F490752

General Info

Members Datasets Scaffolds Average Seq Length
1144 590 2288 246

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10076055|Ga0105244_100760552
Length 272
Sequence MRLDAGASPIPLKGKHMEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQPRTRIFGLALAMVTRIMLLLSITWVMRLTDDLFVVLGQGISGRDLILFFGGLFLLWKSSQEIYHGLEGEEENADEPKGSGGKFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIAAIIVAVLVMMACAGTIADFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFAMAFSLAVEAINIRMRTSLARKAGKEHEAVKLRKDVPGQ

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
107 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
177 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
178 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
188 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
193 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
197 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
198 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
202 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
203 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
204 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
205 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
206 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
207 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
208 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
209 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
210 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
211 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
212 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
213 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
216 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
324 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
340 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
341 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
342 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
343 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
344 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
345 2511231006 Pseudomonas sp. GM17 Isolate Nodule
346 2511231007 Pseudomonas sp. GM18 Isolate Nodule
347 2511231008 Pseudomonas sp. GM21 Isolate Nodule
348 2511231010 Pseudomonas sp. GM25 Isolate Nodule
349 2511231011 Pseudomonas sp. GM30 Isolate Nodule
350 2511231012 Pseudomonas sp. GM33 Isolate Nodule
351 2511231014 Pseudomonas sp. GM48 Isolate Nodule
352 2511231015 Pseudomonas sp. GM49 Isolate Nodule
353 2511231016 Pseudomonas sp. GM50 Isolate Nodule
354 2511231017 Pseudomonas sp. GM55 Isolate Nodule
355 2511231019 Pseudomonas sp. GM67 Isolate Nodule
356 2511231020 Pseudomonas sp. GM74 Isolate Nodule
357 2511231021 Pseudomonas sp. GM78 Isolate Nodule
358 2511231022 Pseudomonas sp. GM79 Isolate Nodule
359 2511231023 Pseudomonas sp. GM80 Isolate Nodule
360 2511231024 Pseudomonas sp. GM84 Isolate Nodule
361 2511231031 Pseudomonas sp. GM16 Isolate Nodule
362 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
363 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
364 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
365 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
366 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
367 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
368 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
369 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
370 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
371 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
372 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
373 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
374 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
375 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
376 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
377 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
378 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
379 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
380 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
381 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
382 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
383 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
384 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
385 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
386 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
387 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
388 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
389 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
390 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
391 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
392 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
393 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
394 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
395 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
396 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
397 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
398 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
399 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
400 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
401 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
402 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
403 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
404 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
405 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
406 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
407 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
408 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
409 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
410 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
411 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
412 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
413 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
414 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
415 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
416 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
417 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
418 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
419 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
420 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
421 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
422 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
423 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
424 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
425 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
426 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
427 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
428 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
429 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
430 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
431 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
432 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
433 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
434 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
435 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
436 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
437 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
438 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
439 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
440 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
441 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
442 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
443 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
444 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
445 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
446 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
447 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
448 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
449 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
450 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
451 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
452 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
453 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
454 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
455 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
456 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
457 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
458 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
459 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
460 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
461 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
462 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
463 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
464 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
465 2765235841 Pseudomonas putida AA7 Isolate Unclassified
466 2773857670 Pseudomonas sp. 478 Isolate Unclassified
467 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
468 2773857673 Pseudomonas sp. 443 Isolate Unclassified
469 2784132063 Pseudomonas sp. 424 Isolate Unclassified
470 2784132072 Pseudomonas sp. 460 Isolate Unclassified
471 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
472 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
473 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
474 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
475 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
476 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
477 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
478 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
479 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
480 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
481 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
482 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
483 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
484 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
485 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
486 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
487 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
488 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
489 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
490 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
491 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
492 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
493 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
494 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
495 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
496 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
497 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
498 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
499 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
500 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
501 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
502 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
503 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
504 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
505 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
506 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
507 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
508 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
509 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
510 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
511 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
512 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
513 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
514 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
515 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
516 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
517 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
518 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
519 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
520 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
521 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
522 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
523 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
524 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
525 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
526 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
527 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
528 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
529 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
530 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
531 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
532 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
533 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
534 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
535 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
536 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
537 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
538 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
539 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
540 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
541 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
542 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
543 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
544 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
545 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
546 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
547 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
548 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
549 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
550 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
551 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
552 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
553 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
554 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
555 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
556 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
557 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
558 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
559 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
560 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
561 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
562 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
563 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
564 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
565 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
566 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
567 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
568 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
569 8052494512 Pseudomonas putida LD6 Isolate Unclassified
570 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
571 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
572 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
573 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
574 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
575 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
576 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
577 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
578 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
579 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
580 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
581 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
582 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
583 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
584 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
585 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
586 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
587 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
588 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
589 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
590 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.19
Metatranscriptomes 0
Isolates 22.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 6.47
Nodule 2.62
Rhizoplane 6.73
Rhizosphere 70.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10076055 3300009036 Bacteria 1668
2 MRS2a_Contig_6737 2124908027 Bacteria 2198
3 MRS2a_Contig_799 2124908027 Bacteria 11033
4 SwRhRL2b_contig_803191 2162886007 Bacteria 11283
5 JGI24741J21665_1000755 3300001915 Bacteria 9721
6 JGI24750J21931_1025787 3300002070 Bacteria 844
7 JGI25155J39150_1000041 3300002704 Bacteria 88843
8 JGI25156J39149_1000031 3300002705 Bacteria 124983
9 JGI25162J39368_1000208 3300002737 Bacteria 62041
10 JGI25162J39368_1000459 3300002737 Bacteria 31876
11 JGI25154J39366_1000049 3300002738 Bacteria 124995
12 JGI25157J39369_1000041 3300002741 Bacteria 124982
13 JGI25163J39215_1000407 3300002771 Bacteria 13526
14 JGI25163J39215_1000589 3300002771 Bacteria 10199
15 JGI25164J39214_1000297 3300002772 Bacteria 34174
16 JGI25164J39214_1000314 3300002772 Bacteria 31880
17 JGI25165J46597_1000175 3300003214 Bacteria 100117
18 JGI25165J46597_1000193 3300003214 Bacteria 91069
19 rootH1_10017529 3300003316 Bacteria 6372
20 rootH2_10016165 3300003320 Bacteria 8851
21 rootL2_10030466 3300003322 Bacteria 6394
22 rootL2_10110202 3300003322 Bacteria 2659
23 Ga0055538_1000012 3300003751 Bacteria 353826
24 Ga0055539_1000017 3300003752 Bacteria 353873
25 Ga0055533_1000021 3300003756 Bacteria 353826
26 Ga0055532_1000020 3300003758 Bacteria 270853
27 Ga0055525_1000117 3300003759 Bacteria 120690
28 Ga0055535_1004800 3300003761 Bacteria 3160
29 Ga0055536_1000272 3300003781 Bacteria 39323
30 Ga0055536_1003957 3300003781 Bacteria 7765
31 Ga0055536_1008918 3300003781 Bacteria 4233
32 Ga0055536_1029466 3300003781 Bacteria 1474
33 Ga0055530_10000081 3300003791 Bacteria 82192
34 Ga0055530_10000548 3300003791 Bacteria 32545
35 Ga0055530_10002934 3300003791 Bacteria 10326
36 Ga0055530_10009440 3300003791 Bacteria 3748
37 Ga0055540_1000121 3300003792 Bacteria 82192
38 Ga0055540_1000242 3300003792 Bacteria 49989
39 Ga0055540_1001116 3300003792 Bacteria 16913
40 Ga0055540_1032823 3300003792 Bacteria 1181
41 Ga0055531_10001033 3300003794 Bacteria 22056
42 Ga0055541_1000012 3300003841 Bacteria 353826
43 Ga0058692_1008307 3300003856 Bacteria 2683
44 Ga0065714_10002860 3300005288 Bacteria 11454
45 Ga0065714_10003342 3300005288 Bacteria 7781
46 Ga0065714_10005964 3300005288 Bacteria 4038
47 Ga0065714_10021354 3300005288 Bacteria 2008
48 Ga0065714_10064636 3300005288 Bacteria 26785
49 Ga0065714_10107372 3300005288 Bacteria 1532
50 Ga0065704_10001959 3300005289 Bacteria 9751
51 Ga0065704_10009110 3300005289 Bacteria 5158
52 Ga0065704_10070543 3300005289 Bacteria 21104
53 Ga0065704_10071119 3300005289 Bacteria 13035
54 Ga0065704_10121284 3300005289 Bacteria 1768
55 Ga0065712_10001109 3300005290 Bacteria 11350
56 Ga0065712_10068500 3300005290 Bacteria 10228
57 Ga0065712_10074016 3300005290 Bacteria 4210
58 Ga0065715_10013766 3300005293 Bacteria 3460
59 Ga0070670_100000010 3300005331 Bacteria 277365
60 Ga0070670_100003035 3300005331 Bacteria 13890
61 Ga0068869_100084556 3300005334 Bacteria 2375
62 Ga0070691_10142847 3300005341 Bacteria 1221
63 Ga0070661_100000237 3300005344 Bacteria 45515
64 Ga0070661_100293685 3300005344 Bacteria 1264
65 Ga0070669_100000158 3300005353 Bacteria 61318
66 Ga0070669_100000277 3300005353 Bacteria 41213
67 Ga0070669_100002451 3300005353 Bacteria 13426
68 Ga0070669_100035538 3300005353 Bacteria 3611
69 Ga0070675_100017974 3300005354 Bacteria 5627
70 Ga0070671_100000012 3300005355 Bacteria 196420
71 Ga0070674_100037246 3300005356 Bacteria 3270
72 Ga0070688_100002333 3300005365 Bacteria 9573
73 Ga0070659_100407812 3300005366 Bacteria 1148
74 Ga0070667_100000097 3300005367 Bacteria 108709
75 Ga0070700_100014372 3300005441 Bacteria 4469
76 Ga0070700_100062768 3300005441 Bacteria 2348
77 Ga0070662_100000063 3300005457 Bacteria 57210
78 Ga0070662_100087854 3300005457 Bacteria 2328
79 Ga0068867_100000146 3300005459 Bacteria 45501
80 Ga0070685_10000077 3300005466 Bacteria 58856
81 Ga0070697_100147240 3300005536 Bacteria 1983
82 Ga0068853_100000143 3300005539 Bacteria 48815
83 Ga0070672_100398226 3300005543 Bacteria 1180
84 Ga0070686_100158990 3300005544 Bacteria 1590
85 Ga0070665_100078702 3300005548 Bacteria 3303
86 Ga0070665_100089367 3300005548 Bacteria 3086
87 Ga0070665_100509061 3300005548 Bacteria 1215
88 Ga0068857_100627854 3300005577 Bacteria 1017
89 Ga0068854_100004725 3300005578 Bacteria 8585
90 Ga0068852_100187387 3300005616 Bacteria 1949
91 Ga0068859_100014469 3300005617 Bacteria 7920
92 Ga0068859_100404284 3300005617 Bacteria 1461
93 Ga0068864_100000018 3300005618 Bacteria 277365
94 Ga0068861_100001394 3300005719 Bacteria 15177
95 Ga0068861_100059167 3300005719 Bacteria 2932
96 Ga0068861_100188902 3300005719 Bacteria 1721
97 Ga0068851_10000018 3300005834 Bacteria 137425
98 Ga0068863_100162161 3300005841 Bacteria 2142
99 Ga0068863_100263895 3300005841 Bacteria 1665
100 Ga0068858_100024458 3300005842 Bacteria 5627
101 Ga0068858_100155276 3300005842 Bacteria 2153
102 Ga0068860_100000532 3300005843 Bacteria 46509
103 Ga0068862_100000522 3300005844 Bacteria 40581
104 Ga0068862_100136925 3300005844 Bacteria 2171
105 Ga0075364_10031476 3300006051 Bacteria 3409
106 Ga0075364_10113138 3300006051 Bacteria 1812
107 Ga0075432_10000648 3300006058 Bacteria 10657
108 Ga0070712_100201381 3300006175 Bacteria 1564
109 Ga0075362_10066213 3300006177 Bacteria 1641
110 Ga0075362_10072007 3300006177 Bacteria 1580
111 Ga0075369_10045588 3300006186 Bacteria 1885
112 Ga0097621_100081003 3300006237 Bacteria 2701
113 Ga0068871_100141867 3300006358 Bacteria 2043
114 Ga0075428_100214665 3300006844 Bacteria 2079
115 Ga0068865_100003939 3300006881 Bacteria 8916
116 Ga0075436_100050318 3300006914 Bacteria 2875
117 Ga0097620_100014468 3300006931 Bacteria 7920
118 Ga0097620_100404267 3300006931 Bacteria 1461
119 Ga0099823_1000217 3300006944 Bacteria 32286
120 Ga0079104_1000291 3300006946 Bacteria 63569
121 Ga0079104_1000306 3300006946 Bacteria 62131
122 Ga0099826_10012980 3300006948 Bacteria 6281
123 Ga0105251_10000068 3300009011 Bacteria 98955
124 Ga0105251_10000881 3300009011 Bacteria 26861
125 Ga0105251_10002062 3300009011 Bacteria 16229
126 Ga0105251_10004312 3300009011 Bacteria 9752
127 Ga0105251_10007262 3300009011 Bacteria 6870
128 Ga0105251_10071828 3300009011 Bacteria 1610
129 Ga0105244_10000726 3300009036 Bacteria 28455
130 Ga0105244_10001163 3300009036 Bacteria 21788
131 Ga0105244_10001870 3300009036 Bacteria 16359
132 Ga0105244_10004378 3300009036 Bacteria 9736
133 Ga0105244_10005309 3300009036 Bacteria 8578
134 Ga0105244_10007469 3300009036 Bacteria 6945
135 Ga0105244_10011847 3300009036 Bacteria 5197
136 Ga0105244_10030106 3300009036 Bacteria 2891
137 Ga0105244_10030745 3300009036 Bacteria 2854
138 Ga0105244_10072164 3300009036 Bacteria 1720
139 Ga0105244_10132417 3300009036 Bacteria 1203
140 Ga0105250_10000825 3300009092 Bacteria 18449
141 Ga0105250_10022663 3300009092 Bacteria 2530
142 Ga0105250_10023442 3300009092 Bacteria 2486
143 Ga0105250_10031572 3300009092 Bacteria 2126
144 Ga0105250_10037205 3300009092 Bacteria 1953
145 Ga0105250_10038529 3300009092 Bacteria 1916
146 Ga0105250_10056987 3300009092 Bacteria 1568
147 Ga0111539_10096618 3300009094 Bacteria 3470
148 Ga0111539_10935004 3300009094 Bacteria 1008
149 Ga0114129_10289749 3300009147 Bacteria 2185
150 Ga0105243_10000075 3300009148 Bacteria 112098
151 Ga0105243_10000867 3300009148 Bacteria 28621
152 Ga0105243_10001447 3300009148 Bacteria 20865
153 Ga0105243_10010141 3300009148 Bacteria 7164
154 Ga0105243_10097512 3300009148 Bacteria 2433
155 Ga0105241_10398380 3300009174 Bacteria 1207
156 Ga0105242_10000358 3300009176 Bacteria 36515
157 Ga0105242_10090188 3300009176 Bacteria 2578
158 Ga0105242_10214496 3300009176 Bacteria 1717
159 Ga0105248_10019408 3300009177 Bacteria 7522
160 Ga0105248_10123998 3300009177 Bacteria 2914
161 Ga0105249_10093807 3300009553 Bacteria 2812
162 Ga0105249_10152357 3300009553 Bacteria 2227
163 Ga0105239_10087107 3300010375 Bacteria 3442
164 Ga0105246_10000002 3300011119 Bacteria 103711
165 Ga0105246_10000504 3300011119 Bacteria 21247
166 Ga0105246_10010894 3300011119 Bacteria 5636
167 Ga0157373_10003814 3300013100 Bacteria 11399
168 Ga0157373_10006597 3300013100 Bacteria 8656
169 Ga0157373_10023762 3300013100 Bacteria 4441
170 Ga0157373_10051866 3300013100 Bacteria 2920
171 Ga0157373_10094446 3300013100 Bacteria 2106
172 Ga0157371_10000935 3300013102 Bacteria 32661
173 Ga0157371_10000953 3300013102 Bacteria 32196
174 Ga0157371_10002539 3300013102 Bacteria 17337
175 Ga0157371_10076619 3300013102 Bacteria 2368
176 Ga0157370_10000698 3300013104 Bacteria 41998
177 Ga0157370_10000954 3300013104 Bacteria 36668
178 Ga0157370_10002312 3300013104 Bacteria 23072
179 Ga0157370_10186706 3300013104 Bacteria 1924
180 Ga0157369_10023081 3300013105 Bacteria 6932
181 Ga0157369_10521216 3300013105 Bacteria 1229
182 Ga0157378_10002415 3300013297 Bacteria 16605
183 Ga0157378_10024025 3300013297 Bacteria 5362
184 Ga0163162_10017052 3300013306 Bacteria 7106
185 Ga0163162_10079724 3300013306 Bacteria 3340
186 Ga0163162_10224194 3300013306 Bacteria 2009
187 Ga0157372_10013753 3300013307 Bacteria 8648
188 Ga0157372_10052807 3300013307 Bacteria 4527
189 Ga0163163_10001112 3300014325 Bacteria 22859
190 Ga0163163_10101543 3300014325 Bacteria 2899
191 Ga0157380_10272904 3300014326 Bacteria 1543
192 Ga0182008_10001337 3300014497 Bacteria 16791
193 Ga0182008_10003405 3300014497 Bacteria 9609
194 Ga0157379_10054053 3300014968 Bacteria 3588
195 Ga0157376_10100048 3300014969 Bacteria 2531
196 Ga0157376_10136874 3300014969 Bacteria 2193
197 Ga0182006_1001380 3300015261 Bacteria 14787
198 Ga0182006_1002154 3300015261 Bacteria 10922
199 Ga0182006_1003537 3300015261 Bacteria 7969
200 Ga0182006_1008824 3300015261 Bacteria 4554
201 Ga0182007_10000228 3300015262 Bacteria 37784
202 Ga0182005_1000375 3300015265 Bacteria 24704
203 Ga0182005_1000663 3300015265 Bacteria 16296
204 Ga0182005_1018031 3300015265 Bacteria 1952
205 Ga0163161_10050909 3300017792 Bacteria 2998
206 Ga0163161_10097813 3300017792 Bacteria 2180
207 Ga0163161_10173254 3300017792 Bacteria 1651
208 Ga0163161_10287792 3300017792 Bacteria 1291
209 Ga0163161_10339170 3300017792 Bacteria 1192
210 Ga0213876_10008910 3300021384 Bacteria 5412
211 Ga0209435_100014 3300025206 Bacteria 322129
212 Ga0209435_100533 3300025206 Bacteria 7315
213 Ga0209760_100082 3300025207 Bacteria 76168
214 Ga0209760_100230 3300025207 Bacteria 23968
215 Ga0209784_100007 3300025224 Bacteria 747715
216 Ga0209566_100009 3300025225 Bacteria 554018
217 Ga0209674_100021 3300025226 Bacteria 629811
218 Ga0209147_100009 3300025229 Bacteria 747409
219 Ga0209563_100018 3300025230 Bacteria 747850
220 Ga0209563_101660 3300025230 Bacteria 5677
221 Ga0207427_100005 3300025231 Bacteria 797999
222 Ga0207427_100006 3300025231 Bacteria 785415
223 Ga0209437_100013 3300025233 Bacteria 785457
224 Ga0209437_100018 3300025233 Bacteria 694400
225 Ga0209437_109161 3300025233 Bacteria 1556
226 Ga0209258_100237 3300025242 Bacteria 102220
227 Ga0209646_1000001 3300025246 Bacteria 3092932
228 Ga0209646_1000277 3300025246 Bacteria 45368
229 Ga0209026_1000073 3300025250 Bacteria 205399
230 Ga0209677_100012 3300025253 Bacteria 554018
231 Ga0209759_1000013 3300025256 Bacteria 399300
232 Ga0209759_1007431 3300025256 Bacteria 3523
233 Ga0209759_1018453 3300025256 Bacteria 1684
234 Ga0209233_1000021 3300025261 Bacteria 798078
235 Ga0209233_1000022 3300025261 Bacteria 785415
236 Ga0209676_1000015 3300025292 Bacteria 784458
237 Ga0209676_1000157 3300025292 Bacteria 163094
238 Ga0209676_1000222 3300025292 Bacteria 124695
239 Ga0209676_1000583 3300025292 Bacteria 54696
240 Ga0209676_1002274 3300025292 Bacteria 14109
241 Ga0209676_1002823 3300025292 Bacteria 11488
242 Ga0209676_1004012 3300025292 Bacteria 8476
243 Ga0209050_1000030 3300025298 Bacteria 463381
244 Ga0209050_1000061 3300025298 Bacteria 321435
245 Ga0209050_1000296 3300025298 Bacteria 104732
246 Ga0209050_1000318 3300025298 Bacteria 97317
247 Ga0209050_1001114 3300025298 Bacteria 32494
248 Ga0209051_1000088 3300025303 Bacteria 180480
249 Ga0209051_1000143 3300025303 Bacteria 135182
250 Ga0209051_1000295 3300025303 Bacteria 79621
251 Ga0209051_1004120 3300025303 Bacteria 9105
252 Ga0209051_1005691 3300025303 Bacteria 7196
253 Ga0209257_1000143 3300025304 Bacteria 199975
254 Ga0209257_1011914 3300025304 Bacteria 4103
255 Ga0207656_10000009 3300025321 Bacteria 245637
256 Ga0207696_1000055 3300025711 Bacteria 258289
257 Ga0207696_1000151 3300025711 Bacteria 120171
258 Ga0207696_1000165 3300025711 Bacteria 104683
259 Ga0207696_1003300 3300025711 Bacteria 7439
260 Ga0207696_1007367 3300025711 Bacteria 4315
261 Ga0207696_1015831 3300025711 Bacteria 2543
262 Ga0207696_1024677 3300025711 Bacteria 1882
263 Ga0207696_1028968 3300025711 Bacteria 1694
264 Ga0207655_1000135 3300025728 Bacteria 143597
265 Ga0207655_1000548 3300025728 Bacteria 47302
266 Ga0207655_1000667 3300025728 Bacteria 40487
267 Ga0207655_1000754 3300025728 Bacteria 36294
268 Ga0207655_1001254 3300025728 Bacteria 24214
269 Ga0207655_1001422 3300025728 Bacteria 22200
270 Ga0207655_1001733 3300025728 Bacteria 19145
271 Ga0207655_1002247 3300025728 Bacteria 15981
272 Ga0207655_1004181 3300025728 Bacteria 10359
273 Ga0207655_1004957 3300025728 Bacteria 9227
274 Ga0207655_1006266 3300025728 Bacteria 7910
275 Ga0207655_1008704 3300025728 Bacteria 6400
276 Ga0207655_1008902 3300025728 Bacteria 6305
277 Ga0207655_1009242 3300025728 Bacteria 6146
278 Ga0207655_1018736 3300025728 Bacteria 3655
279 Ga0207655_1026577 3300025728 Bacteria 2777
280 Ga0207655_1036871 3300025728 Bacteria 2162
281 Ga0207655_1038021 3300025728 Bacteria 2110
282 Ga0207655_1087014 3300025728 Bacteria 1110
283 Ga0207713_1000103 3300025735 Bacteria 138415
284 Ga0207713_1000325 3300025735 Bacteria 53895
285 Ga0207713_1003599 3300025735 Bacteria 10444
286 Ga0207713_1003772 3300025735 Bacteria 10160
287 Ga0207713_1004686 3300025735 Bacteria 8816
288 Ga0207713_1006272 3300025735 Bacteria 7272
289 Ga0207713_1006916 3300025735 Bacteria 6813
290 Ga0207713_1010743 3300025735 Bacteria 5043
291 Ga0207713_1016458 3300025735 Bacteria 3751
292 Ga0207713_1020322 3300025735 Bacteria 3221
293 Ga0207713_1022973 3300025735 Bacteria 2947
294 Ga0207713_1041073 3300025735 Bacteria 1933
295 Ga0207713_1048900 3300025735 Bacteria 1700
296 Ga0207713_1050375 3300025735 Bacteria 1663
297 Ga0207710_10008242 3300025900 Bacteria 4400
298 Ga0207671_10000876 3300025914 Bacteria 38121
299 Ga0207693_10121721 3300025915 Bacteria 2049
300 Ga0207662_10236760 3300025918 Bacteria 1194
301 Ga0207649_10000007 3300025920 Bacteria 334217
302 Ga0207681_10000291 3300025923 Bacteria 37201
303 Ga0207681_10006732 3300025923 Bacteria 7052
304 Ga0207650_10000003 3300025925 Bacteria 1123235
305 Ga0207650_10000308 3300025925 Bacteria 48275
306 Ga0207650_10000407 3300025925 Bacteria 38580
307 Ga0207659_10033931 3300025926 Bacteria 3516
308 Ga0207644_10001111 3300025931 Bacteria 17279
309 Ga0207690_10391921 3300025932 Bacteria 1106
310 Ga0207706_10000050 3300025933 Bacteria 116811
311 Ga0207706_10011123 3300025933 Bacteria 8201
312 Ga0207686_10001347 3300025934 Bacteria 13985
313 Ga0207686_10388387 3300025934 Bacteria 1060
314 Ga0207709_10000107 3300025935 Bacteria 129240
315 Ga0207709_10001047 3300025935 Bacteria 20429
316 Ga0207709_10002479 3300025935 Bacteria 11568
317 Ga0207709_10009947 3300025935 Bacteria 5238
318 Ga0207709_10066438 3300025935 Bacteria 2271
319 Ga0207709_10136564 3300025935 Bacteria 1680
320 Ga0207709_10544924 3300025935 Bacteria 912
321 Ga0207670_10171133 3300025936 Bacteria 1629
322 Ga0207670_10507585 3300025936 Bacteria 980
323 Ga0207669_10062361 3300025937 Bacteria 2296
324 Ga0207704_10066450 3300025938 Bacteria 2263
325 Ga0207691_10114481 3300025940 Bacteria 2396
326 Ga0207711_10002049 3300025941 Bacteria 18226
327 Ga0207711_10013160 3300025941 Bacteria 6872
328 Ga0207711_10391003 3300025941 Bacteria 1291
329 Ga0207689_10150576 3300025942 Bacteria 1918
330 Ga0207679_10000013 3300025945 Bacteria 334197
331 Ga0207712_10009817 3300025961 Bacteria 6065
332 Ga0207712_10025348 3300025961 Bacteria 3939
333 Ga0207712_10033258 3300025961 Bacteria 3484
334 Ga0207640_10008153 3300025981 Bacteria 5804
335 Ga0207658_10000007 3300025986 Bacteria 329651
336 Ga0207639_10000079 3300026041 Bacteria 83859
337 Ga0207678_10710562 3300026067 Bacteria 885
338 Ga0207708_10006713 3300026075 Bacteria 8513
339 Ga0207708_10023107 3300026075 Bacteria 4697
340 Ga0207641_10094982 3300026088 Bacteria 2615
341 Ga0207648_10000425 3300026089 Bacteria 46432
342 Ga0207648_10045457 3300026089 Bacteria 3851
343 Ga0207676_10000003 3300026095 Bacteria 1123235
344 Ga0207676_10186858 3300026095 Bacteria 1820
345 Ga0207675_100007239 3300026118 Bacteria 10486
346 Ga0207675_100117779 3300026118 Bacteria 2511
347 Ga0207675_100267215 3300026118 Bacteria 1659
348 Ga0207698_10387053 3300026142 Bacteria 1332
349 Ga0209281_1000091 3300027111 Bacteria 242588
350 Ga0209281_1000237 3300027111 Bacteria 112688
351 Ga0209281_1020632 3300027111 Bacteria 1285
352 Ga0209389_1000065 3300027296 Bacteria 102064
353 Ga0209371_1000176 3300027312 Bacteria 95739
354 Ga0209371_1000929 3300027312 Bacteria 22972
355 Ga0209371_1010153 3300027312 Bacteria 2924
356 Ga0209996_1002016 3300027395 Bacteria 2504
357 Ga0209995_1004740 3300027471 Bacteria 2184
358 Ga0209968_1004678 3300027526 Bacteria 2052
359 Ga0210002_1006695 3300027617 Bacteria 1740
360 Ga0209983_1001053 3300027665 Bacteria 6080
361 Ga0209282_1042131 3300027666 Bacteria 2697
362 Ga0209974_10007890 3300027876 Bacteria 3653
363 Ga0209974_10026535 3300027876 Bacteria 1917
364 Ga0209974_10057638 3300027876 Bacteria 1312
365 Ga0207428_10042514 3300027907 Bacteria 3675
366 Ga0207428_10051774 3300027907 Bacteria 3281
367 Ga0207428_10238084 3300027907 Bacteria 1361
368 Ga0207428_10299703 3300027907 Bacteria 1190
369 Ga0268266_10002796 3300028379 Bacteria 18197
370 Ga0268266_10041478 3300028379 Bacteria 3927
371 Ga0268266_10136768 3300028379 Bacteria 2195
372 Ga0268265_10000234 3300028380 Bacteria 63478
373 Ga0268264_10000009 3300028381 Bacteria 724972
374 Ga0268256_1000146 3300030500 Bacteria 95753
375 Ga0268256_1000782 3300030500 Bacteria 22972
376 Ga0268256_1009906 3300030500 Bacteria 3124
377 Ga0307511_10008829 3300030521 Bacteria 10062
378 Ga0314311_1174000 3300030733 Bacteria 8214
379 Ga0316183_1099209 3300030742 Bacteria 952
380 Ga0316183_1101138 3300030742 Bacteria 1106
381 Ga0316181_1016487 3300030744 Bacteria 1345
382 Ga0316181_1111959 3300030744 Bacteria 4733
383 Ga0307513_10007959 3300031456 Bacteria 13638
384 Ga0307509_10107120 3300031507 Bacteria 2812
385 Ga0307509_10114588 3300031507 Bacteria 2690
386 Ga0307516_10345550 3300031730 Bacteria 1154
387 Ga0307416_101118720 3300032002 Bacteria 892
388 Ga0307414_10197381 3300032004 Bacteria 1634
389 Ga0307414_10422723 3300032004 Bacteria 1162
390 Ga0395899_0000478 3300037312 Bacteria 44762
391 Ga0395905_0006602 3300037471 Bacteria 11641
392 Ga0436365_1689934 3300039437 Bacteria 6213
393 Ga0439436_0002017 3300041404 Bacteria 6034
394 Ga0439436_0008011 3300041404 Bacteria 3245
395 Ga0439438_000775 3300041405 Bacteria 14291
396 Ga0439438_005624 3300041405 Bacteria 4572
397 Ga0439438_012464 3300041405 Bacteria 2606
398 Ga0439439_0002322 3300041406 Bacteria 4021
399 Ga0439447_002739 3300041407 Bacteria 6366
400 Ga0439447_013680 3300041407 Bacteria 2296
401 Ga0439447_019637 3300041407 Bacteria 1799
402 Ga0439447_029111 3300041407 Bacteria 1400
403 Ga0439466_0000289 3300041411 Bacteria 19586
404 Ga0439466_0001121 3300041411 Bacteria 10407
405 Ga0439466_0001334 3300041411 Bacteria 9623
406 Ga0439466_0002385 3300041411 Bacteria 7367
407 Ga0439466_0004035 3300041411 Bacteria 5667
408 Ga0439466_0021199 3300041411 Bacteria 2307
409 Ga0439466_0025436 3300041411 Bacteria 2066
410 Ga0439437_000536 3300042000 Bacteria 3771
411 Ga0439442_008500 3300042002 Bacteria 2073
412 Ga0439432_001586 3300042006 Bacteria 8503
413 Ga0439432_001810 3300042006 Bacteria 8017
414 Ga0439432_002251 3300042006 Bacteria 7284
415 Ga0439432_014726 3300042006 Bacteria 2645
416 Ga0439432_031069 3300042006 Bacteria 1728
417 Ga0439432_066039 3300042006 Bacteria 1108
418 Ga0439449_0010779 3300042007 Bacteria 3449
419 Ga0439451_000786 3300042009 Bacteria 6047
420 Ga0439451_002140 3300042009 Bacteria 3965
421 Ga0439452_000190 3300042010 Bacteria 45505
422 Ga0439452_000443 3300042010 Bacteria 23463
423 Ga0439452_001993 3300042010 Bacteria 7819
424 Ga0439452_001995 3300042010 Bacteria 7813
425 Ga0439452_003249 3300042010 Bacteria 5743
426 Ga0439452_008676 3300042010 Bacteria 3041
427 Ga0439452_010013 3300042010 Bacteria 2773
428 Ga0439456_000036 3300042013 Bacteria 49413
429 Ga0439456_000406 3300042013 Bacteria 9644
430 Ga0439456_000462 3300042013 Bacteria 8887
431 Ga0439456_005910 3300042013 Bacteria 2490
432 Ga0439462_0007982 3300042015 Bacteria 2661
433 Ga0439463_000120 3300042016 Bacteria 19571
434 Ga0439463_000491 3300042016 Bacteria 11038
435 Ga0439463_001245 3300042016 Bacteria 6807
436 Ga0450911_000011 3300042115 Bacteria 130739
437 Ga0450911_000019 3300042115 Bacteria 103441
438 Ga0450911_000211 3300042115 Bacteria 22807
439 Ga0450911_000509 3300042115 Bacteria 12334
440 Ga0450911_004119 3300042115 Bacteria 2428
441 Ga0450914_000201 3300042118 Bacteria 2259
442 Ga0450919_003455 3300042121 Bacteria 1976
443 Ga0450922_001769 3300042124 Bacteria 2087
444 Ga0450890_000131 3300042127 Bacteria 11737
445 Ga0450894_003690 3300042131 Bacteria 2001
446 Ga0450902_001841 3300042137 Bacteria 2943
447 Ga0450903_000620 3300042138 Bacteria 7178
448 Ga0450904_000097 3300042139 Bacteria 19742
449 Ga0450905_000157 3300042142 Bacteria 7279
450 Ga0450906_006046 3300042145 Bacteria 2458
451 Ga0450907_000110 3300042146 Bacteria 31083
452 Ga0450907_003387 3300042146 Bacteria 2851
453 Ga0450910_002043 3300042147 Bacteria 2623
454 Ga0439446_0000463 3300042156 Bacteria 8050
455 Ga0439446_0002388 3300042156 Bacteria 4501
456 Ga0439446_0002934 3300042156 Bacteria 4165
457 Ga0439446_0003376 3300042156 Bacteria 3955
458 Ga0439446_0004933 3300042156 Bacteria 3410
459 Ga0450908_005890 3300042184 Bacteria 2341
460 Ga0450909_004626 3300042185 Bacteria 1967
461 Ga0450909_011498 3300042185 Bacteria 1297
462 Ga0439434_0000092 3300042435 Bacteria 22644
463 Ga0439434_0000184 3300042435 Bacteria 17025
464 Ga0439464_0040131 3300042439 Bacteria 1332
465 Ga0439460_0000002 3300042461 Bacteria 48212
466 Ga0439460_0001270 3300042461 Bacteria 5936
467 Ga0439460_0009852 3300042461 Bacteria 2434
468 Ga0439460_0018324 3300042461 Bacteria 1884
469 Ga0450916_000505 3300042530 Bacteria 3421
470 Ga0450918_008576 3300042531 Bacteria 1796
471 Ga0450901_000463 3300042533 Bacteria 4831
472 Ga0451577_0277040 3300042876 Bacteria 1519
473 Ga0439440_0005351 3300042993 Bacteria 2548
474 Ga0466965_0064128 3300044683 Bacteria 1839
475 Ga0466964_0008174 3300044706 Bacteria 3927
476 Ga0453684_0014934 3300044712 Bacteria 12346
477 Ga0453684_0017471 3300044712 Bacteria 11109
478 Ga0453684_0040463 3300044712 Bacteria 6328
479 Ga0466968_0005006 3300044735 Bacteria 4964
480 Ga0451576_0059657 3300045051 Bacteria 3982
481 Ga0495617_001787 3300046452 Bacteria 9175
482 Ga0495617_012651 3300046452 Bacteria 2877
483 Ga0495617_024999 3300046452 Bacteria 2014
484 Ga0495627_000095 3300046453 Bacteria 108094
485 Ga0495627_000646 3300046453 Bacteria 27194
486 Ga0495627_000869 3300046453 Bacteria 21472
487 Ga0495627_010851 3300046453 Bacteria 3293
488 Ga0495627_039198 3300046453 Bacteria 1462
489 Ga0495603_0001944 3300046455 Bacteria 12181
490 Ga0495603_0161761 3300046455 Bacteria 1298
491 Ga0495590_0002659 3300046457 Bacteria 7383
492 Ga0495590_0007106 3300046457 Bacteria 4333
493 Ga0495591_000198 3300046458 Bacteria 61546
494 Ga0495591_000334 3300046458 Bacteria 42109
495 Ga0495591_000628 3300046458 Bacteria 26285
496 Ga0495591_002016 3300046458 Bacteria 11817
497 Ga0495591_002668 3300046458 Bacteria 9711
498 Ga0495591_010984 3300046458 Bacteria 3459
499 Ga0495591_017440 3300046458 Bacteria 2465
500 Ga0495591_020022 3300046458 Bacteria 2223
501 Ga0495591_020266 3300046458 Bacteria 2201
502 Ga0495591_025531 3300046458 Bacteria 1851
503 Ga0495591_027139 3300046458 Bacteria 1769
504 Ga0495629_0083415 3300046459 Bacteria 2230
505 Ga0495638_0011328 3300046460 Bacteria 6145
506 Ga0495638_0011519 3300046460 Bacteria 6090
507 Ga0495638_0019536 3300046460 Bacteria 4483
508 Ga0495638_0057233 3300046460 Bacteria 2418
509 Ga0495638_0060978 3300046460 Bacteria 2331
510 Ga0495653_0005962 3300046463 Bacteria 9975
511 Ga0495653_0006872 3300046463 Bacteria 9349
512 Ga0495653_0147285 3300046463 Bacteria 1648
513 Ga0495650_0001617 3300046471 Bacteria 21024
514 Ga0495650_0003976 3300046471 Bacteria 10390
515 Ga0495650_0004680 3300046471 Bacteria 9239
516 Ga0495650_0008792 3300046471 Bacteria 5838
517 Ga0495650_0048726 3300046471 Bacteria 1763
518 Ga0495650_0076954 3300046471 Bacteria 1295
519 Ga0495582_0000456 3300046473 Bacteria 22343
520 Ga0495605_0000019 3300046474 Bacteria 270010
521 Ga0495605_0000376 3300046474 Bacteria 42124
522 Ga0495605_0000387 3300046474 Bacteria 40707
523 Ga0495605_0000664 3300046474 Bacteria 26130
524 Ga0495605_0001221 3300046474 Bacteria 17091
525 Ga0495605_0002242 3300046474 Bacteria 12068
526 Ga0495605_0007209 3300046474 Bacteria 6323
527 Ga0495605_0171991 3300046474 Bacteria 956
528 Ga0495639_0000295 3300046475 Bacteria 24407
529 Ga0495584_0000408 3300046491 Bacteria 29754
530 Ga0495584_0002026 3300046491 Bacteria 11641
531 Ga0495584_0002140 3300046491 Bacteria 11289
532 Ga0495584_0006909 3300046491 Bacteria 5929
533 Ga0495584_0007040 3300046491 Bacteria 5875
534 Ga0495584_0009992 3300046491 Bacteria 4871
535 Ga0495584_0046053 3300046491 Bacteria 2200
536 Ga0495585_0000895 3300046492 Bacteria 25250
537 Ga0495585_0005030 3300046492 Bacteria 8434
538 Ga0495585_0010265 3300046492 Bacteria 5584
539 Ga0495585_0010423 3300046492 Bacteria 5532
540 Ga0495585_0035713 3300046492 Bacteria 2807
541 Ga0495585_0037229 3300046492 Bacteria 2740
542 Ga0495594_0011120 3300046499 Bacteria 4673
543 Ga0495596_0000175 3300046500 Bacteria 44764
544 Ga0495596_0015961 3300046500 Bacteria 3127
545 Ga0495607_0000024 3300046501 Bacteria 159904
546 Ga0495607_0000306 3300046501 Bacteria 51378
547 Ga0495607_0000531 3300046501 Bacteria 37437
548 Ga0495607_0000751 3300046501 Bacteria 31037
549 Ga0495607_0001123 3300046501 Bacteria 24276
550 Ga0495607_0003423 3300046501 Bacteria 12155
551 Ga0495607_0008096 3300046501 Bacteria 7216
552 Ga0495607_0012685 3300046501 Bacteria 5551
553 Ga0495607_0014244 3300046501 Bacteria 5185
554 Ga0495607_0020047 3300046501 Bacteria 4233
555 Ga0495607_0046946 3300046501 Bacteria 2532
556 Ga0495607_0065376 3300046501 Bacteria 2051
557 Ga0495607_0095448 3300046501 Bacteria 1602
558 Ga0495607_0117861 3300046501 Bacteria 1398
559 Ga0495607_0171456 3300046501 Bacteria 1095
560 Ga0495583_0000146 3300046506 Bacteria 119793
561 Ga0495583_0000452 3300046506 Bacteria 61394
562 Ga0495583_0001254 3300046506 Bacteria 26768
563 Ga0495583_0002206 3300046506 Bacteria 17249
564 Ga0495583_0005888 3300046506 Bacteria 8166
565 Ga0495583_0015935 3300046506 Bacteria 4064
566 Ga0495606_0000115 3300046507 Bacteria 135589
567 Ga0495606_0000246 3300046507 Bacteria 95318
568 Ga0495606_0000454 3300046507 Bacteria 67097
569 Ga0495606_0000477 3300046507 Bacteria 65883
570 Ga0495606_0001164 3300046507 Bacteria 37202
571 Ga0495606_0002670 3300046507 Bacteria 20254
572 Ga0495606_0007824 3300046507 Bacteria 9438
573 Ga0495606_0009157 3300046507 Bacteria 8423
574 Ga0495606_0038528 3300046507 Bacteria 3233
575 Ga0495610_0003687 3300046512 Bacteria 11763
576 Ga0495610_0008413 3300046512 Bacteria 6688
577 Ga0495610_0014124 3300046512 Bacteria 4709
578 Ga0495610_0054587 3300046512 Bacteria 1929
579 Ga0495616_0000852 3300046513 Bacteria 22250
580 Ga0495616_0035228 3300046513 Bacteria 2591
581 Ga0495616_0051050 3300046513 Bacteria 2064
582 Ga0495616_0088639 3300046513 Bacteria 1468
583 Ga0495620_0000023 3300046515 Bacteria 131512
584 Ga0495620_0000108 3300046515 Bacteria 66218
585 Ga0495620_0001611 3300046515 Bacteria 13368
586 Ga0495620_0001719 3300046515 Bacteria 12933
587 Ga0495620_0002090 3300046515 Bacteria 11609
588 Ga0495620_0003034 3300046515 Bacteria 9654
589 Ga0495620_0003388 3300046515 Bacteria 9121
590 Ga0495620_0089078 3300046515 Bacteria 1239
591 Ga0495631_0001318 3300046518 Bacteria 15202
592 Ga0495631_0004094 3300046518 Bacteria 7830
593 Ga0495631_0006065 3300046518 Bacteria 6278
594 Ga0495632_0001735 3300046519 Bacteria 17682
595 Ga0495632_0001795 3300046519 Bacteria 17318
596 Ga0495632_0003309 3300046519 Bacteria 11492
597 Ga0495632_0005231 3300046519 Bacteria 8647
598 Ga0495632_0015933 3300046519 Bacteria 4195
599 Ga0495632_0182428 3300046519 Bacteria 961
600 Ga0495637_0000054 3300046520 Bacteria 99531
601 Ga0495637_0000194 3300046520 Bacteria 47572
602 Ga0495637_0000269 3300046520 Bacteria 41036
603 Ga0495637_0000466 3300046520 Bacteria 29566
604 Ga0495637_0004473 3300046520 Bacteria 7235
605 Ga0495637_0006747 3300046520 Bacteria 5745
606 Ga0495637_0015104 3300046520 Bacteria 3628
607 Ga0495637_0020194 3300046520 Bacteria 3068
608 Ga0495637_0026282 3300046520 Bacteria 2615
609 Ga0495637_0041970 3300046520 Bacteria 1959
610 Ga0495637_0052122 3300046520 Bacteria 1709
611 Ga0495643_0000402 3300046522 Bacteria 56542
612 Ga0495643_0000730 3300046522 Bacteria 37461
613 Ga0495643_0001170 3300046522 Bacteria 25602
614 Ga0495643_0001604 3300046522 Bacteria 20016
615 Ga0495643_0001680 3300046522 Bacteria 19333
616 Ga0495643_0002170 3300046522 Bacteria 16064
617 Ga0495643_0002454 3300046522 Bacteria 14677
618 Ga0495643_0009905 3300046522 Bacteria 5892
619 Ga0495643_0010294 3300046522 Bacteria 5759
620 Ga0495643_0019663 3300046522 Bacteria 3903
621 Ga0495643_0087473 3300046522 Bacteria 1612
622 Ga0495648_0000783 3300046524 Bacteria 33886
623 Ga0495648_0001858 3300046524 Bacteria 20225
624 Ga0495648_0002460 3300046524 Bacteria 17056
625 Ga0495648_0002748 3300046524 Bacteria 15885
626 Ga0495648_0012345 3300046524 Bacteria 6380
627 Ga0495648_0017798 3300046524 Bacteria 5065
628 Ga0495648_0183970 3300046524 Bacteria 1059
629 Ga0495666_0005396 3300046526 Bacteria 6436
630 Ga0495666_0042994 3300046526 Bacteria 2183
631 Ga0495666_0058971 3300046526 Bacteria 1836
632 Ga0495666_0107903 3300046526 Bacteria 1309
633 Ga0495642_0000536 3300046528 Bacteria 19246
634 Ga0495642_0000555 3300046528 Bacteria 18832
635 Ga0495642_0015291 3300046528 Bacteria 2981
636 Ga0495654_0000210 3300046530 Bacteria 55201
637 Ga0495654_0001010 3300046530 Bacteria 20620
638 Ga0495654_0002438 3300046530 Bacteria 11969
639 Ga0495654_0003497 3300046530 Bacteria 9591
640 Ga0495654_0009898 3300046530 Bacteria 5211
641 Ga0495654_0015931 3300046530 Bacteria 3983
642 Ga0495654_0023317 3300046530 Bacteria 3205
643 Ga0495654_0090195 3300046530 Bacteria 1423
644 Ga0495586_0022525 3300046535 Bacteria 3362
645 Ga0495587_0003520 3300046536 Bacteria 10428
646 Ga0495587_0057179 3300046536 Bacteria 2294
647 Ga0495609_0000061 3300046538 Bacteria 139848
648 Ga0495609_0000101 3300046538 Bacteria 100818
649 Ga0495609_0000696 3300046538 Bacteria 25895
650 Ga0495609_0001338 3300046538 Bacteria 16696
651 Ga0495609_0011057 3300046538 Bacteria 4309
652 Ga0495609_0022196 3300046538 Bacteria 2924
653 Ga0495597_0000676 3300046542 Bacteria 27672
654 Ga0495597_0004012 3300046542 Bacteria 8264
655 Ga0495597_0005112 3300046542 Bacteria 7001
656 Ga0495597_0005967 3300046542 Bacteria 6357
657 Ga0495597_0021813 3300046542 Bacteria 2975
658 Ga0495597_0135952 3300046542 Bacteria 1016
659 Ga0495622_0005884 3300046557 Bacteria 5693
660 Ga0495622_0006049 3300046557 Bacteria 5623
661 Ga0495622_0020035 3300046557 Bacteria 3113
662 Ga0495633_0000129 3300046558 Bacteria 100833
663 Ga0495633_0003624 3300046558 Bacteria 10211
664 Ga0495656_0004240 3300046615 Bacteria 4895
665 Ga0495668_0001708 3300046616 Bacteria 20267
666 Ga0495668_0003520 3300046616 Bacteria 11662
667 Ga0495668_0029435 3300046616 Bacteria 3102
668 Ga0495668_0093913 3300046616 Bacteria 1642
669 Ga0495668_0225844 3300046616 Bacteria 1025
670 Ga0495634_0015246 3300046642 Bacteria 5526
671 Ga0495634_0311913 3300046642 Bacteria 949
672 Ga0495611_0000525 3300046648 Bacteria 22782
673 Ga0495611_0000571 3300046648 Bacteria 21238
674 Ga0495611_0001821 3300046648 Bacteria 10218
675 Ga0495625_0000147 3300046660 Bacteria 107983
676 Ga0495625_0011548 3300046660 Bacteria 7195
677 Ga0495625_0135001 3300046660 Bacteria 1668
678 Ga0495625_0159038 3300046660 Bacteria 1514
679 Ga0495635_0000583 3300046663 Bacteria 23456
680 Ga0495635_0000604 3300046663 Bacteria 23105
681 Ga0495659_0001461 3300046664 Bacteria 8015
682 Ga0495659_0006759 3300046664 Bacteria 3624
683 Ga0495661_0000153 3300046665 Bacteria 81096
684 Ga0495661_0000196 3300046665 Bacteria 69840
685 Ga0495661_0000431 3300046665 Bacteria 44303
686 Ga0495661_0000484 3300046665 Bacteria 41967
687 Ga0495661_0001727 3300046665 Bacteria 17684
688 Ga0495661_0058509 3300046665 Bacteria 2297
689 Ga0495661_0063649 3300046665 Bacteria 2179
690 Ga0495661_0074274 3300046665 Bacteria 1979
691 Ga0495661_0082777 3300046665 Bacteria 1846
692 Ga0495661_0252256 3300046665 Bacteria 900
693 Ga0495588_0005506 3300046674 Bacteria 5638
694 Ga0495623_0050832 3300046679 Bacteria 2624
695 Ga0495646_0039441 3300046680 Bacteria 2911
696 Ga0495669_0160323 3300046684 Bacteria 1067
697 Ga0495613_0054929 3300046689 Bacteria 2927
698 Ga0495670_0000388 3300046691 Bacteria 21005
699 Ga0495670_0001599 3300046691 Bacteria 11079
700 Ga0495670_0003795 3300046691 Bacteria 7424
701 Ga0495670_0005439 3300046691 Bacteria 6252
702 Ga0495670_0007272 3300046691 Bacteria 5444
703 Ga0495671_0000471 3300046692 Bacteria 31523
704 Ga0495671_0001192 3300046692 Bacteria 17802
705 Ga0495671_0001895 3300046692 Bacteria 13430
706 Ga0495671_0001900 3300046692 Bacteria 13409
707 Ga0495671_0002856 3300046692 Bacteria 10806
708 Ga0495671_0003042 3300046692 Bacteria 10421
709 Ga0495671_0037684 3300046692 Bacteria 2444
710 Ga0495671_0042708 3300046692 Bacteria 2277
711 Ga0495671_0086214 3300046692 Bacteria 1538
712 Ga0495649_0000711 3300046694 Bacteria 27137
713 Ga0495649_0000968 3300046694 Bacteria 22667
714 Ga0495649_0002156 3300046694 Bacteria 14079
715 Ga0495649_0003441 3300046694 Bacteria 10676
716 Ga0495649_0007937 3300046694 Bacteria 6419
717 Ga0495649_0009797 3300046694 Bacteria 5672
718 Ga0495649_0013458 3300046694 Bacteria 4719
719 Ga0495649_0077864 3300046694 Bacteria 1774
720 Ga0495589_0002719 3300046794 Bacteria 9775
721 Ga0495589_0007109 3300046794 Bacteria 5866
722 Ga0495589_0014900 3300046794 Bacteria 4000
723 Ga0495589_0026339 3300046794 Bacteria 2946
724 Ga0495589_0055325 3300046794 Bacteria 1955
725 Ga0495600_0000547 3300046809 Bacteria 19473
726 Ga0495660_0000431 3300046810 Bacteria 35256
727 Ga0495660_0004060 3300046810 Bacteria 8938
728 Ga0495660_0014906 3300046810 Bacteria 4495
729 Ga0495660_0020968 3300046810 Bacteria 3744
730 Ga0495660_0036778 3300046810 Bacteria 2729
731 Ga0495660_0055822 3300046810 Bacteria 2136
732 Ga0495660_0083874 3300046810 Bacteria 1667
733 Ga0495581_0107187 3300047315 Bacteria 1624
734 Ga0495604_0012043 3300047317 Bacteria 6875
735 Ga0495604_0016005 3300047317 Bacteria 5988
736 Ga0495636_0008819 3300047318 Bacteria 3972
737 Ga0495674_0034797 3300047319 Bacteria 4551
738 Ga0495672_0003079 3300047320 Bacteria 14595
739 Ga0495672_0003447 3300047320 Bacteria 13529
740 Ga0495672_0004295 3300047320 Bacteria 11749
741 Ga0495672_0005642 3300047320 Bacteria 9876
742 Ga0495672_0006899 3300047320 Bacteria 8659
743 Ga0495672_0012746 3300047320 Bacteria 5844
744 Ga0495676_0000027 3300047321 Bacteria 141955
745 Ga0495676_0021111 3300047321 Bacteria 5698
746 Ga0495676_0049708 3300047321 Bacteria 3368
747 Ga0495680_0005758 3300047322 Bacteria 11601
748 Ga0495683_0000038 3300047323 Bacteria 139494
749 Ga0495683_0000075 3300047323 Bacteria 100715
750 Ga0495683_0001303 3300047323 Bacteria 16785
751 Ga0495683_0001374 3300047323 Bacteria 16151
752 Ga0495683_0052279 3300047323 Bacteria 2040
753 Ga0495683_0071627 3300047323 Bacteria 1700
754 Ga0495683_0165052 3300047323 Bacteria 1021
755 Ga0495687_003446 3300047443 Bacteria 11443
756 Ga0495687_004754 3300047443 Bacteria 8978
757 Ga0495687_010017 3300047443 Bacteria 5237
758 Ga0495675_0156627 3300047444 Bacteria 1404
759 Ga0495677_0001006 3300047445 Bacteria 11356
760 Ga0495679_000237 3300047446 Bacteria 45847
761 Ga0495679_000495 3300047446 Bacteria 27885
762 Ga0495679_013833 3300047446 Bacteria 3011
763 Ga0495685_066872 3300047447 Bacteria 1207
764 Ga0495673_0000389 3300047469 Bacteria 51664
765 Ga0495673_0001628 3300047469 Bacteria 17374
766 Ga0495673_0001807 3300047469 Bacteria 16191
767 Ga0495673_0005394 3300047469 Bacteria 7744
768 Ga0495673_0008202 3300047469 Bacteria 5899
769 Ga0495673_0012990 3300047469 Bacteria 4388
770 Ga0495673_0019427 3300047469 Bacteria 3403
771 Ga0495673_0041012 3300047469 Bacteria 2086
772 Ga0495673_0095900 3300047469 Bacteria 1205
773 Ga0495681_0003081 3300047470 Bacteria 11691
774 Ga0495681_0003215 3300047470 Bacteria 11403
775 Ga0495681_0004777 3300047470 Bacteria 9177
776 Ga0495681_0012244 3300047470 Bacteria 5053
777 Ga0495681_0022208 3300047470 Bacteria 3402
778 Ga0495681_0031756 3300047470 Bacteria 2667
779 Ga0495686_0007608 3300047472 Bacteria 8091
780 Ga0495686_0125865 3300047472 Bacteria 1523
781 Ga0495686_0127672 3300047472 Bacteria 1510
782 Ga0495593_0038639 3300047673 Bacteria 2577
783 Ga0495593_0071064 3300047673 Bacteria 1807
784 Ga0495593_0106202 3300047673 Bacteria 1436
785 Ga0495626_0000067 3300048091 Bacteria 139969
786 Ga0495626_0000507 3300048091 Bacteria 38997
787 Ga0495626_0000684 3300048091 Bacteria 32479
788 Ga0495626_0000996 3300048091 Bacteria 24344
789 Ga0495626_0001171 3300048091 Bacteria 21808
790 Ga0495626_0001627 3300048091 Bacteria 17443
791 Ga0495626_0012837 3300048091 Bacteria 4372
792 Ga0495626_0013045 3300048091 Bacteria 4333
793 Ga0495626_0027693 3300048091 Bacteria 2753
794 Ga0495626_0033525 3300048091 Bacteria 2460
795 Ga0496102_0034338 3300048905 Bacteria 4561
796 Ga0496103_0014973 3300048906 Bacteria 4610
797 Ga0496106_0484204 3300048909 Bacteria 994
798 Ga0496109_0091764 3300048912 Bacteria 2809
799 Ga0496110_0069750 3300048913 Bacteria 3113
800 Ga0496110_0146071 3300048913 Bacteria 2139
801 Ga0496111_0049816 3300048914 Bacteria 3020
802 Ga0496111_0055581 3300048914 Bacteria 2863
803 Ga0496112_0228484 3300048915 Bacteria 1816
804 Ga0496113_0214562 3300048916 Bacteria 1533
805 Ga0496114_0024637 3300048917 Bacteria 4912
806 Ga0496116_0000242 3300048919 Bacteria 99455
807 Ga0496116_0001670 3300048919 Bacteria 24375
808 Ga0496116_0002076 3300048919 Bacteria 21440
809 Ga0496116_0023569 3300048919 Bacteria 4581
810 Ga0496117_0000270 3300048920 Bacteria 97077
811 Ga0496117_0000932 3300048920 Bacteria 44792
812 Ga0496117_0002067 3300048920 Bacteria 26545
813 Ga0496118_0042191 3300048921 Bacteria 3601
814 Ga0496118_0068266 3300048921 Bacteria 2583
815 Ga0496118_0069267 3300048921 Bacteria 2556
816 Ga0496119_0000704 3300048922 Bacteria 44799
817 Ga0496120_0001473 3300048923 Bacteria 28054
818 Ga0496120_0004336 3300048923 Bacteria 11991
819 Ga0496121_0000318 3300048924 Bacteria 100833
820 Ga0496121_0003788 3300048924 Bacteria 21104
821 Ga0496121_0004345 3300048924 Bacteria 19161
822 Ga0496121_0149535 3300048924 Bacteria 1720
823 Ga0496121_0268043 3300048924 Bacteria 1175
824 Ga0496122_0000517 3300048925 Bacteria 79890
825 Ga0496122_0002629 3300048925 Bacteria 25113
826 Ga0496122_0007631 3300048925 Bacteria 11947
827 Ga0496122_0138317 3300048925 Bacteria 1529
828 Ga0496122_0141719 3300048925 Bacteria 1502
829 Ga0496123_0000243 3300048926 Bacteria 109767
830 Ga0496123_0007055 3300048926 Bacteria 10690
831 Ga0496123_0040963 3300048926 Bacteria 3217
832 Ga0496124_0000511 3300048927 Bacteria 66830
833 Ga0496124_0001467 3300048927 Bacteria 34796
834 Ga0496124_0002260 3300048927 Bacteria 25562
835 Ga0496124_0002328 3300048927 Bacteria 25081
836 Ga0496124_0007063 3300048927 Bacteria 12030
837 Ga0496124_0015657 3300048927 Bacteria 7256
838 Ga0496124_0023005 3300048927 Bacteria 5701
839 Ga0496124_0028667 3300048927 Bacteria 4977
840 Ga0496124_0087458 3300048927 Bacteria 2548
841 Ga0496124_0107378 3300048927 Bacteria 2252
842 Ga0496124_0172950 3300048927 Bacteria 1670
843 Ga0496124_0216254 3300048927 Bacteria 1445
844 Ga0496125_0000971 3300048928 Bacteria 44877
845 Ga0496125_0002177 3300048928 Bacteria 26150
846 Ga0496125_0006705 3300048928 Bacteria 12379
847 Ga0496125_0021605 3300048928 Bacteria 5998
848 Ga0496125_0045763 3300048928 Bacteria 3678
849 Ga0496125_0113892 3300048928 Bacteria 1949
850 Ga0496126_0055003 3300048929 Bacteria 3602
851 Ga0496126_0099192 3300048929 Bacteria 2551
852 Ga0496126_0698856 3300048929 Bacteria 788
853 Ga0495678_000106 3300049459 Bacteria 100780
854 Ga0495678_000499 3300049459 Bacteria 38715
855 Ga0495678_000694 3300049459 Bacteria 30590
856 Ga0495678_002365 3300049459 Bacteria 12945
857 Ga0495678_008447 3300049459 Bacteria 5191
858 Ga0495678_008793 3300049459 Bacteria 5058
859 Ga0495678_090731 3300049459 Bacteria 1077
860 Ga0495682_0000069 3300049460 Bacteria 94250
861 Ga0495682_0000804 3300049460 Bacteria 19829
862 Ga0495682_0021349 3300049460 Bacteria 2426
863 Ga0501031_0079268 3300049568 Bacteria 2140
864 Ga0501032_0010649 3300049569 Bacteria 6621
865 Ga0501034_0000164 3300049571 Bacteria 125152
866 Ga0501034_0042054 3300049571 Bacteria 4625
867 Ga0501034_0060143 3300049571 Bacteria 3817
868 Ga0501034_0086454 3300049571 Bacteria 3136
869 Ga0501037_0071136 3300049573 Bacteria 2531
870 Ga0501038_0165610 3300049574 Bacteria 1793
871 Ga0501043_0055575 3300049579 Bacteria 3110
872 Ga0501047_0530647 3300049581 Bacteria 1002
873 Ga0501243_004728 3300049675 Bacteria 2046
874 Ga0501044_0317260 3300049823 Bacteria 1484
875 Ga0501226_000034 3300049853 Bacteria 71598
876 Ga0501226_000117 3300049853 Bacteria 17509
877 nmdc:mga00v17_119646_c1 3300050491 Bacteria 1676
878 nmdc:mga05p37_250708_c1 3300050507 Bacteria 2123
879 nmdc:mga08y16_396816_c1 3300050511 Bacteria 1412
880 nmdc:mga0sz30_7760_c1 3300050516 Bacteria 4032
881 Ga0500593_000476 3300053117 Bacteria 15884
882 Ga0500628_067781 3300053129 Bacteria 887
883 Ga0500659_0002369 3300053135 Bacteria 11369
884 2510282678 2510065053 Bacteria 5005518
885 2510295333 2510065055 Bacteria 5037935
886 2510311042 2510065058 Bacteria 5005894
887 2511264702 2511231006 Bacteria 6794709
888 2511274353 2511231007 Bacteria 6306603
889 2511278470 2511231008 Bacteria 6624100
890 2511279868 2511231008 Bacteria 6624100
891 2511289681 2511231010 Bacteria 6373152
892 2511294610 2511231011 Bacteria 6149768
893 2511298919 2511231012 Bacteria 6738011
894 2511304203 2511231012 Bacteria 6738011
895 2511313102 2511231014 Bacteria 6462302
896 2511322234 2511231015 Bacteria 6598026
897 2511325254 2511231016 Bacteria 6704427
898 2511331101 2511231017 Bacteria 6503007
899 2511332238 2511231017 Bacteria 6503007
900 2511347000 2511231019 Bacteria 6520662
901 2511348012 2511231020 Bacteria 6115223
902 2511359156 2511231021 Bacteria 7302637
903 2511366124 2511231022 Bacteria 6719296
904 2511370490 2511231023 Bacteria 6808468
905 2511377020 2511231024 Bacteria 5835885
906 2511412441 2511231031 Bacteria 6558529
907 2511822033 2511231156 Bacteria 6845832
908 2512325215 2512047018 Bacteria 6663241
909 2554818311 2554235132 Bacteria 6772433
910 2554818595 2554235132 Bacteria 6772433
911 2555245329 2554235231 Bacteria 5215788
912 2555667044 2554235341 Bacteria 6867980
913 2583795313 2582580891 Bacteria 6800976
914 2597855295 2597489887 Bacteria 6666321
915 2597861296 2597489888 Bacteria 6179543
916 2597867043 2597489889 Bacteria 6297495
917 2599355547 2599185160 Bacteria 6844013
918 2599363050 2599185161 Bacteria 6960462
919 2599368644 2599185162 Bacteria 6957254
920 2599376159 2599185163 Bacteria 6995158
921 2599380653 2599185164 Bacteria 6841688
922 2599387831 2599185165 Bacteria 6843250
923 2599395017 2599185166 Bacteria 6959206
924 2599401183 2599185167 Bacteria 6353609
925 2599406782 2599185168 Bacteria 6997636
926 2599449484 2599185179 Bacteria 6611171
927 2599462381 2599185181 Bacteria 6844519
928 2599468196 2599185182 Bacteria 6883168
929 2599487421 2599185185 Bacteria 6652270
930 2599491398 2599185186 Bacteria 6831633
931 2599503814 2599185188 Bacteria 6164180
932 2599506122 2599185189 Bacteria 5862825
933 2599511556 2599185190 Bacteria 6285678
934 2599516530 2599185191 Bacteria 6297582
935 2599612597 2599185212 Bacteria 6765997
936 2599767791 2599185248 Bacteria 6696816
937 2599804223 2599185257 Bacteria 6492581
938 2599879417 2599185288 Bacteria 6666191
939 2599887892 2599185289 Bacteria 6778765
940 2599893059 2599185290 Bacteria 6289611
941 2599899417 2599185291 Bacteria 6775623
942 2599933247 2599185300 Bacteria 6062622
943 2599942004 2599185302 Bacteria 5954930
944 2599948637 2599185303 Bacteria 6512725
945 2599954985 2599185304 Bacteria 5951361
946 2599963560 2599185305 Bacteria 6748700
947 2599966423 2599185306 Bacteria 6637356
948 2599975255 2599185307 Bacteria 6194719
949 2599977272 2599185308 Bacteria 6621546
950 2599986292 2599185309 Bacteria 5969593
951 2599991345 2599185310 Bacteria 6014457
952 2599995162 2599185311 Bacteria 6354990
953 2600000826 2599185312 Bacteria 5912071
954 2600007474 2599185313 Bacteria 6658188
955 2600011295 2599185314 Bacteria 6621749
956 2600020215 2599185315 Bacteria 6771107
957 2600026578 2599185316 Bacteria 6320029
958 2600029540 2599185317 Bacteria 6435722
959 2600037608 2599185318 Bacteria 6961590
960 2600044264 2599185319 Bacteria 6637840
961 2600050046 2599185320 Bacteria 5963263
962 2600054706 2599185321 Bacteria 6764560
963 2600059889 2599185322 Bacteria 6763055
964 2600065308 2599185323 Bacteria 6688755
965 2600073249 2599185324 Bacteria 6590677
966 2600078980 2599185325 Bacteria 6324919
967 2600215003 2599185356 Bacteria 6843884
968 2600358776 2600254930 Bacteria 6431253
969 2600363094 2600254931 Bacteria 6734225
970 2601627782 2600255283 Bacteria 6061572
971 2601693370 2600255296 Bacteria 5784754
972 2601775169 2600255313 Bacteria 6842543
973 2601798184 2600255318 Bacteria 6383414
974 2606077072 2603880185 Bacteria 6379190
975 2606129682 2603880199 Bacteria 6377649
976 2608380395 2606217733 Bacteria 6360972
977 2608384257 2606217733 Bacteria 6360972
978 2621296449 2619619299 Bacteria 6649820
979 2624477811 2623620443 Bacteria 6427864
980 2624489389 2623620446 Bacteria 6500345
981 2643843165 2643221565 Bacteria 6216018
982 2643843784 2643221565 Bacteria 6216018
983 2643873585 2643221571 Bacteria 6228673
984 2643956033 2643221589 Bacteria 6250934
985 2644020155 2643221602 Bacteria 6249926
986 2644184167 2643221633 Bacteria 6733554
987 2644282863 2643221650 Bacteria 7029547
988 2644624398 2643221713 Bacteria 6554480
989 2652544482 2651869719 Bacteria 6047974
990 2671091921 2667528170 Bacteria 6786960
991 2671099691 2667528171 Bacteria 6900659
992 2671129625 2667528176 Bacteria 6724917
993 2671771232 2671180172 Bacteria 6495783
994 2677900373 2675903420 Bacteria 6247433
995 2678266506 2675903515 Bacteria 6580491
996 2715749509 2713897148 Bacteria 5883533
997 2715754506 2713897149 Bacteria 6506249
998 2723246199 2721755607 Bacteria 5841722
999 2738673395 2738541265 Bacteria 6594665
1000 2738690672 2738541271 Bacteria 5657310
1001 2738751788 2738541282 Bacteria 6593925
1002 2738807641 2738541294 Bacteria 6925949
1003 2738860829 2738541303 Bacteria 6591772
1004 2738895001 2738541309 Bacteria 6926455
1005 2739200952 2738543004 Bacteria 6381073
1006 2739261788 2738543015 Bacteria 6750701
1007 2739266446 2738543016 Bacteria 5657564
1008 2739288737 2738543020 Bacteria 5718238
1009 2739289693 2738543020 Bacteria 5718238
1010 2739294049 2738543021 Bacteria 5718241
1011 2739295005 2738543021 Bacteria 5718241
1012 2739312156 2738543025 Bacteria 6600348
1013 2743740864 2740892503 Bacteria 6855563
1014 2745007736 2744054620 Bacteria 6551379
1015 2765581309 2765235841 Bacteria 6137024
1016 2774118033 2773857670 Bacteria 6407454
1017 2774129165 2773857672 Bacteria 4993178
1018 2774136530 2773857673 Bacteria 6513460
1019 2784261474 2784132063 Bacteria 6262788
1020 2784316520 2784132072 Bacteria 6596533
1021 2794593604 2791355520 Bacteria 5948615
1022 2807405892 2806310737 Bacteria 5751088
1023 2807454227 2806310745 Bacteria 5742165
1024 2808858624 2808606361 Bacteria 6136259
1025 2808905826 2808606373 Bacteria 4423627
1026 2808923943 2808606376 Bacteria 6248667
1027 2808928115 2808606377 Bacteria 6646337
1028 2808938584 2808606378 Bacteria 6177535
1029 2808942257 2808606379 Bacteria 5022697
1030 2808946202 2808606380 Bacteria 6248705
1031 2808950703 2808606381 Bacteria 6646461
1032 2808960674 2808606382 Bacteria 6841132
1033 2808967129 2808606383 Bacteria 6138645
1034 2808980049 2808606385 Bacteria 6711065
1035 2808995769 2808606388 Bacteria 6706662
1036 2809001939 2808606389 Bacteria 6138126
1037 2812369855 2811994881 Bacteria 6298475
1038 2817488072 2816332298 Bacteria 6852809
1039 2819655466 2818991456 Bacteria 6123676
1040 2819704838 2818991464 Bacteria 6907494
1041 2825654706 2825651385 Bacteria 6715909
1042 2826582348 2826581358 Bacteria 5963467
1043 2834031330 2834028612 Bacteria 6354979
1044 2842805456 2842805378 Bacteria 5385175
1045 2842807949 2842805378 Bacteria 5385175
1046 2842816999 2842815866 Bacteria 5947510
1047 2842832034 2842826826 Bacteria 5974129
1048 2842833780 2842832357 Bacteria 5959113
1049 2842838305 2842837860 Bacteria 6066181
1050 2842846014 2842843487 Bacteria 6004777
1051 2842852121 2842849001 Bacteria 5924277
1052 2842855968 2842854478 Bacteria 6143501
1053 2844667531 2844665904 Bacteria 6817974
1054 2852616727 2852612431 Bacteria 6885235
1055 2852662613 2852657418 Bacteria 6472974
1056 2852671695 2852667396 Bacteria 6885555
1057 2860345250 2860339153 Bacteria 6846989
1058 2860868096 2860867994 Bacteria 5645326
1059 2878029754 2878029506 Bacteria 6418441
1060 2880230704 2880230671 Bacteria 6140320
1061 2904518615 2904518522 Bacteria 6068986
1062 2904553440 2904550169 Bacteria 6221258
1063 2908446685 2908446538 Bacteria 6829095
1064 2912963883 2912963787 Bacteria 5646108
1065 2913036894 2913036834 Bacteria 6704877
1066 2917070781 2917070673 Bacteria 6868303
1067 2917833288 2917832318 Bacteria 5346010
1068 2919067989 2919063839 Bacteria 6302690
1069 2919126172 2919125081 Bacteria 5385106
1070 2919156189 2919155634 Bacteria 4860545
1071 2919388836 2919385768 Bacteria 5897293
1072 2919457905 2919456309 Bacteria 6586567
1073 2919487013 2919481497 Bacteria 6907839
1074 2919487799 2919487758 Bacteria 5929766
1075 2919702406 2919697872 Bacteria 6553725
1076 2923153696 2923153595 Bacteria 6870622
1077 2923523941 2923519811 Bacteria 6298479
1078 2923589324 2923586266 Bacteria 6565975
1079 2929144364 2929144301 Bacteria 6622272
1080 2929189979 2929189879 Bacteria 5930554
1081 2931372309 2931369376 Bacteria 6847892
1082 2931391040 2931390751 Bacteria 6273349
1083 2931398449 2931396565 Bacteria 7251677
1084 2935357884 2935353572 Unclassified 6955622
1085 2939640523 2939636861 Bacteria 6297853
1086 2939654486 2939651529 Bacteria 5895393
1087 2945930503 2945928738 Bacteria 6053221
1088 2945967252 2945961074 Bacteria 7342064
1089 2946012849 2946006987 Bacteria 6705746
1090 2946028288 2946027586 Bacteria 6049274
1091 2947234805 2947233263 Bacteria 6439278
1092 2969304510 2969304461 Bacteria 6601805
1093 2974293740 2974289157 Bacteria 6080362
1094 2974302390 2974298342 Bacteria 4840922
1095 2984292417 2984286254 Bacteria 6702062
1096 2984500056 2984499530 Bacteria 5020881
1097 2984506570 2984504281 Bacteria 5262371
1098 2988731826 2988728565 Bacteria 6124362
1099 2998140074 2998139840 Bacteria 6073514
1100 3007253994 3007252601 Bacteria 4559114
1101 3007317262 3007315729 Bacteria 5076637
1102 3007398979 3007395558 Bacteria 6755444
1103 3007419681 3007419365 Bacteria 7026924
1104 3007422426 3007419365 Bacteria 7026924
1105 3007517492 3007511990 Bacteria 6481491
1106 3007617046 3007614139 Bacteria 6053559
1107 3007623817 3007619802 Bacteria 6411688
1108 3007722064 3007718800 Bacteria 5971527
1109 3007804062 3007803356 Bacteria 5931491
1110 3007859519 3007855910 Bacteria 5637581
1111 3007864748 3007861166 Bacteria 6045338
1112 3007871724 3007866637 Bacteria 5899198
1113 3007874921 3007872151 Bacteria 5268868
1114 637317447 637000220 Bacteria 7074893
1115 8011351071 8011350971 Bacteria 6158957
1116 8011356246 8011350971 Bacteria 6158957
1117 8015687959 8015687852 Bacteria 6613826
1118 8016731414 8016728285 Bacteria 5263933
1119 8019769374 8019769354 Bacteria 6924660
1120 8019779629 8019775933 Bacteria 6858656
1121 8029995176 8029995093 Bacteria 5990776
1122 8052494527 8052494512 Bacteria 5765634
1123 8054287601 8054285046 Bacteria 6919322
1124 8054349212 8054347763 Bacteria 5901107
1125 8054503646 8054503363 Bacteria 6101651
1126 8054930031 8054929484 Bacteria 5599761
1127 8055771057 8055770955 Bacteria 6827675
1128 8055818009 8055817908 Bacteria 6609162
1129 8055883518 8055878733 Bacteria 5907058
1130 8056116224 8056115690 Bacteria 5527654
1131 8056120821 8056120720 Bacteria 5758328
1132 8056126093 8056125926 Bacteria 6228218
1133 8056131978 8056131705 Bacteria 6107031
1134 8056137516 8056137416 Bacteria 6147080
1135 8056140045 8056137416 Bacteria 6147080
1136 8056143302 8056143049 Bacteria 6307666
1137 8056151124 8056148874 Bacteria 6479865
1138 8056160071 8056155041 Bacteria 6486948
1139 8056164007 8056161164 Bacteria 6106669
1140 8056170973 8056166840 Bacteria 5820959
1141 8056177106 8056172158 Bacteria 6133900
1142 8056182197 8056177738 Bacteria 6748268
1143 8056570805 8056569372 Bacteria 5997322
1144 8057802339 8057798959 Bacteria 6713499
1145 Ga0105244_10076055
1146 MRS2a_Contig_6737
1147 MRS2a_Contig_799
1148 SwRhRL2b_contig_803191
1149 JGI24741J21665_1000755
1150 JGI24750J21931_1025787
1151 JGI25155J39150_1000041
1152 JGI25156J39149_1000031
1153 JGI25162J39368_1000208
1154 JGI25162J39368_1000459
1155 JGI25154J39366_1000049
1156 JGI25157J39369_1000041
1157 JGI25163J39215_1000407
1158 JGI25163J39215_1000589
1159 JGI25164J39214_1000297
1160 JGI25164J39214_1000314
1161 JGI25165J46597_1000175
1162 JGI25165J46597_1000193
1163 rootH1_10017529
1164 rootH2_10016165
1165 rootL2_10030466
1166 rootL2_10110202
1167 Ga0055538_1000012
1168 Ga0055539_1000017
1169 Ga0055533_1000021
1170 Ga0055532_1000020
1171 Ga0055525_1000117
1172 Ga0055535_1004800
1173 Ga0055536_1000272
1174 Ga0055536_1003957
1175 Ga0055536_1008918
1176 Ga0055536_1029466
1177 Ga0055530_10000081
1178 Ga0055530_10000548
1179 Ga0055530_10002934
1180 Ga0055530_10009440
1181 Ga0055540_1000121
1182 Ga0055540_1000242
1183 Ga0055540_1001116
1184 Ga0055540_1032823
1185 Ga0055531_10001033
1186 Ga0055541_1000012
1187 Ga0058692_1008307
1188 Ga0065714_10002860
1189 Ga0065714_10003342
1190 Ga0065714_10005964
1191 Ga0065714_10021354
1192 Ga0065714_10064636
1193 Ga0065714_10107372
1194 Ga0065704_10001959
1195 Ga0065704_10009110
1196 Ga0065704_10070543
1197 Ga0065704_10071119
1198 Ga0065704_10121284
1199 Ga0065712_10001109
1200 Ga0065712_10068500
1201 Ga0065712_10074016
1202 Ga0065715_10013766
1203 Ga0070670_100000010
1204 Ga0070670_100003035
1205 Ga0068869_100084556
1206 Ga0070691_10142847
1207 Ga0070661_100000237
1208 Ga0070661_100293685
1209 Ga0070669_100000158
1210 Ga0070669_100000277
1211 Ga0070669_100002451
1212 Ga0070669_100035538
1213 Ga0070675_100017974
1214 Ga0070671_100000012
1215 Ga0070674_100037246
1216 Ga0070688_100002333
1217 Ga0070659_100407812
1218 Ga0070667_100000097
1219 Ga0070700_100014372
1220 Ga0070700_100062768
1221 Ga0070662_100000063
1222 Ga0070662_100087854
1223 Ga0068867_100000146
1224 Ga0070685_10000077
1225 Ga0070697_100147240
1226 Ga0068853_100000143
1227 Ga0070672_100398226
1228 Ga0070686_100158990
1229 Ga0070665_100078702
1230 Ga0070665_100089367
1231 Ga0070665_100509061
1232 Ga0068857_100627854
1233 Ga0068854_100004725
1234 Ga0068852_100187387
1235 Ga0068859_100014469
1236 Ga0068859_100404284
1237 Ga0068864_100000018
1238 Ga0068861_100001394
1239 Ga0068861_100059167
1240 Ga0068861_100188902
1241 Ga0068851_10000018
1242 Ga0068863_100162161
1243 Ga0068863_100263895
1244 Ga0068858_100024458
1245 Ga0068858_100155276
1246 Ga0068860_100000532
1247 Ga0068862_100000522
1248 Ga0068862_100136925
1249 Ga0075364_10031476
1250 Ga0075364_10113138
1251 Ga0075432_10000648
1252 Ga0070712_100201381
1253 Ga0075362_10066213
1254 Ga0075362_10072007
1255 Ga0075369_10045588
1256 Ga0097621_100081003
1257 Ga0068871_100141867
1258 Ga0075428_100214665
1259 Ga0068865_100003939
1260 Ga0075436_100050318
1261 Ga0097620_100014468
1262 Ga0097620_100404267
1263 Ga0099823_1000217
1264 Ga0079104_1000291
1265 Ga0079104_1000306
1266 Ga0099826_10012980
1267 Ga0105251_10000068
1268 Ga0105251_10000881
1269 Ga0105251_10002062
1270 Ga0105251_10004312
1271 Ga0105251_10007262
1272 Ga0105251_10071828
1273 Ga0105244_10000726
1274 Ga0105244_10001163
1275 Ga0105244_10001870
1276 Ga0105244_10004378
1277 Ga0105244_10005309
1278 Ga0105244_10007469
1279 Ga0105244_10011847
1280 Ga0105244_10030106
1281 Ga0105244_10030745
1282 Ga0105244_10072164
1283 Ga0105244_10132417
1284 Ga0105250_10000825
1285 Ga0105250_10022663
1286 Ga0105250_10023442
1287 Ga0105250_10031572
1288 Ga0105250_10037205
1289 Ga0105250_10038529
1290 Ga0105250_10056987
1291 Ga0111539_10096618
1292 Ga0111539_10935004
1293 Ga0114129_10289749
1294 Ga0105243_10000075
1295 Ga0105243_10000867
1296 Ga0105243_10001447
1297 Ga0105243_10010141
1298 Ga0105243_10097512
1299 Ga0105241_10398380
1300 Ga0105242_10000358
1301 Ga0105242_10090188
1302 Ga0105242_10214496
1303 Ga0105248_10019408
1304 Ga0105248_10123998
1305 Ga0105249_10093807
1306 Ga0105249_10152357
1307 Ga0105239_10087107
1308 Ga0105246_10000002
1309 Ga0105246_10000504
1310 Ga0105246_10010894
1311 Ga0157373_10003814
1312 Ga0157373_10006597
1313 Ga0157373_10023762
1314 Ga0157373_10051866
1315 Ga0157373_10094446
1316 Ga0157371_10000935
1317 Ga0157371_10000953
1318 Ga0157371_10002539
1319 Ga0157371_10076619
1320 Ga0157370_10000698
1321 Ga0157370_10000954
1322 Ga0157370_10002312
1323 Ga0157370_10186706
1324 Ga0157369_10023081
1325 Ga0157369_10521216
1326 Ga0157378_10002415
1327 Ga0157378_10024025
1328 Ga0163162_10017052
1329 Ga0163162_10079724
1330 Ga0163162_10224194
1331 Ga0157372_10013753
1332 Ga0157372_10052807
1333 Ga0163163_10001112
1334 Ga0163163_10101543
1335 Ga0157380_10272904
1336 Ga0182008_10001337
1337 Ga0182008_10003405
1338 Ga0157379_10054053
1339 Ga0157376_10100048
1340 Ga0157376_10136874
1341 Ga0182006_1001380
1342 Ga0182006_1002154
1343 Ga0182006_1003537
1344 Ga0182006_1008824
1345 Ga0182007_10000228
1346 Ga0182005_1000375
1347 Ga0182005_1000663
1348 Ga0182005_1018031
1349 Ga0163161_10050909
1350 Ga0163161_10097813
1351 Ga0163161_10173254
1352 Ga0163161_10287792
1353 Ga0163161_10339170
1354 Ga0213876_10008910
1355 Ga0209435_100014
1356 Ga0209435_100533
1357 Ga0209760_100082
1358 Ga0209760_100230
1359 Ga0209784_100007
1360 Ga0209566_100009
1361 Ga0209674_100021
1362 Ga0209147_100009
1363 Ga0209563_100018
1364 Ga0209563_101660
1365 Ga0207427_100005
1366 Ga0207427_100006
1367 Ga0209437_100013
1368 Ga0209437_100018
1369 Ga0209437_109161
1370 Ga0209258_100237
1371 Ga0209646_1000001
1372 Ga0209646_1000277
1373 Ga0209026_1000073
1374 Ga0209677_100012
1375 Ga0209759_1000013
1376 Ga0209759_1007431
1377 Ga0209759_1018453
1378 Ga0209233_1000021
1379 Ga0209233_1000022
1380 Ga0209676_1000015
1381 Ga0209676_1000157
1382 Ga0209676_1000222
1383 Ga0209676_1000583
1384 Ga0209676_1002274
1385 Ga0209676_1002823
1386 Ga0209676_1004012
1387 Ga0209050_1000030
1388 Ga0209050_1000061
1389 Ga0209050_1000296
1390 Ga0209050_1000318
1391 Ga0209050_1001114
1392 Ga0209051_1000088
1393 Ga0209051_1000143
1394 Ga0209051_1000295
1395 Ga0209051_1004120
1396 Ga0209051_1005691
1397 Ga0209257_1000143
1398 Ga0209257_1011914
1399 Ga0207656_10000009
1400 Ga0207696_1000055
1401 Ga0207696_1000151
1402 Ga0207696_1000165
1403 Ga0207696_1003300
1404 Ga0207696_1007367
1405 Ga0207696_1015831
1406 Ga0207696_1024677
1407 Ga0207696_1028968
1408 Ga0207655_1000135
1409 Ga0207655_1000548
1410 Ga0207655_1000667
1411 Ga0207655_1000754
1412 Ga0207655_1001254
1413 Ga0207655_1001422
1414 Ga0207655_1001733
1415 Ga0207655_1002247
1416 Ga0207655_1004181
1417 Ga0207655_1004957
1418 Ga0207655_1006266
1419 Ga0207655_1008704
1420 Ga0207655_1008902
1421 Ga0207655_1009242
1422 Ga0207655_1018736
1423 Ga0207655_1026577
1424 Ga0207655_1036871
1425 Ga0207655_1038021
1426 Ga0207655_1087014
1427 Ga0207713_1000103
1428 Ga0207713_1000325
1429 Ga0207713_1003599
1430 Ga0207713_1003772
1431 Ga0207713_1004686
1432 Ga0207713_1006272
1433 Ga0207713_1006916
1434 Ga0207713_1010743
1435 Ga0207713_1016458
1436 Ga0207713_1020322
1437 Ga0207713_1022973
1438 Ga0207713_1041073
1439 Ga0207713_1048900
1440 Ga0207713_1050375
1441 Ga0207710_10008242
1442 Ga0207671_10000876
1443 Ga0207693_10121721
1444 Ga0207662_10236760
1445 Ga0207649_10000007
1446 Ga0207681_10000291
1447 Ga0207681_10006732
1448 Ga0207650_10000003
1449 Ga0207650_10000308
1450 Ga0207650_10000407
1451 Ga0207659_10033931
1452 Ga0207644_10001111
1453 Ga0207690_10391921
1454 Ga0207706_10000050
1455 Ga0207706_10011123
1456 Ga0207686_10001347
1457 Ga0207686_10388387
1458 Ga0207709_10000107
1459 Ga0207709_10001047
1460 Ga0207709_10002479
1461 Ga0207709_10009947
1462 Ga0207709_10066438
1463 Ga0207709_10136564
1464 Ga0207709_10544924
1465 Ga0207670_10171133
1466 Ga0207670_10507585
1467 Ga0207669_10062361
1468 Ga0207704_10066450
1469 Ga0207691_10114481
1470 Ga0207711_10002049
1471 Ga0207711_10013160
1472 Ga0207711_10391003
1473 Ga0207689_10150576
1474 Ga0207679_10000013
1475 Ga0207712_10009817
1476 Ga0207712_10025348
1477 Ga0207712_10033258
1478 Ga0207640_10008153
1479 Ga0207658_10000007
1480 Ga0207639_10000079
1481 Ga0207678_10710562
1482 Ga0207708_10006713
1483 Ga0207708_10023107
1484 Ga0207641_10094982
1485 Ga0207648_10000425
1486 Ga0207648_10045457
1487 Ga0207676_10000003
1488 Ga0207676_10186858
1489 Ga0207675_100007239
1490 Ga0207675_100117779
1491 Ga0207675_100267215
1492 Ga0207698_10387053
1493 Ga0209281_1000091
1494 Ga0209281_1000237
1495 Ga0209281_1020632
1496 Ga0209389_1000065
1497 Ga0209371_1000176
1498 Ga0209371_1000929
1499 Ga0209371_1010153
1500 Ga0209996_1002016
1501 Ga0209995_1004740
1502 Ga0209968_1004678
1503 Ga0210002_1006695
1504 Ga0209983_1001053
1505 Ga0209282_1042131
1506 Ga0209974_10007890
1507 Ga0209974_10026535
1508 Ga0209974_10057638
1509 Ga0207428_10042514
1510 Ga0207428_10051774
1511 Ga0207428_10238084
1512 Ga0207428_10299703
1513 Ga0268266_10002796
1514 Ga0268266_10041478
1515 Ga0268266_10136768
1516 Ga0268265_10000234
1517 Ga0268264_10000009
1518 Ga0268256_1000146
1519 Ga0268256_1000782
1520 Ga0268256_1009906
1521 Ga0307511_10008829
1522 Ga0314311_1174000
1523 Ga0316183_1099209
1524 Ga0316183_1101138
1525 Ga0316181_1016487
1526 Ga0316181_1111959
1527 Ga0307513_10007959
1528 Ga0307509_10107120
1529 Ga0307509_10114588
1530 Ga0307516_10345550
1531 Ga0307416_101118720
1532 Ga0307414_10197381
1533 Ga0307414_10422723
1534 Ga0395899_0000478
1535 Ga0395905_0006602
1536 Ga0436365_1689934
1537 Ga0439436_0002017
1538 Ga0439436_0008011
1539 Ga0439438_000775
1540 Ga0439438_005624
1541 Ga0439438_012464
1542 Ga0439439_0002322
1543 Ga0439447_002739
1544 Ga0439447_013680
1545 Ga0439447_019637
1546 Ga0439447_029111
1547 Ga0439466_0000289
1548 Ga0439466_0001121
1549 Ga0439466_0001334
1550 Ga0439466_0002385
1551 Ga0439466_0004035
1552 Ga0439466_0021199
1553 Ga0439466_0025436
1554 Ga0439437_000536
1555 Ga0439442_008500
1556 Ga0439432_001586
1557 Ga0439432_001810
1558 Ga0439432_002251
1559 Ga0439432_014726
1560 Ga0439432_031069
1561 Ga0439432_066039
1562 Ga0439449_0010779
1563 Ga0439451_000786
1564 Ga0439451_002140
1565 Ga0439452_000190
1566 Ga0439452_000443
1567 Ga0439452_001993
1568 Ga0439452_001995
1569 Ga0439452_003249
1570 Ga0439452_008676
1571 Ga0439452_010013
1572 Ga0439456_000036
1573 Ga0439456_000406
1574 Ga0439456_000462
1575 Ga0439456_005910
1576 Ga0439462_0007982
1577 Ga0439463_000120
1578 Ga0439463_000491
1579 Ga0439463_001245
1580 Ga0450911_000011
1581 Ga0450911_000019
1582 Ga0450911_000211
1583 Ga0450911_000509
1584 Ga0450911_004119
1585 Ga0450914_000201
1586 Ga0450919_003455
1587 Ga0450922_001769
1588 Ga0450890_000131
1589 Ga0450894_003690
1590 Ga0450902_001841
1591 Ga0450903_000620
1592 Ga0450904_000097
1593 Ga0450905_000157
1594 Ga0450906_006046
1595 Ga0450907_000110
1596 Ga0450907_003387
1597 Ga0450910_002043
1598 Ga0439446_0000463
1599 Ga0439446_0002388
1600 Ga0439446_0002934
1601 Ga0439446_0003376
1602 Ga0439446_0004933
1603 Ga0450908_005890
1604 Ga0450909_004626
1605 Ga0450909_011498
1606 Ga0439434_0000092
1607 Ga0439434_0000184
1608 Ga0439464_0040131
1609 Ga0439460_0000002
1610 Ga0439460_0001270
1611 Ga0439460_0009852
1612 Ga0439460_0018324
1613 Ga0450916_000505
1614 Ga0450918_008576
1615 Ga0450901_000463
1616 Ga0451577_0277040
1617 Ga0439440_0005351
1618 Ga0466965_0064128
1619 Ga0466964_0008174
1620 Ga0453684_0014934
1621 Ga0453684_0017471
1622 Ga0453684_0040463
1623 Ga0466968_0005006
1624 Ga0451576_0059657
1625 Ga0495617_001787
1626 Ga0495617_012651
1627 Ga0495617_024999
1628 Ga0495627_000095
1629 Ga0495627_000646
1630 Ga0495627_000869
1631 Ga0495627_010851
1632 Ga0495627_039198
1633 Ga0495603_0001944
1634 Ga0495603_0161761
1635 Ga0495590_0002659
1636 Ga0495590_0007106
1637 Ga0495591_000198
1638 Ga0495591_000334
1639 Ga0495591_000628
1640 Ga0495591_002016
1641 Ga0495591_002668
1642 Ga0495591_010984
1643 Ga0495591_017440
1644 Ga0495591_020022
1645 Ga0495591_020266
1646 Ga0495591_025531
1647 Ga0495591_027139
1648 Ga0495629_0083415
1649 Ga0495638_0011328
1650 Ga0495638_0011519
1651 Ga0495638_0019536
1652 Ga0495638_0057233
1653 Ga0495638_0060978
1654 Ga0495653_0005962
1655 Ga0495653_0006872
1656 Ga0495653_0147285
1657 Ga0495650_0001617
1658 Ga0495650_0003976
1659 Ga0495650_0004680
1660 Ga0495650_0008792
1661 Ga0495650_0048726
1662 Ga0495650_0076954
1663 Ga0495582_0000456
1664 Ga0495605_0000019
1665 Ga0495605_0000376
1666 Ga0495605_0000387
1667 Ga0495605_0000664
1668 Ga0495605_0001221
1669 Ga0495605_0002242
1670 Ga0495605_0007209
1671 Ga0495605_0171991
1672 Ga0495639_0000295
1673 Ga0495584_0000408
1674 Ga0495584_0002026
1675 Ga0495584_0002140
1676 Ga0495584_0006909
1677 Ga0495584_0007040
1678 Ga0495584_0009992
1679 Ga0495584_0046053
1680 Ga0495585_0000895
1681 Ga0495585_0005030
1682 Ga0495585_0010265
1683 Ga0495585_0010423
1684 Ga0495585_0035713
1685 Ga0495585_0037229
1686 Ga0495594_0011120
1687 Ga0495596_0000175
1688 Ga0495596_0015961
1689 Ga0495607_0000024
1690 Ga0495607_0000306
1691 Ga0495607_0000531
1692 Ga0495607_0000751
1693 Ga0495607_0001123
1694 Ga0495607_0003423
1695 Ga0495607_0008096
1696 Ga0495607_0012685
1697 Ga0495607_0014244
1698 Ga0495607_0020047
1699 Ga0495607_0046946
1700 Ga0495607_0065376
1701 Ga0495607_0095448
1702 Ga0495607_0117861
1703 Ga0495607_0171456
1704 Ga0495583_0000146
1705 Ga0495583_0000452
1706 Ga0495583_0001254
1707 Ga0495583_0002206
1708 Ga0495583_0005888
1709 Ga0495583_0015935
1710 Ga0495606_0000115
1711 Ga0495606_0000246
1712 Ga0495606_0000454
1713 Ga0495606_0000477
1714 Ga0495606_0001164
1715 Ga0495606_0002670
1716 Ga0495606_0007824
1717 Ga0495606_0009157
1718 Ga0495606_0038528
1719 Ga0495610_0003687
1720 Ga0495610_0008413
1721 Ga0495610_0014124
1722 Ga0495610_0054587
1723 Ga0495616_0000852
1724 Ga0495616_0035228
1725 Ga0495616_0051050
1726 Ga0495616_0088639
1727 Ga0495620_0000023
1728 Ga0495620_0000108
1729 Ga0495620_0001611
1730 Ga0495620_0001719
1731 Ga0495620_0002090
1732 Ga0495620_0003034
1733 Ga0495620_0003388
1734 Ga0495620_0089078
1735 Ga0495631_0001318
1736 Ga0495631_0004094
1737 Ga0495631_0006065
1738 Ga0495632_0001735
1739 Ga0495632_0001795
1740 Ga0495632_0003309
1741 Ga0495632_0005231
1742 Ga0495632_0015933
1743 Ga0495632_0182428
1744 Ga0495637_0000054
1745 Ga0495637_0000194
1746 Ga0495637_0000269
1747 Ga0495637_0000466
1748 Ga0495637_0004473
1749 Ga0495637_0006747
1750 Ga0495637_0015104
1751 Ga0495637_0020194
1752 Ga0495637_0026282
1753 Ga0495637_0041970
1754 Ga0495637_0052122
1755 Ga0495643_0000402
1756 Ga0495643_0000730
1757 Ga0495643_0001170
1758 Ga0495643_0001604
1759 Ga0495643_0001680
1760 Ga0495643_0002170
1761 Ga0495643_0002454
1762 Ga0495643_0009905
1763 Ga0495643_0010294
1764 Ga0495643_0019663
1765 Ga0495643_0087473
1766 Ga0495648_0000783
1767 Ga0495648_0001858
1768 Ga0495648_0002460
1769 Ga0495648_0002748
1770 Ga0495648_0012345
1771 Ga0495648_0017798
1772 Ga0495648_0183970
1773 Ga0495666_0005396
1774 Ga0495666_0042994
1775 Ga0495666_0058971
1776 Ga0495666_0107903
1777 Ga0495642_0000536
1778 Ga0495642_0000555
1779 Ga0495642_0015291
1780 Ga0495654_0000210
1781 Ga0495654_0001010
1782 Ga0495654_0002438
1783 Ga0495654_0003497
1784 Ga0495654_0009898
1785 Ga0495654_0015931
1786 Ga0495654_0023317
1787 Ga0495654_0090195
1788 Ga0495586_0022525
1789 Ga0495587_0003520
1790 Ga0495587_0057179
1791 Ga0495609_0000061
1792 Ga0495609_0000101
1793 Ga0495609_0000696
1794 Ga0495609_0001338
1795 Ga0495609_0011057
1796 Ga0495609_0022196
1797 Ga0495597_0000676
1798 Ga0495597_0004012
1799 Ga0495597_0005112
1800 Ga0495597_0005967
1801 Ga0495597_0021813
1802 Ga0495597_0135952
1803 Ga0495622_0005884
1804 Ga0495622_0006049
1805 Ga0495622_0020035
1806 Ga0495633_0000129
1807 Ga0495633_0003624
1808 Ga0495656_0004240
1809 Ga0495668_0001708
1810 Ga0495668_0003520
1811 Ga0495668_0029435
1812 Ga0495668_0093913
1813 Ga0495668_0225844
1814 Ga0495634_0015246
1815 Ga0495634_0311913
1816 Ga0495611_0000525
1817 Ga0495611_0000571
1818 Ga0495611_0001821
1819 Ga0495625_0000147
1820 Ga0495625_0011548
1821 Ga0495625_0135001
1822 Ga0495625_0159038
1823 Ga0495635_0000583
1824 Ga0495635_0000604
1825 Ga0495659_0001461
1826 Ga0495659_0006759
1827 Ga0495661_0000153
1828 Ga0495661_0000196
1829 Ga0495661_0000431
1830 Ga0495661_0000484
1831 Ga0495661_0001727
1832 Ga0495661_0058509
1833 Ga0495661_0063649
1834 Ga0495661_0074274
1835 Ga0495661_0082777
1836 Ga0495661_0252256
1837 Ga0495588_0005506
1838 Ga0495623_0050832
1839 Ga0495646_0039441
1840 Ga0495669_0160323
1841 Ga0495613_0054929
1842 Ga0495670_0000388
1843 Ga0495670_0001599
1844 Ga0495670_0003795
1845 Ga0495670_0005439
1846 Ga0495670_0007272
1847 Ga0495671_0000471
1848 Ga0495671_0001192
1849 Ga0495671_0001895
1850 Ga0495671_0001900
1851 Ga0495671_0002856
1852 Ga0495671_0003042
1853 Ga0495671_0037684
1854 Ga0495671_0042708
1855 Ga0495671_0086214
1856 Ga0495649_0000711
1857 Ga0495649_0000968
1858 Ga0495649_0002156
1859 Ga0495649_0003441
1860 Ga0495649_0007937
1861 Ga0495649_0009797
1862 Ga0495649_0013458
1863 Ga0495649_0077864
1864 Ga0495589_0002719
1865 Ga0495589_0007109
1866 Ga0495589_0014900
1867 Ga0495589_0026339
1868 Ga0495589_0055325
1869 Ga0495600_0000547
1870 Ga0495660_0000431
1871 Ga0495660_0004060
1872 Ga0495660_0014906
1873 Ga0495660_0020968
1874 Ga0495660_0036778
1875 Ga0495660_0055822
1876 Ga0495660_0083874
1877 Ga0495581_0107187
1878 Ga0495604_0012043
1879 Ga0495604_0016005
1880 Ga0495636_0008819
1881 Ga0495674_0034797
1882 Ga0495672_0003079
1883 Ga0495672_0003447
1884 Ga0495672_0004295
1885 Ga0495672_0005642
1886 Ga0495672_0006899
1887 Ga0495672_0012746
1888 Ga0495676_0000027
1889 Ga0495676_0021111
1890 Ga0495676_0049708
1891 Ga0495680_0005758
1892 Ga0495683_0000038
1893 Ga0495683_0000075
1894 Ga0495683_0001303
1895 Ga0495683_0001374
1896 Ga0495683_0052279
1897 Ga0495683_0071627
1898 Ga0495683_0165052
1899 Ga0495687_003446
1900 Ga0495687_004754
1901 Ga0495687_010017
1902 Ga0495675_0156627
1903 Ga0495677_0001006
1904 Ga0495679_000237
1905 Ga0495679_000495
1906 Ga0495679_013833
1907 Ga0495685_066872
1908 Ga0495673_0000389
1909 Ga0495673_0001628
1910 Ga0495673_0001807
1911 Ga0495673_0005394
1912 Ga0495673_0008202
1913 Ga0495673_0012990
1914 Ga0495673_0019427
1915 Ga0495673_0041012
1916 Ga0495673_0095900
1917 Ga0495681_0003081
1918 Ga0495681_0003215
1919 Ga0495681_0004777
1920 Ga0495681_0012244
1921 Ga0495681_0022208
1922 Ga0495681_0031756
1923 Ga0495686_0007608
1924 Ga0495686_0125865
1925 Ga0495686_0127672
1926 Ga0495593_0038639
1927 Ga0495593_0071064
1928 Ga0495593_0106202
1929 Ga0495626_0000067
1930 Ga0495626_0000507
1931 Ga0495626_0000684
1932 Ga0495626_0000996
1933 Ga0495626_0001171
1934 Ga0495626_0001627
1935 Ga0495626_0012837
1936 Ga0495626_0013045
1937 Ga0495626_0027693
1938 Ga0495626_0033525
1939 Ga0496102_0034338
1940 Ga0496103_0014973
1941 Ga0496106_0484204
1942 Ga0496109_0091764
1943 Ga0496110_0069750
1944 Ga0496110_0146071
1945 Ga0496111_0049816
1946 Ga0496111_0055581
1947 Ga0496112_0228484
1948 Ga0496113_0214562
1949 Ga0496114_0024637
1950 Ga0496116_0000242
1951 Ga0496116_0001670
1952 Ga0496116_0002076
1953 Ga0496116_0023569
1954 Ga0496117_0000270
1955 Ga0496117_0000932
1956 Ga0496117_0002067
1957 Ga0496118_0042191
1958 Ga0496118_0068266
1959 Ga0496118_0069267
1960 Ga0496119_0000704
1961 Ga0496120_0001473
1962 Ga0496120_0004336
1963 Ga0496121_0000318
1964 Ga0496121_0003788
1965 Ga0496121_0004345
1966 Ga0496121_0149535
1967 Ga0496121_0268043
1968 Ga0496122_0000517
1969 Ga0496122_0002629
1970 Ga0496122_0007631
1971 Ga0496122_0138317
1972 Ga0496122_0141719
1973 Ga0496123_0000243
1974 Ga0496123_0007055
1975 Ga0496123_0040963
1976 Ga0496124_0000511
1977 Ga0496124_0001467
1978 Ga0496124_0002260
1979 Ga0496124_0002328
1980 Ga0496124_0007063
1981 Ga0496124_0015657
1982 Ga0496124_0023005
1983 Ga0496124_0028667
1984 Ga0496124_0087458
1985 Ga0496124_0107378
1986 Ga0496124_0172950
1987 Ga0496124_0216254
1988 Ga0496125_0000971
1989 Ga0496125_0002177
1990 Ga0496125_0006705
1991 Ga0496125_0021605
1992 Ga0496125_0045763
1993 Ga0496125_0113892
1994 Ga0496126_0055003
1995 Ga0496126_0099192
1996 Ga0496126_0698856
1997 Ga0495678_000106
1998 Ga0495678_000499
1999 Ga0495678_000694
2000 Ga0495678_002365
2001 Ga0495678_008447
2002 Ga0495678_008793
2003 Ga0495678_090731
2004 Ga0495682_0000069
2005 Ga0495682_0000804
2006 Ga0495682_0021349
2007 Ga0501031_0079268
2008 Ga0501032_0010649
2009 Ga0501034_0000164
2010 Ga0501034_0042054
2011 Ga0501034_0060143
2012 Ga0501034_0086454
2013 Ga0501037_0071136
2014 Ga0501038_0165610
2015 Ga0501043_0055575
2016 Ga0501047_0530647
2017 Ga0501243_004728
2018 Ga0501044_0317260
2019 Ga0501226_000034
2020 Ga0501226_000117
2021 nmdc:mga00v17_119646_c1
2022 nmdc:mga05p37_250708_c1
2023 nmdc:mga08y16_396816_c1
2024 nmdc:mga0sz30_7760_c1
2025 Ga0500593_000476
2026 Ga0500628_067781
2027 Ga0500659_0002369
2028 2510282678
2029 2510295333
2030 2510311042
2031 2511264702
2032 2511274353
2033 2511278470
2034 2511279868
2035 2511289681
2036 2511294610
2037 2511298919
2038 2511304203
2039 2511313102
2040 2511322234
2041 2511325254
2042 2511331101
2043 2511332238
2044 2511347000
2045 2511348012
2046 2511359156
2047 2511366124
2048 2511370490
2049 2511377020
2050 2511412441
2051 2511822033
2052 2512325215
2053 2554818311
2054 2554818595
2055 2555245329
2056 2555667044
2057 2583795313
2058 2597855295
2059 2597861296
2060 2597867043
2061 2599355547
2062 2599363050
2063 2599368644
2064 2599376159
2065 2599380653
2066 2599387831
2067 2599395017
2068 2599401183
2069 2599406782
2070 2599449484
2071 2599462381
2072 2599468196
2073 2599487421
2074 2599491398
2075 2599503814
2076 2599506122
2077 2599511556
2078 2599516530
2079 2599612597
2080 2599767791
2081 2599804223
2082 2599879417
2083 2599887892
2084 2599893059
2085 2599899417
2086 2599933247
2087 2599942004
2088 2599948637
2089 2599954985
2090 2599963560
2091 2599966423
2092 2599975255
2093 2599977272
2094 2599986292
2095 2599991345
2096 2599995162
2097 2600000826
2098 2600007474
2099 2600011295
2100 2600020215
2101 2600026578
2102 2600029540
2103 2600037608
2104 2600044264
2105 2600050046
2106 2600054706
2107 2600059889
2108 2600065308
2109 2600073249
2110 2600078980
2111 2600215003
2112 2600358776
2113 2600363094
2114 2601627782
2115 2601693370
2116 2601775169
2117 2601798184
2118 2606077072
2119 2606129682
2120 2608380395
2121 2608384257
2122 2621296449
2123 2624477811
2124 2624489389
2125 2643843165
2126 2643843784
2127 2643873585
2128 2643956033
2129 2644020155
2130 2644184167
2131 2644282863
2132 2644624398
2133 2652544482
2134 2671091921
2135 2671099691
2136 2671129625
2137 2671771232
2138 2677900373
2139 2678266506
2140 2715749509
2141 2715754506
2142 2723246199
2143 2738673395
2144 2738690672
2145 2738751788
2146 2738807641
2147 2738860829
2148 2738895001
2149 2739200952
2150 2739261788
2151 2739266446
2152 2739288737
2153 2739289693
2154 2739294049
2155 2739295005
2156 2739312156
2157 2743740864
2158 2745007736
2159 2765581309
2160 2774118033
2161 2774129165
2162 2774136530
2163 2784261474
2164 2784316520
2165 2794593604
2166 2807405892
2167 2807454227
2168 2808858624
2169 2808905826
2170 2808923943
2171 2808928115
2172 2808938584
2173 2808942257
2174 2808946202
2175 2808950703
2176 2808960674
2177 2808967129
2178 2808980049
2179 2808995769
2180 2809001939
2181 2812369855
2182 2817488072
2183 2819655466
2184 2819704838
2185 2825654706
2186 2826582348
2187 2834031330
2188 2842805456
2189 2842807949
2190 2842816999
2191 2842832034
2192 2842833780
2193 2842838305
2194 2842846014
2195 2842852121
2196 2842855968
2197 2844667531
2198 2852616727
2199 2852662613
2200 2852671695
2201 2860345250
2202 2860868096
2203 2878029754
2204 2880230704
2205 2904518615
2206 2904553440
2207 2908446685
2208 2912963883
2209 2913036894
2210 2917070781
2211 2917833288
2212 2919067989
2213 2919126172
2214 2919156189
2215 2919388836
2216 2919457905
2217 2919487013
2218 2919487799
2219 2919702406
2220 2923153696
2221 2923523941
2222 2923589324
2223 2929144364
2224 2929189979
2225 2931372309
2226 2931391040
2227 2931398449
2228 2935357884
2229 2939640523
2230 2939654486
2231 2945930503
2232 2945967252
2233 2946012849
2234 2946028288
2235 2947234805
2236 2969304510
2237 2974293740
2238 2974302390
2239 2984292417
2240 2984500056
2241 2984506570
2242 2988731826
2243 2998140074
2244 3007253994
2245 3007317262
2246 3007398979
2247 3007419681
2248 3007422426
2249 3007517492
2250 3007617046
2251 3007623817
2252 3007722064
2253 3007804062
2254 3007859519
2255 3007864748
2256 3007871724
2257 3007874921
2258 637317447
2259 8011351071
2260 8011356246
2261 8015687959
2262 8016731414
2263 8019769374
2264 8019779629
2265 8029995176
2266 8052494527
2267 8054287601
2268 8054349212
2269 8054503646
2270 8054930031
2271 8055771057
2272 8055818009
2273 8055883518
2274 8056116224
2275 8056120821
2276 8056126093
2277 8056131978
2278 8056137516
2279 8056140045
2280 8056143302
2281 8056151124
2282 8056160071
2283 8056164007
2284 8056170973
2285 8056177106
2286 8056182197
2287 8056570805
2288 8057802339

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

30

221

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rw3-assembly2.cif.gz_B the molecular basis for sugar import in malaria parasites. 0.4784 16 201
7yub-assembly1.cif.gz_R s1p-bound human spns2 0.4495 7 204
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.4471 12 202
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.4445 16 201
6ob7-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, dilazep bound 0.441 8 232
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9048 15 203 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8914 15 203 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7232 15 203 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6711 15 203 1.20.1250.20
af_Q54DL1_165_416_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5432 6 206 1.20.1250.20
ID Description Score Start End GO Terms
AF-N6V0S1-F1-model_v4 Integral membrane protein TerC 0.9359 2 239 GO:0016020
AF-A0A0F0KRP1-F1-model_v4 Integral membrane protein TerC family protein 0.9325 5 242 GO:0016020
AF-A0A2L0WE71-F1-model_v4 deleted 0.9297 2 239
AF-A0A561C2F0-F1-model_v4 deleted 0.9288 2 242
AF-A0A6S7CNP0-F1-model_v4 Membrane protein TerC 0.9282 3 242 GO:0016020

Map