F490752
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1144 | 590 | 2288 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10076055|Ga0105244_100760552 |
| Length | 272 |
| Sequence | MRLDAGASPIPLKGKHMEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQPRTRIFGLALAMVTRIMLLLSITWVMRLTDDLFVVLGQGISGRDLILFFGGLFLLWKSSQEIYHGLEGEEENADEPKGSGGKFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIAAIIVAVLVMMACAGTIADFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFAMAFSLAVEAINIRMRTSLARKAGKEHEAVKLRKDVPGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 76 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 77 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 177 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 178 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 188 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 189 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 190 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 191 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 192 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 193 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 194 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 195 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 196 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 197 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 198 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 199 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 200 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 201 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 202 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 203 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 204 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 205 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 206 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 207 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 208 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 209 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 210 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 211 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 212 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 213 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 216 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 221 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 222 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 313 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 314 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 315 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 316 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 341 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 342 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 343 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 344 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 345 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 346 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 347 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 348 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 349 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 350 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 351 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 352 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 353 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 354 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 355 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 356 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 357 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 358 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 359 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 360 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 361 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 362 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 363 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 364 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 365 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 366 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 367 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 368 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 369 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 370 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 371 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 372 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 373 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 374 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 375 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 376 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 377 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 378 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 379 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 380 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 381 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 382 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 383 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 384 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 385 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 386 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 387 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 388 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 389 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 390 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 391 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 392 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 393 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 394 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 395 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 396 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 397 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 398 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 399 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 400 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 401 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 402 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 403 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 404 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 405 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 406 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 407 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 408 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 409 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 410 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 411 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 412 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 413 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 414 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 415 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 416 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 417 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 418 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 419 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 420 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 421 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 422 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 423 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 424 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 425 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 426 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 427 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 428 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 429 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 430 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 431 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 432 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 433 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 434 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 435 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 436 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 437 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 438 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 439 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 440 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 441 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 442 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 443 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 444 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 445 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 446 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 447 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 448 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 449 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 450 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 451 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 452 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 453 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 454 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 455 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 456 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 457 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 458 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 459 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 460 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 461 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 462 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 463 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 464 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 465 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 466 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 467 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 468 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 469 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 470 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 471 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 472 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 473 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 474 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 475 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 476 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 477 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 478 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 479 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 480 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 481 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 482 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 483 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 484 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 485 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 486 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 487 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 488 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 489 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 490 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 491 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 492 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 493 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 494 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 495 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 496 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 497 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 498 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 499 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 500 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 501 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 502 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 503 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 504 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 505 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 506 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 507 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 508 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 509 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 510 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 511 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 512 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 513 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 514 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 515 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 516 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 517 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 518 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 519 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 520 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 521 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 522 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 523 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 524 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 525 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 526 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 527 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 528 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 529 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 530 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 531 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 532 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 533 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 534 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 535 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 536 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 537 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 538 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 539 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 540 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 541 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 542 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 543 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 544 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 545 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 546 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 547 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 548 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 549 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 550 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 551 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 552 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 553 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 554 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 555 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 556 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 557 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 558 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 559 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 560 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 561 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 562 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 563 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 564 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 565 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 566 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 567 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 568 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 569 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 570 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 571 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 572 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 573 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 574 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 575 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 576 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 577 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 578 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 579 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 580 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 581 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 582 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 583 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 584 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 585 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 586 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 587 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 588 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 589 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 590 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.19 |
| Metatranscriptomes | 0 |
| Isolates | 22.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 6.47 |
| Nodule | 2.62 |
| Rhizoplane | 6.73 |
| Rhizosphere | 70.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10076055 | 3300009036 | Bacteria | 1668 |
| 2 | MRS2a_Contig_6737 | 2124908027 | Bacteria | 2198 |
| 3 | MRS2a_Contig_799 | 2124908027 | Bacteria | 11033 |
| 4 | SwRhRL2b_contig_803191 | 2162886007 | Bacteria | 11283 |
| 5 | JGI24741J21665_1000755 | 3300001915 | Bacteria | 9721 |
| 6 | JGI24750J21931_1025787 | 3300002070 | Bacteria | 844 |
| 7 | JGI25155J39150_1000041 | 3300002704 | Bacteria | 88843 |
| 8 | JGI25156J39149_1000031 | 3300002705 | Bacteria | 124983 |
| 9 | JGI25162J39368_1000208 | 3300002737 | Bacteria | 62041 |
| 10 | JGI25162J39368_1000459 | 3300002737 | Bacteria | 31876 |
| 11 | JGI25154J39366_1000049 | 3300002738 | Bacteria | 124995 |
| 12 | JGI25157J39369_1000041 | 3300002741 | Bacteria | 124982 |
| 13 | JGI25163J39215_1000407 | 3300002771 | Bacteria | 13526 |
| 14 | JGI25163J39215_1000589 | 3300002771 | Bacteria | 10199 |
| 15 | JGI25164J39214_1000297 | 3300002772 | Bacteria | 34174 |
| 16 | JGI25164J39214_1000314 | 3300002772 | Bacteria | 31880 |
| 17 | JGI25165J46597_1000175 | 3300003214 | Bacteria | 100117 |
| 18 | JGI25165J46597_1000193 | 3300003214 | Bacteria | 91069 |
| 19 | rootH1_10017529 | 3300003316 | Bacteria | 6372 |
| 20 | rootH2_10016165 | 3300003320 | Bacteria | 8851 |
| 21 | rootL2_10030466 | 3300003322 | Bacteria | 6394 |
| 22 | rootL2_10110202 | 3300003322 | Bacteria | 2659 |
| 23 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 24 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 25 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 26 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 27 | Ga0055525_1000117 | 3300003759 | Bacteria | 120690 |
| 28 | Ga0055535_1004800 | 3300003761 | Bacteria | 3160 |
| 29 | Ga0055536_1000272 | 3300003781 | Bacteria | 39323 |
| 30 | Ga0055536_1003957 | 3300003781 | Bacteria | 7765 |
| 31 | Ga0055536_1008918 | 3300003781 | Bacteria | 4233 |
| 32 | Ga0055536_1029466 | 3300003781 | Bacteria | 1474 |
| 33 | Ga0055530_10000081 | 3300003791 | Bacteria | 82192 |
| 34 | Ga0055530_10000548 | 3300003791 | Bacteria | 32545 |
| 35 | Ga0055530_10002934 | 3300003791 | Bacteria | 10326 |
| 36 | Ga0055530_10009440 | 3300003791 | Bacteria | 3748 |
| 37 | Ga0055540_1000121 | 3300003792 | Bacteria | 82192 |
| 38 | Ga0055540_1000242 | 3300003792 | Bacteria | 49989 |
| 39 | Ga0055540_1001116 | 3300003792 | Bacteria | 16913 |
| 40 | Ga0055540_1032823 | 3300003792 | Bacteria | 1181 |
| 41 | Ga0055531_10001033 | 3300003794 | Bacteria | 22056 |
| 42 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 43 | Ga0058692_1008307 | 3300003856 | Bacteria | 2683 |
| 44 | Ga0065714_10002860 | 3300005288 | Bacteria | 11454 |
| 45 | Ga0065714_10003342 | 3300005288 | Bacteria | 7781 |
| 46 | Ga0065714_10005964 | 3300005288 | Bacteria | 4038 |
| 47 | Ga0065714_10021354 | 3300005288 | Bacteria | 2008 |
| 48 | Ga0065714_10064636 | 3300005288 | Bacteria | 26785 |
| 49 | Ga0065714_10107372 | 3300005288 | Bacteria | 1532 |
| 50 | Ga0065704_10001959 | 3300005289 | Bacteria | 9751 |
| 51 | Ga0065704_10009110 | 3300005289 | Bacteria | 5158 |
| 52 | Ga0065704_10070543 | 3300005289 | Bacteria | 21104 |
| 53 | Ga0065704_10071119 | 3300005289 | Bacteria | 13035 |
| 54 | Ga0065704_10121284 | 3300005289 | Bacteria | 1768 |
| 55 | Ga0065712_10001109 | 3300005290 | Bacteria | 11350 |
| 56 | Ga0065712_10068500 | 3300005290 | Bacteria | 10228 |
| 57 | Ga0065712_10074016 | 3300005290 | Bacteria | 4210 |
| 58 | Ga0065715_10013766 | 3300005293 | Bacteria | 3460 |
| 59 | Ga0070670_100000010 | 3300005331 | Bacteria | 277365 |
| 60 | Ga0070670_100003035 | 3300005331 | Bacteria | 13890 |
| 61 | Ga0068869_100084556 | 3300005334 | Bacteria | 2375 |
| 62 | Ga0070691_10142847 | 3300005341 | Bacteria | 1221 |
| 63 | Ga0070661_100000237 | 3300005344 | Bacteria | 45515 |
| 64 | Ga0070661_100293685 | 3300005344 | Bacteria | 1264 |
| 65 | Ga0070669_100000158 | 3300005353 | Bacteria | 61318 |
| 66 | Ga0070669_100000277 | 3300005353 | Bacteria | 41213 |
| 67 | Ga0070669_100002451 | 3300005353 | Bacteria | 13426 |
| 68 | Ga0070669_100035538 | 3300005353 | Bacteria | 3611 |
| 69 | Ga0070675_100017974 | 3300005354 | Bacteria | 5627 |
| 70 | Ga0070671_100000012 | 3300005355 | Bacteria | 196420 |
| 71 | Ga0070674_100037246 | 3300005356 | Bacteria | 3270 |
| 72 | Ga0070688_100002333 | 3300005365 | Bacteria | 9573 |
| 73 | Ga0070659_100407812 | 3300005366 | Bacteria | 1148 |
| 74 | Ga0070667_100000097 | 3300005367 | Bacteria | 108709 |
| 75 | Ga0070700_100014372 | 3300005441 | Bacteria | 4469 |
| 76 | Ga0070700_100062768 | 3300005441 | Bacteria | 2348 |
| 77 | Ga0070662_100000063 | 3300005457 | Bacteria | 57210 |
| 78 | Ga0070662_100087854 | 3300005457 | Bacteria | 2328 |
| 79 | Ga0068867_100000146 | 3300005459 | Bacteria | 45501 |
| 80 | Ga0070685_10000077 | 3300005466 | Bacteria | 58856 |
| 81 | Ga0070697_100147240 | 3300005536 | Bacteria | 1983 |
| 82 | Ga0068853_100000143 | 3300005539 | Bacteria | 48815 |
| 83 | Ga0070672_100398226 | 3300005543 | Bacteria | 1180 |
| 84 | Ga0070686_100158990 | 3300005544 | Bacteria | 1590 |
| 85 | Ga0070665_100078702 | 3300005548 | Bacteria | 3303 |
| 86 | Ga0070665_100089367 | 3300005548 | Bacteria | 3086 |
| 87 | Ga0070665_100509061 | 3300005548 | Bacteria | 1215 |
| 88 | Ga0068857_100627854 | 3300005577 | Bacteria | 1017 |
| 89 | Ga0068854_100004725 | 3300005578 | Bacteria | 8585 |
| 90 | Ga0068852_100187387 | 3300005616 | Bacteria | 1949 |
| 91 | Ga0068859_100014469 | 3300005617 | Bacteria | 7920 |
| 92 | Ga0068859_100404284 | 3300005617 | Bacteria | 1461 |
| 93 | Ga0068864_100000018 | 3300005618 | Bacteria | 277365 |
| 94 | Ga0068861_100001394 | 3300005719 | Bacteria | 15177 |
| 95 | Ga0068861_100059167 | 3300005719 | Bacteria | 2932 |
| 96 | Ga0068861_100188902 | 3300005719 | Bacteria | 1721 |
| 97 | Ga0068851_10000018 | 3300005834 | Bacteria | 137425 |
| 98 | Ga0068863_100162161 | 3300005841 | Bacteria | 2142 |
| 99 | Ga0068863_100263895 | 3300005841 | Bacteria | 1665 |
| 100 | Ga0068858_100024458 | 3300005842 | Bacteria | 5627 |
| 101 | Ga0068858_100155276 | 3300005842 | Bacteria | 2153 |
| 102 | Ga0068860_100000532 | 3300005843 | Bacteria | 46509 |
| 103 | Ga0068862_100000522 | 3300005844 | Bacteria | 40581 |
| 104 | Ga0068862_100136925 | 3300005844 | Bacteria | 2171 |
| 105 | Ga0075364_10031476 | 3300006051 | Bacteria | 3409 |
| 106 | Ga0075364_10113138 | 3300006051 | Bacteria | 1812 |
| 107 | Ga0075432_10000648 | 3300006058 | Bacteria | 10657 |
| 108 | Ga0070712_100201381 | 3300006175 | Bacteria | 1564 |
| 109 | Ga0075362_10066213 | 3300006177 | Bacteria | 1641 |
| 110 | Ga0075362_10072007 | 3300006177 | Bacteria | 1580 |
| 111 | Ga0075369_10045588 | 3300006186 | Bacteria | 1885 |
| 112 | Ga0097621_100081003 | 3300006237 | Bacteria | 2701 |
| 113 | Ga0068871_100141867 | 3300006358 | Bacteria | 2043 |
| 114 | Ga0075428_100214665 | 3300006844 | Bacteria | 2079 |
| 115 | Ga0068865_100003939 | 3300006881 | Bacteria | 8916 |
| 116 | Ga0075436_100050318 | 3300006914 | Bacteria | 2875 |
| 117 | Ga0097620_100014468 | 3300006931 | Bacteria | 7920 |
| 118 | Ga0097620_100404267 | 3300006931 | Bacteria | 1461 |
| 119 | Ga0099823_1000217 | 3300006944 | Bacteria | 32286 |
| 120 | Ga0079104_1000291 | 3300006946 | Bacteria | 63569 |
| 121 | Ga0079104_1000306 | 3300006946 | Bacteria | 62131 |
| 122 | Ga0099826_10012980 | 3300006948 | Bacteria | 6281 |
| 123 | Ga0105251_10000068 | 3300009011 | Bacteria | 98955 |
| 124 | Ga0105251_10000881 | 3300009011 | Bacteria | 26861 |
| 125 | Ga0105251_10002062 | 3300009011 | Bacteria | 16229 |
| 126 | Ga0105251_10004312 | 3300009011 | Bacteria | 9752 |
| 127 | Ga0105251_10007262 | 3300009011 | Bacteria | 6870 |
| 128 | Ga0105251_10071828 | 3300009011 | Bacteria | 1610 |
| 129 | Ga0105244_10000726 | 3300009036 | Bacteria | 28455 |
| 130 | Ga0105244_10001163 | 3300009036 | Bacteria | 21788 |
| 131 | Ga0105244_10001870 | 3300009036 | Bacteria | 16359 |
| 132 | Ga0105244_10004378 | 3300009036 | Bacteria | 9736 |
| 133 | Ga0105244_10005309 | 3300009036 | Bacteria | 8578 |
| 134 | Ga0105244_10007469 | 3300009036 | Bacteria | 6945 |
| 135 | Ga0105244_10011847 | 3300009036 | Bacteria | 5197 |
| 136 | Ga0105244_10030106 | 3300009036 | Bacteria | 2891 |
| 137 | Ga0105244_10030745 | 3300009036 | Bacteria | 2854 |
| 138 | Ga0105244_10072164 | 3300009036 | Bacteria | 1720 |
| 139 | Ga0105244_10132417 | 3300009036 | Bacteria | 1203 |
| 140 | Ga0105250_10000825 | 3300009092 | Bacteria | 18449 |
| 141 | Ga0105250_10022663 | 3300009092 | Bacteria | 2530 |
| 142 | Ga0105250_10023442 | 3300009092 | Bacteria | 2486 |
| 143 | Ga0105250_10031572 | 3300009092 | Bacteria | 2126 |
| 144 | Ga0105250_10037205 | 3300009092 | Bacteria | 1953 |
| 145 | Ga0105250_10038529 | 3300009092 | Bacteria | 1916 |
| 146 | Ga0105250_10056987 | 3300009092 | Bacteria | 1568 |
| 147 | Ga0111539_10096618 | 3300009094 | Bacteria | 3470 |
| 148 | Ga0111539_10935004 | 3300009094 | Bacteria | 1008 |
| 149 | Ga0114129_10289749 | 3300009147 | Bacteria | 2185 |
| 150 | Ga0105243_10000075 | 3300009148 | Bacteria | 112098 |
| 151 | Ga0105243_10000867 | 3300009148 | Bacteria | 28621 |
| 152 | Ga0105243_10001447 | 3300009148 | Bacteria | 20865 |
| 153 | Ga0105243_10010141 | 3300009148 | Bacteria | 7164 |
| 154 | Ga0105243_10097512 | 3300009148 | Bacteria | 2433 |
| 155 | Ga0105241_10398380 | 3300009174 | Bacteria | 1207 |
| 156 | Ga0105242_10000358 | 3300009176 | Bacteria | 36515 |
| 157 | Ga0105242_10090188 | 3300009176 | Bacteria | 2578 |
| 158 | Ga0105242_10214496 | 3300009176 | Bacteria | 1717 |
| 159 | Ga0105248_10019408 | 3300009177 | Bacteria | 7522 |
| 160 | Ga0105248_10123998 | 3300009177 | Bacteria | 2914 |
| 161 | Ga0105249_10093807 | 3300009553 | Bacteria | 2812 |
| 162 | Ga0105249_10152357 | 3300009553 | Bacteria | 2227 |
| 163 | Ga0105239_10087107 | 3300010375 | Bacteria | 3442 |
| 164 | Ga0105246_10000002 | 3300011119 | Bacteria | 103711 |
| 165 | Ga0105246_10000504 | 3300011119 | Bacteria | 21247 |
| 166 | Ga0105246_10010894 | 3300011119 | Bacteria | 5636 |
| 167 | Ga0157373_10003814 | 3300013100 | Bacteria | 11399 |
| 168 | Ga0157373_10006597 | 3300013100 | Bacteria | 8656 |
| 169 | Ga0157373_10023762 | 3300013100 | Bacteria | 4441 |
| 170 | Ga0157373_10051866 | 3300013100 | Bacteria | 2920 |
| 171 | Ga0157373_10094446 | 3300013100 | Bacteria | 2106 |
| 172 | Ga0157371_10000935 | 3300013102 | Bacteria | 32661 |
| 173 | Ga0157371_10000953 | 3300013102 | Bacteria | 32196 |
| 174 | Ga0157371_10002539 | 3300013102 | Bacteria | 17337 |
| 175 | Ga0157371_10076619 | 3300013102 | Bacteria | 2368 |
| 176 | Ga0157370_10000698 | 3300013104 | Bacteria | 41998 |
| 177 | Ga0157370_10000954 | 3300013104 | Bacteria | 36668 |
| 178 | Ga0157370_10002312 | 3300013104 | Bacteria | 23072 |
| 179 | Ga0157370_10186706 | 3300013104 | Bacteria | 1924 |
| 180 | Ga0157369_10023081 | 3300013105 | Bacteria | 6932 |
| 181 | Ga0157369_10521216 | 3300013105 | Bacteria | 1229 |
| 182 | Ga0157378_10002415 | 3300013297 | Bacteria | 16605 |
| 183 | Ga0157378_10024025 | 3300013297 | Bacteria | 5362 |
| 184 | Ga0163162_10017052 | 3300013306 | Bacteria | 7106 |
| 185 | Ga0163162_10079724 | 3300013306 | Bacteria | 3340 |
| 186 | Ga0163162_10224194 | 3300013306 | Bacteria | 2009 |
| 187 | Ga0157372_10013753 | 3300013307 | Bacteria | 8648 |
| 188 | Ga0157372_10052807 | 3300013307 | Bacteria | 4527 |
| 189 | Ga0163163_10001112 | 3300014325 | Bacteria | 22859 |
| 190 | Ga0163163_10101543 | 3300014325 | Bacteria | 2899 |
| 191 | Ga0157380_10272904 | 3300014326 | Bacteria | 1543 |
| 192 | Ga0182008_10001337 | 3300014497 | Bacteria | 16791 |
| 193 | Ga0182008_10003405 | 3300014497 | Bacteria | 9609 |
| 194 | Ga0157379_10054053 | 3300014968 | Bacteria | 3588 |
| 195 | Ga0157376_10100048 | 3300014969 | Bacteria | 2531 |
| 196 | Ga0157376_10136874 | 3300014969 | Bacteria | 2193 |
| 197 | Ga0182006_1001380 | 3300015261 | Bacteria | 14787 |
| 198 | Ga0182006_1002154 | 3300015261 | Bacteria | 10922 |
| 199 | Ga0182006_1003537 | 3300015261 | Bacteria | 7969 |
| 200 | Ga0182006_1008824 | 3300015261 | Bacteria | 4554 |
| 201 | Ga0182007_10000228 | 3300015262 | Bacteria | 37784 |
| 202 | Ga0182005_1000375 | 3300015265 | Bacteria | 24704 |
| 203 | Ga0182005_1000663 | 3300015265 | Bacteria | 16296 |
| 204 | Ga0182005_1018031 | 3300015265 | Bacteria | 1952 |
| 205 | Ga0163161_10050909 | 3300017792 | Bacteria | 2998 |
| 206 | Ga0163161_10097813 | 3300017792 | Bacteria | 2180 |
| 207 | Ga0163161_10173254 | 3300017792 | Bacteria | 1651 |
| 208 | Ga0163161_10287792 | 3300017792 | Bacteria | 1291 |
| 209 | Ga0163161_10339170 | 3300017792 | Bacteria | 1192 |
| 210 | Ga0213876_10008910 | 3300021384 | Bacteria | 5412 |
| 211 | Ga0209435_100014 | 3300025206 | Bacteria | 322129 |
| 212 | Ga0209435_100533 | 3300025206 | Bacteria | 7315 |
| 213 | Ga0209760_100082 | 3300025207 | Bacteria | 76168 |
| 214 | Ga0209760_100230 | 3300025207 | Bacteria | 23968 |
| 215 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 216 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 217 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 218 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 219 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 220 | Ga0209563_101660 | 3300025230 | Bacteria | 5677 |
| 221 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 222 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 223 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 224 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 225 | Ga0209437_109161 | 3300025233 | Bacteria | 1556 |
| 226 | Ga0209258_100237 | 3300025242 | Bacteria | 102220 |
| 227 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 228 | Ga0209646_1000277 | 3300025246 | Bacteria | 45368 |
| 229 | Ga0209026_1000073 | 3300025250 | Bacteria | 205399 |
| 230 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 231 | Ga0209759_1000013 | 3300025256 | Bacteria | 399300 |
| 232 | Ga0209759_1007431 | 3300025256 | Bacteria | 3523 |
| 233 | Ga0209759_1018453 | 3300025256 | Bacteria | 1684 |
| 234 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 235 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 236 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 237 | Ga0209676_1000157 | 3300025292 | Bacteria | 163094 |
| 238 | Ga0209676_1000222 | 3300025292 | Bacteria | 124695 |
| 239 | Ga0209676_1000583 | 3300025292 | Bacteria | 54696 |
| 240 | Ga0209676_1002274 | 3300025292 | Bacteria | 14109 |
| 241 | Ga0209676_1002823 | 3300025292 | Bacteria | 11488 |
| 242 | Ga0209676_1004012 | 3300025292 | Bacteria | 8476 |
| 243 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 244 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 245 | Ga0209050_1000296 | 3300025298 | Bacteria | 104732 |
| 246 | Ga0209050_1000318 | 3300025298 | Bacteria | 97317 |
| 247 | Ga0209050_1001114 | 3300025298 | Bacteria | 32494 |
| 248 | Ga0209051_1000088 | 3300025303 | Bacteria | 180480 |
| 249 | Ga0209051_1000143 | 3300025303 | Bacteria | 135182 |
| 250 | Ga0209051_1000295 | 3300025303 | Bacteria | 79621 |
| 251 | Ga0209051_1004120 | 3300025303 | Bacteria | 9105 |
| 252 | Ga0209051_1005691 | 3300025303 | Bacteria | 7196 |
| 253 | Ga0209257_1000143 | 3300025304 | Bacteria | 199975 |
| 254 | Ga0209257_1011914 | 3300025304 | Bacteria | 4103 |
| 255 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 256 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 257 | Ga0207696_1000151 | 3300025711 | Bacteria | 120171 |
| 258 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 259 | Ga0207696_1003300 | 3300025711 | Bacteria | 7439 |
| 260 | Ga0207696_1007367 | 3300025711 | Bacteria | 4315 |
| 261 | Ga0207696_1015831 | 3300025711 | Bacteria | 2543 |
| 262 | Ga0207696_1024677 | 3300025711 | Bacteria | 1882 |
| 263 | Ga0207696_1028968 | 3300025711 | Bacteria | 1694 |
| 264 | Ga0207655_1000135 | 3300025728 | Bacteria | 143597 |
| 265 | Ga0207655_1000548 | 3300025728 | Bacteria | 47302 |
| 266 | Ga0207655_1000667 | 3300025728 | Bacteria | 40487 |
| 267 | Ga0207655_1000754 | 3300025728 | Bacteria | 36294 |
| 268 | Ga0207655_1001254 | 3300025728 | Bacteria | 24214 |
| 269 | Ga0207655_1001422 | 3300025728 | Bacteria | 22200 |
| 270 | Ga0207655_1001733 | 3300025728 | Bacteria | 19145 |
| 271 | Ga0207655_1002247 | 3300025728 | Bacteria | 15981 |
| 272 | Ga0207655_1004181 | 3300025728 | Bacteria | 10359 |
| 273 | Ga0207655_1004957 | 3300025728 | Bacteria | 9227 |
| 274 | Ga0207655_1006266 | 3300025728 | Bacteria | 7910 |
| 275 | Ga0207655_1008704 | 3300025728 | Bacteria | 6400 |
| 276 | Ga0207655_1008902 | 3300025728 | Bacteria | 6305 |
| 277 | Ga0207655_1009242 | 3300025728 | Bacteria | 6146 |
| 278 | Ga0207655_1018736 | 3300025728 | Bacteria | 3655 |
| 279 | Ga0207655_1026577 | 3300025728 | Bacteria | 2777 |
| 280 | Ga0207655_1036871 | 3300025728 | Bacteria | 2162 |
| 281 | Ga0207655_1038021 | 3300025728 | Bacteria | 2110 |
| 282 | Ga0207655_1087014 | 3300025728 | Bacteria | 1110 |
| 283 | Ga0207713_1000103 | 3300025735 | Bacteria | 138415 |
| 284 | Ga0207713_1000325 | 3300025735 | Bacteria | 53895 |
| 285 | Ga0207713_1003599 | 3300025735 | Bacteria | 10444 |
| 286 | Ga0207713_1003772 | 3300025735 | Bacteria | 10160 |
| 287 | Ga0207713_1004686 | 3300025735 | Bacteria | 8816 |
| 288 | Ga0207713_1006272 | 3300025735 | Bacteria | 7272 |
| 289 | Ga0207713_1006916 | 3300025735 | Bacteria | 6813 |
| 290 | Ga0207713_1010743 | 3300025735 | Bacteria | 5043 |
| 291 | Ga0207713_1016458 | 3300025735 | Bacteria | 3751 |
| 292 | Ga0207713_1020322 | 3300025735 | Bacteria | 3221 |
| 293 | Ga0207713_1022973 | 3300025735 | Bacteria | 2947 |
| 294 | Ga0207713_1041073 | 3300025735 | Bacteria | 1933 |
| 295 | Ga0207713_1048900 | 3300025735 | Bacteria | 1700 |
| 296 | Ga0207713_1050375 | 3300025735 | Bacteria | 1663 |
| 297 | Ga0207710_10008242 | 3300025900 | Bacteria | 4400 |
| 298 | Ga0207671_10000876 | 3300025914 | Bacteria | 38121 |
| 299 | Ga0207693_10121721 | 3300025915 | Bacteria | 2049 |
| 300 | Ga0207662_10236760 | 3300025918 | Bacteria | 1194 |
| 301 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 302 | Ga0207681_10000291 | 3300025923 | Bacteria | 37201 |
| 303 | Ga0207681_10006732 | 3300025923 | Bacteria | 7052 |
| 304 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 305 | Ga0207650_10000308 | 3300025925 | Bacteria | 48275 |
| 306 | Ga0207650_10000407 | 3300025925 | Bacteria | 38580 |
| 307 | Ga0207659_10033931 | 3300025926 | Bacteria | 3516 |
| 308 | Ga0207644_10001111 | 3300025931 | Bacteria | 17279 |
| 309 | Ga0207690_10391921 | 3300025932 | Bacteria | 1106 |
| 310 | Ga0207706_10000050 | 3300025933 | Bacteria | 116811 |
| 311 | Ga0207706_10011123 | 3300025933 | Bacteria | 8201 |
| 312 | Ga0207686_10001347 | 3300025934 | Bacteria | 13985 |
| 313 | Ga0207686_10388387 | 3300025934 | Bacteria | 1060 |
| 314 | Ga0207709_10000107 | 3300025935 | Bacteria | 129240 |
| 315 | Ga0207709_10001047 | 3300025935 | Bacteria | 20429 |
| 316 | Ga0207709_10002479 | 3300025935 | Bacteria | 11568 |
| 317 | Ga0207709_10009947 | 3300025935 | Bacteria | 5238 |
| 318 | Ga0207709_10066438 | 3300025935 | Bacteria | 2271 |
| 319 | Ga0207709_10136564 | 3300025935 | Bacteria | 1680 |
| 320 | Ga0207709_10544924 | 3300025935 | Bacteria | 912 |
| 321 | Ga0207670_10171133 | 3300025936 | Bacteria | 1629 |
| 322 | Ga0207670_10507585 | 3300025936 | Bacteria | 980 |
| 323 | Ga0207669_10062361 | 3300025937 | Bacteria | 2296 |
| 324 | Ga0207704_10066450 | 3300025938 | Bacteria | 2263 |
| 325 | Ga0207691_10114481 | 3300025940 | Bacteria | 2396 |
| 326 | Ga0207711_10002049 | 3300025941 | Bacteria | 18226 |
| 327 | Ga0207711_10013160 | 3300025941 | Bacteria | 6872 |
| 328 | Ga0207711_10391003 | 3300025941 | Bacteria | 1291 |
| 329 | Ga0207689_10150576 | 3300025942 | Bacteria | 1918 |
| 330 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 331 | Ga0207712_10009817 | 3300025961 | Bacteria | 6065 |
| 332 | Ga0207712_10025348 | 3300025961 | Bacteria | 3939 |
| 333 | Ga0207712_10033258 | 3300025961 | Bacteria | 3484 |
| 334 | Ga0207640_10008153 | 3300025981 | Bacteria | 5804 |
| 335 | Ga0207658_10000007 | 3300025986 | Bacteria | 329651 |
| 336 | Ga0207639_10000079 | 3300026041 | Bacteria | 83859 |
| 337 | Ga0207678_10710562 | 3300026067 | Bacteria | 885 |
| 338 | Ga0207708_10006713 | 3300026075 | Bacteria | 8513 |
| 339 | Ga0207708_10023107 | 3300026075 | Bacteria | 4697 |
| 340 | Ga0207641_10094982 | 3300026088 | Bacteria | 2615 |
| 341 | Ga0207648_10000425 | 3300026089 | Bacteria | 46432 |
| 342 | Ga0207648_10045457 | 3300026089 | Bacteria | 3851 |
| 343 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 344 | Ga0207676_10186858 | 3300026095 | Bacteria | 1820 |
| 345 | Ga0207675_100007239 | 3300026118 | Bacteria | 10486 |
| 346 | Ga0207675_100117779 | 3300026118 | Bacteria | 2511 |
| 347 | Ga0207675_100267215 | 3300026118 | Bacteria | 1659 |
| 348 | Ga0207698_10387053 | 3300026142 | Bacteria | 1332 |
| 349 | Ga0209281_1000091 | 3300027111 | Bacteria | 242588 |
| 350 | Ga0209281_1000237 | 3300027111 | Bacteria | 112688 |
| 351 | Ga0209281_1020632 | 3300027111 | Bacteria | 1285 |
| 352 | Ga0209389_1000065 | 3300027296 | Bacteria | 102064 |
| 353 | Ga0209371_1000176 | 3300027312 | Bacteria | 95739 |
| 354 | Ga0209371_1000929 | 3300027312 | Bacteria | 22972 |
| 355 | Ga0209371_1010153 | 3300027312 | Bacteria | 2924 |
| 356 | Ga0209996_1002016 | 3300027395 | Bacteria | 2504 |
| 357 | Ga0209995_1004740 | 3300027471 | Bacteria | 2184 |
| 358 | Ga0209968_1004678 | 3300027526 | Bacteria | 2052 |
| 359 | Ga0210002_1006695 | 3300027617 | Bacteria | 1740 |
| 360 | Ga0209983_1001053 | 3300027665 | Bacteria | 6080 |
| 361 | Ga0209282_1042131 | 3300027666 | Bacteria | 2697 |
| 362 | Ga0209974_10007890 | 3300027876 | Bacteria | 3653 |
| 363 | Ga0209974_10026535 | 3300027876 | Bacteria | 1917 |
| 364 | Ga0209974_10057638 | 3300027876 | Bacteria | 1312 |
| 365 | Ga0207428_10042514 | 3300027907 | Bacteria | 3675 |
| 366 | Ga0207428_10051774 | 3300027907 | Bacteria | 3281 |
| 367 | Ga0207428_10238084 | 3300027907 | Bacteria | 1361 |
| 368 | Ga0207428_10299703 | 3300027907 | Bacteria | 1190 |
| 369 | Ga0268266_10002796 | 3300028379 | Bacteria | 18197 |
| 370 | Ga0268266_10041478 | 3300028379 | Bacteria | 3927 |
| 371 | Ga0268266_10136768 | 3300028379 | Bacteria | 2195 |
| 372 | Ga0268265_10000234 | 3300028380 | Bacteria | 63478 |
| 373 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 374 | Ga0268256_1000146 | 3300030500 | Bacteria | 95753 |
| 375 | Ga0268256_1000782 | 3300030500 | Bacteria | 22972 |
| 376 | Ga0268256_1009906 | 3300030500 | Bacteria | 3124 |
| 377 | Ga0307511_10008829 | 3300030521 | Bacteria | 10062 |
| 378 | Ga0314311_1174000 | 3300030733 | Bacteria | 8214 |
| 379 | Ga0316183_1099209 | 3300030742 | Bacteria | 952 |
| 380 | Ga0316183_1101138 | 3300030742 | Bacteria | 1106 |
| 381 | Ga0316181_1016487 | 3300030744 | Bacteria | 1345 |
| 382 | Ga0316181_1111959 | 3300030744 | Bacteria | 4733 |
| 383 | Ga0307513_10007959 | 3300031456 | Bacteria | 13638 |
| 384 | Ga0307509_10107120 | 3300031507 | Bacteria | 2812 |
| 385 | Ga0307509_10114588 | 3300031507 | Bacteria | 2690 |
| 386 | Ga0307516_10345550 | 3300031730 | Bacteria | 1154 |
| 387 | Ga0307416_101118720 | 3300032002 | Bacteria | 892 |
| 388 | Ga0307414_10197381 | 3300032004 | Bacteria | 1634 |
| 389 | Ga0307414_10422723 | 3300032004 | Bacteria | 1162 |
| 390 | Ga0395899_0000478 | 3300037312 | Bacteria | 44762 |
| 391 | Ga0395905_0006602 | 3300037471 | Bacteria | 11641 |
| 392 | Ga0436365_1689934 | 3300039437 | Bacteria | 6213 |
| 393 | Ga0439436_0002017 | 3300041404 | Bacteria | 6034 |
| 394 | Ga0439436_0008011 | 3300041404 | Bacteria | 3245 |
| 395 | Ga0439438_000775 | 3300041405 | Bacteria | 14291 |
| 396 | Ga0439438_005624 | 3300041405 | Bacteria | 4572 |
| 397 | Ga0439438_012464 | 3300041405 | Bacteria | 2606 |
| 398 | Ga0439439_0002322 | 3300041406 | Bacteria | 4021 |
| 399 | Ga0439447_002739 | 3300041407 | Bacteria | 6366 |
| 400 | Ga0439447_013680 | 3300041407 | Bacteria | 2296 |
| 401 | Ga0439447_019637 | 3300041407 | Bacteria | 1799 |
| 402 | Ga0439447_029111 | 3300041407 | Bacteria | 1400 |
| 403 | Ga0439466_0000289 | 3300041411 | Bacteria | 19586 |
| 404 | Ga0439466_0001121 | 3300041411 | Bacteria | 10407 |
| 405 | Ga0439466_0001334 | 3300041411 | Bacteria | 9623 |
| 406 | Ga0439466_0002385 | 3300041411 | Bacteria | 7367 |
| 407 | Ga0439466_0004035 | 3300041411 | Bacteria | 5667 |
| 408 | Ga0439466_0021199 | 3300041411 | Bacteria | 2307 |
| 409 | Ga0439466_0025436 | 3300041411 | Bacteria | 2066 |
| 410 | Ga0439437_000536 | 3300042000 | Bacteria | 3771 |
| 411 | Ga0439442_008500 | 3300042002 | Bacteria | 2073 |
| 412 | Ga0439432_001586 | 3300042006 | Bacteria | 8503 |
| 413 | Ga0439432_001810 | 3300042006 | Bacteria | 8017 |
| 414 | Ga0439432_002251 | 3300042006 | Bacteria | 7284 |
| 415 | Ga0439432_014726 | 3300042006 | Bacteria | 2645 |
| 416 | Ga0439432_031069 | 3300042006 | Bacteria | 1728 |
| 417 | Ga0439432_066039 | 3300042006 | Bacteria | 1108 |
| 418 | Ga0439449_0010779 | 3300042007 | Bacteria | 3449 |
| 419 | Ga0439451_000786 | 3300042009 | Bacteria | 6047 |
| 420 | Ga0439451_002140 | 3300042009 | Bacteria | 3965 |
| 421 | Ga0439452_000190 | 3300042010 | Bacteria | 45505 |
| 422 | Ga0439452_000443 | 3300042010 | Bacteria | 23463 |
| 423 | Ga0439452_001993 | 3300042010 | Bacteria | 7819 |
| 424 | Ga0439452_001995 | 3300042010 | Bacteria | 7813 |
| 425 | Ga0439452_003249 | 3300042010 | Bacteria | 5743 |
| 426 | Ga0439452_008676 | 3300042010 | Bacteria | 3041 |
| 427 | Ga0439452_010013 | 3300042010 | Bacteria | 2773 |
| 428 | Ga0439456_000036 | 3300042013 | Bacteria | 49413 |
| 429 | Ga0439456_000406 | 3300042013 | Bacteria | 9644 |
| 430 | Ga0439456_000462 | 3300042013 | Bacteria | 8887 |
| 431 | Ga0439456_005910 | 3300042013 | Bacteria | 2490 |
| 432 | Ga0439462_0007982 | 3300042015 | Bacteria | 2661 |
| 433 | Ga0439463_000120 | 3300042016 | Bacteria | 19571 |
| 434 | Ga0439463_000491 | 3300042016 | Bacteria | 11038 |
| 435 | Ga0439463_001245 | 3300042016 | Bacteria | 6807 |
| 436 | Ga0450911_000011 | 3300042115 | Bacteria | 130739 |
| 437 | Ga0450911_000019 | 3300042115 | Bacteria | 103441 |
| 438 | Ga0450911_000211 | 3300042115 | Bacteria | 22807 |
| 439 | Ga0450911_000509 | 3300042115 | Bacteria | 12334 |
| 440 | Ga0450911_004119 | 3300042115 | Bacteria | 2428 |
| 441 | Ga0450914_000201 | 3300042118 | Bacteria | 2259 |
| 442 | Ga0450919_003455 | 3300042121 | Bacteria | 1976 |
| 443 | Ga0450922_001769 | 3300042124 | Bacteria | 2087 |
| 444 | Ga0450890_000131 | 3300042127 | Bacteria | 11737 |
| 445 | Ga0450894_003690 | 3300042131 | Bacteria | 2001 |
| 446 | Ga0450902_001841 | 3300042137 | Bacteria | 2943 |
| 447 | Ga0450903_000620 | 3300042138 | Bacteria | 7178 |
| 448 | Ga0450904_000097 | 3300042139 | Bacteria | 19742 |
| 449 | Ga0450905_000157 | 3300042142 | Bacteria | 7279 |
| 450 | Ga0450906_006046 | 3300042145 | Bacteria | 2458 |
| 451 | Ga0450907_000110 | 3300042146 | Bacteria | 31083 |
| 452 | Ga0450907_003387 | 3300042146 | Bacteria | 2851 |
| 453 | Ga0450910_002043 | 3300042147 | Bacteria | 2623 |
| 454 | Ga0439446_0000463 | 3300042156 | Bacteria | 8050 |
| 455 | Ga0439446_0002388 | 3300042156 | Bacteria | 4501 |
| 456 | Ga0439446_0002934 | 3300042156 | Bacteria | 4165 |
| 457 | Ga0439446_0003376 | 3300042156 | Bacteria | 3955 |
| 458 | Ga0439446_0004933 | 3300042156 | Bacteria | 3410 |
| 459 | Ga0450908_005890 | 3300042184 | Bacteria | 2341 |
| 460 | Ga0450909_004626 | 3300042185 | Bacteria | 1967 |
| 461 | Ga0450909_011498 | 3300042185 | Bacteria | 1297 |
| 462 | Ga0439434_0000092 | 3300042435 | Bacteria | 22644 |
| 463 | Ga0439434_0000184 | 3300042435 | Bacteria | 17025 |
| 464 | Ga0439464_0040131 | 3300042439 | Bacteria | 1332 |
| 465 | Ga0439460_0000002 | 3300042461 | Bacteria | 48212 |
| 466 | Ga0439460_0001270 | 3300042461 | Bacteria | 5936 |
| 467 | Ga0439460_0009852 | 3300042461 | Bacteria | 2434 |
| 468 | Ga0439460_0018324 | 3300042461 | Bacteria | 1884 |
| 469 | Ga0450916_000505 | 3300042530 | Bacteria | 3421 |
| 470 | Ga0450918_008576 | 3300042531 | Bacteria | 1796 |
| 471 | Ga0450901_000463 | 3300042533 | Bacteria | 4831 |
| 472 | Ga0451577_0277040 | 3300042876 | Bacteria | 1519 |
| 473 | Ga0439440_0005351 | 3300042993 | Bacteria | 2548 |
| 474 | Ga0466965_0064128 | 3300044683 | Bacteria | 1839 |
| 475 | Ga0466964_0008174 | 3300044706 | Bacteria | 3927 |
| 476 | Ga0453684_0014934 | 3300044712 | Bacteria | 12346 |
| 477 | Ga0453684_0017471 | 3300044712 | Bacteria | 11109 |
| 478 | Ga0453684_0040463 | 3300044712 | Bacteria | 6328 |
| 479 | Ga0466968_0005006 | 3300044735 | Bacteria | 4964 |
| 480 | Ga0451576_0059657 | 3300045051 | Bacteria | 3982 |
| 481 | Ga0495617_001787 | 3300046452 | Bacteria | 9175 |
| 482 | Ga0495617_012651 | 3300046452 | Bacteria | 2877 |
| 483 | Ga0495617_024999 | 3300046452 | Bacteria | 2014 |
| 484 | Ga0495627_000095 | 3300046453 | Bacteria | 108094 |
| 485 | Ga0495627_000646 | 3300046453 | Bacteria | 27194 |
| 486 | Ga0495627_000869 | 3300046453 | Bacteria | 21472 |
| 487 | Ga0495627_010851 | 3300046453 | Bacteria | 3293 |
| 488 | Ga0495627_039198 | 3300046453 | Bacteria | 1462 |
| 489 | Ga0495603_0001944 | 3300046455 | Bacteria | 12181 |
| 490 | Ga0495603_0161761 | 3300046455 | Bacteria | 1298 |
| 491 | Ga0495590_0002659 | 3300046457 | Bacteria | 7383 |
| 492 | Ga0495590_0007106 | 3300046457 | Bacteria | 4333 |
| 493 | Ga0495591_000198 | 3300046458 | Bacteria | 61546 |
| 494 | Ga0495591_000334 | 3300046458 | Bacteria | 42109 |
| 495 | Ga0495591_000628 | 3300046458 | Bacteria | 26285 |
| 496 | Ga0495591_002016 | 3300046458 | Bacteria | 11817 |
| 497 | Ga0495591_002668 | 3300046458 | Bacteria | 9711 |
| 498 | Ga0495591_010984 | 3300046458 | Bacteria | 3459 |
| 499 | Ga0495591_017440 | 3300046458 | Bacteria | 2465 |
| 500 | Ga0495591_020022 | 3300046458 | Bacteria | 2223 |
| 501 | Ga0495591_020266 | 3300046458 | Bacteria | 2201 |
| 502 | Ga0495591_025531 | 3300046458 | Bacteria | 1851 |
| 503 | Ga0495591_027139 | 3300046458 | Bacteria | 1769 |
| 504 | Ga0495629_0083415 | 3300046459 | Bacteria | 2230 |
| 505 | Ga0495638_0011328 | 3300046460 | Bacteria | 6145 |
| 506 | Ga0495638_0011519 | 3300046460 | Bacteria | 6090 |
| 507 | Ga0495638_0019536 | 3300046460 | Bacteria | 4483 |
| 508 | Ga0495638_0057233 | 3300046460 | Bacteria | 2418 |
| 509 | Ga0495638_0060978 | 3300046460 | Bacteria | 2331 |
| 510 | Ga0495653_0005962 | 3300046463 | Bacteria | 9975 |
| 511 | Ga0495653_0006872 | 3300046463 | Bacteria | 9349 |
| 512 | Ga0495653_0147285 | 3300046463 | Bacteria | 1648 |
| 513 | Ga0495650_0001617 | 3300046471 | Bacteria | 21024 |
| 514 | Ga0495650_0003976 | 3300046471 | Bacteria | 10390 |
| 515 | Ga0495650_0004680 | 3300046471 | Bacteria | 9239 |
| 516 | Ga0495650_0008792 | 3300046471 | Bacteria | 5838 |
| 517 | Ga0495650_0048726 | 3300046471 | Bacteria | 1763 |
| 518 | Ga0495650_0076954 | 3300046471 | Bacteria | 1295 |
| 519 | Ga0495582_0000456 | 3300046473 | Bacteria | 22343 |
| 520 | Ga0495605_0000019 | 3300046474 | Bacteria | 270010 |
| 521 | Ga0495605_0000376 | 3300046474 | Bacteria | 42124 |
| 522 | Ga0495605_0000387 | 3300046474 | Bacteria | 40707 |
| 523 | Ga0495605_0000664 | 3300046474 | Bacteria | 26130 |
| 524 | Ga0495605_0001221 | 3300046474 | Bacteria | 17091 |
| 525 | Ga0495605_0002242 | 3300046474 | Bacteria | 12068 |
| 526 | Ga0495605_0007209 | 3300046474 | Bacteria | 6323 |
| 527 | Ga0495605_0171991 | 3300046474 | Bacteria | 956 |
| 528 | Ga0495639_0000295 | 3300046475 | Bacteria | 24407 |
| 529 | Ga0495584_0000408 | 3300046491 | Bacteria | 29754 |
| 530 | Ga0495584_0002026 | 3300046491 | Bacteria | 11641 |
| 531 | Ga0495584_0002140 | 3300046491 | Bacteria | 11289 |
| 532 | Ga0495584_0006909 | 3300046491 | Bacteria | 5929 |
| 533 | Ga0495584_0007040 | 3300046491 | Bacteria | 5875 |
| 534 | Ga0495584_0009992 | 3300046491 | Bacteria | 4871 |
| 535 | Ga0495584_0046053 | 3300046491 | Bacteria | 2200 |
| 536 | Ga0495585_0000895 | 3300046492 | Bacteria | 25250 |
| 537 | Ga0495585_0005030 | 3300046492 | Bacteria | 8434 |
| 538 | Ga0495585_0010265 | 3300046492 | Bacteria | 5584 |
| 539 | Ga0495585_0010423 | 3300046492 | Bacteria | 5532 |
| 540 | Ga0495585_0035713 | 3300046492 | Bacteria | 2807 |
| 541 | Ga0495585_0037229 | 3300046492 | Bacteria | 2740 |
| 542 | Ga0495594_0011120 | 3300046499 | Bacteria | 4673 |
| 543 | Ga0495596_0000175 | 3300046500 | Bacteria | 44764 |
| 544 | Ga0495596_0015961 | 3300046500 | Bacteria | 3127 |
| 545 | Ga0495607_0000024 | 3300046501 | Bacteria | 159904 |
| 546 | Ga0495607_0000306 | 3300046501 | Bacteria | 51378 |
| 547 | Ga0495607_0000531 | 3300046501 | Bacteria | 37437 |
| 548 | Ga0495607_0000751 | 3300046501 | Bacteria | 31037 |
| 549 | Ga0495607_0001123 | 3300046501 | Bacteria | 24276 |
| 550 | Ga0495607_0003423 | 3300046501 | Bacteria | 12155 |
| 551 | Ga0495607_0008096 | 3300046501 | Bacteria | 7216 |
| 552 | Ga0495607_0012685 | 3300046501 | Bacteria | 5551 |
| 553 | Ga0495607_0014244 | 3300046501 | Bacteria | 5185 |
| 554 | Ga0495607_0020047 | 3300046501 | Bacteria | 4233 |
| 555 | Ga0495607_0046946 | 3300046501 | Bacteria | 2532 |
| 556 | Ga0495607_0065376 | 3300046501 | Bacteria | 2051 |
| 557 | Ga0495607_0095448 | 3300046501 | Bacteria | 1602 |
| 558 | Ga0495607_0117861 | 3300046501 | Bacteria | 1398 |
| 559 | Ga0495607_0171456 | 3300046501 | Bacteria | 1095 |
| 560 | Ga0495583_0000146 | 3300046506 | Bacteria | 119793 |
| 561 | Ga0495583_0000452 | 3300046506 | Bacteria | 61394 |
| 562 | Ga0495583_0001254 | 3300046506 | Bacteria | 26768 |
| 563 | Ga0495583_0002206 | 3300046506 | Bacteria | 17249 |
| 564 | Ga0495583_0005888 | 3300046506 | Bacteria | 8166 |
| 565 | Ga0495583_0015935 | 3300046506 | Bacteria | 4064 |
| 566 | Ga0495606_0000115 | 3300046507 | Bacteria | 135589 |
| 567 | Ga0495606_0000246 | 3300046507 | Bacteria | 95318 |
| 568 | Ga0495606_0000454 | 3300046507 | Bacteria | 67097 |
| 569 | Ga0495606_0000477 | 3300046507 | Bacteria | 65883 |
| 570 | Ga0495606_0001164 | 3300046507 | Bacteria | 37202 |
| 571 | Ga0495606_0002670 | 3300046507 | Bacteria | 20254 |
| 572 | Ga0495606_0007824 | 3300046507 | Bacteria | 9438 |
| 573 | Ga0495606_0009157 | 3300046507 | Bacteria | 8423 |
| 574 | Ga0495606_0038528 | 3300046507 | Bacteria | 3233 |
| 575 | Ga0495610_0003687 | 3300046512 | Bacteria | 11763 |
| 576 | Ga0495610_0008413 | 3300046512 | Bacteria | 6688 |
| 577 | Ga0495610_0014124 | 3300046512 | Bacteria | 4709 |
| 578 | Ga0495610_0054587 | 3300046512 | Bacteria | 1929 |
| 579 | Ga0495616_0000852 | 3300046513 | Bacteria | 22250 |
| 580 | Ga0495616_0035228 | 3300046513 | Bacteria | 2591 |
| 581 | Ga0495616_0051050 | 3300046513 | Bacteria | 2064 |
| 582 | Ga0495616_0088639 | 3300046513 | Bacteria | 1468 |
| 583 | Ga0495620_0000023 | 3300046515 | Bacteria | 131512 |
| 584 | Ga0495620_0000108 | 3300046515 | Bacteria | 66218 |
| 585 | Ga0495620_0001611 | 3300046515 | Bacteria | 13368 |
| 586 | Ga0495620_0001719 | 3300046515 | Bacteria | 12933 |
| 587 | Ga0495620_0002090 | 3300046515 | Bacteria | 11609 |
| 588 | Ga0495620_0003034 | 3300046515 | Bacteria | 9654 |
| 589 | Ga0495620_0003388 | 3300046515 | Bacteria | 9121 |
| 590 | Ga0495620_0089078 | 3300046515 | Bacteria | 1239 |
| 591 | Ga0495631_0001318 | 3300046518 | Bacteria | 15202 |
| 592 | Ga0495631_0004094 | 3300046518 | Bacteria | 7830 |
| 593 | Ga0495631_0006065 | 3300046518 | Bacteria | 6278 |
| 594 | Ga0495632_0001735 | 3300046519 | Bacteria | 17682 |
| 595 | Ga0495632_0001795 | 3300046519 | Bacteria | 17318 |
| 596 | Ga0495632_0003309 | 3300046519 | Bacteria | 11492 |
| 597 | Ga0495632_0005231 | 3300046519 | Bacteria | 8647 |
| 598 | Ga0495632_0015933 | 3300046519 | Bacteria | 4195 |
| 599 | Ga0495632_0182428 | 3300046519 | Bacteria | 961 |
| 600 | Ga0495637_0000054 | 3300046520 | Bacteria | 99531 |
| 601 | Ga0495637_0000194 | 3300046520 | Bacteria | 47572 |
| 602 | Ga0495637_0000269 | 3300046520 | Bacteria | 41036 |
| 603 | Ga0495637_0000466 | 3300046520 | Bacteria | 29566 |
| 604 | Ga0495637_0004473 | 3300046520 | Bacteria | 7235 |
| 605 | Ga0495637_0006747 | 3300046520 | Bacteria | 5745 |
| 606 | Ga0495637_0015104 | 3300046520 | Bacteria | 3628 |
| 607 | Ga0495637_0020194 | 3300046520 | Bacteria | 3068 |
| 608 | Ga0495637_0026282 | 3300046520 | Bacteria | 2615 |
| 609 | Ga0495637_0041970 | 3300046520 | Bacteria | 1959 |
| 610 | Ga0495637_0052122 | 3300046520 | Bacteria | 1709 |
| 611 | Ga0495643_0000402 | 3300046522 | Bacteria | 56542 |
| 612 | Ga0495643_0000730 | 3300046522 | Bacteria | 37461 |
| 613 | Ga0495643_0001170 | 3300046522 | Bacteria | 25602 |
| 614 | Ga0495643_0001604 | 3300046522 | Bacteria | 20016 |
| 615 | Ga0495643_0001680 | 3300046522 | Bacteria | 19333 |
| 616 | Ga0495643_0002170 | 3300046522 | Bacteria | 16064 |
| 617 | Ga0495643_0002454 | 3300046522 | Bacteria | 14677 |
| 618 | Ga0495643_0009905 | 3300046522 | Bacteria | 5892 |
| 619 | Ga0495643_0010294 | 3300046522 | Bacteria | 5759 |
| 620 | Ga0495643_0019663 | 3300046522 | Bacteria | 3903 |
| 621 | Ga0495643_0087473 | 3300046522 | Bacteria | 1612 |
| 622 | Ga0495648_0000783 | 3300046524 | Bacteria | 33886 |
| 623 | Ga0495648_0001858 | 3300046524 | Bacteria | 20225 |
| 624 | Ga0495648_0002460 | 3300046524 | Bacteria | 17056 |
| 625 | Ga0495648_0002748 | 3300046524 | Bacteria | 15885 |
| 626 | Ga0495648_0012345 | 3300046524 | Bacteria | 6380 |
| 627 | Ga0495648_0017798 | 3300046524 | Bacteria | 5065 |
| 628 | Ga0495648_0183970 | 3300046524 | Bacteria | 1059 |
| 629 | Ga0495666_0005396 | 3300046526 | Bacteria | 6436 |
| 630 | Ga0495666_0042994 | 3300046526 | Bacteria | 2183 |
| 631 | Ga0495666_0058971 | 3300046526 | Bacteria | 1836 |
| 632 | Ga0495666_0107903 | 3300046526 | Bacteria | 1309 |
| 633 | Ga0495642_0000536 | 3300046528 | Bacteria | 19246 |
| 634 | Ga0495642_0000555 | 3300046528 | Bacteria | 18832 |
| 635 | Ga0495642_0015291 | 3300046528 | Bacteria | 2981 |
| 636 | Ga0495654_0000210 | 3300046530 | Bacteria | 55201 |
| 637 | Ga0495654_0001010 | 3300046530 | Bacteria | 20620 |
| 638 | Ga0495654_0002438 | 3300046530 | Bacteria | 11969 |
| 639 | Ga0495654_0003497 | 3300046530 | Bacteria | 9591 |
| 640 | Ga0495654_0009898 | 3300046530 | Bacteria | 5211 |
| 641 | Ga0495654_0015931 | 3300046530 | Bacteria | 3983 |
| 642 | Ga0495654_0023317 | 3300046530 | Bacteria | 3205 |
| 643 | Ga0495654_0090195 | 3300046530 | Bacteria | 1423 |
| 644 | Ga0495586_0022525 | 3300046535 | Bacteria | 3362 |
| 645 | Ga0495587_0003520 | 3300046536 | Bacteria | 10428 |
| 646 | Ga0495587_0057179 | 3300046536 | Bacteria | 2294 |
| 647 | Ga0495609_0000061 | 3300046538 | Bacteria | 139848 |
| 648 | Ga0495609_0000101 | 3300046538 | Bacteria | 100818 |
| 649 | Ga0495609_0000696 | 3300046538 | Bacteria | 25895 |
| 650 | Ga0495609_0001338 | 3300046538 | Bacteria | 16696 |
| 651 | Ga0495609_0011057 | 3300046538 | Bacteria | 4309 |
| 652 | Ga0495609_0022196 | 3300046538 | Bacteria | 2924 |
| 653 | Ga0495597_0000676 | 3300046542 | Bacteria | 27672 |
| 654 | Ga0495597_0004012 | 3300046542 | Bacteria | 8264 |
| 655 | Ga0495597_0005112 | 3300046542 | Bacteria | 7001 |
| 656 | Ga0495597_0005967 | 3300046542 | Bacteria | 6357 |
| 657 | Ga0495597_0021813 | 3300046542 | Bacteria | 2975 |
| 658 | Ga0495597_0135952 | 3300046542 | Bacteria | 1016 |
| 659 | Ga0495622_0005884 | 3300046557 | Bacteria | 5693 |
| 660 | Ga0495622_0006049 | 3300046557 | Bacteria | 5623 |
| 661 | Ga0495622_0020035 | 3300046557 | Bacteria | 3113 |
| 662 | Ga0495633_0000129 | 3300046558 | Bacteria | 100833 |
| 663 | Ga0495633_0003624 | 3300046558 | Bacteria | 10211 |
| 664 | Ga0495656_0004240 | 3300046615 | Bacteria | 4895 |
| 665 | Ga0495668_0001708 | 3300046616 | Bacteria | 20267 |
| 666 | Ga0495668_0003520 | 3300046616 | Bacteria | 11662 |
| 667 | Ga0495668_0029435 | 3300046616 | Bacteria | 3102 |
| 668 | Ga0495668_0093913 | 3300046616 | Bacteria | 1642 |
| 669 | Ga0495668_0225844 | 3300046616 | Bacteria | 1025 |
| 670 | Ga0495634_0015246 | 3300046642 | Bacteria | 5526 |
| 671 | Ga0495634_0311913 | 3300046642 | Bacteria | 949 |
| 672 | Ga0495611_0000525 | 3300046648 | Bacteria | 22782 |
| 673 | Ga0495611_0000571 | 3300046648 | Bacteria | 21238 |
| 674 | Ga0495611_0001821 | 3300046648 | Bacteria | 10218 |
| 675 | Ga0495625_0000147 | 3300046660 | Bacteria | 107983 |
| 676 | Ga0495625_0011548 | 3300046660 | Bacteria | 7195 |
| 677 | Ga0495625_0135001 | 3300046660 | Bacteria | 1668 |
| 678 | Ga0495625_0159038 | 3300046660 | Bacteria | 1514 |
| 679 | Ga0495635_0000583 | 3300046663 | Bacteria | 23456 |
| 680 | Ga0495635_0000604 | 3300046663 | Bacteria | 23105 |
| 681 | Ga0495659_0001461 | 3300046664 | Bacteria | 8015 |
| 682 | Ga0495659_0006759 | 3300046664 | Bacteria | 3624 |
| 683 | Ga0495661_0000153 | 3300046665 | Bacteria | 81096 |
| 684 | Ga0495661_0000196 | 3300046665 | Bacteria | 69840 |
| 685 | Ga0495661_0000431 | 3300046665 | Bacteria | 44303 |
| 686 | Ga0495661_0000484 | 3300046665 | Bacteria | 41967 |
| 687 | Ga0495661_0001727 | 3300046665 | Bacteria | 17684 |
| 688 | Ga0495661_0058509 | 3300046665 | Bacteria | 2297 |
| 689 | Ga0495661_0063649 | 3300046665 | Bacteria | 2179 |
| 690 | Ga0495661_0074274 | 3300046665 | Bacteria | 1979 |
| 691 | Ga0495661_0082777 | 3300046665 | Bacteria | 1846 |
| 692 | Ga0495661_0252256 | 3300046665 | Bacteria | 900 |
| 693 | Ga0495588_0005506 | 3300046674 | Bacteria | 5638 |
| 694 | Ga0495623_0050832 | 3300046679 | Bacteria | 2624 |
| 695 | Ga0495646_0039441 | 3300046680 | Bacteria | 2911 |
| 696 | Ga0495669_0160323 | 3300046684 | Bacteria | 1067 |
| 697 | Ga0495613_0054929 | 3300046689 | Bacteria | 2927 |
| 698 | Ga0495670_0000388 | 3300046691 | Bacteria | 21005 |
| 699 | Ga0495670_0001599 | 3300046691 | Bacteria | 11079 |
| 700 | Ga0495670_0003795 | 3300046691 | Bacteria | 7424 |
| 701 | Ga0495670_0005439 | 3300046691 | Bacteria | 6252 |
| 702 | Ga0495670_0007272 | 3300046691 | Bacteria | 5444 |
| 703 | Ga0495671_0000471 | 3300046692 | Bacteria | 31523 |
| 704 | Ga0495671_0001192 | 3300046692 | Bacteria | 17802 |
| 705 | Ga0495671_0001895 | 3300046692 | Bacteria | 13430 |
| 706 | Ga0495671_0001900 | 3300046692 | Bacteria | 13409 |
| 707 | Ga0495671_0002856 | 3300046692 | Bacteria | 10806 |
| 708 | Ga0495671_0003042 | 3300046692 | Bacteria | 10421 |
| 709 | Ga0495671_0037684 | 3300046692 | Bacteria | 2444 |
| 710 | Ga0495671_0042708 | 3300046692 | Bacteria | 2277 |
| 711 | Ga0495671_0086214 | 3300046692 | Bacteria | 1538 |
| 712 | Ga0495649_0000711 | 3300046694 | Bacteria | 27137 |
| 713 | Ga0495649_0000968 | 3300046694 | Bacteria | 22667 |
| 714 | Ga0495649_0002156 | 3300046694 | Bacteria | 14079 |
| 715 | Ga0495649_0003441 | 3300046694 | Bacteria | 10676 |
| 716 | Ga0495649_0007937 | 3300046694 | Bacteria | 6419 |
| 717 | Ga0495649_0009797 | 3300046694 | Bacteria | 5672 |
| 718 | Ga0495649_0013458 | 3300046694 | Bacteria | 4719 |
| 719 | Ga0495649_0077864 | 3300046694 | Bacteria | 1774 |
| 720 | Ga0495589_0002719 | 3300046794 | Bacteria | 9775 |
| 721 | Ga0495589_0007109 | 3300046794 | Bacteria | 5866 |
| 722 | Ga0495589_0014900 | 3300046794 | Bacteria | 4000 |
| 723 | Ga0495589_0026339 | 3300046794 | Bacteria | 2946 |
| 724 | Ga0495589_0055325 | 3300046794 | Bacteria | 1955 |
| 725 | Ga0495600_0000547 | 3300046809 | Bacteria | 19473 |
| 726 | Ga0495660_0000431 | 3300046810 | Bacteria | 35256 |
| 727 | Ga0495660_0004060 | 3300046810 | Bacteria | 8938 |
| 728 | Ga0495660_0014906 | 3300046810 | Bacteria | 4495 |
| 729 | Ga0495660_0020968 | 3300046810 | Bacteria | 3744 |
| 730 | Ga0495660_0036778 | 3300046810 | Bacteria | 2729 |
| 731 | Ga0495660_0055822 | 3300046810 | Bacteria | 2136 |
| 732 | Ga0495660_0083874 | 3300046810 | Bacteria | 1667 |
| 733 | Ga0495581_0107187 | 3300047315 | Bacteria | 1624 |
| 734 | Ga0495604_0012043 | 3300047317 | Bacteria | 6875 |
| 735 | Ga0495604_0016005 | 3300047317 | Bacteria | 5988 |
| 736 | Ga0495636_0008819 | 3300047318 | Bacteria | 3972 |
| 737 | Ga0495674_0034797 | 3300047319 | Bacteria | 4551 |
| 738 | Ga0495672_0003079 | 3300047320 | Bacteria | 14595 |
| 739 | Ga0495672_0003447 | 3300047320 | Bacteria | 13529 |
| 740 | Ga0495672_0004295 | 3300047320 | Bacteria | 11749 |
| 741 | Ga0495672_0005642 | 3300047320 | Bacteria | 9876 |
| 742 | Ga0495672_0006899 | 3300047320 | Bacteria | 8659 |
| 743 | Ga0495672_0012746 | 3300047320 | Bacteria | 5844 |
| 744 | Ga0495676_0000027 | 3300047321 | Bacteria | 141955 |
| 745 | Ga0495676_0021111 | 3300047321 | Bacteria | 5698 |
| 746 | Ga0495676_0049708 | 3300047321 | Bacteria | 3368 |
| 747 | Ga0495680_0005758 | 3300047322 | Bacteria | 11601 |
| 748 | Ga0495683_0000038 | 3300047323 | Bacteria | 139494 |
| 749 | Ga0495683_0000075 | 3300047323 | Bacteria | 100715 |
| 750 | Ga0495683_0001303 | 3300047323 | Bacteria | 16785 |
| 751 | Ga0495683_0001374 | 3300047323 | Bacteria | 16151 |
| 752 | Ga0495683_0052279 | 3300047323 | Bacteria | 2040 |
| 753 | Ga0495683_0071627 | 3300047323 | Bacteria | 1700 |
| 754 | Ga0495683_0165052 | 3300047323 | Bacteria | 1021 |
| 755 | Ga0495687_003446 | 3300047443 | Bacteria | 11443 |
| 756 | Ga0495687_004754 | 3300047443 | Bacteria | 8978 |
| 757 | Ga0495687_010017 | 3300047443 | Bacteria | 5237 |
| 758 | Ga0495675_0156627 | 3300047444 | Bacteria | 1404 |
| 759 | Ga0495677_0001006 | 3300047445 | Bacteria | 11356 |
| 760 | Ga0495679_000237 | 3300047446 | Bacteria | 45847 |
| 761 | Ga0495679_000495 | 3300047446 | Bacteria | 27885 |
| 762 | Ga0495679_013833 | 3300047446 | Bacteria | 3011 |
| 763 | Ga0495685_066872 | 3300047447 | Bacteria | 1207 |
| 764 | Ga0495673_0000389 | 3300047469 | Bacteria | 51664 |
| 765 | Ga0495673_0001628 | 3300047469 | Bacteria | 17374 |
| 766 | Ga0495673_0001807 | 3300047469 | Bacteria | 16191 |
| 767 | Ga0495673_0005394 | 3300047469 | Bacteria | 7744 |
| 768 | Ga0495673_0008202 | 3300047469 | Bacteria | 5899 |
| 769 | Ga0495673_0012990 | 3300047469 | Bacteria | 4388 |
| 770 | Ga0495673_0019427 | 3300047469 | Bacteria | 3403 |
| 771 | Ga0495673_0041012 | 3300047469 | Bacteria | 2086 |
| 772 | Ga0495673_0095900 | 3300047469 | Bacteria | 1205 |
| 773 | Ga0495681_0003081 | 3300047470 | Bacteria | 11691 |
| 774 | Ga0495681_0003215 | 3300047470 | Bacteria | 11403 |
| 775 | Ga0495681_0004777 | 3300047470 | Bacteria | 9177 |
| 776 | Ga0495681_0012244 | 3300047470 | Bacteria | 5053 |
| 777 | Ga0495681_0022208 | 3300047470 | Bacteria | 3402 |
| 778 | Ga0495681_0031756 | 3300047470 | Bacteria | 2667 |
| 779 | Ga0495686_0007608 | 3300047472 | Bacteria | 8091 |
| 780 | Ga0495686_0125865 | 3300047472 | Bacteria | 1523 |
| 781 | Ga0495686_0127672 | 3300047472 | Bacteria | 1510 |
| 782 | Ga0495593_0038639 | 3300047673 | Bacteria | 2577 |
| 783 | Ga0495593_0071064 | 3300047673 | Bacteria | 1807 |
| 784 | Ga0495593_0106202 | 3300047673 | Bacteria | 1436 |
| 785 | Ga0495626_0000067 | 3300048091 | Bacteria | 139969 |
| 786 | Ga0495626_0000507 | 3300048091 | Bacteria | 38997 |
| 787 | Ga0495626_0000684 | 3300048091 | Bacteria | 32479 |
| 788 | Ga0495626_0000996 | 3300048091 | Bacteria | 24344 |
| 789 | Ga0495626_0001171 | 3300048091 | Bacteria | 21808 |
| 790 | Ga0495626_0001627 | 3300048091 | Bacteria | 17443 |
| 791 | Ga0495626_0012837 | 3300048091 | Bacteria | 4372 |
| 792 | Ga0495626_0013045 | 3300048091 | Bacteria | 4333 |
| 793 | Ga0495626_0027693 | 3300048091 | Bacteria | 2753 |
| 794 | Ga0495626_0033525 | 3300048091 | Bacteria | 2460 |
| 795 | Ga0496102_0034338 | 3300048905 | Bacteria | 4561 |
| 796 | Ga0496103_0014973 | 3300048906 | Bacteria | 4610 |
| 797 | Ga0496106_0484204 | 3300048909 | Bacteria | 994 |
| 798 | Ga0496109_0091764 | 3300048912 | Bacteria | 2809 |
| 799 | Ga0496110_0069750 | 3300048913 | Bacteria | 3113 |
| 800 | Ga0496110_0146071 | 3300048913 | Bacteria | 2139 |
| 801 | Ga0496111_0049816 | 3300048914 | Bacteria | 3020 |
| 802 | Ga0496111_0055581 | 3300048914 | Bacteria | 2863 |
| 803 | Ga0496112_0228484 | 3300048915 | Bacteria | 1816 |
| 804 | Ga0496113_0214562 | 3300048916 | Bacteria | 1533 |
| 805 | Ga0496114_0024637 | 3300048917 | Bacteria | 4912 |
| 806 | Ga0496116_0000242 | 3300048919 | Bacteria | 99455 |
| 807 | Ga0496116_0001670 | 3300048919 | Bacteria | 24375 |
| 808 | Ga0496116_0002076 | 3300048919 | Bacteria | 21440 |
| 809 | Ga0496116_0023569 | 3300048919 | Bacteria | 4581 |
| 810 | Ga0496117_0000270 | 3300048920 | Bacteria | 97077 |
| 811 | Ga0496117_0000932 | 3300048920 | Bacteria | 44792 |
| 812 | Ga0496117_0002067 | 3300048920 | Bacteria | 26545 |
| 813 | Ga0496118_0042191 | 3300048921 | Bacteria | 3601 |
| 814 | Ga0496118_0068266 | 3300048921 | Bacteria | 2583 |
| 815 | Ga0496118_0069267 | 3300048921 | Bacteria | 2556 |
| 816 | Ga0496119_0000704 | 3300048922 | Bacteria | 44799 |
| 817 | Ga0496120_0001473 | 3300048923 | Bacteria | 28054 |
| 818 | Ga0496120_0004336 | 3300048923 | Bacteria | 11991 |
| 819 | Ga0496121_0000318 | 3300048924 | Bacteria | 100833 |
| 820 | Ga0496121_0003788 | 3300048924 | Bacteria | 21104 |
| 821 | Ga0496121_0004345 | 3300048924 | Bacteria | 19161 |
| 822 | Ga0496121_0149535 | 3300048924 | Bacteria | 1720 |
| 823 | Ga0496121_0268043 | 3300048924 | Bacteria | 1175 |
| 824 | Ga0496122_0000517 | 3300048925 | Bacteria | 79890 |
| 825 | Ga0496122_0002629 | 3300048925 | Bacteria | 25113 |
| 826 | Ga0496122_0007631 | 3300048925 | Bacteria | 11947 |
| 827 | Ga0496122_0138317 | 3300048925 | Bacteria | 1529 |
| 828 | Ga0496122_0141719 | 3300048925 | Bacteria | 1502 |
| 829 | Ga0496123_0000243 | 3300048926 | Bacteria | 109767 |
| 830 | Ga0496123_0007055 | 3300048926 | Bacteria | 10690 |
| 831 | Ga0496123_0040963 | 3300048926 | Bacteria | 3217 |
| 832 | Ga0496124_0000511 | 3300048927 | Bacteria | 66830 |
| 833 | Ga0496124_0001467 | 3300048927 | Bacteria | 34796 |
| 834 | Ga0496124_0002260 | 3300048927 | Bacteria | 25562 |
| 835 | Ga0496124_0002328 | 3300048927 | Bacteria | 25081 |
| 836 | Ga0496124_0007063 | 3300048927 | Bacteria | 12030 |
| 837 | Ga0496124_0015657 | 3300048927 | Bacteria | 7256 |
| 838 | Ga0496124_0023005 | 3300048927 | Bacteria | 5701 |
| 839 | Ga0496124_0028667 | 3300048927 | Bacteria | 4977 |
| 840 | Ga0496124_0087458 | 3300048927 | Bacteria | 2548 |
| 841 | Ga0496124_0107378 | 3300048927 | Bacteria | 2252 |
| 842 | Ga0496124_0172950 | 3300048927 | Bacteria | 1670 |
| 843 | Ga0496124_0216254 | 3300048927 | Bacteria | 1445 |
| 844 | Ga0496125_0000971 | 3300048928 | Bacteria | 44877 |
| 845 | Ga0496125_0002177 | 3300048928 | Bacteria | 26150 |
| 846 | Ga0496125_0006705 | 3300048928 | Bacteria | 12379 |
| 847 | Ga0496125_0021605 | 3300048928 | Bacteria | 5998 |
| 848 | Ga0496125_0045763 | 3300048928 | Bacteria | 3678 |
| 849 | Ga0496125_0113892 | 3300048928 | Bacteria | 1949 |
| 850 | Ga0496126_0055003 | 3300048929 | Bacteria | 3602 |
| 851 | Ga0496126_0099192 | 3300048929 | Bacteria | 2551 |
| 852 | Ga0496126_0698856 | 3300048929 | Bacteria | 788 |
| 853 | Ga0495678_000106 | 3300049459 | Bacteria | 100780 |
| 854 | Ga0495678_000499 | 3300049459 | Bacteria | 38715 |
| 855 | Ga0495678_000694 | 3300049459 | Bacteria | 30590 |
| 856 | Ga0495678_002365 | 3300049459 | Bacteria | 12945 |
| 857 | Ga0495678_008447 | 3300049459 | Bacteria | 5191 |
| 858 | Ga0495678_008793 | 3300049459 | Bacteria | 5058 |
| 859 | Ga0495678_090731 | 3300049459 | Bacteria | 1077 |
| 860 | Ga0495682_0000069 | 3300049460 | Bacteria | 94250 |
| 861 | Ga0495682_0000804 | 3300049460 | Bacteria | 19829 |
| 862 | Ga0495682_0021349 | 3300049460 | Bacteria | 2426 |
| 863 | Ga0501031_0079268 | 3300049568 | Bacteria | 2140 |
| 864 | Ga0501032_0010649 | 3300049569 | Bacteria | 6621 |
| 865 | Ga0501034_0000164 | 3300049571 | Bacteria | 125152 |
| 866 | Ga0501034_0042054 | 3300049571 | Bacteria | 4625 |
| 867 | Ga0501034_0060143 | 3300049571 | Bacteria | 3817 |
| 868 | Ga0501034_0086454 | 3300049571 | Bacteria | 3136 |
| 869 | Ga0501037_0071136 | 3300049573 | Bacteria | 2531 |
| 870 | Ga0501038_0165610 | 3300049574 | Bacteria | 1793 |
| 871 | Ga0501043_0055575 | 3300049579 | Bacteria | 3110 |
| 872 | Ga0501047_0530647 | 3300049581 | Bacteria | 1002 |
| 873 | Ga0501243_004728 | 3300049675 | Bacteria | 2046 |
| 874 | Ga0501044_0317260 | 3300049823 | Bacteria | 1484 |
| 875 | Ga0501226_000034 | 3300049853 | Bacteria | 71598 |
| 876 | Ga0501226_000117 | 3300049853 | Bacteria | 17509 |
| 877 | nmdc:mga00v17_119646_c1 | 3300050491 | Bacteria | 1676 |
| 878 | nmdc:mga05p37_250708_c1 | 3300050507 | Bacteria | 2123 |
| 879 | nmdc:mga08y16_396816_c1 | 3300050511 | Bacteria | 1412 |
| 880 | nmdc:mga0sz30_7760_c1 | 3300050516 | Bacteria | 4032 |
| 881 | Ga0500593_000476 | 3300053117 | Bacteria | 15884 |
| 882 | Ga0500628_067781 | 3300053129 | Bacteria | 887 |
| 883 | Ga0500659_0002369 | 3300053135 | Bacteria | 11369 |
| 884 | 2510282678 | 2510065053 | Bacteria | 5005518 |
| 885 | 2510295333 | 2510065055 | Bacteria | 5037935 |
| 886 | 2510311042 | 2510065058 | Bacteria | 5005894 |
| 887 | 2511264702 | 2511231006 | Bacteria | 6794709 |
| 888 | 2511274353 | 2511231007 | Bacteria | 6306603 |
| 889 | 2511278470 | 2511231008 | Bacteria | 6624100 |
| 890 | 2511279868 | 2511231008 | Bacteria | 6624100 |
| 891 | 2511289681 | 2511231010 | Bacteria | 6373152 |
| 892 | 2511294610 | 2511231011 | Bacteria | 6149768 |
| 893 | 2511298919 | 2511231012 | Bacteria | 6738011 |
| 894 | 2511304203 | 2511231012 | Bacteria | 6738011 |
| 895 | 2511313102 | 2511231014 | Bacteria | 6462302 |
| 896 | 2511322234 | 2511231015 | Bacteria | 6598026 |
| 897 | 2511325254 | 2511231016 | Bacteria | 6704427 |
| 898 | 2511331101 | 2511231017 | Bacteria | 6503007 |
| 899 | 2511332238 | 2511231017 | Bacteria | 6503007 |
| 900 | 2511347000 | 2511231019 | Bacteria | 6520662 |
| 901 | 2511348012 | 2511231020 | Bacteria | 6115223 |
| 902 | 2511359156 | 2511231021 | Bacteria | 7302637 |
| 903 | 2511366124 | 2511231022 | Bacteria | 6719296 |
| 904 | 2511370490 | 2511231023 | Bacteria | 6808468 |
| 905 | 2511377020 | 2511231024 | Bacteria | 5835885 |
| 906 | 2511412441 | 2511231031 | Bacteria | 6558529 |
| 907 | 2511822033 | 2511231156 | Bacteria | 6845832 |
| 908 | 2512325215 | 2512047018 | Bacteria | 6663241 |
| 909 | 2554818311 | 2554235132 | Bacteria | 6772433 |
| 910 | 2554818595 | 2554235132 | Bacteria | 6772433 |
| 911 | 2555245329 | 2554235231 | Bacteria | 5215788 |
| 912 | 2555667044 | 2554235341 | Bacteria | 6867980 |
| 913 | 2583795313 | 2582580891 | Bacteria | 6800976 |
| 914 | 2597855295 | 2597489887 | Bacteria | 6666321 |
| 915 | 2597861296 | 2597489888 | Bacteria | 6179543 |
| 916 | 2597867043 | 2597489889 | Bacteria | 6297495 |
| 917 | 2599355547 | 2599185160 | Bacteria | 6844013 |
| 918 | 2599363050 | 2599185161 | Bacteria | 6960462 |
| 919 | 2599368644 | 2599185162 | Bacteria | 6957254 |
| 920 | 2599376159 | 2599185163 | Bacteria | 6995158 |
| 921 | 2599380653 | 2599185164 | Bacteria | 6841688 |
| 922 | 2599387831 | 2599185165 | Bacteria | 6843250 |
| 923 | 2599395017 | 2599185166 | Bacteria | 6959206 |
| 924 | 2599401183 | 2599185167 | Bacteria | 6353609 |
| 925 | 2599406782 | 2599185168 | Bacteria | 6997636 |
| 926 | 2599449484 | 2599185179 | Bacteria | 6611171 |
| 927 | 2599462381 | 2599185181 | Bacteria | 6844519 |
| 928 | 2599468196 | 2599185182 | Bacteria | 6883168 |
| 929 | 2599487421 | 2599185185 | Bacteria | 6652270 |
| 930 | 2599491398 | 2599185186 | Bacteria | 6831633 |
| 931 | 2599503814 | 2599185188 | Bacteria | 6164180 |
| 932 | 2599506122 | 2599185189 | Bacteria | 5862825 |
| 933 | 2599511556 | 2599185190 | Bacteria | 6285678 |
| 934 | 2599516530 | 2599185191 | Bacteria | 6297582 |
| 935 | 2599612597 | 2599185212 | Bacteria | 6765997 |
| 936 | 2599767791 | 2599185248 | Bacteria | 6696816 |
| 937 | 2599804223 | 2599185257 | Bacteria | 6492581 |
| 938 | 2599879417 | 2599185288 | Bacteria | 6666191 |
| 939 | 2599887892 | 2599185289 | Bacteria | 6778765 |
| 940 | 2599893059 | 2599185290 | Bacteria | 6289611 |
| 941 | 2599899417 | 2599185291 | Bacteria | 6775623 |
| 942 | 2599933247 | 2599185300 | Bacteria | 6062622 |
| 943 | 2599942004 | 2599185302 | Bacteria | 5954930 |
| 944 | 2599948637 | 2599185303 | Bacteria | 6512725 |
| 945 | 2599954985 | 2599185304 | Bacteria | 5951361 |
| 946 | 2599963560 | 2599185305 | Bacteria | 6748700 |
| 947 | 2599966423 | 2599185306 | Bacteria | 6637356 |
| 948 | 2599975255 | 2599185307 | Bacteria | 6194719 |
| 949 | 2599977272 | 2599185308 | Bacteria | 6621546 |
| 950 | 2599986292 | 2599185309 | Bacteria | 5969593 |
| 951 | 2599991345 | 2599185310 | Bacteria | 6014457 |
| 952 | 2599995162 | 2599185311 | Bacteria | 6354990 |
| 953 | 2600000826 | 2599185312 | Bacteria | 5912071 |
| 954 | 2600007474 | 2599185313 | Bacteria | 6658188 |
| 955 | 2600011295 | 2599185314 | Bacteria | 6621749 |
| 956 | 2600020215 | 2599185315 | Bacteria | 6771107 |
| 957 | 2600026578 | 2599185316 | Bacteria | 6320029 |
| 958 | 2600029540 | 2599185317 | Bacteria | 6435722 |
| 959 | 2600037608 | 2599185318 | Bacteria | 6961590 |
| 960 | 2600044264 | 2599185319 | Bacteria | 6637840 |
| 961 | 2600050046 | 2599185320 | Bacteria | 5963263 |
| 962 | 2600054706 | 2599185321 | Bacteria | 6764560 |
| 963 | 2600059889 | 2599185322 | Bacteria | 6763055 |
| 964 | 2600065308 | 2599185323 | Bacteria | 6688755 |
| 965 | 2600073249 | 2599185324 | Bacteria | 6590677 |
| 966 | 2600078980 | 2599185325 | Bacteria | 6324919 |
| 967 | 2600215003 | 2599185356 | Bacteria | 6843884 |
| 968 | 2600358776 | 2600254930 | Bacteria | 6431253 |
| 969 | 2600363094 | 2600254931 | Bacteria | 6734225 |
| 970 | 2601627782 | 2600255283 | Bacteria | 6061572 |
| 971 | 2601693370 | 2600255296 | Bacteria | 5784754 |
| 972 | 2601775169 | 2600255313 | Bacteria | 6842543 |
| 973 | 2601798184 | 2600255318 | Bacteria | 6383414 |
| 974 | 2606077072 | 2603880185 | Bacteria | 6379190 |
| 975 | 2606129682 | 2603880199 | Bacteria | 6377649 |
| 976 | 2608380395 | 2606217733 | Bacteria | 6360972 |
| 977 | 2608384257 | 2606217733 | Bacteria | 6360972 |
| 978 | 2621296449 | 2619619299 | Bacteria | 6649820 |
| 979 | 2624477811 | 2623620443 | Bacteria | 6427864 |
| 980 | 2624489389 | 2623620446 | Bacteria | 6500345 |
| 981 | 2643843165 | 2643221565 | Bacteria | 6216018 |
| 982 | 2643843784 | 2643221565 | Bacteria | 6216018 |
| 983 | 2643873585 | 2643221571 | Bacteria | 6228673 |
| 984 | 2643956033 | 2643221589 | Bacteria | 6250934 |
| 985 | 2644020155 | 2643221602 | Bacteria | 6249926 |
| 986 | 2644184167 | 2643221633 | Bacteria | 6733554 |
| 987 | 2644282863 | 2643221650 | Bacteria | 7029547 |
| 988 | 2644624398 | 2643221713 | Bacteria | 6554480 |
| 989 | 2652544482 | 2651869719 | Bacteria | 6047974 |
| 990 | 2671091921 | 2667528170 | Bacteria | 6786960 |
| 991 | 2671099691 | 2667528171 | Bacteria | 6900659 |
| 992 | 2671129625 | 2667528176 | Bacteria | 6724917 |
| 993 | 2671771232 | 2671180172 | Bacteria | 6495783 |
| 994 | 2677900373 | 2675903420 | Bacteria | 6247433 |
| 995 | 2678266506 | 2675903515 | Bacteria | 6580491 |
| 996 | 2715749509 | 2713897148 | Bacteria | 5883533 |
| 997 | 2715754506 | 2713897149 | Bacteria | 6506249 |
| 998 | 2723246199 | 2721755607 | Bacteria | 5841722 |
| 999 | 2738673395 | 2738541265 | Bacteria | 6594665 |
| 1000 | 2738690672 | 2738541271 | Bacteria | 5657310 |
| 1001 | 2738751788 | 2738541282 | Bacteria | 6593925 |
| 1002 | 2738807641 | 2738541294 | Bacteria | 6925949 |
| 1003 | 2738860829 | 2738541303 | Bacteria | 6591772 |
| 1004 | 2738895001 | 2738541309 | Bacteria | 6926455 |
| 1005 | 2739200952 | 2738543004 | Bacteria | 6381073 |
| 1006 | 2739261788 | 2738543015 | Bacteria | 6750701 |
| 1007 | 2739266446 | 2738543016 | Bacteria | 5657564 |
| 1008 | 2739288737 | 2738543020 | Bacteria | 5718238 |
| 1009 | 2739289693 | 2738543020 | Bacteria | 5718238 |
| 1010 | 2739294049 | 2738543021 | Bacteria | 5718241 |
| 1011 | 2739295005 | 2738543021 | Bacteria | 5718241 |
| 1012 | 2739312156 | 2738543025 | Bacteria | 6600348 |
| 1013 | 2743740864 | 2740892503 | Bacteria | 6855563 |
| 1014 | 2745007736 | 2744054620 | Bacteria | 6551379 |
| 1015 | 2765581309 | 2765235841 | Bacteria | 6137024 |
| 1016 | 2774118033 | 2773857670 | Bacteria | 6407454 |
| 1017 | 2774129165 | 2773857672 | Bacteria | 4993178 |
| 1018 | 2774136530 | 2773857673 | Bacteria | 6513460 |
| 1019 | 2784261474 | 2784132063 | Bacteria | 6262788 |
| 1020 | 2784316520 | 2784132072 | Bacteria | 6596533 |
| 1021 | 2794593604 | 2791355520 | Bacteria | 5948615 |
| 1022 | 2807405892 | 2806310737 | Bacteria | 5751088 |
| 1023 | 2807454227 | 2806310745 | Bacteria | 5742165 |
| 1024 | 2808858624 | 2808606361 | Bacteria | 6136259 |
| 1025 | 2808905826 | 2808606373 | Bacteria | 4423627 |
| 1026 | 2808923943 | 2808606376 | Bacteria | 6248667 |
| 1027 | 2808928115 | 2808606377 | Bacteria | 6646337 |
| 1028 | 2808938584 | 2808606378 | Bacteria | 6177535 |
| 1029 | 2808942257 | 2808606379 | Bacteria | 5022697 |
| 1030 | 2808946202 | 2808606380 | Bacteria | 6248705 |
| 1031 | 2808950703 | 2808606381 | Bacteria | 6646461 |
| 1032 | 2808960674 | 2808606382 | Bacteria | 6841132 |
| 1033 | 2808967129 | 2808606383 | Bacteria | 6138645 |
| 1034 | 2808980049 | 2808606385 | Bacteria | 6711065 |
| 1035 | 2808995769 | 2808606388 | Bacteria | 6706662 |
| 1036 | 2809001939 | 2808606389 | Bacteria | 6138126 |
| 1037 | 2812369855 | 2811994881 | Bacteria | 6298475 |
| 1038 | 2817488072 | 2816332298 | Bacteria | 6852809 |
| 1039 | 2819655466 | 2818991456 | Bacteria | 6123676 |
| 1040 | 2819704838 | 2818991464 | Bacteria | 6907494 |
| 1041 | 2825654706 | 2825651385 | Bacteria | 6715909 |
| 1042 | 2826582348 | 2826581358 | Bacteria | 5963467 |
| 1043 | 2834031330 | 2834028612 | Bacteria | 6354979 |
| 1044 | 2842805456 | 2842805378 | Bacteria | 5385175 |
| 1045 | 2842807949 | 2842805378 | Bacteria | 5385175 |
| 1046 | 2842816999 | 2842815866 | Bacteria | 5947510 |
| 1047 | 2842832034 | 2842826826 | Bacteria | 5974129 |
| 1048 | 2842833780 | 2842832357 | Bacteria | 5959113 |
| 1049 | 2842838305 | 2842837860 | Bacteria | 6066181 |
| 1050 | 2842846014 | 2842843487 | Bacteria | 6004777 |
| 1051 | 2842852121 | 2842849001 | Bacteria | 5924277 |
| 1052 | 2842855968 | 2842854478 | Bacteria | 6143501 |
| 1053 | 2844667531 | 2844665904 | Bacteria | 6817974 |
| 1054 | 2852616727 | 2852612431 | Bacteria | 6885235 |
| 1055 | 2852662613 | 2852657418 | Bacteria | 6472974 |
| 1056 | 2852671695 | 2852667396 | Bacteria | 6885555 |
| 1057 | 2860345250 | 2860339153 | Bacteria | 6846989 |
| 1058 | 2860868096 | 2860867994 | Bacteria | 5645326 |
| 1059 | 2878029754 | 2878029506 | Bacteria | 6418441 |
| 1060 | 2880230704 | 2880230671 | Bacteria | 6140320 |
| 1061 | 2904518615 | 2904518522 | Bacteria | 6068986 |
| 1062 | 2904553440 | 2904550169 | Bacteria | 6221258 |
| 1063 | 2908446685 | 2908446538 | Bacteria | 6829095 |
| 1064 | 2912963883 | 2912963787 | Bacteria | 5646108 |
| 1065 | 2913036894 | 2913036834 | Bacteria | 6704877 |
| 1066 | 2917070781 | 2917070673 | Bacteria | 6868303 |
| 1067 | 2917833288 | 2917832318 | Bacteria | 5346010 |
| 1068 | 2919067989 | 2919063839 | Bacteria | 6302690 |
| 1069 | 2919126172 | 2919125081 | Bacteria | 5385106 |
| 1070 | 2919156189 | 2919155634 | Bacteria | 4860545 |
| 1071 | 2919388836 | 2919385768 | Bacteria | 5897293 |
| 1072 | 2919457905 | 2919456309 | Bacteria | 6586567 |
| 1073 | 2919487013 | 2919481497 | Bacteria | 6907839 |
| 1074 | 2919487799 | 2919487758 | Bacteria | 5929766 |
| 1075 | 2919702406 | 2919697872 | Bacteria | 6553725 |
| 1076 | 2923153696 | 2923153595 | Bacteria | 6870622 |
| 1077 | 2923523941 | 2923519811 | Bacteria | 6298479 |
| 1078 | 2923589324 | 2923586266 | Bacteria | 6565975 |
| 1079 | 2929144364 | 2929144301 | Bacteria | 6622272 |
| 1080 | 2929189979 | 2929189879 | Bacteria | 5930554 |
| 1081 | 2931372309 | 2931369376 | Bacteria | 6847892 |
| 1082 | 2931391040 | 2931390751 | Bacteria | 6273349 |
| 1083 | 2931398449 | 2931396565 | Bacteria | 7251677 |
| 1084 | 2935357884 | 2935353572 | Unclassified | 6955622 |
| 1085 | 2939640523 | 2939636861 | Bacteria | 6297853 |
| 1086 | 2939654486 | 2939651529 | Bacteria | 5895393 |
| 1087 | 2945930503 | 2945928738 | Bacteria | 6053221 |
| 1088 | 2945967252 | 2945961074 | Bacteria | 7342064 |
| 1089 | 2946012849 | 2946006987 | Bacteria | 6705746 |
| 1090 | 2946028288 | 2946027586 | Bacteria | 6049274 |
| 1091 | 2947234805 | 2947233263 | Bacteria | 6439278 |
| 1092 | 2969304510 | 2969304461 | Bacteria | 6601805 |
| 1093 | 2974293740 | 2974289157 | Bacteria | 6080362 |
| 1094 | 2974302390 | 2974298342 | Bacteria | 4840922 |
| 1095 | 2984292417 | 2984286254 | Bacteria | 6702062 |
| 1096 | 2984500056 | 2984499530 | Bacteria | 5020881 |
| 1097 | 2984506570 | 2984504281 | Bacteria | 5262371 |
| 1098 | 2988731826 | 2988728565 | Bacteria | 6124362 |
| 1099 | 2998140074 | 2998139840 | Bacteria | 6073514 |
| 1100 | 3007253994 | 3007252601 | Bacteria | 4559114 |
| 1101 | 3007317262 | 3007315729 | Bacteria | 5076637 |
| 1102 | 3007398979 | 3007395558 | Bacteria | 6755444 |
| 1103 | 3007419681 | 3007419365 | Bacteria | 7026924 |
| 1104 | 3007422426 | 3007419365 | Bacteria | 7026924 |
| 1105 | 3007517492 | 3007511990 | Bacteria | 6481491 |
| 1106 | 3007617046 | 3007614139 | Bacteria | 6053559 |
| 1107 | 3007623817 | 3007619802 | Bacteria | 6411688 |
| 1108 | 3007722064 | 3007718800 | Bacteria | 5971527 |
| 1109 | 3007804062 | 3007803356 | Bacteria | 5931491 |
| 1110 | 3007859519 | 3007855910 | Bacteria | 5637581 |
| 1111 | 3007864748 | 3007861166 | Bacteria | 6045338 |
| 1112 | 3007871724 | 3007866637 | Bacteria | 5899198 |
| 1113 | 3007874921 | 3007872151 | Bacteria | 5268868 |
| 1114 | 637317447 | 637000220 | Bacteria | 7074893 |
| 1115 | 8011351071 | 8011350971 | Bacteria | 6158957 |
| 1116 | 8011356246 | 8011350971 | Bacteria | 6158957 |
| 1117 | 8015687959 | 8015687852 | Bacteria | 6613826 |
| 1118 | 8016731414 | 8016728285 | Bacteria | 5263933 |
| 1119 | 8019769374 | 8019769354 | Bacteria | 6924660 |
| 1120 | 8019779629 | 8019775933 | Bacteria | 6858656 |
| 1121 | 8029995176 | 8029995093 | Bacteria | 5990776 |
| 1122 | 8052494527 | 8052494512 | Bacteria | 5765634 |
| 1123 | 8054287601 | 8054285046 | Bacteria | 6919322 |
| 1124 | 8054349212 | 8054347763 | Bacteria | 5901107 |
| 1125 | 8054503646 | 8054503363 | Bacteria | 6101651 |
| 1126 | 8054930031 | 8054929484 | Bacteria | 5599761 |
| 1127 | 8055771057 | 8055770955 | Bacteria | 6827675 |
| 1128 | 8055818009 | 8055817908 | Bacteria | 6609162 |
| 1129 | 8055883518 | 8055878733 | Bacteria | 5907058 |
| 1130 | 8056116224 | 8056115690 | Bacteria | 5527654 |
| 1131 | 8056120821 | 8056120720 | Bacteria | 5758328 |
| 1132 | 8056126093 | 8056125926 | Bacteria | 6228218 |
| 1133 | 8056131978 | 8056131705 | Bacteria | 6107031 |
| 1134 | 8056137516 | 8056137416 | Bacteria | 6147080 |
| 1135 | 8056140045 | 8056137416 | Bacteria | 6147080 |
| 1136 | 8056143302 | 8056143049 | Bacteria | 6307666 |
| 1137 | 8056151124 | 8056148874 | Bacteria | 6479865 |
| 1138 | 8056160071 | 8056155041 | Bacteria | 6486948 |
| 1139 | 8056164007 | 8056161164 | Bacteria | 6106669 |
| 1140 | 8056170973 | 8056166840 | Bacteria | 5820959 |
| 1141 | 8056177106 | 8056172158 | Bacteria | 6133900 |
| 1142 | 8056182197 | 8056177738 | Bacteria | 6748268 |
| 1143 | 8056570805 | 8056569372 | Bacteria | 5997322 |
| 1144 | 8057802339 | 8057798959 | Bacteria | 6713499 |
| 1145 | Ga0105244_10076055 | |||
| 1146 | MRS2a_Contig_6737 | |||
| 1147 | MRS2a_Contig_799 | |||
| 1148 | SwRhRL2b_contig_803191 | |||
| 1149 | JGI24741J21665_1000755 | |||
| 1150 | JGI24750J21931_1025787 | |||
| 1151 | JGI25155J39150_1000041 | |||
| 1152 | JGI25156J39149_1000031 | |||
| 1153 | JGI25162J39368_1000208 | |||
| 1154 | JGI25162J39368_1000459 | |||
| 1155 | JGI25154J39366_1000049 | |||
| 1156 | JGI25157J39369_1000041 | |||
| 1157 | JGI25163J39215_1000407 | |||
| 1158 | JGI25163J39215_1000589 | |||
| 1159 | JGI25164J39214_1000297 | |||
| 1160 | JGI25164J39214_1000314 | |||
| 1161 | JGI25165J46597_1000175 | |||
| 1162 | JGI25165J46597_1000193 | |||
| 1163 | rootH1_10017529 | |||
| 1164 | rootH2_10016165 | |||
| 1165 | rootL2_10030466 | |||
| 1166 | rootL2_10110202 | |||
| 1167 | Ga0055538_1000012 | |||
| 1168 | Ga0055539_1000017 | |||
| 1169 | Ga0055533_1000021 | |||
| 1170 | Ga0055532_1000020 | |||
| 1171 | Ga0055525_1000117 | |||
| 1172 | Ga0055535_1004800 | |||
| 1173 | Ga0055536_1000272 | |||
| 1174 | Ga0055536_1003957 | |||
| 1175 | Ga0055536_1008918 | |||
| 1176 | Ga0055536_1029466 | |||
| 1177 | Ga0055530_10000081 | |||
| 1178 | Ga0055530_10000548 | |||
| 1179 | Ga0055530_10002934 | |||
| 1180 | Ga0055530_10009440 | |||
| 1181 | Ga0055540_1000121 | |||
| 1182 | Ga0055540_1000242 | |||
| 1183 | Ga0055540_1001116 | |||
| 1184 | Ga0055540_1032823 | |||
| 1185 | Ga0055531_10001033 | |||
| 1186 | Ga0055541_1000012 | |||
| 1187 | Ga0058692_1008307 | |||
| 1188 | Ga0065714_10002860 | |||
| 1189 | Ga0065714_10003342 | |||
| 1190 | Ga0065714_10005964 | |||
| 1191 | Ga0065714_10021354 | |||
| 1192 | Ga0065714_10064636 | |||
| 1193 | Ga0065714_10107372 | |||
| 1194 | Ga0065704_10001959 | |||
| 1195 | Ga0065704_10009110 | |||
| 1196 | Ga0065704_10070543 | |||
| 1197 | Ga0065704_10071119 | |||
| 1198 | Ga0065704_10121284 | |||
| 1199 | Ga0065712_10001109 | |||
| 1200 | Ga0065712_10068500 | |||
| 1201 | Ga0065712_10074016 | |||
| 1202 | Ga0065715_10013766 | |||
| 1203 | Ga0070670_100000010 | |||
| 1204 | Ga0070670_100003035 | |||
| 1205 | Ga0068869_100084556 | |||
| 1206 | Ga0070691_10142847 | |||
| 1207 | Ga0070661_100000237 | |||
| 1208 | Ga0070661_100293685 | |||
| 1209 | Ga0070669_100000158 | |||
| 1210 | Ga0070669_100000277 | |||
| 1211 | Ga0070669_100002451 | |||
| 1212 | Ga0070669_100035538 | |||
| 1213 | Ga0070675_100017974 | |||
| 1214 | Ga0070671_100000012 | |||
| 1215 | Ga0070674_100037246 | |||
| 1216 | Ga0070688_100002333 | |||
| 1217 | Ga0070659_100407812 | |||
| 1218 | Ga0070667_100000097 | |||
| 1219 | Ga0070700_100014372 | |||
| 1220 | Ga0070700_100062768 | |||
| 1221 | Ga0070662_100000063 | |||
| 1222 | Ga0070662_100087854 | |||
| 1223 | Ga0068867_100000146 | |||
| 1224 | Ga0070685_10000077 | |||
| 1225 | Ga0070697_100147240 | |||
| 1226 | Ga0068853_100000143 | |||
| 1227 | Ga0070672_100398226 | |||
| 1228 | Ga0070686_100158990 | |||
| 1229 | Ga0070665_100078702 | |||
| 1230 | Ga0070665_100089367 | |||
| 1231 | Ga0070665_100509061 | |||
| 1232 | Ga0068857_100627854 | |||
| 1233 | Ga0068854_100004725 | |||
| 1234 | Ga0068852_100187387 | |||
| 1235 | Ga0068859_100014469 | |||
| 1236 | Ga0068859_100404284 | |||
| 1237 | Ga0068864_100000018 | |||
| 1238 | Ga0068861_100001394 | |||
| 1239 | Ga0068861_100059167 | |||
| 1240 | Ga0068861_100188902 | |||
| 1241 | Ga0068851_10000018 | |||
| 1242 | Ga0068863_100162161 | |||
| 1243 | Ga0068863_100263895 | |||
| 1244 | Ga0068858_100024458 | |||
| 1245 | Ga0068858_100155276 | |||
| 1246 | Ga0068860_100000532 | |||
| 1247 | Ga0068862_100000522 | |||
| 1248 | Ga0068862_100136925 | |||
| 1249 | Ga0075364_10031476 | |||
| 1250 | Ga0075364_10113138 | |||
| 1251 | Ga0075432_10000648 | |||
| 1252 | Ga0070712_100201381 | |||
| 1253 | Ga0075362_10066213 | |||
| 1254 | Ga0075362_10072007 | |||
| 1255 | Ga0075369_10045588 | |||
| 1256 | Ga0097621_100081003 | |||
| 1257 | Ga0068871_100141867 | |||
| 1258 | Ga0075428_100214665 | |||
| 1259 | Ga0068865_100003939 | |||
| 1260 | Ga0075436_100050318 | |||
| 1261 | Ga0097620_100014468 | |||
| 1262 | Ga0097620_100404267 | |||
| 1263 | Ga0099823_1000217 | |||
| 1264 | Ga0079104_1000291 | |||
| 1265 | Ga0079104_1000306 | |||
| 1266 | Ga0099826_10012980 | |||
| 1267 | Ga0105251_10000068 | |||
| 1268 | Ga0105251_10000881 | |||
| 1269 | Ga0105251_10002062 | |||
| 1270 | Ga0105251_10004312 | |||
| 1271 | Ga0105251_10007262 | |||
| 1272 | Ga0105251_10071828 | |||
| 1273 | Ga0105244_10000726 | |||
| 1274 | Ga0105244_10001163 | |||
| 1275 | Ga0105244_10001870 | |||
| 1276 | Ga0105244_10004378 | |||
| 1277 | Ga0105244_10005309 | |||
| 1278 | Ga0105244_10007469 | |||
| 1279 | Ga0105244_10011847 | |||
| 1280 | Ga0105244_10030106 | |||
| 1281 | Ga0105244_10030745 | |||
| 1282 | Ga0105244_10072164 | |||
| 1283 | Ga0105244_10132417 | |||
| 1284 | Ga0105250_10000825 | |||
| 1285 | Ga0105250_10022663 | |||
| 1286 | Ga0105250_10023442 | |||
| 1287 | Ga0105250_10031572 | |||
| 1288 | Ga0105250_10037205 | |||
| 1289 | Ga0105250_10038529 | |||
| 1290 | Ga0105250_10056987 | |||
| 1291 | Ga0111539_10096618 | |||
| 1292 | Ga0111539_10935004 | |||
| 1293 | Ga0114129_10289749 | |||
| 1294 | Ga0105243_10000075 | |||
| 1295 | Ga0105243_10000867 | |||
| 1296 | Ga0105243_10001447 | |||
| 1297 | Ga0105243_10010141 | |||
| 1298 | Ga0105243_10097512 | |||
| 1299 | Ga0105241_10398380 | |||
| 1300 | Ga0105242_10000358 | |||
| 1301 | Ga0105242_10090188 | |||
| 1302 | Ga0105242_10214496 | |||
| 1303 | Ga0105248_10019408 | |||
| 1304 | Ga0105248_10123998 | |||
| 1305 | Ga0105249_10093807 | |||
| 1306 | Ga0105249_10152357 | |||
| 1307 | Ga0105239_10087107 | |||
| 1308 | Ga0105246_10000002 | |||
| 1309 | Ga0105246_10000504 | |||
| 1310 | Ga0105246_10010894 | |||
| 1311 | Ga0157373_10003814 | |||
| 1312 | Ga0157373_10006597 | |||
| 1313 | Ga0157373_10023762 | |||
| 1314 | Ga0157373_10051866 | |||
| 1315 | Ga0157373_10094446 | |||
| 1316 | Ga0157371_10000935 | |||
| 1317 | Ga0157371_10000953 | |||
| 1318 | Ga0157371_10002539 | |||
| 1319 | Ga0157371_10076619 | |||
| 1320 | Ga0157370_10000698 | |||
| 1321 | Ga0157370_10000954 | |||
| 1322 | Ga0157370_10002312 | |||
| 1323 | Ga0157370_10186706 | |||
| 1324 | Ga0157369_10023081 | |||
| 1325 | Ga0157369_10521216 | |||
| 1326 | Ga0157378_10002415 | |||
| 1327 | Ga0157378_10024025 | |||
| 1328 | Ga0163162_10017052 | |||
| 1329 | Ga0163162_10079724 | |||
| 1330 | Ga0163162_10224194 | |||
| 1331 | Ga0157372_10013753 | |||
| 1332 | Ga0157372_10052807 | |||
| 1333 | Ga0163163_10001112 | |||
| 1334 | Ga0163163_10101543 | |||
| 1335 | Ga0157380_10272904 | |||
| 1336 | Ga0182008_10001337 | |||
| 1337 | Ga0182008_10003405 | |||
| 1338 | Ga0157379_10054053 | |||
| 1339 | Ga0157376_10100048 | |||
| 1340 | Ga0157376_10136874 | |||
| 1341 | Ga0182006_1001380 | |||
| 1342 | Ga0182006_1002154 | |||
| 1343 | Ga0182006_1003537 | |||
| 1344 | Ga0182006_1008824 | |||
| 1345 | Ga0182007_10000228 | |||
| 1346 | Ga0182005_1000375 | |||
| 1347 | Ga0182005_1000663 | |||
| 1348 | Ga0182005_1018031 | |||
| 1349 | Ga0163161_10050909 | |||
| 1350 | Ga0163161_10097813 | |||
| 1351 | Ga0163161_10173254 | |||
| 1352 | Ga0163161_10287792 | |||
| 1353 | Ga0163161_10339170 | |||
| 1354 | Ga0213876_10008910 | |||
| 1355 | Ga0209435_100014 | |||
| 1356 | Ga0209435_100533 | |||
| 1357 | Ga0209760_100082 | |||
| 1358 | Ga0209760_100230 | |||
| 1359 | Ga0209784_100007 | |||
| 1360 | Ga0209566_100009 | |||
| 1361 | Ga0209674_100021 | |||
| 1362 | Ga0209147_100009 | |||
| 1363 | Ga0209563_100018 | |||
| 1364 | Ga0209563_101660 | |||
| 1365 | Ga0207427_100005 | |||
| 1366 | Ga0207427_100006 | |||
| 1367 | Ga0209437_100013 | |||
| 1368 | Ga0209437_100018 | |||
| 1369 | Ga0209437_109161 | |||
| 1370 | Ga0209258_100237 | |||
| 1371 | Ga0209646_1000001 | |||
| 1372 | Ga0209646_1000277 | |||
| 1373 | Ga0209026_1000073 | |||
| 1374 | Ga0209677_100012 | |||
| 1375 | Ga0209759_1000013 | |||
| 1376 | Ga0209759_1007431 | |||
| 1377 | Ga0209759_1018453 | |||
| 1378 | Ga0209233_1000021 | |||
| 1379 | Ga0209233_1000022 | |||
| 1380 | Ga0209676_1000015 | |||
| 1381 | Ga0209676_1000157 | |||
| 1382 | Ga0209676_1000222 | |||
| 1383 | Ga0209676_1000583 | |||
| 1384 | Ga0209676_1002274 | |||
| 1385 | Ga0209676_1002823 | |||
| 1386 | Ga0209676_1004012 | |||
| 1387 | Ga0209050_1000030 | |||
| 1388 | Ga0209050_1000061 | |||
| 1389 | Ga0209050_1000296 | |||
| 1390 | Ga0209050_1000318 | |||
| 1391 | Ga0209050_1001114 | |||
| 1392 | Ga0209051_1000088 | |||
| 1393 | Ga0209051_1000143 | |||
| 1394 | Ga0209051_1000295 | |||
| 1395 | Ga0209051_1004120 | |||
| 1396 | Ga0209051_1005691 | |||
| 1397 | Ga0209257_1000143 | |||
| 1398 | Ga0209257_1011914 | |||
| 1399 | Ga0207656_10000009 | |||
| 1400 | Ga0207696_1000055 | |||
| 1401 | Ga0207696_1000151 | |||
| 1402 | Ga0207696_1000165 | |||
| 1403 | Ga0207696_1003300 | |||
| 1404 | Ga0207696_1007367 | |||
| 1405 | Ga0207696_1015831 | |||
| 1406 | Ga0207696_1024677 | |||
| 1407 | Ga0207696_1028968 | |||
| 1408 | Ga0207655_1000135 | |||
| 1409 | Ga0207655_1000548 | |||
| 1410 | Ga0207655_1000667 | |||
| 1411 | Ga0207655_1000754 | |||
| 1412 | Ga0207655_1001254 | |||
| 1413 | Ga0207655_1001422 | |||
| 1414 | Ga0207655_1001733 | |||
| 1415 | Ga0207655_1002247 | |||
| 1416 | Ga0207655_1004181 | |||
| 1417 | Ga0207655_1004957 | |||
| 1418 | Ga0207655_1006266 | |||
| 1419 | Ga0207655_1008704 | |||
| 1420 | Ga0207655_1008902 | |||
| 1421 | Ga0207655_1009242 | |||
| 1422 | Ga0207655_1018736 | |||
| 1423 | Ga0207655_1026577 | |||
| 1424 | Ga0207655_1036871 | |||
| 1425 | Ga0207655_1038021 | |||
| 1426 | Ga0207655_1087014 | |||
| 1427 | Ga0207713_1000103 | |||
| 1428 | Ga0207713_1000325 | |||
| 1429 | Ga0207713_1003599 | |||
| 1430 | Ga0207713_1003772 | |||
| 1431 | Ga0207713_1004686 | |||
| 1432 | Ga0207713_1006272 | |||
| 1433 | Ga0207713_1006916 | |||
| 1434 | Ga0207713_1010743 | |||
| 1435 | Ga0207713_1016458 | |||
| 1436 | Ga0207713_1020322 | |||
| 1437 | Ga0207713_1022973 | |||
| 1438 | Ga0207713_1041073 | |||
| 1439 | Ga0207713_1048900 | |||
| 1440 | Ga0207713_1050375 | |||
| 1441 | Ga0207710_10008242 | |||
| 1442 | Ga0207671_10000876 | |||
| 1443 | Ga0207693_10121721 | |||
| 1444 | Ga0207662_10236760 | |||
| 1445 | Ga0207649_10000007 | |||
| 1446 | Ga0207681_10000291 | |||
| 1447 | Ga0207681_10006732 | |||
| 1448 | Ga0207650_10000003 | |||
| 1449 | Ga0207650_10000308 | |||
| 1450 | Ga0207650_10000407 | |||
| 1451 | Ga0207659_10033931 | |||
| 1452 | Ga0207644_10001111 | |||
| 1453 | Ga0207690_10391921 | |||
| 1454 | Ga0207706_10000050 | |||
| 1455 | Ga0207706_10011123 | |||
| 1456 | Ga0207686_10001347 | |||
| 1457 | Ga0207686_10388387 | |||
| 1458 | Ga0207709_10000107 | |||
| 1459 | Ga0207709_10001047 | |||
| 1460 | Ga0207709_10002479 | |||
| 1461 | Ga0207709_10009947 | |||
| 1462 | Ga0207709_10066438 | |||
| 1463 | Ga0207709_10136564 | |||
| 1464 | Ga0207709_10544924 | |||
| 1465 | Ga0207670_10171133 | |||
| 1466 | Ga0207670_10507585 | |||
| 1467 | Ga0207669_10062361 | |||
| 1468 | Ga0207704_10066450 | |||
| 1469 | Ga0207691_10114481 | |||
| 1470 | Ga0207711_10002049 | |||
| 1471 | Ga0207711_10013160 | |||
| 1472 | Ga0207711_10391003 | |||
| 1473 | Ga0207689_10150576 | |||
| 1474 | Ga0207679_10000013 | |||
| 1475 | Ga0207712_10009817 | |||
| 1476 | Ga0207712_10025348 | |||
| 1477 | Ga0207712_10033258 | |||
| 1478 | Ga0207640_10008153 | |||
| 1479 | Ga0207658_10000007 | |||
| 1480 | Ga0207639_10000079 | |||
| 1481 | Ga0207678_10710562 | |||
| 1482 | Ga0207708_10006713 | |||
| 1483 | Ga0207708_10023107 | |||
| 1484 | Ga0207641_10094982 | |||
| 1485 | Ga0207648_10000425 | |||
| 1486 | Ga0207648_10045457 | |||
| 1487 | Ga0207676_10000003 | |||
| 1488 | Ga0207676_10186858 | |||
| 1489 | Ga0207675_100007239 | |||
| 1490 | Ga0207675_100117779 | |||
| 1491 | Ga0207675_100267215 | |||
| 1492 | Ga0207698_10387053 | |||
| 1493 | Ga0209281_1000091 | |||
| 1494 | Ga0209281_1000237 | |||
| 1495 | Ga0209281_1020632 | |||
| 1496 | Ga0209389_1000065 | |||
| 1497 | Ga0209371_1000176 | |||
| 1498 | Ga0209371_1000929 | |||
| 1499 | Ga0209371_1010153 | |||
| 1500 | Ga0209996_1002016 | |||
| 1501 | Ga0209995_1004740 | |||
| 1502 | Ga0209968_1004678 | |||
| 1503 | Ga0210002_1006695 | |||
| 1504 | Ga0209983_1001053 | |||
| 1505 | Ga0209282_1042131 | |||
| 1506 | Ga0209974_10007890 | |||
| 1507 | Ga0209974_10026535 | |||
| 1508 | Ga0209974_10057638 | |||
| 1509 | Ga0207428_10042514 | |||
| 1510 | Ga0207428_10051774 | |||
| 1511 | Ga0207428_10238084 | |||
| 1512 | Ga0207428_10299703 | |||
| 1513 | Ga0268266_10002796 | |||
| 1514 | Ga0268266_10041478 | |||
| 1515 | Ga0268266_10136768 | |||
| 1516 | Ga0268265_10000234 | |||
| 1517 | Ga0268264_10000009 | |||
| 1518 | Ga0268256_1000146 | |||
| 1519 | Ga0268256_1000782 | |||
| 1520 | Ga0268256_1009906 | |||
| 1521 | Ga0307511_10008829 | |||
| 1522 | Ga0314311_1174000 | |||
| 1523 | Ga0316183_1099209 | |||
| 1524 | Ga0316183_1101138 | |||
| 1525 | Ga0316181_1016487 | |||
| 1526 | Ga0316181_1111959 | |||
| 1527 | Ga0307513_10007959 | |||
| 1528 | Ga0307509_10107120 | |||
| 1529 | Ga0307509_10114588 | |||
| 1530 | Ga0307516_10345550 | |||
| 1531 | Ga0307416_101118720 | |||
| 1532 | Ga0307414_10197381 | |||
| 1533 | Ga0307414_10422723 | |||
| 1534 | Ga0395899_0000478 | |||
| 1535 | Ga0395905_0006602 | |||
| 1536 | Ga0436365_1689934 | |||
| 1537 | Ga0439436_0002017 | |||
| 1538 | Ga0439436_0008011 | |||
| 1539 | Ga0439438_000775 | |||
| 1540 | Ga0439438_005624 | |||
| 1541 | Ga0439438_012464 | |||
| 1542 | Ga0439439_0002322 | |||
| 1543 | Ga0439447_002739 | |||
| 1544 | Ga0439447_013680 | |||
| 1545 | Ga0439447_019637 | |||
| 1546 | Ga0439447_029111 | |||
| 1547 | Ga0439466_0000289 | |||
| 1548 | Ga0439466_0001121 | |||
| 1549 | Ga0439466_0001334 | |||
| 1550 | Ga0439466_0002385 | |||
| 1551 | Ga0439466_0004035 | |||
| 1552 | Ga0439466_0021199 | |||
| 1553 | Ga0439466_0025436 | |||
| 1554 | Ga0439437_000536 | |||
| 1555 | Ga0439442_008500 | |||
| 1556 | Ga0439432_001586 | |||
| 1557 | Ga0439432_001810 | |||
| 1558 | Ga0439432_002251 | |||
| 1559 | Ga0439432_014726 | |||
| 1560 | Ga0439432_031069 | |||
| 1561 | Ga0439432_066039 | |||
| 1562 | Ga0439449_0010779 | |||
| 1563 | Ga0439451_000786 | |||
| 1564 | Ga0439451_002140 | |||
| 1565 | Ga0439452_000190 | |||
| 1566 | Ga0439452_000443 | |||
| 1567 | Ga0439452_001993 | |||
| 1568 | Ga0439452_001995 | |||
| 1569 | Ga0439452_003249 | |||
| 1570 | Ga0439452_008676 | |||
| 1571 | Ga0439452_010013 | |||
| 1572 | Ga0439456_000036 | |||
| 1573 | Ga0439456_000406 | |||
| 1574 | Ga0439456_000462 | |||
| 1575 | Ga0439456_005910 | |||
| 1576 | Ga0439462_0007982 | |||
| 1577 | Ga0439463_000120 | |||
| 1578 | Ga0439463_000491 | |||
| 1579 | Ga0439463_001245 | |||
| 1580 | Ga0450911_000011 | |||
| 1581 | Ga0450911_000019 | |||
| 1582 | Ga0450911_000211 | |||
| 1583 | Ga0450911_000509 | |||
| 1584 | Ga0450911_004119 | |||
| 1585 | Ga0450914_000201 | |||
| 1586 | Ga0450919_003455 | |||
| 1587 | Ga0450922_001769 | |||
| 1588 | Ga0450890_000131 | |||
| 1589 | Ga0450894_003690 | |||
| 1590 | Ga0450902_001841 | |||
| 1591 | Ga0450903_000620 | |||
| 1592 | Ga0450904_000097 | |||
| 1593 | Ga0450905_000157 | |||
| 1594 | Ga0450906_006046 | |||
| 1595 | Ga0450907_000110 | |||
| 1596 | Ga0450907_003387 | |||
| 1597 | Ga0450910_002043 | |||
| 1598 | Ga0439446_0000463 | |||
| 1599 | Ga0439446_0002388 | |||
| 1600 | Ga0439446_0002934 | |||
| 1601 | Ga0439446_0003376 | |||
| 1602 | Ga0439446_0004933 | |||
| 1603 | Ga0450908_005890 | |||
| 1604 | Ga0450909_004626 | |||
| 1605 | Ga0450909_011498 | |||
| 1606 | Ga0439434_0000092 | |||
| 1607 | Ga0439434_0000184 | |||
| 1608 | Ga0439464_0040131 | |||
| 1609 | Ga0439460_0000002 | |||
| 1610 | Ga0439460_0001270 | |||
| 1611 | Ga0439460_0009852 | |||
| 1612 | Ga0439460_0018324 | |||
| 1613 | Ga0450916_000505 | |||
| 1614 | Ga0450918_008576 | |||
| 1615 | Ga0450901_000463 | |||
| 1616 | Ga0451577_0277040 | |||
| 1617 | Ga0439440_0005351 | |||
| 1618 | Ga0466965_0064128 | |||
| 1619 | Ga0466964_0008174 | |||
| 1620 | Ga0453684_0014934 | |||
| 1621 | Ga0453684_0017471 | |||
| 1622 | Ga0453684_0040463 | |||
| 1623 | Ga0466968_0005006 | |||
| 1624 | Ga0451576_0059657 | |||
| 1625 | Ga0495617_001787 | |||
| 1626 | Ga0495617_012651 | |||
| 1627 | Ga0495617_024999 | |||
| 1628 | Ga0495627_000095 | |||
| 1629 | Ga0495627_000646 | |||
| 1630 | Ga0495627_000869 | |||
| 1631 | Ga0495627_010851 | |||
| 1632 | Ga0495627_039198 | |||
| 1633 | Ga0495603_0001944 | |||
| 1634 | Ga0495603_0161761 | |||
| 1635 | Ga0495590_0002659 | |||
| 1636 | Ga0495590_0007106 | |||
| 1637 | Ga0495591_000198 | |||
| 1638 | Ga0495591_000334 | |||
| 1639 | Ga0495591_000628 | |||
| 1640 | Ga0495591_002016 | |||
| 1641 | Ga0495591_002668 | |||
| 1642 | Ga0495591_010984 | |||
| 1643 | Ga0495591_017440 | |||
| 1644 | Ga0495591_020022 | |||
| 1645 | Ga0495591_020266 | |||
| 1646 | Ga0495591_025531 | |||
| 1647 | Ga0495591_027139 | |||
| 1648 | Ga0495629_0083415 | |||
| 1649 | Ga0495638_0011328 | |||
| 1650 | Ga0495638_0011519 | |||
| 1651 | Ga0495638_0019536 | |||
| 1652 | Ga0495638_0057233 | |||
| 1653 | Ga0495638_0060978 | |||
| 1654 | Ga0495653_0005962 | |||
| 1655 | Ga0495653_0006872 | |||
| 1656 | Ga0495653_0147285 | |||
| 1657 | Ga0495650_0001617 | |||
| 1658 | Ga0495650_0003976 | |||
| 1659 | Ga0495650_0004680 | |||
| 1660 | Ga0495650_0008792 | |||
| 1661 | Ga0495650_0048726 | |||
| 1662 | Ga0495650_0076954 | |||
| 1663 | Ga0495582_0000456 | |||
| 1664 | Ga0495605_0000019 | |||
| 1665 | Ga0495605_0000376 | |||
| 1666 | Ga0495605_0000387 | |||
| 1667 | Ga0495605_0000664 | |||
| 1668 | Ga0495605_0001221 | |||
| 1669 | Ga0495605_0002242 | |||
| 1670 | Ga0495605_0007209 | |||
| 1671 | Ga0495605_0171991 | |||
| 1672 | Ga0495639_0000295 | |||
| 1673 | Ga0495584_0000408 | |||
| 1674 | Ga0495584_0002026 | |||
| 1675 | Ga0495584_0002140 | |||
| 1676 | Ga0495584_0006909 | |||
| 1677 | Ga0495584_0007040 | |||
| 1678 | Ga0495584_0009992 | |||
| 1679 | Ga0495584_0046053 | |||
| 1680 | Ga0495585_0000895 | |||
| 1681 | Ga0495585_0005030 | |||
| 1682 | Ga0495585_0010265 | |||
| 1683 | Ga0495585_0010423 | |||
| 1684 | Ga0495585_0035713 | |||
| 1685 | Ga0495585_0037229 | |||
| 1686 | Ga0495594_0011120 | |||
| 1687 | Ga0495596_0000175 | |||
| 1688 | Ga0495596_0015961 | |||
| 1689 | Ga0495607_0000024 | |||
| 1690 | Ga0495607_0000306 | |||
| 1691 | Ga0495607_0000531 | |||
| 1692 | Ga0495607_0000751 | |||
| 1693 | Ga0495607_0001123 | |||
| 1694 | Ga0495607_0003423 | |||
| 1695 | Ga0495607_0008096 | |||
| 1696 | Ga0495607_0012685 | |||
| 1697 | Ga0495607_0014244 | |||
| 1698 | Ga0495607_0020047 | |||
| 1699 | Ga0495607_0046946 | |||
| 1700 | Ga0495607_0065376 | |||
| 1701 | Ga0495607_0095448 | |||
| 1702 | Ga0495607_0117861 | |||
| 1703 | Ga0495607_0171456 | |||
| 1704 | Ga0495583_0000146 | |||
| 1705 | Ga0495583_0000452 | |||
| 1706 | Ga0495583_0001254 | |||
| 1707 | Ga0495583_0002206 | |||
| 1708 | Ga0495583_0005888 | |||
| 1709 | Ga0495583_0015935 | |||
| 1710 | Ga0495606_0000115 | |||
| 1711 | Ga0495606_0000246 | |||
| 1712 | Ga0495606_0000454 | |||
| 1713 | Ga0495606_0000477 | |||
| 1714 | Ga0495606_0001164 | |||
| 1715 | Ga0495606_0002670 | |||
| 1716 | Ga0495606_0007824 | |||
| 1717 | Ga0495606_0009157 | |||
| 1718 | Ga0495606_0038528 | |||
| 1719 | Ga0495610_0003687 | |||
| 1720 | Ga0495610_0008413 | |||
| 1721 | Ga0495610_0014124 | |||
| 1722 | Ga0495610_0054587 | |||
| 1723 | Ga0495616_0000852 | |||
| 1724 | Ga0495616_0035228 | |||
| 1725 | Ga0495616_0051050 | |||
| 1726 | Ga0495616_0088639 | |||
| 1727 | Ga0495620_0000023 | |||
| 1728 | Ga0495620_0000108 | |||
| 1729 | Ga0495620_0001611 | |||
| 1730 | Ga0495620_0001719 | |||
| 1731 | Ga0495620_0002090 | |||
| 1732 | Ga0495620_0003034 | |||
| 1733 | Ga0495620_0003388 | |||
| 1734 | Ga0495620_0089078 | |||
| 1735 | Ga0495631_0001318 | |||
| 1736 | Ga0495631_0004094 | |||
| 1737 | Ga0495631_0006065 | |||
| 1738 | Ga0495632_0001735 | |||
| 1739 | Ga0495632_0001795 | |||
| 1740 | Ga0495632_0003309 | |||
| 1741 | Ga0495632_0005231 | |||
| 1742 | Ga0495632_0015933 | |||
| 1743 | Ga0495632_0182428 | |||
| 1744 | Ga0495637_0000054 | |||
| 1745 | Ga0495637_0000194 | |||
| 1746 | Ga0495637_0000269 | |||
| 1747 | Ga0495637_0000466 | |||
| 1748 | Ga0495637_0004473 | |||
| 1749 | Ga0495637_0006747 | |||
| 1750 | Ga0495637_0015104 | |||
| 1751 | Ga0495637_0020194 | |||
| 1752 | Ga0495637_0026282 | |||
| 1753 | Ga0495637_0041970 | |||
| 1754 | Ga0495637_0052122 | |||
| 1755 | Ga0495643_0000402 | |||
| 1756 | Ga0495643_0000730 | |||
| 1757 | Ga0495643_0001170 | |||
| 1758 | Ga0495643_0001604 | |||
| 1759 | Ga0495643_0001680 | |||
| 1760 | Ga0495643_0002170 | |||
| 1761 | Ga0495643_0002454 | |||
| 1762 | Ga0495643_0009905 | |||
| 1763 | Ga0495643_0010294 | |||
| 1764 | Ga0495643_0019663 | |||
| 1765 | Ga0495643_0087473 | |||
| 1766 | Ga0495648_0000783 | |||
| 1767 | Ga0495648_0001858 | |||
| 1768 | Ga0495648_0002460 | |||
| 1769 | Ga0495648_0002748 | |||
| 1770 | Ga0495648_0012345 | |||
| 1771 | Ga0495648_0017798 | |||
| 1772 | Ga0495648_0183970 | |||
| 1773 | Ga0495666_0005396 | |||
| 1774 | Ga0495666_0042994 | |||
| 1775 | Ga0495666_0058971 | |||
| 1776 | Ga0495666_0107903 | |||
| 1777 | Ga0495642_0000536 | |||
| 1778 | Ga0495642_0000555 | |||
| 1779 | Ga0495642_0015291 | |||
| 1780 | Ga0495654_0000210 | |||
| 1781 | Ga0495654_0001010 | |||
| 1782 | Ga0495654_0002438 | |||
| 1783 | Ga0495654_0003497 | |||
| 1784 | Ga0495654_0009898 | |||
| 1785 | Ga0495654_0015931 | |||
| 1786 | Ga0495654_0023317 | |||
| 1787 | Ga0495654_0090195 | |||
| 1788 | Ga0495586_0022525 | |||
| 1789 | Ga0495587_0003520 | |||
| 1790 | Ga0495587_0057179 | |||
| 1791 | Ga0495609_0000061 | |||
| 1792 | Ga0495609_0000101 | |||
| 1793 | Ga0495609_0000696 | |||
| 1794 | Ga0495609_0001338 | |||
| 1795 | Ga0495609_0011057 | |||
| 1796 | Ga0495609_0022196 | |||
| 1797 | Ga0495597_0000676 | |||
| 1798 | Ga0495597_0004012 | |||
| 1799 | Ga0495597_0005112 | |||
| 1800 | Ga0495597_0005967 | |||
| 1801 | Ga0495597_0021813 | |||
| 1802 | Ga0495597_0135952 | |||
| 1803 | Ga0495622_0005884 | |||
| 1804 | Ga0495622_0006049 | |||
| 1805 | Ga0495622_0020035 | |||
| 1806 | Ga0495633_0000129 | |||
| 1807 | Ga0495633_0003624 | |||
| 1808 | Ga0495656_0004240 | |||
| 1809 | Ga0495668_0001708 | |||
| 1810 | Ga0495668_0003520 | |||
| 1811 | Ga0495668_0029435 | |||
| 1812 | Ga0495668_0093913 | |||
| 1813 | Ga0495668_0225844 | |||
| 1814 | Ga0495634_0015246 | |||
| 1815 | Ga0495634_0311913 | |||
| 1816 | Ga0495611_0000525 | |||
| 1817 | Ga0495611_0000571 | |||
| 1818 | Ga0495611_0001821 | |||
| 1819 | Ga0495625_0000147 | |||
| 1820 | Ga0495625_0011548 | |||
| 1821 | Ga0495625_0135001 | |||
| 1822 | Ga0495625_0159038 | |||
| 1823 | Ga0495635_0000583 | |||
| 1824 | Ga0495635_0000604 | |||
| 1825 | Ga0495659_0001461 | |||
| 1826 | Ga0495659_0006759 | |||
| 1827 | Ga0495661_0000153 | |||
| 1828 | Ga0495661_0000196 | |||
| 1829 | Ga0495661_0000431 | |||
| 1830 | Ga0495661_0000484 | |||
| 1831 | Ga0495661_0001727 | |||
| 1832 | Ga0495661_0058509 | |||
| 1833 | Ga0495661_0063649 | |||
| 1834 | Ga0495661_0074274 | |||
| 1835 | Ga0495661_0082777 | |||
| 1836 | Ga0495661_0252256 | |||
| 1837 | Ga0495588_0005506 | |||
| 1838 | Ga0495623_0050832 | |||
| 1839 | Ga0495646_0039441 | |||
| 1840 | Ga0495669_0160323 | |||
| 1841 | Ga0495613_0054929 | |||
| 1842 | Ga0495670_0000388 | |||
| 1843 | Ga0495670_0001599 | |||
| 1844 | Ga0495670_0003795 | |||
| 1845 | Ga0495670_0005439 | |||
| 1846 | Ga0495670_0007272 | |||
| 1847 | Ga0495671_0000471 | |||
| 1848 | Ga0495671_0001192 | |||
| 1849 | Ga0495671_0001895 | |||
| 1850 | Ga0495671_0001900 | |||
| 1851 | Ga0495671_0002856 | |||
| 1852 | Ga0495671_0003042 | |||
| 1853 | Ga0495671_0037684 | |||
| 1854 | Ga0495671_0042708 | |||
| 1855 | Ga0495671_0086214 | |||
| 1856 | Ga0495649_0000711 | |||
| 1857 | Ga0495649_0000968 | |||
| 1858 | Ga0495649_0002156 | |||
| 1859 | Ga0495649_0003441 | |||
| 1860 | Ga0495649_0007937 | |||
| 1861 | Ga0495649_0009797 | |||
| 1862 | Ga0495649_0013458 | |||
| 1863 | Ga0495649_0077864 | |||
| 1864 | Ga0495589_0002719 | |||
| 1865 | Ga0495589_0007109 | |||
| 1866 | Ga0495589_0014900 | |||
| 1867 | Ga0495589_0026339 | |||
| 1868 | Ga0495589_0055325 | |||
| 1869 | Ga0495600_0000547 | |||
| 1870 | Ga0495660_0000431 | |||
| 1871 | Ga0495660_0004060 | |||
| 1872 | Ga0495660_0014906 | |||
| 1873 | Ga0495660_0020968 | |||
| 1874 | Ga0495660_0036778 | |||
| 1875 | Ga0495660_0055822 | |||
| 1876 | Ga0495660_0083874 | |||
| 1877 | Ga0495581_0107187 | |||
| 1878 | Ga0495604_0012043 | |||
| 1879 | Ga0495604_0016005 | |||
| 1880 | Ga0495636_0008819 | |||
| 1881 | Ga0495674_0034797 | |||
| 1882 | Ga0495672_0003079 | |||
| 1883 | Ga0495672_0003447 | |||
| 1884 | Ga0495672_0004295 | |||
| 1885 | Ga0495672_0005642 | |||
| 1886 | Ga0495672_0006899 | |||
| 1887 | Ga0495672_0012746 | |||
| 1888 | Ga0495676_0000027 | |||
| 1889 | Ga0495676_0021111 | |||
| 1890 | Ga0495676_0049708 | |||
| 1891 | Ga0495680_0005758 | |||
| 1892 | Ga0495683_0000038 | |||
| 1893 | Ga0495683_0000075 | |||
| 1894 | Ga0495683_0001303 | |||
| 1895 | Ga0495683_0001374 | |||
| 1896 | Ga0495683_0052279 | |||
| 1897 | Ga0495683_0071627 | |||
| 1898 | Ga0495683_0165052 | |||
| 1899 | Ga0495687_003446 | |||
| 1900 | Ga0495687_004754 | |||
| 1901 | Ga0495687_010017 | |||
| 1902 | Ga0495675_0156627 | |||
| 1903 | Ga0495677_0001006 | |||
| 1904 | Ga0495679_000237 | |||
| 1905 | Ga0495679_000495 | |||
| 1906 | Ga0495679_013833 | |||
| 1907 | Ga0495685_066872 | |||
| 1908 | Ga0495673_0000389 | |||
| 1909 | Ga0495673_0001628 | |||
| 1910 | Ga0495673_0001807 | |||
| 1911 | Ga0495673_0005394 | |||
| 1912 | Ga0495673_0008202 | |||
| 1913 | Ga0495673_0012990 | |||
| 1914 | Ga0495673_0019427 | |||
| 1915 | Ga0495673_0041012 | |||
| 1916 | Ga0495673_0095900 | |||
| 1917 | Ga0495681_0003081 | |||
| 1918 | Ga0495681_0003215 | |||
| 1919 | Ga0495681_0004777 | |||
| 1920 | Ga0495681_0012244 | |||
| 1921 | Ga0495681_0022208 | |||
| 1922 | Ga0495681_0031756 | |||
| 1923 | Ga0495686_0007608 | |||
| 1924 | Ga0495686_0125865 | |||
| 1925 | Ga0495686_0127672 | |||
| 1926 | Ga0495593_0038639 | |||
| 1927 | Ga0495593_0071064 | |||
| 1928 | Ga0495593_0106202 | |||
| 1929 | Ga0495626_0000067 | |||
| 1930 | Ga0495626_0000507 | |||
| 1931 | Ga0495626_0000684 | |||
| 1932 | Ga0495626_0000996 | |||
| 1933 | Ga0495626_0001171 | |||
| 1934 | Ga0495626_0001627 | |||
| 1935 | Ga0495626_0012837 | |||
| 1936 | Ga0495626_0013045 | |||
| 1937 | Ga0495626_0027693 | |||
| 1938 | Ga0495626_0033525 | |||
| 1939 | Ga0496102_0034338 | |||
| 1940 | Ga0496103_0014973 | |||
| 1941 | Ga0496106_0484204 | |||
| 1942 | Ga0496109_0091764 | |||
| 1943 | Ga0496110_0069750 | |||
| 1944 | Ga0496110_0146071 | |||
| 1945 | Ga0496111_0049816 | |||
| 1946 | Ga0496111_0055581 | |||
| 1947 | Ga0496112_0228484 | |||
| 1948 | Ga0496113_0214562 | |||
| 1949 | Ga0496114_0024637 | |||
| 1950 | Ga0496116_0000242 | |||
| 1951 | Ga0496116_0001670 | |||
| 1952 | Ga0496116_0002076 | |||
| 1953 | Ga0496116_0023569 | |||
| 1954 | Ga0496117_0000270 | |||
| 1955 | Ga0496117_0000932 | |||
| 1956 | Ga0496117_0002067 | |||
| 1957 | Ga0496118_0042191 | |||
| 1958 | Ga0496118_0068266 | |||
| 1959 | Ga0496118_0069267 | |||
| 1960 | Ga0496119_0000704 | |||
| 1961 | Ga0496120_0001473 | |||
| 1962 | Ga0496120_0004336 | |||
| 1963 | Ga0496121_0000318 | |||
| 1964 | Ga0496121_0003788 | |||
| 1965 | Ga0496121_0004345 | |||
| 1966 | Ga0496121_0149535 | |||
| 1967 | Ga0496121_0268043 | |||
| 1968 | Ga0496122_0000517 | |||
| 1969 | Ga0496122_0002629 | |||
| 1970 | Ga0496122_0007631 | |||
| 1971 | Ga0496122_0138317 | |||
| 1972 | Ga0496122_0141719 | |||
| 1973 | Ga0496123_0000243 | |||
| 1974 | Ga0496123_0007055 | |||
| 1975 | Ga0496123_0040963 | |||
| 1976 | Ga0496124_0000511 | |||
| 1977 | Ga0496124_0001467 | |||
| 1978 | Ga0496124_0002260 | |||
| 1979 | Ga0496124_0002328 | |||
| 1980 | Ga0496124_0007063 | |||
| 1981 | Ga0496124_0015657 | |||
| 1982 | Ga0496124_0023005 | |||
| 1983 | Ga0496124_0028667 | |||
| 1984 | Ga0496124_0087458 | |||
| 1985 | Ga0496124_0107378 | |||
| 1986 | Ga0496124_0172950 | |||
| 1987 | Ga0496124_0216254 | |||
| 1988 | Ga0496125_0000971 | |||
| 1989 | Ga0496125_0002177 | |||
| 1990 | Ga0496125_0006705 | |||
| 1991 | Ga0496125_0021605 | |||
| 1992 | Ga0496125_0045763 | |||
| 1993 | Ga0496125_0113892 | |||
| 1994 | Ga0496126_0055003 | |||
| 1995 | Ga0496126_0099192 | |||
| 1996 | Ga0496126_0698856 | |||
| 1997 | Ga0495678_000106 | |||
| 1998 | Ga0495678_000499 | |||
| 1999 | Ga0495678_000694 | |||
| 2000 | Ga0495678_002365 | |||
| 2001 | Ga0495678_008447 | |||
| 2002 | Ga0495678_008793 | |||
| 2003 | Ga0495678_090731 | |||
| 2004 | Ga0495682_0000069 | |||
| 2005 | Ga0495682_0000804 | |||
| 2006 | Ga0495682_0021349 | |||
| 2007 | Ga0501031_0079268 | |||
| 2008 | Ga0501032_0010649 | |||
| 2009 | Ga0501034_0000164 | |||
| 2010 | Ga0501034_0042054 | |||
| 2011 | Ga0501034_0060143 | |||
| 2012 | Ga0501034_0086454 | |||
| 2013 | Ga0501037_0071136 | |||
| 2014 | Ga0501038_0165610 | |||
| 2015 | Ga0501043_0055575 | |||
| 2016 | Ga0501047_0530647 | |||
| 2017 | Ga0501243_004728 | |||
| 2018 | Ga0501044_0317260 | |||
| 2019 | Ga0501226_000034 | |||
| 2020 | Ga0501226_000117 | |||
| 2021 | nmdc:mga00v17_119646_c1 | |||
| 2022 | nmdc:mga05p37_250708_c1 | |||
| 2023 | nmdc:mga08y16_396816_c1 | |||
| 2024 | nmdc:mga0sz30_7760_c1 | |||
| 2025 | Ga0500593_000476 | |||
| 2026 | Ga0500628_067781 | |||
| 2027 | Ga0500659_0002369 | |||
| 2028 | 2510282678 | |||
| 2029 | 2510295333 | |||
| 2030 | 2510311042 | |||
| 2031 | 2511264702 | |||
| 2032 | 2511274353 | |||
| 2033 | 2511278470 | |||
| 2034 | 2511279868 | |||
| 2035 | 2511289681 | |||
| 2036 | 2511294610 | |||
| 2037 | 2511298919 | |||
| 2038 | 2511304203 | |||
| 2039 | 2511313102 | |||
| 2040 | 2511322234 | |||
| 2041 | 2511325254 | |||
| 2042 | 2511331101 | |||
| 2043 | 2511332238 | |||
| 2044 | 2511347000 | |||
| 2045 | 2511348012 | |||
| 2046 | 2511359156 | |||
| 2047 | 2511366124 | |||
| 2048 | 2511370490 | |||
| 2049 | 2511377020 | |||
| 2050 | 2511412441 | |||
| 2051 | 2511822033 | |||
| 2052 | 2512325215 | |||
| 2053 | 2554818311 | |||
| 2054 | 2554818595 | |||
| 2055 | 2555245329 | |||
| 2056 | 2555667044 | |||
| 2057 | 2583795313 | |||
| 2058 | 2597855295 | |||
| 2059 | 2597861296 | |||
| 2060 | 2597867043 | |||
| 2061 | 2599355547 | |||
| 2062 | 2599363050 | |||
| 2063 | 2599368644 | |||
| 2064 | 2599376159 | |||
| 2065 | 2599380653 | |||
| 2066 | 2599387831 | |||
| 2067 | 2599395017 | |||
| 2068 | 2599401183 | |||
| 2069 | 2599406782 | |||
| 2070 | 2599449484 | |||
| 2071 | 2599462381 | |||
| 2072 | 2599468196 | |||
| 2073 | 2599487421 | |||
| 2074 | 2599491398 | |||
| 2075 | 2599503814 | |||
| 2076 | 2599506122 | |||
| 2077 | 2599511556 | |||
| 2078 | 2599516530 | |||
| 2079 | 2599612597 | |||
| 2080 | 2599767791 | |||
| 2081 | 2599804223 | |||
| 2082 | 2599879417 | |||
| 2083 | 2599887892 | |||
| 2084 | 2599893059 | |||
| 2085 | 2599899417 | |||
| 2086 | 2599933247 | |||
| 2087 | 2599942004 | |||
| 2088 | 2599948637 | |||
| 2089 | 2599954985 | |||
| 2090 | 2599963560 | |||
| 2091 | 2599966423 | |||
| 2092 | 2599975255 | |||
| 2093 | 2599977272 | |||
| 2094 | 2599986292 | |||
| 2095 | 2599991345 | |||
| 2096 | 2599995162 | |||
| 2097 | 2600000826 | |||
| 2098 | 2600007474 | |||
| 2099 | 2600011295 | |||
| 2100 | 2600020215 | |||
| 2101 | 2600026578 | |||
| 2102 | 2600029540 | |||
| 2103 | 2600037608 | |||
| 2104 | 2600044264 | |||
| 2105 | 2600050046 | |||
| 2106 | 2600054706 | |||
| 2107 | 2600059889 | |||
| 2108 | 2600065308 | |||
| 2109 | 2600073249 | |||
| 2110 | 2600078980 | |||
| 2111 | 2600215003 | |||
| 2112 | 2600358776 | |||
| 2113 | 2600363094 | |||
| 2114 | 2601627782 | |||
| 2115 | 2601693370 | |||
| 2116 | 2601775169 | |||
| 2117 | 2601798184 | |||
| 2118 | 2606077072 | |||
| 2119 | 2606129682 | |||
| 2120 | 2608380395 | |||
| 2121 | 2608384257 | |||
| 2122 | 2621296449 | |||
| 2123 | 2624477811 | |||
| 2124 | 2624489389 | |||
| 2125 | 2643843165 | |||
| 2126 | 2643843784 | |||
| 2127 | 2643873585 | |||
| 2128 | 2643956033 | |||
| 2129 | 2644020155 | |||
| 2130 | 2644184167 | |||
| 2131 | 2644282863 | |||
| 2132 | 2644624398 | |||
| 2133 | 2652544482 | |||
| 2134 | 2671091921 | |||
| 2135 | 2671099691 | |||
| 2136 | 2671129625 | |||
| 2137 | 2671771232 | |||
| 2138 | 2677900373 | |||
| 2139 | 2678266506 | |||
| 2140 | 2715749509 | |||
| 2141 | 2715754506 | |||
| 2142 | 2723246199 | |||
| 2143 | 2738673395 | |||
| 2144 | 2738690672 | |||
| 2145 | 2738751788 | |||
| 2146 | 2738807641 | |||
| 2147 | 2738860829 | |||
| 2148 | 2738895001 | |||
| 2149 | 2739200952 | |||
| 2150 | 2739261788 | |||
| 2151 | 2739266446 | |||
| 2152 | 2739288737 | |||
| 2153 | 2739289693 | |||
| 2154 | 2739294049 | |||
| 2155 | 2739295005 | |||
| 2156 | 2739312156 | |||
| 2157 | 2743740864 | |||
| 2158 | 2745007736 | |||
| 2159 | 2765581309 | |||
| 2160 | 2774118033 | |||
| 2161 | 2774129165 | |||
| 2162 | 2774136530 | |||
| 2163 | 2784261474 | |||
| 2164 | 2784316520 | |||
| 2165 | 2794593604 | |||
| 2166 | 2807405892 | |||
| 2167 | 2807454227 | |||
| 2168 | 2808858624 | |||
| 2169 | 2808905826 | |||
| 2170 | 2808923943 | |||
| 2171 | 2808928115 | |||
| 2172 | 2808938584 | |||
| 2173 | 2808942257 | |||
| 2174 | 2808946202 | |||
| 2175 | 2808950703 | |||
| 2176 | 2808960674 | |||
| 2177 | 2808967129 | |||
| 2178 | 2808980049 | |||
| 2179 | 2808995769 | |||
| 2180 | 2809001939 | |||
| 2181 | 2812369855 | |||
| 2182 | 2817488072 | |||
| 2183 | 2819655466 | |||
| 2184 | 2819704838 | |||
| 2185 | 2825654706 | |||
| 2186 | 2826582348 | |||
| 2187 | 2834031330 | |||
| 2188 | 2842805456 | |||
| 2189 | 2842807949 | |||
| 2190 | 2842816999 | |||
| 2191 | 2842832034 | |||
| 2192 | 2842833780 | |||
| 2193 | 2842838305 | |||
| 2194 | 2842846014 | |||
| 2195 | 2842852121 | |||
| 2196 | 2842855968 | |||
| 2197 | 2844667531 | |||
| 2198 | 2852616727 | |||
| 2199 | 2852662613 | |||
| 2200 | 2852671695 | |||
| 2201 | 2860345250 | |||
| 2202 | 2860868096 | |||
| 2203 | 2878029754 | |||
| 2204 | 2880230704 | |||
| 2205 | 2904518615 | |||
| 2206 | 2904553440 | |||
| 2207 | 2908446685 | |||
| 2208 | 2912963883 | |||
| 2209 | 2913036894 | |||
| 2210 | 2917070781 | |||
| 2211 | 2917833288 | |||
| 2212 | 2919067989 | |||
| 2213 | 2919126172 | |||
| 2214 | 2919156189 | |||
| 2215 | 2919388836 | |||
| 2216 | 2919457905 | |||
| 2217 | 2919487013 | |||
| 2218 | 2919487799 | |||
| 2219 | 2919702406 | |||
| 2220 | 2923153696 | |||
| 2221 | 2923523941 | |||
| 2222 | 2923589324 | |||
| 2223 | 2929144364 | |||
| 2224 | 2929189979 | |||
| 2225 | 2931372309 | |||
| 2226 | 2931391040 | |||
| 2227 | 2931398449 | |||
| 2228 | 2935357884 | |||
| 2229 | 2939640523 | |||
| 2230 | 2939654486 | |||
| 2231 | 2945930503 | |||
| 2232 | 2945967252 | |||
| 2233 | 2946012849 | |||
| 2234 | 2946028288 | |||
| 2235 | 2947234805 | |||
| 2236 | 2969304510 | |||
| 2237 | 2974293740 | |||
| 2238 | 2974302390 | |||
| 2239 | 2984292417 | |||
| 2240 | 2984500056 | |||
| 2241 | 2984506570 | |||
| 2242 | 2988731826 | |||
| 2243 | 2998140074 | |||
| 2244 | 3007253994 | |||
| 2245 | 3007317262 | |||
| 2246 | 3007398979 | |||
| 2247 | 3007419681 | |||
| 2248 | 3007422426 | |||
| 2249 | 3007517492 | |||
| 2250 | 3007617046 | |||
| 2251 | 3007623817 | |||
| 2252 | 3007722064 | |||
| 2253 | 3007804062 | |||
| 2254 | 3007859519 | |||
| 2255 | 3007864748 | |||
| 2256 | 3007871724 | |||
| 2257 | 3007874921 | |||
| 2258 | 637317447 | |||
| 2259 | 8011351071 | |||
| 2260 | 8011356246 | |||
| 2261 | 8015687959 | |||
| 2262 | 8016731414 | |||
| 2263 | 8019769374 | |||
| 2264 | 8019779629 | |||
| 2265 | 8029995176 | |||
| 2266 | 8052494527 | |||
| 2267 | 8054287601 | |||
| 2268 | 8054349212 | |||
| 2269 | 8054503646 | |||
| 2270 | 8054930031 | |||
| 2271 | 8055771057 | |||
| 2272 | 8055818009 | |||
| 2273 | 8055883518 | |||
| 2274 | 8056116224 | |||
| 2275 | 8056120821 | |||
| 2276 | 8056126093 | |||
| 2277 | 8056131978 | |||
| 2278 | 8056137516 | |||
| 2279 | 8056140045 | |||
| 2280 | 8056143302 | |||
| 2281 | 8056151124 | |||
| 2282 | 8056160071 | |||
| 2283 | 8056164007 | |||
| 2284 | 8056170973 | |||
| 2285 | 8056177106 | |||
| 2286 | 8056182197 | |||
| 2287 | 8056570805 | |||
| 2288 | 8057802339 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rw3-assembly2.cif.gz_B | the molecular basis for sugar import in malaria parasites. | 0.4784 | 16 | 201 |
| 7yub-assembly1.cif.gz_R | s1p-bound human spns2 | 0.4495 | 7 | 204 |
| 6h7d-assembly1.cif.gz_A | crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state | 0.4471 | 12 | 202 |
| 6rw3-assembly4.cif.gz_D | the molecular basis for sugar import in malaria parasites. | 0.4445 | 16 | 201 |
| 6ob7-assembly1.cif.gz_A | human equilibrative nucleoside transporter-1, dilazep bound | 0.441 | 8 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9048 | 15 | 203 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8914 | 15 | 203 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7232 | 15 | 203 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6711 | 15 | 203 | 1.20.1250.20 |
| af_Q54DL1_165_416_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5432 | 6 | 206 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-N6V0S1-F1-model_v4 | Integral membrane protein TerC | 0.9359 | 2 | 239 |
GO:0016020
|
| AF-A0A0F0KRP1-F1-model_v4 | Integral membrane protein TerC family protein | 0.9325 | 5 | 242 |
GO:0016020
|
| AF-A0A2L0WE71-F1-model_v4 | deleted | 0.9297 | 2 | 239 |
|
| AF-A0A561C2F0-F1-model_v4 | deleted | 0.9288 | 2 | 242 |
|
| AF-A0A6S7CNP0-F1-model_v4 | Membrane protein TerC | 0.9282 | 3 | 242 |
GO:0016020
|