0207683_10166455 3300026121 Bacteria 1995
463 Ga0207683_10170942 3300026121 Bacteria 1968
464 Ga0207683_10237400 3300026121 Bacteria 1663
465 Ga0207698_10054572 3300026142 Bacteria 3075
466 Ga0207698_10114172 3300026142 Bacteria 2271
467 Ga0209389_1000163 3300027296 Bacteria 55041
468 Ga0209489_101100 3300027361 Bacteria 55041
469 Ga0209700_100014 3300027363 Bacteria 299349
470 Ga0268266_10004510 3300028379 Bacteria 13310
471 Ga0268266_10014493 3300028379 Bacteria 6775
472 Ga0268266_10250808 3300028379 Bacteria 1637
473 Ga0268266_10263322 3300028379 Bacteria 1598
474 Ga0268266_10688045 3300028379 Bacteria 985
475 Ga0268265_10002012 3300028380 Bacteria 16001
476 Ga0268265_10557746 3300028380 Bacteria 1088
477 Ga0268264_10000107 3300028381 Bacteria 209105
478 Ga0268264_10101045 3300028381 Bacteria 2506
479 Ga0268264_10745597 3300028381 Bacteria 975
480 Ga0265334_10017875 3300028573 Bacteria 2924
481 Ga0265318_10009533 3300028577 Bacteria 4263
482 Ga0265323_10000706 3300028653 Bacteria 18167
483 Ga0265336_10000683 3300028666 Bacteria 18322
484 Ga0307517_10001121 3300028786 Bacteria 45217
485 Ga0307515_10048703 3300028794 Bacteria 6400
486 Ga0265338_10001041 3300028800 Bacteria 46363
487 Ga0265324_10004820 3300029957 Bacteria 5958
488 Ga0316177_1142486 3300030731 Bacteria 4082
489 Ga0316178_1062662 3300030735 Bacteria 1086
490 Ga0307513_10170936 3300031456 Bacteria 2051
491 Ga0307513_10238570 3300031456 Bacteria 1625
492 Ga0307513_10326987 3300031456 Bacteria 1289
493 Ga0307509_10032140 3300031507 Bacteria 5786
494 Ga0307509_10306562 3300031507 Bacteria 1332
495 Ga0307509_10355137 3300031507 Bacteria 1187
496 Ga0307408_100000252 3300031548 Bacteria 54975
497 Ga0265313_10085917 3300031595 Bacteria 1420
498 Ga0307508_10000154 3300031616 Bacteria 82824
499 Ga0307508_10144852 3300031616 Bacteria 1980
500 Ga0307508_10199788 3300031616 Bacteria 1600
501 Ga0307508_10284103 3300031616 Bacteria 1248
502 Ga0265314_10084709 3300031711 Bacteria 2080
503 Ga0265342_10000687 3300031712 Bacteria 35389
504 Ga0307516_10009658 3300031730 Bacteria 10725
505 Ga0307516_10046891 3300031730 Bacteria 4261
506 Ga0307516_10048561 3300031730 Bacteria 4176
507 Ga0307516_10058550 3300031730 Bacteria 3750
508 Ga0307405_10166428 3300031731 Bacteria 1568
509 Ga0307405_10239103 3300031731 Bacteria 1344
510 Ga0307416_100250974 3300032002 Bacteria 1722
511 Ga0307416_100369373 3300032002 Bacteria 1460
512 Ga0307411_10079962 3300032005 Bacteria 2246
513 Ga0307415_100195771 3300032126 Bacteria 1599
514 Ga0307510_10020868 3300033180 Bacteria 7646
515 Ga0307510_10035200 3300033180 Bacteria 5596
516 Ga0307510_10210970 3300033180 Bacteria 1464
517 Ga0307510_10229271 3300033180 Bacteria 1361
518 Ga0373930_0038620 3300034816 Bacteria 1009
519 Ga0373936_0034200 3300035113 Bacteria 2018
520 Ga0373936_0050697 3300035113 Bacteria 1679
521 Ga0373941_0018909 3300035115 Bacteria 1910
522 Ga0373945_0023969 3300035116 Bacteria 2111
523 Ga0373954_0049206 3300035118 Bacteria 1976
524 Ga0373956_0016462 3300035119 Bacteria 3106
525 Ga0373943_0019761 3300035170 Bacteria 3101
526 Ga0373946_0077904 3300035171 Bacteria 1445
527 Ga0373946_0156936 3300035171 Bacteria 1066
528 Ga0373924_0105697 3300035410 Bacteria 1213
529 Ga0373931_0000922 3300035691 Bacteria 12362
530 Ga0373931_0069916 3300035691 Bacteria 1914
531 Ga0373931_0401473 3300035691 Bacteria 868
532 Ga0373935_0007139 3300035692 Bacteria 6669
533 Ga0373935_0061490 3300035692 Bacteria 2404
534 Ga0373927_0003207 3300035695 Bacteria 11783
535 Ga0373927_0027031 3300035695 Bacteria 3750
536 Ga0373927_0130679 3300035695 Bacteria 1640
537 Ga0373927_0304999 3300035695 Bacteria 1048
538 Ga0373927_0310865 3300035695 Bacteria 1037
539 Ga0373927_0369211 3300035695 Bacteria 946
540 Ga0373947_0016126 3300035725 Bacteria 4293
541 Ga0373925_0051695 3300037068 Bacteria 3068
542 Ga0373925_0386573 3300037068 Bacteria 1140
543 Ga0373925_0448791 3300037068 Bacteria 1056
544 Ga0395898_0333998 3300037466 Bacteria 1445
545 Ga0395905_0003426 3300037471 Bacteria 16972
546 Ga0395905_0072293 3300037471 Bacteria 3234
547 Ga0395905_0177334 3300037471 Bacteria 2000
548 Ga0395905_0213892 3300037471 Bacteria 1806
549 Ga0436364_1376044 3300037853 Bacteria 1231
550 Ga0436365_1627177 3300039437 Bacteria 3436
551 Ga0436363_0270101 3300039450 Bacteria 4354
552 Ga0439465_0010459 3300041413 Bacteria 2914
553 Ga0451791_0655594 3300041451 Bacteria 961
554 Ga0451849_1322946 3300041505 Bacteria 951
555 Ga0439459_0008892 3300042438 Bacteria 1727
556 Ga0466972_0078620 3300044658 Bacteria 1571
557 Ga0466963_0274646 3300044694 Unclassified 1184
558 Ga0466957_0195755 3300044842 Bacteria 1326
559 Ga0466957_0380207 3300044842 Bacteria 963
560 Ga0466960_0235099 3300044901 Bacteria 1013
561 Ga0466959_0221764 3300045049 Bacteria 1311
562 Ga0466958_0104327 3300045836 Bacteria 1766
563 Ga0466967_0001133 3300045976 Bacteria 14847
564 Ga0495617_058050 3300046452 Bacteria 1282
565 Ga0495592_0037169 3300046454 Bacteria 3666
566 Ga0495603_0000182 3300046455 Bacteria 32426
567 Ga0495603_0004488 3300046455 Bacteria 8327
568 Ga0495603_0030757 3300046455 Bacteria 3233
569 Ga0495603_0148374 3300046455 Bacteria 1363
570 Ga0495603_0363663 3300046455 Bacteria 830
571 Ga0495629_0000314 3300046459 Bacteria 41394
572 Ga0495641_0001508 3300046461 Bacteria 19835
573 Ga0495641_0041135 3300046461 Bacteria 2148
574 Ga0495651_0012151 3300046462 Bacteria 6629
575 Ga0495651_0180065 3300046462 Bacteria 1497
576 Ga0495653_0101966 3300046463 Bacteria 2078
577 Ga0495653_0109029 3300046463 Bacteria 1993
578 Ga0495580_0036094 3300046472 Bacteria 3550
579 Ga0495582_0000597 3300046473 Bacteria 19925
580 Ga0495582_0016511 3300046473 Bacteria 4044
581 Ga0495605_0120213 3300046474 Bacteria 1191
582 Ga0495639_0000235 3300046475 Bacteria 27682
583 Ga0495639_0089101 3300046475 Bacteria 1445
584 Ga0495662_0001470 3300046476 Bacteria 11662
585 Ga0495664_0005693 3300046477 Bacteria 6856
586 Ga0495664_0315894 3300046477 Bacteria 942
587 Ga0495584_0015964 3300046491 Bacteria 3832
588 Ga0495585_0048788 3300046492 Bacteria 2353
589 Ga0495594_0000302 3300046499 Bacteria 24227
590 Ga0495607_0142450 3300046501 Bacteria 1235
591 Ga0495606_0047029 3300046507 Bacteria 2848
592 Ga0495606_0106966 3300046507 Bacteria 1693
593 Ga0495606_0116102 3300046507 Bacteria 1608
594 Ga0495606_0159498 3300046507 Bacteria 1317
595 Ga0495610_0099204 3300046512 Bacteria 1307
596 Ga0495610_0136409 3300046512 Bacteria 1060
597 Ga0495616_0020136 3300046513 Bacteria 3634
598 Ga0495616_0032705 3300046513 Bacteria 2715
599 Ga0495628_0029830 3300046516 Bacteria 4420
600 Ga0495628_0274453 3300046516 Bacteria 1253
601 Ga0495628_0294238 3300046516 Bacteria 1203
602 Ga0495628_0376855 3300046516 Bacteria 1040
603 Ga0495630_0002415 3300046517 Bacteria 12968
604 Ga0495632_0067614 3300046519 Bacteria 1723
605 Ga0495637_0087103 3300046520 Bacteria 1237
606 Ga0495643_0208714 3300046522 Bacteria 933
607 Ga0495644_0072945 3300046523 Bacteria 1291
608 Ga0495648_0000619 3300046524 Bacteria 38032
609 Ga0495648_0006267 3300046524 Bacteria 9733
610 Ga0495666_0035782 3300046526 Bacteria 2419
611 Ga0495652_0006258 3300046529 Bacteria 11097
612 Ga0495652_0041525 3300046529 Bacteria 3970
613 Ga0495652_0232304 3300046529 Bacteria 1378
614 Ga0495665_0000619 3300046531 Bacteria 18044
615 Ga0495640_0000308 3300046533 Bacteria 33750
616 Ga0495640_0124019 3300046533 Bacteria 1676
617 Ga0495640_0229529 3300046533 Bacteria 1168
618 Ga0495587_0032889 3300046536 Bacteria 3132
619 Ga0495609_0102427 3300046538 Bacteria 1240
620 Ga0495609_0155626 3300046538 Bacteria 971
621 Ga0495621_0064946 3300046539 Bacteria 1332
622 Ga0495645_0002277 3300046543 Bacteria 13061
623 Ga0495622_0033182 3300046557 Bacteria 2410
624 Ga0495622_0056752 3300046557 Bacteria 1816
625 Ga0495622_0072635 3300046557 Bacteria 1587
626 Ga0495633_0012187 3300046558 Bacteria 4588
627 Ga0495633_0063792 3300046558 Bacteria 1723
628 Ga0495667_0008896 3300046559 Bacteria 6827
629 Ga0495656_0042782 3300046615 Bacteria 1898
630 Ga0495668_0017158 3300046616 Bacteria 4205
631 Ga0495668_0052268 3300046616 Bacteria 2261
632 Ga0495668_0069062 3300046616 Bacteria 1943
633 Ga0495668_0131199 3300046616 Bacteria 1371
634 Ga0495634_0001483 3300046642 Bacteria 20763
635 Ga0495634_0047054 3300046642 Bacteria 2908
636 Ga0495611_0113091 3300046648 Bacteria 1264
637 Ga0495625_0123597 3300046660 Bacteria 1759
638 Ga0495625_0134632 3300046660 Bacteria 1671
639 Ga0495625_0164807 3300046660 Bacteria 1483
640 Ga0495625_0195089 3300046660 Bacteria 1339
641 Ga0495635_0003423 3300046663 Bacteria 10975
642 Ga0495635_0045072 3300046663 Bacteria 3042
643 Ga0495661_0102372 3300046665 Bacteria 1610
644 Ga0495661_0137567 3300046665 Bacteria 1332
645 Ga0495588_0004152 3300046674 Bacteria 6381
646 Ga0495588_0006111 3300046674 Bacteria 5405
647 Ga0495588_0081788 3300046674 Bacteria 1686
648 Ga0495657_0021179 3300046675 Bacteria 4666
649 Ga0495657_0060848 3300046675 Bacteria 2500
650 Ga0495657_0135004 3300046675 Bacteria 1542
651 Ga0495599_0032491 3300046678 Bacteria 3276
652 Ga0495623_0124232 3300046679 Bacteria 1551
653 Ga0495646_0077067 3300046680 Bacteria 1951
654 Ga0495647_0000405 3300046681 Bacteria 12350
655 Ga0495647_0047624 3300046681 Bacteria 1655
656 Ga0495647_0119342 3300046681 Bacteria 1108
657 Ga0495658_0000936 3300046683 Bacteria 15569
658 Ga0495658_0259591 3300046683 Bacteria 1094
659 Ga0495669_0035983 3300046684 Bacteria 2187
660 Ga0495669_0096619 3300046684 Bacteria 1369
661 Ga0495613_0004828 3300046689 Bacteria 10114
662 Ga0495613_0082107 3300046689 Bacteria 2341
663 Ga0495624_0000810 3300046690 Bacteria 24701
664 Ga0495624_0116093 3300046690 Bacteria 1645
665 Ga0495670_0076587 3300046691 Bacteria 1700
666 Ga0495670_0276454 3300046691 Bacteria 898
667 Ga0495671_0106338 3300046692 Bacteria 1370
668 Ga0495589_0092108 3300046794 Bacteria 1472
669 Ga0495600_0004756 3300046809 Bacteria 8148
670 Ga0495600_0049276 3300046809 Bacteria 2748
671 Ga0495600_0211607 3300046809 Bacteria 1242
672 Ga0495660_0165806 3300046810 Bacteria 1080
673 Ga0495581_0000683 3300047315 Bacteria 17799
674 Ga0495581_0037772 3300047315 Bacteria 2795
675 Ga0495604_0005707 3300047317 Bacteria 9871
676 Ga0495604_0321556 3300047317 Bacteria 1034
677 Ga0495604_0347989 3300047317 Bacteria 985
678 Ga0495636_0027019 3300047318 Bacteria 2337
679 Ga0495674_0033870 3300047319 Bacteria 4623
680 Ga0495672_0018381 3300047320 Bacteria 4642
681 Ga0495672_0091395 3300047320 Bacteria 1671
682 Ga0495676_0005624 3300047321 Bacteria 11492
683 Ga0495676_0146325 3300047321 Bacteria 1687
684 Ga0495676_0165304 3300047321 Bacteria 1562
685 Ga0495680_0181214 3300047322 Bacteria 1520
686 Ga0495680_0201624 3300047322 Bacteria 1427
687 Ga0495683_0026647 3300047323 Bacteria 2958
688 Ga0495683_0048443 3300047323 Bacteria 2131
689 Ga0495683_0068885 3300047323 Bacteria 1739
690 Ga0495683_0203252 3300047323 Bacteria 892
691 Ga0495687_003554 3300047443 Bacteria 11205
692 Ga0495687_029783 3300047443 Bacteria 2521
693 Ga0495675_0022183 3300047444 Bacteria 4046
694 Ga0495677_0019823 3300047445 Bacteria 2439
695 Ga0495673_0024196 3300047469 Bacteria 2940
696 Ga0495684_0014657 3300047471 Bacteria 6032
697 Ga0495686_0139174 3300047472 Bacteria 1433
698 Ga0495686_0174065 3300047472 Bacteria 1251
699 Ga0495686_0329425 3300047472 Bacteria 835
700 Ga0495593_0000370 3300047673 Bacteria 24754
701 Ga0495602_0055398 3300048088 Bacteria 3492
702 Ga0495614_0067848 3300048089 Bacteria 1535
703 Ga0496100_0057050 3300048903 Bacteria 2557
704 Ga0496100_0059644 3300048903 Bacteria 2508
705 Ga0496101_0011788 3300048904 Bacteria 5814
706 Ga0496101_0079991 3300048904 Bacteria 2414
707 Ga0496102_0035160 3300048905 Bacteria 4508
708 Ga0496102_0039885 3300048905 Bacteria 4245
709 Ga0496102_0182086 3300048905 Bacteria 1980
710 Ga0496102_0296367 3300048905 Bacteria 1524
711 Ga0496102_0650350 3300048905 Bacteria 977
712 Ga0496103_0050386 3300048906 Bacteria 2576
713 Ga0496103_0199871 3300048906 Bacteria 1285
714 Ga0496104_0027452 3300048907 Bacteria 5267
715 Ga0496104_0046793 3300048907 Bacteria 4075
716 Ga0496104_0145388 3300048907 Bacteria 2277
717 Ga0496104_0156640 3300048907 Bacteria 2186
718 Ga0496104_0259136 3300048907 Bacteria 1652
719 Ga0496105_0248534 3300048908 Bacteria 1441
720 Ga0496105_0492742 3300048908 Bacteria 963
721 Ga0496105_0636787 3300048908 Bacteria 824
722 Ga0496106_0000788 3300048909 Bacteria 22899
723 Ga0496106_0006629 3300048909 Bacteria 8572
724 Ga0496106_0010327 3300048909 Bacteria 6902
725 Ga0496106_0071909 3300048909 Bacteria 2644
726 Ga0496106_0085959 3300048909 Bacteria 2422
727 Ga0496106_0399575 3300048909 Bacteria 1104
728 Ga0496107_0010427 3300048910 Bacteria 6455
729 Ga0496107_0073394 3300048910 Bacteria 2488
730 Ga0496108_0029240 3300048911 Bacteria 4562
731 Ga0496108_0041613 3300048911 Bacteria 3836
732 Ga0496108_0138390 3300048911 Bacteria 2097
733 Ga0496108_0378606 3300048911 Bacteria 1236
734 Ga0496108_0874853 3300048911 Bacteria 772
735 Ga0496109_0074114 3300048912 Bacteria 3128
736 Ga0496109_0216868 3300048912 Bacteria 1799
737 Ga0496110_0009815 3300048913 Bacteria 7754
738 Ga0496110_0035698 3300048913 Bacteria 4314
739 Ga0496111_0002060 3300048914 Bacteria 11981
740 Ga0496111_0021035 3300048914 Bacteria 4550
741 Ga0496112_0074644 3300048915 Bacteria 3353
742 Ga0496112_0150982 3300048915 Bacteria 2290
743 Ga0496112_0168267 3300048915 Bacteria 2157
744 Ga0496112_0242858 3300048915 Bacteria 1753
745 Ga0496113_0005020 3300048916 Bacteria 8207
746 Ga0496113_0048688 3300048916 Bacteria 3154
747 Ga0496113_0049431 3300048916 Bacteria 3131
748 Ga0496114_0002069 3300048917 Bacteria 15273
749 Ga0496114_0117355 3300048917 Bacteria 2286
750 Ga0496114_0519902 3300048917 Bacteria 1053
751 Ga0496115_0005035 3300048918 Bacteria 9600
752 Ga0496115_0051684 3300048918 Bacteria 3295
753 Ga0496115_0081154 3300048918 Bacteria 2641
754 Ga0496116_0026977 3300048919 Bacteria 4188
755 Ga0496116_0135082 3300048919 Bacteria 1398
756 Ga0496117_0008719 3300048920 Bacteria 9584
757 Ga0496117_0105573 3300048920 Bacteria 1770
758 Ga0496117_0139628 3300048920 Bacteria 1453
759 Ga0496117_0148990 3300048920 Bacteria 1388
760 Ga0496118_0004035 3300048921 Bacteria 17843
761 Ga0496118_0067376 3300048921 Bacteria 2607
762 Ga0496118_0104340 3300048921 Bacteria 1903
763 Ga0496118_0243986 3300048921 Bacteria 1026
764 Ga0496119_0022541 3300048922 Bacteria 4502
765 Ga0496119_0140231 3300048922 Bacteria 1306
766 Ga0496120_0111142 3300048923 Bacteria 1432
767 Ga0496120_0223240 3300048923 Bacteria 899
768 Ga0496121_0000640 3300048924 Bacteria 65295
769 Ga0496121_0006350 3300048924 Bacteria 14731
770 Ga0496121_0014968 3300048924 Bacteria 8170
771 Ga0496121_0018042 3300048924 Bacteria 7147
772 Ga0496121_0027740 3300048924 Bacteria 5292
773 Ga0496121_0042560 3300048924 Bacteria 3947
774 Ga0496121_0097728 3300048924 Bacteria 2274
775 Ga0496121_0117532 3300048924 Bacteria 2014
776 Ga0496121_0176268 3300048924 Bacteria 1547
777 Ga0496121_0355383 3300048924 Bacteria 974
778 Ga0496122_0000072 3300048925 Bacteria 222436
779 Ga0496122_0096390 3300048925 Bacteria 1995
780 Ga0496123_0000035 3300048926 Bacteria 267288
781 Ga0496124_0000004 3300048927 Bacteria 976131
782 Ga0496124_0007008 3300048927 Bacteria 12079
783 Ga0496124_0049279 3300048927 Bacteria 3594
784 Ga0496124_0051307 3300048927 Bacteria 3511
785 Ga0496124_0068381 3300048927 Bacteria 2952
786 Ga0496124_0340935 3300048927 Unclassified 1064
787 Ga0496125_0000136 3300048928 Bacteria 160544
788 Ga0496125_0049499 3300048928 Bacteria 3492
789 Ga0496125_0052528 3300048928 Bacteria 3351
790 Ga0496125_0063712 3300048928 Bacteria 2937
791 Ga0496125_0071712 3300048928 Bacteria 2704
792 Ga0496125_0124627 3300048928 Bacteria 1829
793 Ga0496125_0379349 3300048928 Unclassified 834
794 Ga0496126_0013134 3300048929 Bacteria 8447
795 Ga0496126_0030491 3300048929 Bacteria 5108
796 Ga0496126_0064381 3300048929 Bacteria 3284
797 Ga0496126_0067186 3300048929 Bacteria 3204
798 Ga0496126_0108383 3300048929 Bacteria 2422
799 Ga0496126_0185856 3300048929 Bacteria 1762
800 Ga0496126_0360985 3300048929 Bacteria 1186
801 Ga0496126_0462019 3300048929 Bacteria 1020
802 Ga0501036_0080390 3300049572 Bacteria 2756
803 Ga0501036_0478362 3300049572 Bacteria 1037
804 Ga0501038_0280696 3300049574 Bacteria 1311
805 Ga0501039_0272995 3300049575 Bacteria 1329
806 Ga0501042_0159742 3300049578 Bacteria 1626
807 Ga0501047_0009703 3300049581 Bacteria 9102
808 Ga0501047_0191466 3300049581 Bacteria 1908
809 Ga0501069_0197914 3300049585 Bacteria 1164
810 Ga0501076_0021084 3300049592 Bacteria 4994
811 Ga0501222_019810 3300049662 Unclassified 899
812 Ga0501227_002739 3300049665 Bacteria 3874
813 Ga0501079_0125280 3300049741 Bacteria 1999
814 Ga0501080_0452554 3300049742 Bacteria 1151
815 Ga0501279_002614 3300049775 Bacteria 2353
816 Ga0501279_005909 3300049775 Unclassified 1611
817 Ga0501044_0214807 3300049823 Bacteria 1876
818 nmdc:mga03683_144337_c1 3300050489 Bacteria 1071
819 nmdc:mga03683_147991_c1 3300050489 Unclassified 1058
820 nmdc:mga03683_82892_c1 3300050489 Bacteria 1387
821 nmdc:mga03n38_989_c1 3300050490 Bacteria 7760
822 nmdc:mga00v17_11205_c1 3300050491 Bacteria 4923
823 nmdc:mga00v17_171917_c1 3300050491 Bacteria 1397
824 nmdc:mga00v17_407537_c1 3300050491 Bacteria 883
825 nmdc:mga00v17_51920_c1 3300050491 Bacteria 2493
826 nmdc:mga0yw44_143278_c1 3300050492 Bacteria 1554
827 nmdc:mga0yw44_15824_c1 3300050492 Bacteria 3350
828 nmdc:mga0yw44_20383_c1 3300050492 Bacteria 3679
829 nmdc:mga0yw44_24975_c1 3300050492 Bacteria 3390
830 nmdc:mga0yw44_311142_c1 3300050492 Bacteria 1057
831 nmdc:mga0yw44_331579_c1 3300050492 Bacteria 1023
832 nmdc:mga0yw44_71313_c1 3300050492 Bacteria 2157
833 nmdc:mga0k408_100771_c1 3300050493 Bacteria 1703
834 nmdc:mga0k408_1944_c1 3300050493 Bacteria 11068
835 nmdc:mga0k408_247264_c1 3300050493 Bacteria 1065
836 nmdc:mga0k408_341162_c1 3300050493 Bacteria 893
837 nmdc:mga06z11_3558_c1 3300050494 Bacteria 6033
838 nmdc:mga06z11_47899_c1 3300050494 Bacteria 2173
839 nmdc:mga06z11_94031_c1 3300050494 Bacteria 1633
840 nmdc:mga07m45_115683_c1 3300050496 Bacteria 1546
841 nmdc:mga07m45_130042_c1 3300050496 Bacteria 1457
842 nmdc:mga07m45_269500_c1 3300050496 Bacteria 990
843 nmdc:mga07m45_6373_c1 3300050496 Bacteria 4073
844 nmdc:mga09592_656276_c1 3300050508 Bacteria 895
845 nmdc:mga0qj67_354668_c1 3300050509 Bacteria 1185
846 nmdc:mga0n895_196917_c1 3300050512 Bacteria 2046
847 nmdc:mga0n895_243665_c1 3300050512 Bacteria 1824
848 nmdc:mga0n895_80087_c1 3300050512 Bacteria 3253
849 nmdc:mga0rr50_32574_c1 3300050513 Bacteria 3714
850 nmdc:mga0a205_393136_c1 3300050515 Bacteria 1250
851 nmdc:mga0sz30_102954_c1 3300050516 Bacteria 1248
852 nmdc:mga0sz30_2977_c1 3300050516 Bacteria 6074
853 nmdc:mga0sz30_37766_c1 3300050516 Bacteria 2022
854 nmdc:mga0sz30_98394_c1 3300050516 Bacteria 1277
855 Ga0495601_0170003 3300053077 Bacteria 1425
856 Ga0495612_0037009 3300053078 Bacteria 1981
857 Ga0500635_0001720 3300053080 Bacteria 5313
858 Ga0500635_0019869 3300053080 Bacteria 2049
859 Ga0500635_0141489 3300053080 Bacteria 913
860 Ga0495595_0046772 3300053084 Bacteria 1994
861 Ga0495619_0238218 3300053085 Bacteria 1261
862 Ga0495619_0295850 3300053085 Bacteria 1121
863 Ga0500578_0154790 3300053086 Bacteria 1426
864 Ga0500578_0187342 3300053086 Bacteria 1272
865 Ga0500578_0271687 3300053086 Bacteria 1014
866 Ga0500643_000160 3300053087 Bacteria 66845
867 Ga0500643_018379 3300053087 Bacteria 2320
868 Ga0500581_145907 3300053089 Bacteria 1116
869 Ga0500583_0171510 3300053092 Bacteria 1080
870 Ga0500651_0010771 3300053093 Bacteria 5494
871 Ga0500651_0272163 3300053093 Bacteria 979
872 Ga0500566_0001345 3300053094 Bacteria 14355
873 Ga0500566_0003268 3300053094 Bacteria 9688
874 Ga0500566_0025753 3300053094 Bacteria 3446
875 Ga0500566_0194611 3300053094 Bacteria 1029
876 Ga0500640_027308 3300053095 Bacteria 2490
877 Ga0500641_0004044 3300053096 Bacteria 5179
878 Ga0500641_0028998 3300053096 Bacteria 2165
879 Ga0500554_010606 3300053102 Bacteria 2253
880 Ga0500555_049236 3300053103 Bacteria 1156
881 Ga0500556_0008987 3300053104 Bacteria 2895
882 Ga0500557_000128 3300053105 Bacteria 20005
883 Ga0500562_021788 3300053108 Bacteria 1669
884 Ga0500569_008127 3300053109 Bacteria 2388
885 Ga0500572_003155 3300053111 Bacteria 3817
886 Ga0500572_004302 3300053111 Bacteria 3235
887 Ga0500572_022921 3300053111 Bacteria 1671
888 Ga0500593_118304 3300053117 Unclassified 1078
889 Ga0500595_000095 3300053119 Bacteria 61248
890 Ga0500595_003348 3300053119 Bacteria 7528
891 Ga0500595_003752 3300053119 Bacteria 6999
892 Ga0500595_012265 3300053119 Bacteria 3320
893 Ga0500595_012487 3300053119 Bacteria 3284
894 Ga0500595_037246 3300053119 Bacteria 1588
895 Ga0500595_046973 3300053119 Bacteria 1355
896 Ga0500607_059315 3300053121 Bacteria 2011
897 Ga0500642_0000477 3300053130 Bacteria 12415
898 Ga0500642_0045664 3300053130 Bacteria 1912
899 Ga0500642_0061116 3300053130 Bacteria 1692
900 Ga0500559_0059280 3300053136 Bacteria 1704
901 Ga0500564_172143 3300053138 Bacteria 909
902 Ga0500568_0027931 3300053139 Bacteria 2356
903 Ga0500573_0027650 3300053140 Bacteria 3262
904 Ga0500586_000452 3300053145 Bacteria 8178
905 Ga0500590_000992 3300053148 Bacteria 10984
906 Ga0500590_037623 3300053148 Bacteria 2499
907 Ga0500603_000280 3300053150 Bacteria 13469
908 Ga0500603_001503 3300053150 Bacteria 5312
909 Ga0500616_0022308 3300053153 Bacteria 3537
910 Ga0500619_105282 3300053154 Bacteria 958
911 Ga0500638_007811 3300053162 Bacteria 4512
912 Ga0500638_139429 3300053162 Bacteria 1091
913 Ga0500639_013828 3300053163 Bacteria 4243
914 Ga0500639_062419 3300053163 Bacteria 1918
915 Ga0500639_073945 3300053163 Bacteria 1730
916 Ga0500636_0001993 3300053177 Bacteria 11232
917 Ga0500636_0005628 3300053177 Bacteria 7160
918 Ga0500637_0000653 3300053178 Bacteria 13761
919 Ga0500637_0032662 3300053178 Bacteria 2902
920 Ga0500637_0144347 3300053178 Bacteria 1377
921 Ga0500609_015376 3300053731 Bacteria 1036
922 Ga0500596_005506 3300053735 Bacteria 2218
923 Ga0500599_007382 3300053736 Bacteria 1413
924 Ga0500601_000310 3300053737 Bacteria 9139
925 Ga0500661_000198 3300055283 Bacteria 10649
926 Ga0466962_0088477 3300061719 Bacteria 1483
927 Ga0530510_0531238 3300061734 Bacteria 893

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100387304 Ga0068867_1003873042 211
2 3300005937 Ga0081455_10004895 Ga0081455_1000489511 211
3 3300005983 Ga0081540_1010591 Ga0081540_10105914 211
4 3300046524 Ga0495648_0000619 Ga0495648_0000619_5493_6212 211
5 3300031616 Ga0307508_10000154 Ga0307508_1000015454 212
6 3300044842 Ga0466957_0195755 Ga0466957_0195755_380_1090 212
7 iso_pu_bacteria 2824704595 2824714418 212
8 iso_pu_bacteria 2824671348 2824678909 213
9 iso_pu_bacteria 2824687955 2824695431 213
10 3300037853 Ga0436364_1376044 Ga0436364_1376044_72_782 214
11 iso_pu_bacteria 2824696289 2824703809 214
12 3300005339 Ga0070660_100014405 Ga0070660_1000144055 215
13 3300005366 Ga0070659_100050519 Ga0070659_1000505192 215
14 3300005530 Ga0070679_100354758 Ga0070679_1003547582 215
15 3300005539 Ga0068853_100201553 Ga0068853_1002015533 215
16 3300005616 Ga0068852_100579129 Ga0068852_1005791292 215
17 3300013104 Ga0157370_10031768 Ga0157370_100317681 215
18 3300013307 Ga0157372_10027954 Ga0157372_100279543 215
19 3300025919 Ga0207657_10350377 Ga0207657_103503771 215
20 3300025921 Ga0207652_10632312 Ga0207652_106323121 215
21 3300026041 Ga0207639_10139648 Ga0207639_101396482 215
22 iso_pu_bacteria 2824773399 2824781310 215
23 3300049775 Ga0501279_005909 Ga0501279_005909_660_1358 216
24 3300021384 Ga0213876_10077997 Ga0213876_100779973 217
25 3300039437 Ga0436365_1627177 Ga0436365_1627177_585_1295 217
26 3300025272 Ga0209455_1031154 Ga0209455_10311541 219
27 3300048906 Ga0496103_0199871 Ga0496103_0199871_500_1243 219
28 3300005339 Ga0070660_100034372 Ga0070660_1000343722 221
29 3300025919 Ga0207657_10032543 Ga0207657_100325434 221
30 iso_pu_bacteria 2857542790 2857547434 221
31 iso_pu_bacteria 8055225921 8055227679 221
32 3300044842 Ga0466957_0380207 Ga0466957_0380207_53_751 222
33 3300046455 Ga0495603_0148374 Ga0495603_0148374_224_943 222
34 3300046523 Ga0495644_0072945 Ga0495644_0072945_394_1113 222
35 3300047472 Ga0495686_0329425 Ga0495686_0329425_63_782 222
36 3300061719 Ga0466962_0088477 Ga0466962_0088477_192_890 222
37 iso_pu_bacteria 2643221558 2643814134 222
38 3300049665 Ga0501227_002739 Ga0501227_002739_2544_3227 223
39 iso_pu_bacteria 2855730933 2855734093 223
40 iso_pu_bacteria 2855767633 2855769683 223
41 iso_pu_bacteria 2881412998 2881414021 223
42 iso_pu_bacteria 8055431914 8055436055 224
43 3300003214 JGI25165J46597_1012936 JGI25165J46597_10129362 225
44 3300025261 Ga0209233_1002119 Ga0209233_10021195 225
45 3300048927 Ga0496124_0000004 Ga0496124_0000004_927089_927775 225
46 3300049572 Ga0501036_0478362 Ga0501036_0478362_252_953 225
47 iso_pu_bacteria 2718217997 2719669412 225
48 iso_pu_bacteria 2718218199 2720494428 225
49 iso_pu_bacteria 2718218232 2720610765 225
50 iso_pu_bacteria 2718218233 2720616643 225
51 iso_pu_bacteria 2718218235 2720628000 225
52 iso_pu_bacteria 2718218269 2720771580 225
53 iso_pu_bacteria 2721755684 2723563343 225
54 iso_pu_bacteria 2721755685 2723571334 225
55 iso_pu_bacteria 2721755819 2724087129 225
56 iso_pu_bacteria 2721755822 2724100840 225
57 iso_pu_bacteria 2721755823 2724108081 225
58 iso_pu_bacteria 2791355256 2793296096 225
59 iso_pu_bacteria 2791355261 2793328629 225
60 iso_pu_bacteria 2791355262 2793334728 225
61 iso_pu_bacteria 2791355264 2793348682 225
62 iso_pu_bacteria 2791355265 2793357190 225
63 iso_pu_bacteria 2802429605 2805929688 225
64 iso_pu_bacteria 2802429606 2805933036 225
65 iso_pu_bacteria 2838016132 2838019532 225
66 iso_pu_bacteria 2838061910 2838066316 225
67 iso_pu_bacteria 2838068647 2838072696 225
68 iso_pu_bacteria 2842205361 2842208620 225
69 iso_pu_bacteria 2842278818 2842282034 225
70 iso_pu_bacteria 2842285085 2842289080 225
71 iso_pu_bacteria 2842311132 2842313122 225
72 iso_pu_bacteria 2842402390 2842407286 225
73 iso_pu_bacteria 2842409023 2842413465 225
74 iso_pu_bacteria 2842415677 2842420108 225
75 iso_pu_bacteria 2842422224 2842426206 225
76 iso_pu_bacteria 2842428310 2842430009 225
77 iso_pu_bacteria 2842441272 2842442750 225
78 iso_pu_bacteria 2842447887 2842453813 225
79 iso_pu_bacteria 2842462802 2842464626 225
80 iso_pu_bacteria 2842469257 2842471006 225
81 iso_pu_bacteria 2842489311 2842490798 225
82 iso_pu_bacteria 2996887358 2996887414 225
83 iso_pu_bacteria 2996893221 2996895469 225
84 iso_pu_bacteria 8005258706 8005261976 225
85 iso_pu_bacteria 8005282627 8005287517 225
86 iso_pu_bacteria 8005289223 8005292323 225
87 iso_pu_bacteria 8005321885 8005321941 225
88 iso_pu_bacteria 8005382845 8005384299 225
89 iso_pu_bacteria 8005395548 8005401504 225
90 iso_pu_bacteria 8005430974 8005435996 225
91 iso_pu_bacteria 8005497431 8005503668 225
92 iso_pu_bacteria 8005619151 8005625669 225
93 iso_pu_bacteria 8005626139 8005632215 225
94 iso_pu_bacteria 8005668836 8005675546 225
95 iso_pu_bacteria 8024501048 8024507098 225
96 iso_pu_bacteria 8056382006 8056383013 225
97 3300009551 Ga0105238_10351489 Ga0105238_103514891 226
98 3300010375 Ga0105239_10094671 Ga0105239_100946713 226
99 3300041413 Ga0439465_0010459 Ga0439465_0010459_1598_2281 226
100 3300046507 Ga0495606_0047029 Ga0495606_0047029_1342_2025 226
101 3300046809 Ga0495600_0211607 Ga0495600_0211607_17_712 226
102 3300048927 Ga0496124_0049279 Ga0496124_0049279_965_1648 226
103 3300049575 Ga0501039_0272995 Ga0501039_0272995_190_894 226
104 3300049578 Ga0501042_0159742 Ga0501042_0159742_506_1210 226
105 3300049741 Ga0501079_0125280 Ga0501079_0125280_1005_1709 226
106 3300053148 Ga0500590_000992 Ga0500590_000992_8558_9253 226
107 3300003187 JGI25151J46595_10000451 JGI25151J46595_1000045127 227
108 3300005456 Ga0070678_100078094 Ga0070678_1000780943 227
109 3300005840 Ga0068870_10139812 Ga0068870_101398122 227
110 3300006051 Ga0075364_10011381 Ga0075364_100113813 227
111 3300014326 Ga0157380_10534424 Ga0157380_105344242 227
112 3300025294 Ga0209025_1000003 Ga0209025_1000003911 227
113 3300025908 Ga0207643_10107871 Ga0207643_101078712 227
114 3300026121 Ga0207683_10049887 Ga0207683_100498873 227
115 3300049572 Ga0501036_0080390 Ga0501036_0080390_1608_2330 227
116 3300050491 nmdc:mga00v17_11205_c1 nmdc:mga00v17_11205_c1_2375_3121 227
117 3300028379 Ga0268266_10263322 Ga0268266_102633221 228
118 3300049592 Ga0501076_0021084 Ga0501076_0021084_129_851 228
119 3300053096 Ga0500641_0004044 Ga0500641_0004044_4144_4863 228
120 iso_pu_bacteria 2511231028 2511397412 228
121 iso_pu_bacteria 2841957949 2841964872 228
122 iso_pu_bacteria 3005594810 3005595304 228
123 3300005262 Ga0065165_1022241 Ga0065165_10222412 229
124 3300005548 Ga0070665_100134738 Ga0070665_1001347382 229
125 3300009763 Ga0123340_1000167 Ga0123340_100016711 229
126 3300009765 Ga0123341_1010909 Ga0123341_10109092 229
127 3300009765 Ga0123341_1063720 Ga0123341_10637202 229
128 3300009766 Ga0123342_1018186 Ga0123342_10181865 229
129 3300013100 Ga0157373_10049148 Ga0157373_100491484 229
130 3300025245 Ga0207425_1010250 Ga0207425_10102502 229
131 3300025258 Ga0209129_1000489 Ga0209129_10004898 229
132 3300025294 Ga0209025_1002657 Ga0209025_10026578 229
133 3300025297 Ga0209758_1003221 Ga0209758_10032214 229
134 3300025297 Ga0209758_1004001 Ga0209758_10040019 229
135 3300048925 Ga0496122_0000072 Ga0496122_0000072_203162_203893 229
136 3300048926 Ga0496123_0000035 Ga0496123_0000035_248014_248745 229
137 3300048927 Ga0496124_0340935 Ga0496124_0340935_113_844 229
138 3300048928 Ga0496125_0379349 Ga0496125_0379349_82_813 229
139 3300050489 nmdc:mga03683_82892_c1 nmdc:mga03683_82892_c1_445_1164 229
140 3300053096 Ga0500641_0028998 Ga0500641_0028998_1180_1899 229
141 3300053111 Ga0500572_022921 Ga0500572_022921_769_1461 229
142 3300053117 Ga0500593_118304 Ga0500593_118304_124_864 229
143 3300053140 Ga0500573_0027650 Ga0500573_0027650_1725_2438 229
144 3300053177 Ga0500636_0005628 Ga0500636_0005628_568_1260 229
145 iso_pu_bacteria 2882456835 2882458745 229
146 3300005844 Ga0068862_100012465 Ga0068862_1000124652 230
147 3300005844 Ga0068862_100489020 Ga0068862_1004890201 230
148 3300006038 Ga0075365_10093839 Ga0075365_100938392 230
149 3300006038 Ga0075365_10311713 Ga0075365_103117131 230
150 3300006042 Ga0075368_10035929 Ga0075368_100359292 230
151 3300006051 Ga0075364_10223317 Ga0075364_102233171 230
152 3300028380 Ga0268265_10002012 Ga0268265_100020127 230
153 3300030731 Ga0316177_1142486 Ga0316177_11424861 230
154 3300030735 Ga0316178_1062662 Ga0316178_10626622 230
155 3300031548 Ga0307408_100000252 Ga0307408_10000025218 230
156 3300048917 Ga0496114_0117355 Ga0496114_0117355_1070_1789 230
157 3300050489 nmdc:mga03683_147991_c1 nmdc:mga03683_147991_c1_321_1022 230
158 3300050516 nmdc:mga0sz30_37766_c1 nmdc:mga0sz30_37766_c1_669_1370 230
159 3300053087 Ga0500643_018379 Ga0500643_018379_902_1603 230
160 iso_pu_bacteria 2513237095 2513652611 230
161 iso_pu_bacteria 2517093001 2517107618 230
162 iso_pu_bacteria 2816332527 2818239028 230
163 iso_pu_bacteria 2824753945 2824761398 230
164 iso_pu_bacteria 2824763712 2824768529 230
165 iso_pu_bacteria 2874612657 2874619948 230
166 iso_pu_bacteria 2879099564 2879106863 230
167 iso_pu_bacteria 2888378607 2888379326 230
168 iso_pu_bacteria 2904711408 2904714030 230
169 iso_pu_bacteria 2932784394 2932791058 230
170 iso_pu_bacteria 2932794094 2932800044 230
171 iso_pu_bacteria 2932801729 2932809053 230
172 iso_pu_bacteria 2932809354 2932817942 230
173 iso_pu_bacteria 2932818245 2932820573 230
174 iso_pu_bacteria 2932828146 2932837136 230
175 iso_pu_bacteria 2935616580 2935624367 230
176 iso_pu_bacteria 2935638405 2935644358 230
177 iso_pu_bacteria 2935665750 2935674727 230
178 iso_pu_bacteria 2935694250 2935701663 230
179 iso_pu_bacteria 2935703347 2935710391 230
180 iso_pu_bacteria 2935760218 2935764945 230
181 iso_pu_bacteria 2935801545 2935810511 230
182 iso_pu_bacteria 2935827899 2935833398 230
183 iso_pu_bacteria 2935837841 2935846046 230
184 iso_pu_bacteria 2935855204 2935863086 230
185 iso_pu_bacteria 2935864058 2935873458 230
186 iso_pu_bacteria 2935873716 2935879980 230
187 iso_pu_bacteria 2935883170 2935888260 230
188 iso_pu_bacteria 2935992306 2935997798 230
189 iso_pu_bacteria 2936002035 2936010994 230
190 iso_pu_bacteria 2941531003 2941537946 230
191 iso_pu_bacteria 2941538514 2941547073 230
192 iso_pu_bacteria 8016511872 8016517909 230
193 iso_pu_bacteria 8017057580 8017058727 230
194 iso_pu_bacteria 8019576017 8019576926 230
195 iso_pu_bacteria 8019586578 8019594988 230
196 iso_pu_bacteria 8019597564 8019606752 230
197 iso_pu_bacteria 8019608314 8019611756 230
198 iso_pu_bacteria 8056967851 8056975788 230
199 3300005337 Ga0070682_100349336 Ga0070682_1003493361 231
200 3300005344 Ga0070661_100002881 Ga0070661_10000288112 231
201 3300005347 Ga0070668_100066527 Ga0070668_1000665272 231
202 3300005354 Ga0070675_100697504 Ga0070675_1006975041 231
203 3300005455 Ga0070663_100000598 Ga0070663_1000005983 231
204 3300005543 Ga0070672_100127479 Ga0070672_1001274792 231
205 3300005563 Ga0068855_100019755 Ga0068855_1000197554 231
206 3300005564 Ga0070664_100003791 Ga0070664_1000037915 231
207 3300005614 Ga0068856_100002355 Ga0068856_1000023555 231
208 3300005616 Ga0068852_100018956 Ga0068852_1000189562 231
209 3300007076 Ga0075435_100222013 Ga0075435_1002220132 231
210 3300025907 Ga0207645_10112693 Ga0207645_101126932 231
211 3300025912 Ga0207707_10190557 Ga0207707_101905572 231
212 3300025919 Ga0207657_10000510 Ga0207657_100005104 231
213 3300025920 Ga0207649_10018858 Ga0207649_100188584 231
214 3300025923 Ga0207681_10047401 Ga0207681_100474012 231
215 3300025926 Ga0207659_10500644 Ga0207659_105006442 231
216 3300025931 Ga0207644_10003534 Ga0207644_100035344 231
217 3300025932 Ga0207690_10000725 Ga0207690_1000072517 231
218 3300025933 Ga0207706_10000093 Ga0207706_1000009311 231
219 3300025940 Ga0207691_10056371 Ga0207691_100563714 231
220 3300025945 Ga0207679_10139755 Ga0207679_101397552 231
221 3300025949 Ga0207667_10003071 Ga0207667_1000307111 231
222 3300025981 Ga0207640_10062308 Ga0207640_100623082 231
223 3300025986 Ga0207658_10046691 Ga0207658_100466912 231
224 3300026023 Ga0207677_10068509 Ga0207677_100685092 231
225 3300026067 Ga0207678_10030242 Ga0207678_100302422 231
226 3300026121 Ga0207683_10078177 Ga0207683_100781773 231
227 3300026142 Ga0207698_10114172 Ga0207698_101141722 231
228 3300031616 Ga0307508_10144852 Ga0307508_101448522 231
229 3300049662 Ga0501222_019810 Ga0501222_019810_44_751 231
230 3300049775 Ga0501279_002614 Ga0501279_002614_647_1354 231
231 3300003323 rootH1_10058417 rootH1_100584173 232
232 3300005327 Ga0070658_10110967 Ga0070658_101109673 232
233 3300005336 Ga0070680_100005214 Ga0070680_1000052142 232
234 3300005338 Ga0068868_100086679 Ga0068868_1000866792 232
235 3300005339 Ga0070660_100021819 Ga0070660_1000218192 232
236 3300005339 Ga0070660_100068342 Ga0070660_1000683423 232
237 3300005355 Ga0070671_100015188 Ga0070671_1000151883 232
238 3300005367 Ga0070667_100149367 Ga0070667_1001493672 232
239 3300005435 Ga0070714_100231515 Ga0070714_1002315152 232
240 3300005456 Ga0070678_100024855 Ga0070678_1000248553 232
241 3300005457 Ga0070662_100007191 Ga0070662_1000071914 232
242 3300005458 Ga0070681_10104996 Ga0070681_101049963 232
243 3300005458 Ga0070681_10139645 Ga0070681_101396452 232
244 3300005530 Ga0070679_100262422 Ga0070679_1002624221 232
245 3300005535 Ga0070684_100588559 Ga0070684_1005885592 232
246 3300005563 Ga0068855_100355831 Ga0068855_1003558311 232
247 3300005563 Ga0068855_100454851 Ga0068855_1004548512 232
248 3300005614 Ga0068856_100368275 Ga0068856_1003682752 232
249 3300005616 Ga0068852_100082923 Ga0068852_1000829232 232
250 3300005616 Ga0068852_100360141 Ga0068852_1003601412 232
251 3300005983 Ga0081540_1004561 Ga0081540_10045619 232
252 3300013100 Ga0157373_10000647 Ga0157373_100006474 232
253 3300013102 Ga0157371_10028934 Ga0157371_100289342 232
254 3300013105 Ga0157369_10159097 Ga0157369_101590972 232
255 3300013307 Ga0157372_10000593 Ga0157372_1000059330 232
256 3300025297 Ga0209758_1051646 Ga0209758_10516462 232
257 3300025909 Ga0207705_10348081 Ga0207705_103480812 232
258 3300025917 Ga0207660_10012643 Ga0207660_100126431 232
259 3300025919 Ga0207657_10053216 Ga0207657_100532165 232
260 3300025921 Ga0207652_10042542 Ga0207652_100425425 232
261 3300025929 Ga0207664_10270537 Ga0207664_102705372 232
262 3300025949 Ga0207667_10076640 Ga0207667_100766402 232
263 3300025949 Ga0207667_10091474 Ga0207667_100914741 232
264 3300026041 Ga0207639_10051447 Ga0207639_100514471 232
265 3300026078 Ga0207702_10004987 Ga0207702_100049871 232
266 3300026078 Ga0207702_11196976 Ga0207702_111969761 232
267 3300026142 Ga0207698_10054572 Ga0207698_100545722 232
268 3300031595 Ga0265313_10085917 Ga0265313_100859172 232
269 3300031711 Ga0265314_10084709 Ga0265314_100847092 232
270 3300031712 Ga0265342_10000687 Ga0265342_1000068726 232
271 3300048909 Ga0496106_0006629 Ga0496106_0006629_188_892 232
272 3300049581 Ga0501047_0191466 Ga0501047_0191466_65_763 232
273 3300049742 Ga0501080_0452554 Ga0501080_0452554_254_952 232
274 3300049823 Ga0501044_0214807 Ga0501044_0214807_740_1438 232
275 iso_pu_bacteria 2929615660 2929618869 232
276 iso_pu_bacteria 2929624759 2929630946 232
277 iso_pu_bacteria 2933577622 2933580421 232
278 iso_pu_bacteria 8055742211 8055742718 232
279 3300002773 JGI25152J39213_1001108 JGI25152J39213_10011087 233
280 3300003187 JGI25151J46595_10012763 JGI25151J46595_100127632 233
281 3300003215 JGI25153J46596_10001849 JGI25153J46596_100018497 233
282 3300005336 Ga0070680_100011561 Ga0070680_1000115615 233
283 3300005339 Ga0070660_100193274 Ga0070660_1001932742 233
284 3300005530 Ga0070679_100240604 Ga0070679_1002406042 233
285 3300005614 Ga0068856_100083923 Ga0068856_1000839233 233
286 3300009093 Ga0105240_10575624 Ga0105240_105756242 233
287 3300013102 Ga0157371_10173482 Ga0157371_101734821 233
288 3300013104 Ga0157370_10029317 Ga0157370_100293174 233
289 3300013105 Ga0157369_10215276 Ga0157369_102152762 233
290 3300020070 Ga0206356_10161480 Ga0206356_101614803 233
291 3300025230 Ga0209563_100670 Ga0209563_1006703 233
292 3300025253 Ga0209677_101711 Ga0209677_1017119 233
293 3300025297 Ga0209758_1036140 Ga0209758_10361402 233
294 3300025909 Ga0207705_10034198 Ga0207705_100341982 233
295 3300025912 Ga0207707_10159207 Ga0207707_101592072 233
296 3300025913 Ga0207695_10195650 Ga0207695_101956502 233
297 3300025917 Ga0207660_10329673 Ga0207660_103296732 233
298 3300025919 Ga0207657_10187229 Ga0207657_101872292 233
299 3300025921 Ga0207652_10023363 Ga0207652_100233632 233
300 3300025949 Ga0207667_10375327 Ga0207667_103753271 233
301 3300026078 Ga0207702_10452340 Ga0207702_104523401 233
302 3300037471 Ga0395905_0003426 Ga0395905_0003426_8345_9061 233
303 3300046683 Ga0495658_0259591 Ga0495658_0259591_331_1035 233
304 3300053087 Ga0500643_000160 Ga0500643_000160_8037_8744 233
305 iso_pu_bacteria 2513237139 2513879266 233
306 iso_pu_bacteria 2617270735 2617354363 233
307 iso_pu_bacteria 2802429603 2805921586 233
308 iso_pu_bacteria 2838122688 2838130159 233
309 iso_pu_bacteria 2841983080 2841990707 233
310 iso_pu_bacteria 2847930680 2847931313 233
311 iso_pu_bacteria 2847939898 2847942404 233
312 iso_pu_bacteria 2879083081 2879087646 233
313 3300005331 Ga0070670_100403626 Ga0070670_1004036261 234
314 3300005347 Ga0070668_100025268 Ga0070668_1000252682 234
315 3300005354 Ga0070675_100311874 Ga0070675_1003118742 234
316 3300005355 Ga0070671_100063445 Ga0070671_1000634452 234
317 3300005455 Ga0070663_100017095 Ga0070663_1000170952 234
318 3300005539 Ga0068853_100175878 Ga0068853_1001758782 234
319 3300005548 Ga0070665_100015557 Ga0070665_1000155572 234
320 3300005564 Ga0070664_100082048 Ga0070664_1000820482 234
321 3300005578 Ga0068854_100805751 Ga0068854_1008057511 234
322 3300005616 Ga0068852_100008549 Ga0068852_1000085495 234
323 3300005618 Ga0068864_100821211 Ga0068864_1008212111 234
324 3300005834 Ga0068851_10324908 Ga0068851_103249081 234
325 3300005842 Ga0068858_100365844 Ga0068858_1003658442 234
326 3300005983 Ga0081540_1036693 Ga0081540_10366932 234
327 3300006051 Ga0075364_10020053 Ga0075364_100200533 234
328 3300006178 Ga0075367_10159273 Ga0075367_101592731 234
329 3300006353 Ga0075370_10012846 Ga0075370_100128464 234
330 3300006881 Ga0068865_100425324 Ga0068865_1004253242 234
331 3300009093 Ga0105240_10015922 Ga0105240_100159226 234
332 3300009098 Ga0105245_10044825 Ga0105245_100448254 234
333 3300009098 Ga0105245_10183066 Ga0105245_101830662 234
334 3300009148 Ga0105243_10249007 Ga0105243_102490072 234
335 3300009174 Ga0105241_10174490 Ga0105241_101744902 234
336 3300009174 Ga0105241_10412078 Ga0105241_104120781 234
337 3300009177 Ga0105248_10942923 Ga0105248_109429232 234
338 3300009545 Ga0105237_10009776 Ga0105237_100097767 234
339 3300009545 Ga0105237_10016276 Ga0105237_100162764 234
340 3300009551 Ga0105238_10685202 Ga0105238_106852021 234
341 3300010375 Ga0105239_10040749 Ga0105239_100407493 234
342 3300013296 Ga0157374_10164035 Ga0157374_101640351 234
343 3300014745 Ga0157377_10027973 Ga0157377_100279732 234
344 3300014969 Ga0157376_10713806 Ga0157376_107138062 234
345 3300025304 Ga0209257_1007061 Ga0209257_10070614 234
346 3300025904 Ga0207647_10002968 Ga0207647_1000296812 234
347 3300025913 Ga0207695_10001156 Ga0207695_1000115610 234
348 3300025914 Ga0207671_10009815 Ga0207671_100098158 234
349 3300025925 Ga0207650_10728091 Ga0207650_107280912 234
350 3300025932 Ga0207690_10566500 Ga0207690_105665002 234
351 3300025938 Ga0207704_10455356 Ga0207704_104553562 234
352 3300025945 Ga0207679_10352563 Ga0207679_103525631 234
353 3300025949 Ga0207667_11023390 Ga0207667_110233901 234
354 3300026035 Ga0207703_10075570 Ga0207703_100755702 234
355 3300026041 Ga0207639_10303926 Ga0207639_103039262 234
356 3300026067 Ga0207678_10019543 Ga0207678_100195434 234
357 3300026088 Ga0207641_10404061 Ga0207641_104040612 234
358 3300026095 Ga0207676_10680803 Ga0207676_106808031 234
359 3300028379 Ga0268266_10688045 Ga0268266_106880451 234
360 3300033180 Ga0307510_10020868 Ga0307510_100208682 234
361 3300044694 Ga0466963_0274646 Ga0466963_0274646_34_738 234
362 3300045836 Ga0466958_0104327 Ga0466958_0104327_144_848 234
363 3300045976 Ga0466967_0001133 Ga0466967_0001133_11248_11952 234
364 3300046462 Ga0495651_0012151 Ga0495651_0012151_1964_2668 234
365 3300046463 Ga0495653_0101966 Ga0495653_0101966_307_1011 234
366 3300046477 Ga0495664_0315894 Ga0495664_0315894_121_825 234
367 3300046507 Ga0495606_0106966 Ga0495606_0106966_203_913 234
368 3300046512 Ga0495610_0136409 Ga0495610_0136409_285_989 234
369 3300046513 Ga0495616_0032705 Ga0495616_0032705_1995_2699 234
370 3300046516 Ga0495628_0029830 Ga0495628_0029830_2078_2782 234
371 3300046516 Ga0495628_0294238 Ga0495628_0294238_254_958 234
372 3300046519 Ga0495632_0067614 Ga0495632_0067614_850_1554 234
373 3300046524 Ga0495648_0006267 Ga0495648_0006267_666_1370 234
374 3300046529 Ga0495652_0006258 Ga0495652_0006258_9685_10389 234
375 3300046529 Ga0495652_0232304 Ga0495652_0232304_107_811 234
376 3300046533 Ga0495640_0124019 Ga0495640_0124019_21_725 234
377 3300046533 Ga0495640_0229529 Ga0495640_0229529_88_792 234
378 3300046536 Ga0495587_0032889 Ga0495587_0032889_87_791 234
379 3300046543 Ga0495645_0002277 Ga0495645_0002277_1769_2473 234
380 3300046557 Ga0495622_0033182 Ga0495622_0033182_192_902 234
381 3300046557 Ga0495622_0072635 Ga0495622_0072635_529_1233 234
382 3300046642 Ga0495634_0047054 Ga0495634_0047054_36_740 234
383 3300046663 Ga0495635_0045072 Ga0495635_0045072_1707_2411 234
384 3300046665 Ga0495661_0137567 Ga0495661_0137567_149_859 234
385 3300046674 Ga0495588_0081788 Ga0495588_0081788_569_1279 234
386 3300046675 Ga0495657_0021179 Ga0495657_0021179_1703_2407 234
387 3300046675 Ga0495657_0060848 Ga0495657_0060848_1781_2485 234
388 3300046680 Ga0495646_0077067 Ga0495646_0077067_401_1105 234
389 3300046689 Ga0495613_0082107 Ga0495613_0082107_515_1219 234
390 3300046809 Ga0495600_0004756 Ga0495600_0004756_5954_6658 234
391 3300046810 Ga0495660_0165806 Ga0495660_0165806_302_1012 234
392 3300047315 Ga0495581_0037772 Ga0495581_0037772_1969_2673 234
393 3300047317 Ga0495604_0005707 Ga0495604_0005707_6602_7306 234
394 3300047317 Ga0495604_0347989 Ga0495604_0347989_229_933 234
395 3300047319 Ga0495674_0033870 Ga0495674_0033870_285_989 234
396 3300047321 Ga0495676_0165304 Ga0495676_0165304_360_1070 234
397 3300047322 Ga0495680_0181214 Ga0495680_0181214_412_1116 234
398 3300047323 Ga0495683_0026647 Ga0495683_0026647_1377_2081 234
399 3300047443 Ga0495687_003554 Ga0495687_003554_7069_7773 234
400 3300047444 Ga0495675_0022183 Ga0495675_0022183_2625_3329 234
401 3300047471 Ga0495684_0014657 Ga0495684_0014657_4007_4711 234
402 3300048088 Ga0495602_0055398 Ga0495602_0055398_2320_3024 234
403 3300048903 Ga0496100_0057050 Ga0496100_0057050_1406_2110 234
404 3300048904 Ga0496101_0079991 Ga0496101_0079991_652_1362 234
405 3300048907 Ga0496104_0259136 Ga0496104_0259136_109_819 234
406 3300048908 Ga0496105_0248534 Ga0496105_0248534_689_1399 234
407 3300048908 Ga0496105_0636787 Ga0496105_0636787_90_800 234
408 3300048911 Ga0496108_0874853 Ga0496108_0874853_11_721 234
409 3300048914 Ga0496111_0021035 Ga0496111_0021035_2572_3276 234
410 3300048915 Ga0496112_0074644 Ga0496112_0074644_338_1042 234
411 3300048916 Ga0496113_0048688 Ga0496113_0048688_2198_2902 234
412 3300048918 Ga0496115_0081154 Ga0496115_0081154_579_1289 234
413 3300048920 Ga0496117_0139628 Ga0496117_0139628_397_1101 234
414 3300048920 Ga0496117_0148990 Ga0496117_0148990_647_1351 234
415 3300048921 Ga0496118_0104340 Ga0496118_0104340_1065_1775 234
416 3300048922 Ga0496119_0022541 Ga0496119_0022541_117_821 234
417 3300048923 Ga0496120_0111142 Ga0496120_0111142_106_810 234
418 3300048924 Ga0496121_0014968 Ga0496121_0014968_5096_5806 234
419 3300048924 Ga0496121_0176268 Ga0496121_0176268_51_755 234
420 3300048927 Ga0496124_0051307 Ga0496124_0051307_1031_1735 234
421 3300048929 Ga0496126_0030491 Ga0496126_0030491_300_1004 234
422 3300050492 nmdc:mga0yw44_71313_c1 nmdc:mga0yw44_71313_c1_401_1105 234
423 3300053084 Ga0495595_0046772 Ga0495595_0046772_37_741 234
424 3300053085 Ga0495619_0295850 Ga0495619_0295850_280_984 234
425 3300053086 Ga0500578_0271687 Ga0500578_0271687_79_789 234
426 3300053092 Ga0500583_0171510 Ga0500583_0171510_71_781 234
427 3300053104 Ga0500556_0008987 Ga0500556_0008987_270_980 234
428 3300053119 Ga0500595_012265 Ga0500595_012265_2379_3083 234
429 3300053130 Ga0500642_0045664 Ga0500642_0045664_830_1540 234
430 3300053153 Ga0500616_0022308 Ga0500616_0022308_24_734 234
431 3300053162 Ga0500638_139429 Ga0500638_139429_144_848 234
432 3300053736 Ga0500599_007382 Ga0500599_007382_353_1063 234
433 iso_pu_bacteria 2507262055 2507505509 234
434 iso_pu_bacteria 2508501009 2508539394 234
435 iso_pu_bacteria 2508501042 2508695725 234
436 iso_pu_bacteria 2513237094 2513642384 234
437 iso_pu_bacteria 2513237101 2513698872 234
438 iso_pu_bacteria 2513237104 2513721907 234
439 iso_pu_bacteria 2513237161 2514016903 234
440 iso_pu_bacteria 2515154112 2515630195 234
441 iso_pu_bacteria 2524023205 2524441949 234
442 iso_pu_bacteria 2524023210 2524468123 234
443 iso_pu_bacteria 2528768022 2528851899 234
444 iso_pu_bacteria 2721755755 2723841887 234
445 iso_pu_bacteria 2744054633 2745082749 234
446 iso_pu_bacteria 2791355196 2793065716 234
447 iso_pu_bacteria 2791355199 2793079183 234
448 iso_pu_bacteria 2824653114 2824660248 234
449 iso_pu_bacteria 2841941048 2841949206 234
450 iso_pu_bacteria 2841949485 2841956988 234
451 iso_pu_bacteria 2841966195 2841974462 234
452 iso_pu_bacteria 2841974524 2841977394 234
453 iso_pu_bacteria 2842038055 2842041240 234
454 iso_pu_bacteria 2842045827 2842049282 234
455 iso_pu_bacteria 2857509624 2857516435 234
456 iso_pu_bacteria 2874590934 2874592584 234
457 iso_pu_bacteria 2874604998 2874610517 234
458 iso_pu_bacteria 2874620515 2874622988 234
459 iso_pu_bacteria 2874645413 2874647408 234
460 iso_pu_bacteria 2876761206 2876763769 234
461 iso_pu_bacteria 2876771140 2876772708 234
462 iso_pu_bacteria 2876808645 2876818214 234
463 iso_pu_bacteria 2876818435 2876820041 234
464 iso_pu_bacteria 2879074833 2879076546 234
465 iso_pu_bacteria 2879110137 2879115161 234
466 iso_pu_bacteria 2879127579 2879129180 234
467 iso_pu_bacteria 2879142872 2879144819 234
468 iso_pu_bacteria 2885383462 2885388425 234
469 iso_pu_bacteria 2888419890 2888420018 234
470 iso_pu_bacteria 2889033259 2889035199 234
471 iso_pu_bacteria 2904666416 2904668950 234
472 iso_pu_bacteria 2922361189 2922363274 234
473 iso_pu_bacteria 2922368715 2922369231 234
474 iso_pu_bacteria 2922386360 2922388801 234
475 iso_pu_bacteria 2935608549 2935614565 234
476 iso_pu_bacteria 2935648319 2935654728 234
477 iso_pu_bacteria 2935656913 2935663608 234
478 iso_pu_bacteria 2935675223 2935684713 234
479 iso_pu_bacteria 2935684952 2935686659 234
480 iso_pu_bacteria 2935713505 2935716347 234
481 iso_pu_bacteria 2935722832 2935723528 234
482 iso_pu_bacteria 2935732158 2935735084 234
483 iso_pu_bacteria 2935741537 2935744125 234
484 iso_pu_bacteria 2935750917 2935752625 234
485 iso_pu_bacteria 2935777560 2935778272 234
486 iso_pu_bacteria 2935785616 2935789056 234
487 iso_pu_bacteria 2935793552 2935796806 234
488 iso_pu_bacteria 2935810662 2935816823 234
489 iso_pu_bacteria 2935819856 2935826403 234
490 iso_pu_bacteria 2935847175 2935853890 234
491 iso_pu_bacteria 2935908558 2935915432 234
492 iso_pu_bacteria 2935916978 2935925092 234
493 iso_pu_bacteria 2935926038 2935933327 234
494 iso_pu_bacteria 2935934488 2935941419 234
495 iso_pu_bacteria 2935942939 2935949522 234
496 iso_pu_bacteria 2935951376 2935958303 234
497 iso_pu_bacteria 2935959822 2935966552 234
498 iso_pu_bacteria 2935967501 2935974891 234
499 iso_pu_bacteria 2935975950 2935983154 234
500 iso_pu_bacteria 2935984226 2935985219 234
501 iso_pu_bacteria 2936011229 2936017764 234
502 iso_pu_bacteria 2936019824 2936026267 234
503 iso_pu_bacteria 2936028420 2936035014 234
504 iso_pu_bacteria 2936037263 2936043814 234
505 iso_pu_bacteria 2936046547 2936053229 234
506 iso_pu_bacteria 2936055302 2936057020 234
507 iso_pu_bacteria 2940556831 2940558538 234
508 iso_pu_bacteria 3005506211 3005511457 234
509 iso_pu_bacteria 8006926726 8006930251 234
510 iso_pu_bacteria 8006964411 8006969418 234
511 iso_pu_bacteria 8006984368 8006988467 234
512 iso_pu_bacteria 8006994254 8007000710 234
513 iso_pu_bacteria 8016530956 8016531464 234
514 iso_pu_bacteria 8016539877 8016544674 234
515 iso_pu_bacteria 8016548790 8016557405 234
516 iso_pu_bacteria 8016557553 8016565759 234
517 iso_pu_bacteria 8016566248 8016569732 234
518 iso_pu_bacteria 8016575299 8016582335 234
519 iso_pu_bacteria 8016595262 8016603363 234
520 iso_pu_bacteria 8016603502 8016606295 234
521 iso_pu_bacteria 8016613128 8016618202 234
522 iso_pu_bacteria 8016630954 8016635363 234
523 iso_pu_bacteria 8019538911 8019540262 234
524 iso_pu_bacteria 8019619141 8019623231 234
525 iso_pu_bacteria 8019629233 8019629866 234
526 iso_pu_bacteria 8019638758 8019640744 234
527 iso_pu_bacteria 8019659431 8019666704 234
528 iso_pu_bacteria 8019678201 8019679526 234
529 iso_pu_bacteria 8019687851 8019695985 234
530 iso_pu_bacteria 8056673599 8056678600 234
531 3300005842 Ga0068858_100153798 Ga0068858_1001537982 235
532 3300009101 Ga0105247_10009734 Ga0105247_100097342 235
533 3300009545 Ga0105237_10834968 Ga0105237_108349681 235
534 3300025900 Ga0207710_10077684 Ga0207710_100776842 235
535 3300025914 Ga0207671_10218399 Ga0207671_102183992 235
536 3300028573 Ga0265334_10017875 Ga0265334_100178752 235
537 3300028577 Ga0265318_10009533 Ga0265318_100095333 235
538 3300028653 Ga0265323_10000706 Ga0265323_100007065 235
539 3300028666 Ga0265336_10000683 Ga0265336_1000068312 235
540 3300028800 Ga0265338_10001041 Ga0265338_1000104123 235
541 3300029957 Ga0265324_10004820 Ga0265324_100048203 235
542 3300045049 Ga0466959_0221764 Ga0466959_0221764_505_1215 235
543 3300046522 Ga0495643_0208714 Ga0495643_0208714_78_794 235
544 3300047469 Ga0495673_0024196 Ga0495673_0024196_2205_2921 235
545 3300053086 Ga0500578_0187342 Ga0500578_0187342_71_787 235
546 iso_pu_bacteria 2773857925 2774869488 235
547 3300003752 Ga0055539_1003001 Ga0055539_10030013 236
548 3300005842 Ga0068858_101072092 Ga0068858_1010720921 236
549 3300020081 Ga0206354_10602836 Ga0206354_106028361 236
550 3300025253 Ga0209677_100221 Ga0209677_10022125 236
551 3300025272 Ga0209455_1022391 Ga0209455_10223911 236
552 3300025921 Ga0207652_10180515 Ga0207652_101805151 236
553 3300031507 Ga0307509_10032140 Ga0307509_100321405 236
554 3300031507 Ga0307509_10306562 Ga0307509_103065622 236
555 3300048920 Ga0496117_0105573 Ga0496117_0105573_549_1262 236
556 3300048923 Ga0496120_0223240 Ga0496120_0223240_67_783 236
557 3300048924 Ga0496121_0027740 Ga0496121_0027740_4517_5233 236
558 3300048924 Ga0496121_0355383 Ga0496121_0355383_60_776 236
559 3300048928 Ga0496125_0124627 Ga0496125_0124627_742_1455 236
560 3300048929 Ga0496126_0108383 Ga0496126_0108383_105_821 236
561 3300053094 Ga0500566_0001345 Ga0500566_0001345_10713_11429 236
562 3300053145 Ga0500586_000452 Ga0500586_000452_5027_5743 236
563 3300003354 JGI25160J50197_1005043 JGI25160J50197_10050435 237
564 3300003354 JGI25160J50197_1025211 JGI25160J50197_10252112 237
565 3300005344 Ga0070661_100122108 Ga0070661_1001221082 237
566 3300005843 Ga0068860_100000577 Ga0068860_10000057729 237
567 3300005937 Ga0081455_10013363 Ga0081455_100133634 237
568 3300009101 Ga0105247_10348157 Ga0105247_103481571 237
569 3300009545 Ga0105237_10065294 Ga0105237_100652941 237
570 3300010375 Ga0105239_10120138 Ga0105239_101201383 237
571 3300013104 Ga0157370_10022331 Ga0157370_100223312 237
572 3300013105 Ga0157369_10011194 Ga0157369_100111942 237
573 3300025297 Ga0209758_1031807 Ga0209758_10318072 237
574 3300025297 Ga0209758_1041277 Ga0209758_10412772 237
575 3300025302 Ga0207426_1010110 Ga0207426_10101102 237
576 3300025900 Ga0207710_10133009 Ga0207710_101330092 237
577 3300025914 Ga0207671_10208480 Ga0207671_102084801 237
578 3300025919 Ga0207657_10030292 Ga0207657_100302923 237
579 3300025920 Ga0207649_10139777 Ga0207649_101397772 237
580 3300026035 Ga0207703_10307582 Ga0207703_103075821 237
581 3300026078 Ga0207702_10263990 Ga0207702_102639902 237
582 3300027296 Ga0209389_1000163 Ga0209389_100016343 237
583 3300027361 Ga0209489_101100 Ga0209489_10110043 237
584 3300027363 Ga0209700_100014 Ga0209700_100014254 237
585 3300028381 Ga0268264_10000107 Ga0268264_10000107181 237
586 3300031730 Ga0307516_10009658 Ga0307516_1000965810 237
587 3300035113 Ga0373936_0034200 Ga0373936_0034200_781_1497 237
588 3300035171 Ga0373946_0156936 Ga0373946_0156936_117_833 237
589 3300035692 Ga0373935_0007139 Ga0373935_0007139_5363_6079 237
590 3300035695 Ga0373927_0310865 Ga0373927_0310865_110_826 237
591 3300037068 Ga0373925_0051695 Ga0373925_0051695_1047_1763 237
592 3300039450 Ga0436363_0270101 Ga0436363_0270101_1506_2222 237
593 3300041505 Ga0451849_1322946 Ga0451849_1322946_75_791 237
594 3300046516 Ga0495628_0376855 Ga0495628_0376855_141_857 237
595 3300046557 Ga0495622_0056752 Ga0495622_0056752_691_1407 237
596 3300047443 Ga0495687_029783 Ga0495687_029783_955_1671 237
597 3300048909 Ga0496106_0000788 Ga0496106_0000788_329_1045 237
598 3300048919 Ga0496116_0135082 Ga0496116_0135082_654_1370 237
599 3300048920 Ga0496117_0008719 Ga0496117_0008719_5189_5905 237
600 3300048921 Ga0496118_0004035 Ga0496118_0004035_2323_3039 237
601 3300048924 Ga0496121_0000640 Ga0496121_0000640_44301_45017 237
602 3300048925 Ga0496122_0096390 Ga0496122_0096390_690_1406 237
603 3300048927 Ga0496124_0007008 Ga0496124_0007008_88_804 237
604 3300048928 Ga0496125_0000136 Ga0496125_0000136_19085_19801 237
605 3300048928 Ga0496125_0049499 Ga0496125_0049499_317_1033 237
606 3300048929 Ga0496126_0185856 Ga0496126_0185856_709_1425 237
607 3300048929 Ga0496126_0360985 Ga0496126_0360985_281_997 237
608 3300048929 Ga0496126_0462019 Ga0496126_0462019_46_762 237
609 3300050492 nmdc:mga0yw44_15824_c1 nmdc:mga0yw44_15824_c1_972_1697 237
610 3300053078 Ga0495612_0037009 Ga0495612_0037009_994_1710 237
611 3300053080 Ga0500635_0019869 Ga0500635_0019869_95_811 237
612 3300053080 Ga0500635_0141489 Ga0500635_0141489_12_728 237
613 3300053094 Ga0500566_0003268 Ga0500566_0003268_5938_6654 237
614 3300053094 Ga0500566_0194611 Ga0500566_0194611_91_807 237
615 3300053095 Ga0500640_027308 Ga0500640_027308_1505_2221 237
616 3300053109 Ga0500569_008127 Ga0500569_008127_1356_2072 237
617 3300053111 Ga0500572_003155 Ga0500572_003155_20_736 237
618 3300053119 Ga0500595_012487 Ga0500595_012487_433_1149 237
619 3300053148 Ga0500590_037623 Ga0500590_037623_226_942 237
620 3300053150 Ga0500603_001503 Ga0500603_001503_3188_3904 237
621 3300053163 Ga0500639_013828 Ga0500639_013828_1925_2641 237
622 3300053163 Ga0500639_062419 Ga0500639_062419_262_978 237
623 3300053163 Ga0500639_073945 Ga0500639_073945_332_1048 237
624 3300053178 Ga0500637_0032662 Ga0500637_0032662_1753_2469 237
625 3300053731 Ga0500609_015376 Ga0500609_015376_156_872 237
626 3300053735 Ga0500596_005506 Ga0500596_005506_764_1480 237
627 3300002067 JGI24735J21928_10041752 JGI24735J21928_100417522 238
628 3300003215 JGI25153J46596_10003596 JGI25153J46596_100035964 238
629 3300003215 JGI25153J46596_10003675 JGI25153J46596_100036752 238
630 3300003215 JGI25153J46596_10007159 JGI25153J46596_100071593 238
631 3300003215 JGI25153J46596_10012613 JGI25153J46596_100126132 238
632 3300003316 rootH1_10084142 rootH1_100841422 238
633 3300003322 rootL2_10239686 rootL2_102396862 238
634 3300003354 JGI25160J50197_1003782 JGI25160J50197_10037825 238
635 3300003659 JGI25404J52841_10024642 JGI25404J52841_100246421 238
636 3300003794 Ga0055531_10005144 Ga0055531_100051441 238
637 3300004625 Ga0055543_1001103 Ga0055543_10011035 238
638 3300005262 Ga0065165_1001646 Ga0065165_100164610 238
639 3300005262 Ga0065165_1003743 Ga0065165_10037437 238
640 3300005327 Ga0070658_10064511 Ga0070658_100645113 238
641 3300005327 Ga0070658_10243097 Ga0070658_102430972 238
642 3300005330 Ga0070690_100090747 Ga0070690_1000907471 238
643 3300005331 Ga0070670_100182032 Ga0070670_1001820322 238
644 3300005334 Ga0068869_100018682 Ga0068869_1000186823 238
645 3300005334 Ga0068869_100229158 Ga0068869_1002291582 238
646 3300005335 Ga0070666_10198145 Ga0070666_101981452 238
647 3300005336 Ga0070680_100471625 Ga0070680_1004716251 238
648 3300005337 Ga0070682_100024236 Ga0070682_1000242363 238
649 3300005337 Ga0070682_100074067 Ga0070682_1000740673 238
650 3300005337 Ga0070682_100278192 Ga0070682_1002781921 238
651 3300005338 Ga0068868_100004833 Ga0068868_1000048338 238
652 3300005338 Ga0068868_100529731 Ga0068868_1005297311 238
653 3300005339 Ga0070660_100399953 Ga0070660_1003999531 238
654 3300005340 Ga0070689_100238269 Ga0070689_1002382692 238
655 3300005343 Ga0070687_100157363 Ga0070687_1001573631 238
656 3300005347 Ga0070668_100013201 Ga0070668_1000132013 238
657 3300005347 Ga0070668_100015674 Ga0070668_1000156743 238
658 3300005347 Ga0070668_100547921 Ga0070668_1005479211 238
659 3300005354 Ga0070675_100259455 Ga0070675_1002594552 238
660 3300005355 Ga0070671_100171645 Ga0070671_1001716451 238
661 3300005356 Ga0070674_100199625 Ga0070674_1001996251 238
662 3300005364 Ga0070673_100125190 Ga0070673_1001251902 238
663 3300005364 Ga0070673_100213175 Ga0070673_1002131752 238
664 3300005367 Ga0070667_100200492 Ga0070667_1002004922 238
665 3300005438 Ga0070701_10143799 Ga0070701_101437992 238
666 3300005441 Ga0070700_100070726 Ga0070700_1000707262 238
667 3300005441 Ga0070700_100223878 Ga0070700_1002238782 238
668 3300005455 Ga0070663_100019221 Ga0070663_1000192212 238
669 3300005455 Ga0070663_100083818 Ga0070663_1000838182 238
670 3300005456 Ga0070678_100134028 Ga0070678_1001340282 238
671 3300005456 Ga0070678_100142321 Ga0070678_1001423212 238
672 3300005456 Ga0070678_100158056 Ga0070678_1001580562 238
673 3300005456 Ga0070678_100278143 Ga0070678_1002781431 238
674 3300005457 Ga0070662_100015533 Ga0070662_1000155331 238
675 3300005457 Ga0070662_100073350 Ga0070662_1000733503 238
676 3300005458 Ga0070681_10141265 Ga0070681_101412652 238
677 3300005459 Ga0068867_100164012 Ga0068867_1001640121 238
678 3300005467 Ga0070706_100159540 Ga0070706_1001595402 238
679 3300005535 Ga0070684_100122197 Ga0070684_1001221973 238
680 3300005535 Ga0070684_100408283 Ga0070684_1004082832 238
681 3300005539 Ga0068853_100051162 Ga0068853_1000511622 238
682 3300005539 Ga0068853_100068809 Ga0068853_1000688093 238
683 3300005539 Ga0068853_100257283 Ga0068853_1002572832 238
684 3300005543 Ga0070672_100104298 Ga0070672_1001042983 238
685 3300005544 Ga0070686_100042506 Ga0070686_1000425062 238
686 3300005547 Ga0070693_100040702 Ga0070693_1000407023 238
687 3300005548 Ga0070665_100010827 Ga0070665_10001082710 238
688 3300005548 Ga0070665_100015812 Ga0070665_1000158125 238
689 3300005548 Ga0070665_100123562 Ga0070665_1001235623 238
690 3300005548 Ga0070665_100368750 Ga0070665_1003687502 238
691 3300005548 Ga0070665_100370198 Ga0070665_1003701982 238
692 3300005548 Ga0070665_100370216 Ga0070665_1003702162 238
693 3300005563 Ga0068855_100110183 Ga0068855_1001101833 238
694 3300005563 Ga0068855_100134239 Ga0068855_1001342392 238
695 3300005563 Ga0068855_100565992 Ga0068855_1005659921 238
696 3300005564 Ga0070664_100089380 Ga0070664_1000893802 238
697 3300005577 Ga0068857_100085354 Ga0068857_1000853543 238
698 3300005614 Ga0068856_100649046 Ga0068856_1006490461 238
699 3300005615 Ga0070702_100249769 Ga0070702_1002497692 238
700 3300005615 Ga0070702_100281751 Ga0070702_1002817511 238
701 3300005616 Ga0068852_100229094 Ga0068852_1002290941 238
702 3300005616 Ga0068852_100280195 Ga0068852_1002801952 238
703 3300005616 Ga0068852_100714906 Ga0068852_1007149061 238
704 3300005617 Ga0068859_100016877 Ga0068859_1000168771 238
705 3300005617 Ga0068859_100166317 Ga0068859_1001663172 238
706 3300005617 Ga0068859_100584304 Ga0068859_1005843042 238
707 3300005618 Ga0068864_100027680 Ga0068864_1000276803 238
708 3300005719 Ga0068861_100064658 Ga0068861_1000646582 238
709 3300005719 Ga0068861_100092252 Ga0068861_1000922523 238
710 3300005719 Ga0068861_100096747 Ga0068861_1000967473 238
711 3300005834 Ga0068851_10129435 Ga0068851_101294352 238
712 3300005840 Ga0068870_10175109 Ga0068870_101751092 238
713 3300005841 Ga0068863_100086085 Ga0068863_1000860853 238
714 3300005842 Ga0068858_100151471 Ga0068858_1001514712 238
715 3300005842 Ga0068858_100404129 Ga0068858_1004041292 238
716 3300005843 Ga0068860_100177029 Ga0068860_1001770293 238
717 3300005843 Ga0068860_100222173 Ga0068860_1002221732 238
718 3300005843 Ga0068860_100296370 Ga0068860_1002963701 238
719 3300005843 Ga0068860_100337864 Ga0068860_1003378642 238
720 3300005844 Ga0068862_100036297 Ga0068862_1000362973 238
721 3300005844 Ga0068862_100052418 Ga0068862_1000524183 238
722 3300005844 Ga0068862_100253887 Ga0068862_1002538871 238
723 3300005937 Ga0081455_10047903 Ga0081455_100479032 238
724 3300005937 Ga0081455_10065600 Ga0081455_100656002 238
725 3300005983 Ga0081540_1005048 Ga0081540_10050485 238
726 3300005983 Ga0081540_1011487 Ga0081540_10114873 238
727 3300005983 Ga0081540_1011797 Ga0081540_10117973 238
728 3300005983 Ga0081540_1013781 Ga0081540_10137815 238
729 3300005983 Ga0081540_1031452 Ga0081540_10314523 238
730 3300005983 Ga0081540_1051966 Ga0081540_10519662 238
731 3300005985 Ga0081539_10019046 Ga0081539_100190463 238
732 3300006038 Ga0075365_10004812 Ga0075365_100048125 238
733 3300006038 Ga0075365_10011993 Ga0075365_100119932 238
734 3300006038 Ga0075365_10116414 Ga0075365_101164142 238
735 3300006038 Ga0075365_10199218 Ga0075365_101992182 238
736 3300006042 Ga0075368_10141535 Ga0075368_101415352 238
737 3300006048 Ga0075363_100003163 Ga0075363_1000031634 238
738 3300006048 Ga0075363_100070001 Ga0075363_1000700012 238
739 3300006051 Ga0075364_10044928 Ga0075364_100449283 238
740 3300006051 Ga0075364_10287374 Ga0075364_102873741 238
741 3300006177 Ga0075362_10177018 Ga0075362_101770181 238
742 3300006178 Ga0075367_10018509 Ga0075367_100185092 238
743 3300006178 Ga0075367_10186630 Ga0075367_101866302 238
744 3300006186 Ga0075369_10063085 Ga0075369_100630851 238
745 3300006195 Ga0075366_10138885 Ga0075366_101388852 238
746 3300006195 Ga0075366_10205646 Ga0075366_102056461 238
747 3300006237 Ga0097621_100079086 Ga0097621_1000790862 238
748 3300006353 Ga0075370_10058931 Ga0075370_100589313 238
749 3300006358 Ga0068871_100221194 Ga0068871_1002211942 238
750 3300006358 Ga0068871_100302702 Ga0068871_1003027022 238
751 3300006358 Ga0068871_100508328 Ga0068871_1005083281 238
752 3300006844 Ga0075428_100014565 Ga0075428_1000145659 238
753 3300006871 Ga0075434_100669941 Ga0075434_1006699411 238
754 3300006881 Ga0068865_100077817 Ga0068865_1000778172 238
755 3300006931 Ga0097620_100016876 Ga0097620_1000168761 238
756 3300006931 Ga0097620_100166318 Ga0097620_1001663182 238
757 3300006931 Ga0097620_100584282 Ga0097620_1005842821 238
758 3300007076 Ga0075435_100416675 Ga0075435_1004166751 238
759 3300009092 Ga0105250_10069082 Ga0105250_100690822 238
760 3300009093 Ga0105240_10199785 Ga0105240_101997853 238
761 3300009094 Ga0111539_10042663 Ga0111539_100426632 238
762 3300009098 Ga0105245_10009744 Ga0105245_100097447 238
763 3300009098 Ga0105245_10041488 Ga0105245_100414883 238
764 3300009098 Ga0105245_10262667 Ga0105245_102626672 238
765 3300009101 Ga0105247_10187484 Ga0105247_101874842 238
766 3300009147 Ga0114129_10209945 Ga0114129_102099453 238
767 3300009147 Ga0114129_10364713 Ga0114129_103647132 238
768 3300009148 Ga0105243_10138872 Ga0105243_101388722 238
769 3300009148 Ga0105243_10504984 Ga0105243_105049842 238
770 3300009176 Ga0105242_10018681 Ga0105242_100186812 238
771 3300009176 Ga0105242_10087044 Ga0105242_100870443 238
772 3300009176 Ga0105242_10632323 Ga0105242_106323231 238
773 3300009176 Ga0105242_10928944 Ga0105242_109289441 238
774 3300009177 Ga0105248_10037824 Ga0105248_100378243 238
775 3300009177 Ga0105248_10303341 Ga0105248_103033412 238
776 3300009177 Ga0105248_10315684 Ga0105248_103156842 238
777 3300009177 Ga0105248_10372403 Ga0105248_103724032 238
778 3300009177 Ga0105248_11196719 Ga0105248_111967191 238
779 3300009545 Ga0105237_10061924 Ga0105237_100619243 238
780 3300009551 Ga0105238_10116422 Ga0105238_101164223 238
781 3300009553 Ga0105249_10369478 Ga0105249_103694782 238
782 3300010159 Ga0099796_10011789 Ga0099796_100117893 238
783 3300010375 Ga0105239_10032831 Ga0105239_100328314 238
784 3300010375 Ga0105239_10046379 Ga0105239_100463793 238
785 3300010375 Ga0105239_10060369 Ga0105239_100603692 238
786 3300010375 Ga0105239_10371891 Ga0105239_103718914 238
787 3300010375 Ga0105239_10620053 Ga0105239_106200532 238
788 3300011119 Ga0105246_10022753 Ga0105246_100227532 238
789 3300011119 Ga0105246_10081357 Ga0105246_100813572 238
790 3300011119 Ga0105246_10203546 Ga0105246_102035462 238
791 3300011119 Ga0105246_10386997 Ga0105246_103869971 238
792 3300013102 Ga0157371_10436736 Ga0157371_104367362 238
793 3300013104 Ga0157370_10194746 Ga0157370_101947462 238
794 3300013296 Ga0157374_10016521 Ga0157374_100165215 238
795 3300013297 Ga0157378_10014932 Ga0157378_100149323 238
796 3300013297 Ga0157378_10225469 Ga0157378_102254692 238
797 3300013297 Ga0157378_10302560 Ga0157378_103025602 238
798 3300013306 Ga0163162_10274922 Ga0163162_102749222 238
799 3300013306 Ga0163162_10323237 Ga0163162_103232372 238
800 3300013308 Ga0157375_10283930 Ga0157375_102839302 238
801 3300014325 Ga0163163_10042519 Ga0163163_100425193 238
802 3300014325 Ga0163163_10845215 Ga0163163_108452151 238
803 3300014326 Ga0157380_10152327 Ga0157380_101523273 238
804 3300014745 Ga0157377_10214457 Ga0157377_102144572 238
805 3300014968 Ga0157379_10053440 Ga0157379_100534403 238
806 3300014968 Ga0157379_10112157 Ga0157379_101121573 238
807 3300014969 Ga0157376_10009078 Ga0157376_100090782 238
808 3300014969 Ga0157376_10023064 Ga0157376_100230642 238
809 3300014969 Ga0157376_10032010 Ga0157376_100320103 238
810 3300014969 Ga0157376_10160662 Ga0157376_101606624 238
811 3300017792 Ga0163161_10079952 Ga0163161_100799523 238
812 3300017792 Ga0163161_10145217 Ga0163161_101452172 238
813 3300025245 Ga0207425_1017347 Ga0207425_10173471 238
814 3300025295 Ga0209564_1006843 Ga0209564_10068436 238
815 3300025297 Ga0209758_1000030 Ga0209758_100003032 238
816 3300025297 Ga0209758_1001470 Ga0209758_100147013 238
817 3300025297 Ga0209758_1002448 Ga0209758_10024483 238
818 3300025297 Ga0209758_1003848 Ga0209758_10038483 238
819 3300025297 Ga0209758_1007239 Ga0209758_10072395 238
820 3300025299 Ga0209256_1004427 Ga0209256_10044271 238
821 3300025302 Ga0207426_1001583 Ga0207426_100158311 238
822 3300025304 Ga0209257_1003693 Ga0209257_100369312 238
823 3300025315 Ga0207697_10108442 Ga0207697_101084422 238
824 3300025901 Ga0207688_10026849 Ga0207688_100268492 238
825 3300025901 Ga0207688_10083585 Ga0207688_100835853 238
826 3300025901 Ga0207688_10256468 Ga0207688_102564681 238
827 3300025907 Ga0207645_10256861 Ga0207645_102568612 238
828 3300025909 Ga0207705_10318544 Ga0207705_103185441 238
829 3300025911 Ga0207654_10042739 Ga0207654_100427392 238
830 3300025913 Ga0207695_10483740 Ga0207695_104837401 238
831 3300025914 Ga0207671_10084741 Ga0207671_100847413 238
832 3300025914 Ga0207671_10215184 Ga0207671_102151842 238
833 3300025917 Ga0207660_10085154 Ga0207660_100851542 238
834 3300025919 Ga0207657_10212004 Ga0207657_102120042 238
835 3300025922 Ga0207646_10639630 Ga0207646_106396301 238
836 3300025923 Ga0207681_10383193 Ga0207681_103831932 238
837 3300025924 Ga0207694_10120369 Ga0207694_101203692 238
838 3300025924 Ga0207694_10223641 Ga0207694_102236412 238
839 3300025932 Ga0207690_10079258 Ga0207690_100792582 238
840 3300025933 Ga0207706_10039680 Ga0207706_100396802 238
841 3300025933 Ga0207706_10107804 Ga0207706_101078042 238
842 3300025934 Ga0207686_10257785 Ga0207686_102577853 238
843 3300025935 Ga0207709_10258685 Ga0207709_102586852 238
844 3300025935 Ga0207709_10356389 Ga0207709_103563892 238
845 3300025935 Ga0207709_10529046 Ga0207709_105290461 238
846 3300025936 Ga0207670_10344009 Ga0207670_103440092 238
847 3300025937 Ga0207669_10042091 Ga0207669_100420913 238
848 3300025938 Ga0207704_10087655 Ga0207704_100876553 238
849 3300025940 Ga0207691_10419708 Ga0207691_104197082 238
850 3300025941 Ga0207711_10023938 Ga0207711_100239382 238
851 3300025941 Ga0207711_10056621 Ga0207711_100566212 238
852 3300025941 Ga0207711_10310148 Ga0207711_103101482 238
853 3300025942 Ga0207689_10009995 Ga0207689_100099953 238
854 3300025945 Ga0207679_10068588 Ga0207679_100685883 238
855 3300025960 Ga0207651_10226524 Ga0207651_102265242 238
856 3300025960 Ga0207651_10433481 Ga0207651_104334812 238
857 3300025961 Ga0207712_10032642 Ga0207712_100326422 238
858 3300025972 Ga0207668_10239790 Ga0207668_102397902 238
859 3300025986 Ga0207658_10110777 Ga0207658_101107773 238
860 3300025986 Ga0207658_10845704 Ga0207658_108457041 238
861 3300026035 Ga0207703_10036511 Ga0207703_100365113 238
862 3300026035 Ga0207703_10599310 Ga0207703_105993102 238
863 3300026041 Ga0207639_10123494 Ga0207639_101234943 238
864 3300026041 Ga0207639_10182571 Ga0207639_101825711 238
865 3300026067 Ga0207678_10320935 Ga0207678_103209351 238
866 3300026075 Ga0207708_10011392 Ga0207708_100113925 238
867 3300026075 Ga0207708_10072081 Ga0207708_100720812 238
868 3300026078 Ga0207702_10052978 Ga0207702_100529782 238
869 3300026088 Ga0207641_10358026 Ga0207641_103580262 238
870 3300026089 Ga0207648_10193731 Ga0207648_101937311 238
871 3300026089 Ga0207648_10250267 Ga0207648_102502672 238
872 3300026089 Ga0207648_10782948 Ga0207648_107829481 238
873 3300026095 Ga0207676_10098407 Ga0207676_100984072 238
874 3300026116 Ga0207674_10097268 Ga0207674_100972683 238
875 3300026118 Ga0207675_100025561 Ga0207675_1000255612 238
876 3300026118 Ga0207675_100030002 Ga0207675_1000300023 238
877 3300026121 Ga0207683_10011692 Ga0207683_100116926 238
878 3300026121 Ga0207683_10166455 Ga0207683_101664552 238
879 3300026121 Ga0207683_10170942 Ga0207683_101709422 238
880 3300026121 Ga0207683_10237400 Ga0207683_102374001 238
881 3300028379 Ga0268266_10004510 Ga0268266_100045106 238
882 3300028379 Ga0268266_10014493 Ga0268266_100144935 238
883 3300028379 Ga0268266_10250808 Ga0268266_102508082 238
884 3300028380 Ga0268265_10557746 Ga0268265_105577461 238
885 3300028381 Ga0268264_10101045 Ga0268264_101010452 238
886 3300028381 Ga0268264_10745597 Ga0268264_107455971 238
887 3300028786 Ga0307517_10001121 Ga0307517_100011219 238
888 3300028794 Ga0307515_10048703 Ga0307515_100487032 238
889 3300031456 Ga0307513_10170936 Ga0307513_101709361 238
890 3300031456 Ga0307513_10238570 Ga0307513_102385702 238
891 3300031456 Ga0307513_10326987 Ga0307513_103269871 238
892 3300031507 Ga0307509_10355137 Ga0307509_103551372 238
893 3300031616 Ga0307508_10199788 Ga0307508_101997882 238
894 3300031616 Ga0307508_10284103 Ga0307508_102841032 238
895 3300031730 Ga0307516_10046891 Ga0307516_100468915 238
896 3300031730 Ga0307516_10048561 Ga0307516_100485615 238
897 3300031730 Ga0307516_10058550 Ga0307516_100585504 238
898 3300031731 Ga0307405_10166428 Ga0307405_101664282 238
899 3300031731 Ga0307405_10239103 Ga0307405_102391032 238
900 3300032002 Ga0307416_100250974 Ga0307416_1002509742 238
901 3300032002 Ga0307416_100369373 Ga0307416_1003693732 238
902 3300032005 Ga0307411_10079962 Ga0307411_100799622 238
903 3300032126 Ga0307415_100195771 Ga0307415_1001957712 238
904 3300033180 Ga0307510_10035200 Ga0307510_100352004 238
905 3300033180 Ga0307510_10210970 Ga0307510_102109702 238
906 3300033180 Ga0307510_10229271 Ga0307510_102292711 238
907 3300034816 Ga0373930_0038620 Ga0373930_0038620_179_898 238
908 3300035113 Ga0373936_0050697 Ga0373936_0050697_53_772 238
909 3300035115 Ga0373941_0018909 Ga0373941_0018909_471_1190 238
910 3300035116 Ga0373945_0023969 Ga0373945_0023969_144_863 238
911 3300035118 Ga0373954_0049206 Ga0373954_0049206_1056_1775 238
912 3300035119 Ga0373956_0016462 Ga0373956_0016462_296_1015 238
913 3300035170 Ga0373943_0019761 Ga0373943_0019761_1860_2579 238
914 3300035171 Ga0373946_0077904 Ga0373946_0077904_676_1395 238
915 3300035410 Ga0373924_0105697 Ga0373924_0105697_314_1033 238
916 3300035691 Ga0373931_0000922 Ga0373931_0000922_8297_9016 238
917 3300035691 Ga0373931_0069916 Ga0373931_0069916_1104_1823 238
918 3300035691 Ga0373931_0401473 Ga0373931_0401473_102_821 238
919 3300035692 Ga0373935_0061490 Ga0373935_0061490_778_1497 238
920 3300035695 Ga0373927_0003207 Ga0373927_0003207_9533_10252 238
921 3300035695 Ga0373927_0027031 Ga0373927_0027031_403_1122 238
922 3300035695 Ga0373927_0130679 Ga0373927_0130679_471_1190 238
923 3300035695 Ga0373927_0304999 Ga0373927_0304999_277_996 238
924 3300035695 Ga0373927_0369211 Ga0373927_0369211_163_882 238
925 3300035725 Ga0373947_0016126 Ga0373947_0016126_998_1717 238
926 3300037068 Ga0373925_0386573 Ga0373925_0386573_406_1125 238
927 3300037068 Ga0373925_0448791 Ga0373925_0448791_167_886 238
928 3300037466 Ga0395898_0333998 Ga0395898_0333998_177_896 238
929 3300037471 Ga0395905_0072293 Ga0395905_0072293_1304_2023 238
930 3300037471 Ga0395905_0177334 Ga0395905_0177334_741_1463 238
931 3300037471 Ga0395905_0213892 Ga0395905_0213892_513_1232 238
932 3300041451 Ga0451791_0655594 Ga0451791_0655594_25_744 238
933 3300042438 Ga0439459_0008892 Ga0439459_0008892_160_879 238
934 3300044658 Ga0466972_0078620 Ga0466972_0078620_755_1471 238
935 3300044901 Ga0466960_0235099 Ga0466960_0235099_255_974 238
936 3300046452 Ga0495617_058050 Ga0495617_058050_469_1188 238
937 3300046454 Ga0495592_0037169 Ga0495592_0037169_1664_2383 238
938 3300046455 Ga0495603_0000182 Ga0495603_0000182_23788_24507 238
939 3300046455 Ga0495603_0004488 Ga0495603_0004488_6517_7236 238
940 3300046455 Ga0495603_0030757 Ga0495603_0030757_293_1012 238
941 3300046455 Ga0495603_0363663 Ga0495603_0363663_32_751 238
942 3300046459 Ga0495629_0000314 Ga0495629_0000314_31327_32046 238
943 3300046461 Ga0495641_0001508 Ga0495641_0001508_7934_8653 238
944 3300046461 Ga0495641_0041135 Ga0495641_0041135_1322_2041 238
945 3300046462 Ga0495651_0180065 Ga0495651_0180065_460_1179 238
946 3300046463 Ga0495653_0109029 Ga0495653_0109029_973_1692 238
947 3300046472 Ga0495580_0036094 Ga0495580_0036094_1517_2236 238
948 3300046473 Ga0495582_0000597 Ga0495582_0000597_14724_15443 238
949 3300046473 Ga0495582_0016511 Ga0495582_0016511_2386_3105 238
950 3300046474 Ga0495605_0120213 Ga0495605_0120213_119_838 238
951 3300046475 Ga0495639_0000235 Ga0495639_0000235_3087_3806 238
952 3300046475 Ga0495639_0089101 Ga0495639_0089101_606_1325 238
953 3300046476 Ga0495662_0001470 Ga0495662_0001470_3239_3958 238
954 3300046477 Ga0495664_0005693 Ga0495664_0005693_3549_4268 238
955 3300046491 Ga0495584_0015964 Ga0495584_0015964_1866_2585 238
956 3300046492 Ga0495585_0048788 Ga0495585_0048788_1227_1946 238
957 3300046499 Ga0495594_0000302 Ga0495594_0000302_8004_8723 238
958 3300046501 Ga0495607_0142450 Ga0495607_0142450_245_964 238
959 3300046507 Ga0495606_0116102 Ga0495606_0116102_218_952 238
960 3300046507 Ga0495606_0159498 Ga0495606_0159498_61_777 238
961 3300046512 Ga0495610_0099204 Ga0495610_0099204_136_855 238
962 3300046513 Ga0495616_0020136 Ga0495616_0020136_2289_3008 238
963 3300046516 Ga0495628_0274453 Ga0495628_0274453_423_1142 238
964 3300046517 Ga0495630_0002415 Ga0495630_0002415_1215_1934 238
965 3300046520 Ga0495637_0087103 Ga0495637_0087103_249_968 238
966 3300046526 Ga0495666_0035782 Ga0495666_0035782_418_1137 238
967 3300046529 Ga0495652_0041525 Ga0495652_0041525_302_1021 238
968 3300046531 Ga0495665_0000619 Ga0495665_0000619_9522_10241 238
969 3300046533 Ga0495640_0000308 Ga0495640_0000308_31521_32240 238
970 3300046538 Ga0495609_0102427 Ga0495609_0102427_393_1112 238
971 3300046538 Ga0495609_0155626 Ga0495609_0155626_12_728 238
972 3300046539 Ga0495621_0064946 Ga0495621_0064946_70_789 238
973 3300046558 Ga0495633_0012187 Ga0495633_0012187_2539_3258 238
974 3300046558 Ga0495633_0063792 Ga0495633_0063792_481_1200 238
975 3300046559 Ga0495667_0008896 Ga0495667_0008896_1781_2500 238
976 3300046615 Ga0495656_0042782 Ga0495656_0042782_846_1565 238
977 3300046616 Ga0495668_0017158 Ga0495668_0017158_28_747 238
978 3300046616 Ga0495668_0052268 Ga0495668_0052268_1025_1744 238
979 3300046616 Ga0495668_0069062 Ga0495668_0069062_236_955 238
980 3300046616 Ga0495668_0131199 Ga0495668_0131199_47_766 238
981 3300046642 Ga0495634_0001483 Ga0495634_0001483_12138_12857 238
982 3300046648 Ga0495611_0113091 Ga0495611_0113091_29_748 238
983 3300046660 Ga0495625_0123597 Ga0495625_0123597_551_1270 238
984 3300046660 Ga0495625_0134632 Ga0495625_0134632_405_1124 238
985 3300046660 Ga0495625_0164807 Ga0495625_0164807_338_1057 238
986 3300046660 Ga0495625_0195089 Ga0495625_0195089_236_955 238
987 3300046663 Ga0495635_0003423 Ga0495635_0003423_6611_7330 238
988 3300046665 Ga0495661_0102372 Ga0495661_0102372_314_1033 238
989 3300046674 Ga0495588_0004152 Ga0495588_0004152_4161_4880 238
990 3300046674 Ga0495588_0006111 Ga0495588_0006111_1218_1937 238
991 3300046675 Ga0495657_0135004 Ga0495657_0135004_786_1505 238
992 3300046678 Ga0495599_0032491 Ga0495599_0032491_99_818 238
993 3300046679 Ga0495623_0124232 Ga0495623_0124232_259_978 238
994 3300046681 Ga0495647_0000405 Ga0495647_0000405_8248_8967 238
995 3300046681 Ga0495647_0047624 Ga0495647_0047624_201_920 238
996 3300046681 Ga0495647_0119342 Ga0495647_0119342_308_1027 238
997 3300046683 Ga0495658_0000936 Ga0495658_0000936_7886_8605 238
998 3300046684 Ga0495669_0035983 Ga0495669_0035983_621_1340 238
999 3300046684 Ga0495669_0096619 Ga0495669_0096619_415_1134 238
1000 3300046689 Ga0495613_0004828 Ga0495613_0004828_6422_7141 238
1001 3300046690 Ga0495624_0000810 Ga0495624_0000810_7926_8645 238
1002 3300046690 Ga0495624_0116093 Ga0495624_0116093_330_1049 238
1003 3300046691 Ga0495670_0076587 Ga0495670_0076587_363_1082 238
1004 3300046691 Ga0495670_0276454 Ga0495670_0276454_55_774 238
1005 3300046692 Ga0495671_0106338 Ga0495671_0106338_427_1146 238
1006 3300046794 Ga0495589_0092108 Ga0495589_0092108_627_1349 238
1007 3300046809 Ga0495600_0049276 Ga0495600_0049276_953_1672 238
1008 3300047315 Ga0495581_0000683 Ga0495581_0000683_7935_8654 238
1009 3300047317 Ga0495604_0321556 Ga0495604_0321556_21_740 238
1010 3300047318 Ga0495636_0027019 Ga0495636_0027019_267_986 238
1011 3300047320 Ga0495672_0018381 Ga0495672_0018381_1679_2398 238
1012 3300047320 Ga0495672_0091395 Ga0495672_0091395_267_986 238
1013 3300047321 Ga0495676_0005624 Ga0495676_0005624_7532_8251 238
1014 3300047321 Ga0495676_0146325 Ga0495676_0146325_258_977 238
1015 3300047322 Ga0495680_0201624 Ga0495680_0201624_225_944 238
1016 3300047323 Ga0495683_0048443 Ga0495683_0048443_844_1566 238
1017 3300047323 Ga0495683_0068885 Ga0495683_0068885_683_1402 238
1018 3300047323 Ga0495683_0203252 Ga0495683_0203252_56_775 238
1019 3300047445 Ga0495677_0019823 Ga0495677_0019823_1509_2231 238
1020 3300047472 Ga0495686_0139174 Ga0495686_0139174_102_821 238
1021 3300047472 Ga0495686_0174065 Ga0495686_0174065_301_1020 238
1022 3300047673 Ga0495593_0000370 Ga0495593_0000370_7806_8525 238
1023 3300048089 Ga0495614_0067848 Ga0495614_0067848_212_931 238
1024 3300048903 Ga0496100_0059644 Ga0496100_0059644_1345_2064 238
1025 3300048904 Ga0496101_0011788 Ga0496101_0011788_2579_3313 238
1026 3300048905 Ga0496102_0035160 Ga0496102_0035160_2335_3069 238
1027 3300048905 Ga0496102_0039885 Ga0496102_0039885_1926_2645 238
1028 3300048905 Ga0496102_0182086 Ga0496102_0182086_909_1628 238
1029 3300048905 Ga0496102_0296367 Ga0496102_0296367_537_1256 238
1030 3300048905 Ga0496102_0650350 Ga0496102_0650350_28_747 238
1031 3300048906 Ga0496103_0050386 Ga0496103_0050386_330_1064 238
1032 3300048907 Ga0496104_0027452 Ga0496104_0027452_344_1066 238
1033 3300048907 Ga0496104_0046793 Ga0496104_0046793_2510_3244 238
1034 3300048907 Ga0496104_0145388 Ga0496104_0145388_264_983 238
1035 3300048907 Ga0496104_0156640 Ga0496104_0156640_424_1143 238
1036 3300048908 Ga0496105_0492742 Ga0496105_0492742_192_911 238
1037 3300048909 Ga0496106_0010327 Ga0496106_0010327_4218_4952 238
1038 3300048909 Ga0496106_0071909 Ga0496106_0071909_1595_2314 238
1039 3300048909 Ga0496106_0085959 Ga0496106_0085959_1176_1895 238
1040 3300048909 Ga0496106_0399575 Ga0496106_0399575_185_904 238
1041 3300048910 Ga0496107_0010427 Ga0496107_0010427_1883_2617 238
1042 3300048910 Ga0496107_0073394 Ga0496107_0073394_765_1484 238
1043 3300048911 Ga0496108_0029240 Ga0496108_0029240_2693_3409 238
1044 3300048911 Ga0496108_0041613 Ga0496108_0041613_2400_3134 238
1045 3300048911 Ga0496108_0138390 Ga0496108_0138390_326_1045 238
1046 3300048911 Ga0496108_0378606 Ga0496108_0378606_154_873 238
1047 3300048912 Ga0496109_0074114 Ga0496109_0074114_172_906 238
1048 3300048912 Ga0496109_0216868 Ga0496109_0216868_1058_1777 238
1049 3300048913 Ga0496110_0009815 Ga0496110_0009815_6008_6742 238
1050 3300048913 Ga0496110_0035698 Ga0496110_0035698_1624_2343 238
1051 3300048914 Ga0496111_0002060 Ga0496111_0002060_7329_8048 238
1052 3300048915 Ga0496112_0150982 Ga0496112_0150982_457_1176 238
1053 3300048915 Ga0496112_0168267 Ga0496112_0168267_955_1689 238
1054 3300048915 Ga0496112_0242858 Ga0496112_0242858_43_765 238
1055 3300048916 Ga0496113_0005020 Ga0496113_0005020_371_1090 238
1056 3300048916 Ga0496113_0049431 Ga0496113_0049431_2210_2944 238
1057 3300048917 Ga0496114_0002069 Ga0496114_0002069_14196_14930 238
1058 3300048917 Ga0496114_0519902 Ga0496114_0519902_119_838 238
1059 3300048918 Ga0496115_0005035 Ga0496115_0005035_1273_2007 238
1060 3300048918 Ga0496115_0051684 Ga0496115_0051684_319_1038 238
1061 3300048919 Ga0496116_0026977 Ga0496116_0026977_3044_3766 238
1062 3300048921 Ga0496118_0067376 Ga0496118_0067376_1770_2486 238
1063 3300048921 Ga0496118_0243986 Ga0496118_0243986_257_976 238
1064 3300048922 Ga0496119_0140231 Ga0496119_0140231_358_1080 238
1065 3300048924 Ga0496121_0006350 Ga0496121_0006350_6542_7261 238
1066 3300048924 Ga0496121_0018042 Ga0496121_0018042_1736_2455 238
1067 3300048924 Ga0496121_0042560 Ga0496121_0042560_2778_3497 238
1068 3300048924 Ga0496121_0097728 Ga0496121_0097728_494_1213 238
1069 3300048924 Ga0496121_0117532 Ga0496121_0117532_899_1618 238
1070 3300048927 Ga0496124_0068381 Ga0496124_0068381_2128_2847 238
1071 3300048928 Ga0496125_0052528 Ga0496125_0052528_1179_1895 238
1072 3300048928 Ga0496125_0063712 Ga0496125_0063712_1019_1738 238
1073 3300048928 Ga0496125_0071712 Ga0496125_0071712_1528_2247 238
1074 3300048929 Ga0496126_0013134 Ga0496126_0013134_2749_3468 238
1075 3300048929 Ga0496126_0064381 Ga0496126_0064381_849_1568 238
1076 3300048929 Ga0496126_0067186 Ga0496126_0067186_136_852 238
1077 3300049574 Ga0501038_0280696 Ga0501038_0280696_101_820 238
1078 3300049581 Ga0501047_0009703 Ga0501047_0009703_7339_8058 238
1079 3300049585 Ga0501069_0197914 Ga0501069_0197914_316_1035 238
1080 3300050489 nmdc:mga03683_144337_c1 nmdc:mga03683_144337_c1_225_944 238
1081 3300050490 nmdc:mga03n38_989_c1 nmdc:mga03n38_989_c1_3106_3825 238
1082 3300050491 nmdc:mga00v17_171917_c1 nmdc:mga00v17_171917_c1_262_981 238
1083 3300050491 nmdc:mga00v17_407537_c1 nmdc:mga00v17_407537_c1_100_822 238
1084 3300050491 nmdc:mga00v17_51920_c1 nmdc:mga00v17_51920_c1_1488_2207 238
1085 3300050492 nmdc:mga0yw44_143278_c1 nmdc:mga0yw44_143278_c1_375_1094 238
1086 3300050492 nmdc:mga0yw44_20383_c1 nmdc:mga0yw44_20383_c1_358_1077 238
1087 3300050492 nmdc:mga0yw44_24975_c1 nmdc:mga0yw44_24975_c1_1468_2190 238
1088 3300050492 nmdc:mga0yw44_311142_c1 nmdc:mga0yw44_311142_c1_212_931 238
1089 3300050492 nmdc:mga0yw44_331579_c1 nmdc:mga0yw44_331579_c1_273_992 238
1090 3300050493 nmdc:mga0k408_100771_c1 nmdc:mga0k408_100771_c1_318_1037 238
1091 3300050493 nmdc:mga0k408_1944_c1 nmdc:mga0k408_1944_c1_2605_3324 238
1092 3300050493 nmdc:mga0k408_247264_c1 nmdc:mga0k408_247264_c1_269_988 238
1093 3300050493 nmdc:mga0k408_341162_c1 nmdc:mga0k408_341162_c1_14_733 238
1094 3300050494 nmdc:mga06z11_3558_c1 nmdc:mga06z11_3558_c1_2488_3207 238
1095 3300050494 nmdc:mga06z11_47899_c1 nmdc:mga06z11_47899_c1_1168_1887 238
1096 3300050494 nmdc:mga06z11_94031_c1 nmdc:mga06z11_94031_c1_309_1028 238
1097 3300050496 nmdc:mga07m45_115683_c1 nmdc:mga07m45_115683_c1_611_1330 238
1098 3300050496 nmdc:mga07m45_130042_c1 nmdc:mga07m45_130042_c1_70_789 238
1099 3300050496 nmdc:mga07m45_269500_c1 nmdc:mga07m45_269500_c1_65_784 238
1100 3300050496 nmdc:mga07m45_6373_c1 nmdc:mga07m45_6373_c1_69_788 238
1101 3300050508 nmdc:mga09592_656276_c1 nmdc:mga09592_656276_c1_31_750 238
1102 3300050509 nmdc:mga0qj67_354668_c1 nmdc:mga0qj67_354668_c1_318_1037 238
1103 3300050512 nmdc:mga0n895_196917_c1 nmdc:mga0n895_196917_c1_878_1597 238
1104 3300050512 nmdc:mga0n895_243665_c1 nmdc:mga0n895_243665_c1_783_1502 238
1105 3300050512 nmdc:mga0n895_80087_c1 nmdc:mga0n895_80087_c1_1417_2136 238
1106 3300050513 nmdc:mga0rr50_32574_c1 nmdc:mga0rr50_32574_c1_211_930 238
1107 3300050515 nmdc:mga0a205_393136_c1 nmdc:mga0a205_393136_c1_77_796 238
1108 3300050516 nmdc:mga0sz30_102954_c1 nmdc:mga0sz30_102954_c1_60_779 238
1109 3300050516 nmdc:mga0sz30_2977_c1 nmdc:mga0sz30_2977_c1_1080_1799 238
1110 3300050516 nmdc:mga0sz30_98394_c1 nmdc:mga0sz30_98394_c1_95_811 238
1111 3300053077 Ga0495601_0170003 Ga0495601_0170003_315_1034 238
1112 3300053080 Ga0500635_0001720 Ga0500635_0001720_2999_3718 238
1113 3300053085 Ga0495619_0238218 Ga0495619_0238218_58_777 238
1114 3300053086 Ga0500578_0154790 Ga0500578_0154790_81_800 238
1115 3300053089 Ga0500581_145907 Ga0500581_145907_148_867 238
1116 3300053093 Ga0500651_0010771 Ga0500651_0010771_1647_2363 238
1117 3300053093 Ga0500651_0272163 Ga0500651_0272163_205_921 238
1118 3300053094 Ga0500566_0025753 Ga0500566_0025753_1639_2358 238
1119 3300053102 Ga0500554_010606 Ga0500554_010606_43_762 238
1120 3300053103 Ga0500555_049236 Ga0500555_049236_427_1146 238
1121 3300053105 Ga0500557_000128 Ga0500557_000128_7860_8576 238
1122 3300053108 Ga0500562_021788 Ga0500562_021788_372_1091 238
1123 3300053111 Ga0500572_004302 Ga0500572_004302_194_916 238
1124 3300053119 Ga0500595_000095 Ga0500595_000095_53046_53765 238
1125 3300053119 Ga0500595_003348 Ga0500595_003348_636_1355 238
1126 3300053119 Ga0500595_003752 Ga0500595_003752_3499_4215 238
1127 3300053119 Ga0500595_037246 Ga0500595_037246_347_1063 238
1128 3300053119 Ga0500595_046973 Ga0500595_046973_504_1226 238
1129 3300053121 Ga0500607_059315 Ga0500607_059315_151_873 238
1130 3300053130 Ga0500642_0000477 Ga0500642_0000477_7865_8581 238
1131 3300053130 Ga0500642_0061116 Ga0500642_0061116_667_1383 238
1132 3300053136 Ga0500559_0059280 Ga0500559_0059280_693_1412 238
1133 3300053138 Ga0500564_172143 Ga0500564_172143_47_763 238
1134 3300053139 Ga0500568_0027931 Ga0500568_0027931_1226_1945 238
1135 3300053150 Ga0500603_000280 Ga0500603_000280_8606_9325 238
1136 3300053154 Ga0500619_105282 Ga0500619_105282_63_785 238
1137 3300053162 Ga0500638_007811 Ga0500638_007811_1539_2258 238
1138 3300053177 Ga0500636_0001993 Ga0500636_0001993_7946_8668 238
1139 3300053178 Ga0500637_0000653 Ga0500637_0000653_11458_12177 238
1140 3300053178 Ga0500637_0144347 Ga0500637_0144347_539_1261 238
1141 3300053737 Ga0500601_000310 Ga0500601_000310_4167_4889 238
1142 3300055283 Ga0500661_000198 Ga0500661_000198_7550_8269 238
1143 3300061734 Ga0530510_0531238 Ga0530510_0531238_125_847 238
1144 iso_pu_bacteria 2757320392 2757571902 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07729

FCD

FCD domain

89

246

0.99

PF00392

GntR

Bacterial regulatory proteins, gntR family

50

112

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

71

103

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u5q-assembly2.cif.gz_B crystal structure of transcriptional regulator, gntr family, from brucella melitensis 0.951 23 237
7u5q-assembly2.cif.gz_B crystal structure of transcriptional regulator, gntr family, from brucella melitensis 0.9467 23 237
4egz-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orr3 0.9275 24 87
4wwc-assembly1.cif.gz_A crystal structure of full length yvoa in complex with palindromic operator dna 0.9201 25 87
5d4r-assembly1.cif.gz_A crystal structure of arar(dbd) in complex with operator ore1 0.9189 22 87
ID Description Score Start End Superfamily
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9928 22 87 1.10.10.10
af_P0ACM2_11_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9781 22 87 1.10.10.10
2hs5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.972 25 87 1.10.10.10
af_P0ACM2_81_217_1.20.120.530 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);GntR ligand-binding domain-like 0.959 93 227 1.20.120.530
af_Q79G00_16_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 23 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7EVA1-F1-model_v4 GntR family transcriptional regulator 0.999 26 238 GO:0003677
GO:0003700
AF-A0A4Q7EVA1-F1-model_v4 GntR family transcriptional regulator 0.9943 26 238 GO:0003677
GO:0003700
AF-A0A2S8VD96-F1-model_v4 GntR family transcriptional regulator 0.9942 17 238 GO:0003677
GO:0003700
AF-A0A1H7UXU4-F1-model_v4 DNA-binding transcriptional regulator, GntR family 0.9936 17 238 GO:0003677
GO:0003700
AF-A0A7X4KI93-F1-model_v4 FCD domain-containing protein 0.9933 17 238 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
93.1 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map