F490768

General Info

Members Datasets Scaffolds Average Seq Length
1145 663 2290 245

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100150056|Ga0070672_1001500561
Length 242
Sequence MTKRKRADLLLVERGLFESRARAQAAIAAGRVTADGVVLRKPSDEIAAGAVLDAAPEHPWVSRGGLKLVAALDHFGFDPAKRICLDVGASTGGFTDVLRARGARRVYAVDVGRGQLHPKLRGDPAVVSLEQTDIRTLDPFAEPPDLAVIDVSFISLRLVLPAVDRLLRRPAQLVALIKPQFEAGRGHVKKGIVRDAAVHAAVCDDIAAFAVSLGWDVIGVMPSPIEGGEGNREFLLGACQAA

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
166 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
167 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
168 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
252 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
253 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
254 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
266 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
267 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
268 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
269 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
270 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
271 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
272 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
280 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
281 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
282 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
283 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
286 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
287 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
288 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
289 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
293 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
296 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
309 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
310 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
311 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
320 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
321 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
324 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
325 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
330 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
343 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
366 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
370 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
371 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
372 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
373 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
374 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
375 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
376 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
377 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
417 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
418 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
419 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
420 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
421 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
422 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
423 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
424 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
427 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
428 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
429 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
433 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
434 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
435 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
440 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
441 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
442 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
443 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
444 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
445 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
446 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
447 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
450 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
451 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
455 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
456 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
457 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
458 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
459 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
460 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
461 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
466 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
467 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
468 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
469 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
470 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
471 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
472 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
473 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
478 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
479 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
480 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
481 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
482 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
483 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
486 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
487 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
488 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
489 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
490 2508501050 Microvirga lupini Lut6 Isolate Nodule
491 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
492 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
493 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
494 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
495 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
496 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
497 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
498 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
499 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
500 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
501 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
502 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
503 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
504 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
505 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
506 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
507 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
508 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
509 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
510 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
511 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
512 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
513 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
514 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
515 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
516 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
517 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
518 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
519 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
520 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
521 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
522 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
523 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
524 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
525 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
526 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
527 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
528 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
529 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
530 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
531 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
532 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
533 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
534 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
535 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
536 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
537 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
538 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
539 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
540 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
541 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
542 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
543 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
544 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
545 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
546 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
547 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
548 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
549 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
550 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
551 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
552 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
553 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
554 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
555 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
556 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
557 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
558 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
559 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
560 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
561 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
562 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
563 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
564 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
565 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
566 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
567 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
568 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
569 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
570 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
571 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
572 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
573 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
574 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
575 2922368715
576 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
577 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
578 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
579 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
580 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
581 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
582 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
583 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
584 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
585 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
586 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
587 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
588 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
589 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
590 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
591 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
592 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
593 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
594 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
595 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
596 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
597 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
598 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
599 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
600 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
601 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
602 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
603 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
604 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
605 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
606 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
607 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
608 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
609 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
610 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
611 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
612 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
613 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
614 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
615 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
616 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
617 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
618 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
619 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
620 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
621 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
622 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
623 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
624 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
625 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
626 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
627 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
628 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
629 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
630 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
631 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
632 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
633 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
634 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
635 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
636 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
637 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
638 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
639 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
640 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
641 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
642 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
643 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
644 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
645 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
646 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
647 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
648 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
649 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
650 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
651 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
652 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
653 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
654 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
655 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
656 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
657 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
658 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
659 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
660 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
661 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
662 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
663 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 0
Isolates 15.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.69
Nodule 12.14
Rhizoplane 5.41
Rhizosphere 64.89
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100150056 3300005543 Bacteria 1928
2 2214736880 2209111006 Bacteria 4082
3 ARcpr5yngRDRAFT_c000142 3300000043 Bacteria 11426
4 ARSoilOldRDRAFT_c000054 3300000044 Bacteria 23692
5 ARCol0yngRDRAFT_1000054 3300000652 Bacteria 20195
6 JGI24746J21847_1001891 3300001977 Bacteria 3339
7 JGI24740J21852_10017249 3300001979 Bacteria 2586
8 JGI24739J22299_10009856 3300001989 Bacteria 3552
9 JGI24739J22299_10018516 3300001989 Bacteria 2501
10 JGI24737J22298_10001185 3300001990 Bacteria 9195
11 JGI24737J22298_10001974 3300001990 Bacteria 7331
12 JGI24750J21931_1000231 3300002070 Bacteria 9469
13 JGI24745J21846_1000657 3300002073 Bacteria 3106
14 JGI24748J21848_1000261 3300002074 Bacteria 6289
15 JGI24738J21930_10002888 3300002075 Bacteria 4397
16 JGI24744J21845_10000435 3300002077 Bacteria 7351
17 JGI24035J26624_1000833 3300002126 Bacteria 2914
18 JGI24034J26672_10000673 3300002239 Bacteria 4384
19 JGI24742J22300_10000181 3300002244 Bacteria 9346
20 JGI25406J46586_10008015 3300003203 Bacteria 4800
21 JGI25153J46596_10000853 3300003215 Bacteria 18697
22 JGI25153J46596_10023134 3300003215 Bacteria 2272
23 JGI25160J50197_1000837 3300003354 Bacteria 16438
24 JGI25160J50197_1002791 3300003354 Bacteria 7997
25 JGI25160J50197_1029116 3300003354 Bacteria 1468
26 JGI25404J52841_10029381 3300003659 Bacteria 1179
27 Ga0055542_1007799 3300003762 Bacteria 2139
28 Ga0055526_1044665 3300003771 Bacteria 1067
29 Ga0055531_10002933 3300003794 Bacteria 11106
30 Ga0055531_10050790 3300003794 Bacteria 1094
31 Ga0055543_1003952 3300004625 Bacteria 4183
32 Ga0055543_1020000 3300004625 Bacteria 1235
33 Ga0065165_1000309 3300005262 Bacteria 80166
34 Ga0065165_1000577 3300005262 Bacteria 54256
35 Ga0065165_1002255 3300005262 Bacteria 17049
36 Ga0065716_1001587 3300005277 Bacteria 5695
37 Ga0065712_10076027 3300005290 Bacteria 3746
38 Ga0065715_10006812 3300005293 Bacteria 2795
39 Ga0065715_10089280 3300005293 Bacteria 11642
40 Ga0070658_10319887 3300005327 Bacteria 1325
41 Ga0070676_10000128 3300005328 Bacteria 28446
42 Ga0070683_100000289 3300005329 Bacteria 34698
43 Ga0070683_100181709 3300005329 Bacteria 1997
44 Ga0070683_100669744 3300005329 Bacteria 993
45 Ga0070690_100000935 3300005330 Bacteria 14900
46 Ga0070690_100030048 3300005330 Bacteria 3374
47 Ga0070670_100003173 3300005331 Bacteria 13581
48 Ga0070677_10000043 3300005333 Bacteria 39363
49 Ga0068869_100000289 3300005334 Bacteria 26851
50 Ga0070666_10008412 3300005335 Bacteria 6407
51 Ga0070666_10137390 3300005335 Bacteria 1701
52 Ga0070666_10155898 3300005335 Bacteria 1595
53 Ga0070666_10277827 3300005335 Bacteria 1190
54 Ga0070680_100002347 3300005336 Bacteria 13977
55 Ga0070680_100068702 3300005336 Bacteria 2908
56 Ga0070682_100004343 3300005337 Bacteria 7868
57 Ga0068868_100000408 3300005338 Bacteria 29034
58 Ga0068868_100404241 3300005338 Bacteria 1179
59 Ga0070660_100000182 3300005339 Bacteria 41532
60 Ga0070660_100112272 3300005339 Bacteria 2169
61 Ga0070689_100000819 3300005340 Bacteria 19235
62 Ga0070689_100014880 3300005340 Bacteria 5661
63 Ga0070689_100047877 3300005340 Bacteria 3296
64 Ga0070691_10056698 3300005341 Bacteria 1878
65 Ga0070687_100000689 3300005343 Bacteria 11282
66 Ga0070661_100000314 3300005344 Bacteria 39090
67 Ga0070661_100128153 3300005344 Bacteria 1905
68 Ga0070692_10000310 3300005345 Bacteria 13896
69 Ga0070692_10109068 3300005345 Bacteria 1528
70 Ga0070668_100000857 3300005347 Bacteria 21127
71 Ga0070668_100033097 3300005347 Bacteria 3934
72 Ga0070668_100043452 3300005347 Bacteria 3446
73 Ga0070669_100002719 3300005353 Bacteria 12760
74 Ga0070669_100119736 3300005353 Bacteria 2006
75 Ga0070669_100244390 3300005353 Bacteria 1427
76 Ga0070675_100002240 3300005354 Bacteria 14349
77 Ga0070671_100000598 3300005355 Bacteria 25820
78 Ga0070671_100067059 3300005355 Bacteria 2991
79 Ga0070674_100002210 3300005356 Bacteria 10703
80 Ga0070673_100000289 3300005364 Bacteria 26187
81 Ga0070688_100000189 3300005365 Bacteria 32631
82 Ga0070659_100003195 3300005366 Bacteria 11664
83 Ga0070659_100009819 3300005366 Bacteria 7036
84 Ga0070659_100216750 3300005366 Bacteria 1579
85 Ga0070667_100000436 3300005367 Bacteria 43897
86 Ga0070667_100150309 3300005367 Bacteria 2045
87 Ga0070667_100645962 3300005367 Bacteria 977
88 Ga0070703_10055656 3300005406 Bacteria 1279
89 Ga0070709_10084550 3300005434 Bacteria 2078
90 Ga0070709_10355355 3300005434 Bacteria 1084
91 Ga0070714_100003388 3300005435 Bacteria 11883
92 Ga0070714_100057878 3300005435 Bacteria 3318
93 Ga0070714_100077211 3300005435 Bacteria 2893
94 Ga0070714_100424514 3300005435 Bacteria 1260
95 Ga0070713_100010828 3300005436 Bacteria 6609
96 Ga0070713_100089323 3300005436 Bacteria 2646
97 Ga0070713_100295584 3300005436 Bacteria 1490
98 Ga0070710_10018511 3300005437 Bacteria 3584
99 Ga0070701_10000608 3300005438 Bacteria 12508
100 Ga0070701_10100735 3300005438 Bacteria 1599
101 Ga0070711_100002007 3300005439 Bacteria 11458
102 Ga0070711_100186037 3300005439 Bacteria 1593
103 Ga0070705_100000781 3300005440 Bacteria 17954
104 Ga0070705_100135857 3300005440 Bacteria 1611
105 Ga0070700_100002740 3300005441 Bacteria 9011
106 Ga0070700_100039945 3300005441 Bacteria 2869
107 Ga0070694_100001837 3300005444 Bacteria 12570
108 Ga0070694_100044118 3300005444 Bacteria 2983
109 Ga0070708_100027802 3300005445 Bacteria 4857
110 Ga0070708_100394827 3300005445 Bacteria 1304
111 Ga0070708_100427630 3300005445 Bacteria 1249
112 Ga0070663_100000297 3300005455 Bacteria 25442
113 Ga0070663_100041533 3300005455 Bacteria 3227
114 Ga0070663_100065057 3300005455 Bacteria 2637
115 Ga0070663_100203696 3300005455 Bacteria 1545
116 Ga0070663_100234296 3300005455 Bacteria 1447
117 Ga0070678_100001856 3300005456 Bacteria 11388
118 Ga0070678_100183776 3300005456 Bacteria 1714
119 Ga0070662_100011992 3300005457 Bacteria 5734
120 Ga0070681_10005077 3300005458 Bacteria 12699
121 Ga0070681_10027575 3300005458 Bacteria 5710
122 Ga0070681_10093558 3300005458 Bacteria 2954
123 Ga0068867_100003318 3300005459 Bacteria 11338
124 Ga0068867_100026609 3300005459 Bacteria 4154
125 Ga0070685_10001152 3300005466 Bacteria 14147
126 Ga0070685_10096827 3300005466 Bacteria 1796
127 Ga0070685_10262511 3300005466 Bacteria 1149
128 Ga0070706_100513535 3300005467 Bacteria 1114
129 Ga0070707_100566039 3300005468 Bacteria 1098
130 Ga0070698_100531572 3300005471 Bacteria 1114
131 Ga0070699_100001443 3300005518 Bacteria 21833
132 Ga0070699_100171370 3300005518 Bacteria 1923
133 Ga0070679_100003016 3300005530 Bacteria 15378
134 Ga0070679_100029119 3300005530 Bacteria 5447
135 Ga0070679_100170809 3300005530 Bacteria 2147
136 Ga0070679_100293309 3300005530 Bacteria 1578
137 Ga0070679_100462731 3300005530 Bacteria 1213
138 Ga0070684_100002293 3300005535 Bacteria 14101
139 Ga0068853_100011439 3300005539 Bacteria 7210
140 Ga0068853_100070015 3300005539 Bacteria 3053
141 Ga0068853_100097148 3300005539 Bacteria 2600
142 Ga0068853_100115602 3300005539 Bacteria 2388
143 Ga0070672_100000106 3300005543 Bacteria 41858
144 Ga0070672_100092818 3300005543 Bacteria 2438
145 Ga0070686_100000615 3300005544 Bacteria 20904
146 Ga0070686_100016532 3300005544 Bacteria 4293
147 Ga0070695_100001248 3300005545 Bacteria 13985
148 Ga0070695_100030963 3300005545 Bacteria 3333
149 Ga0070696_100005592 3300005546 Bacteria 8391
150 Ga0070696_100257973 3300005546 Bacteria 1321
151 Ga0070693_100001863 3300005547 Bacteria 9633
152 Ga0070665_100031480 3300005548 Bacteria 5339
153 Ga0070665_100059112 3300005548 Bacteria 3843
154 Ga0070665_100642952 3300005548 Bacteria 1074
155 Ga0070704_100004061 3300005549 Bacteria 8447
156 Ga0070704_100122817 3300005549 Bacteria 1998
157 Ga0068855_100012743 3300005563 Bacteria 10140
158 Ga0068855_100137200 3300005563 Bacteria 2790
159 Ga0068855_100687275 3300005563 Bacteria 1096
160 Ga0070664_100009338 3300005564 Bacteria 7954
161 Ga0068857_100000047 3300005577 Bacteria 67784
162 Ga0068857_100007716 3300005577 Bacteria 9273
163 Ga0068854_100003161 3300005578 Bacteria 10266
164 Ga0068856_100000505 3300005614 Bacteria 43297
165 Ga0068856_100001905 3300005614 Bacteria 21761
166 Ga0068856_100037113 3300005614 Bacteria 4780
167 Ga0068856_100079646 3300005614 Bacteria 3248
168 Ga0068856_100264580 3300005614 Bacteria 1735
169 Ga0070702_100001524 3300005615 Bacteria 9532
170 Ga0068852_100003513 3300005616 Bacteria 10963
171 Ga0068852_100070713 3300005616 Bacteria 3062
172 Ga0068852_100160030 3300005616 Bacteria 2102
173 Ga0068852_100213957 3300005616 Bacteria 1830
174 Ga0068852_100678299 3300005616 Bacteria 1040
175 Ga0068852_100749814 3300005616 Bacteria 988
176 Ga0068852_100808544 3300005616 Bacteria 952
177 Ga0068852_100912487 3300005616 Bacteria 896
178 Ga0068859_100011991 3300005617 Bacteria 8705
179 Ga0068864_100000931 3300005618 Bacteria 24535
180 Ga0068864_100347775 3300005618 Bacteria 1398
181 Ga0068866_10000077 3300005718 Bacteria 39340
182 Ga0068861_100004701 3300005719 Bacteria 9180
183 Ga0068861_100420383 3300005719 Bacteria 1191
184 Ga0068870_10000037 3300005840 Bacteria 42069
185 Ga0068863_100000543 3300005841 Bacteria 38366
186 Ga0068863_100155215 3300005841 Bacteria 2191
187 Ga0068858_100002073 3300005842 Bacteria 20401
188 Ga0068860_100006167 3300005843 Bacteria 12056
189 Ga0068860_100571824 3300005843 Bacteria 1134
190 Ga0068862_100000879 3300005844 Bacteria 29265
191 Ga0068862_100033399 3300005844 Bacteria 4349
192 Ga0081455_10000007 3300005937 Bacteria 269394
193 Ga0081455_10005572 3300005937 Bacteria 13777
194 Ga0081455_10015842 3300005937 Bacteria 7301
195 Ga0081455_10097327 3300005937 Bacteria 2371
196 Ga0081538_10005025 3300005981 Bacteria 12041
197 Ga0081540_1001710 3300005983 Bacteria 18575
198 Ga0081540_1003262 3300005983 Bacteria 12891
199 Ga0081540_1003848 3300005983 Bacteria 11726
200 Ga0081540_1008449 3300005983 Bacteria 7194
201 Ga0081540_1014536 3300005983 Bacteria 5034
202 Ga0081540_1018429 3300005983 Bacteria 4282
203 Ga0081540_1034995 3300005983 Bacteria 2699
204 Ga0081539_10000199 3300005985 Bacteria 139305
205 Ga0081539_10000932 3300005985 Bacteria 54871
206 Ga0070717_10028863 3300006028 Bacteria 4445
207 Ga0070717_10118670 3300006028 Bacteria 2264
208 Ga0070717_10133638 3300006028 Bacteria 2135
209 Ga0070717_10528206 3300006028 Bacteria 1068
210 Ga0070717_10554629 3300006028 Bacteria 1041
211 Ga0075365_10011197 3300006038 Bacteria 5266
212 Ga0075365_10160675 3300006038 Bacteria 1565
213 Ga0075365_10211564 3300006038 Bacteria 1359
214 Ga0075368_10018373 3300006042 Bacteria 2627
215 Ga0075363_100037702 3300006048 Bacteria 2540
216 Ga0075364_10009608 3300006051 Bacteria 5809
217 Ga0075432_10014621 3300006058 Bacteria 2672
218 Ga0075432_10026570 3300006058 Bacteria 1989
219 Ga0070715_10202716 3300006163 Bacteria 1009
220 Ga0070715_10278538 3300006163 Bacteria 886
221 Ga0070716_100006210 3300006173 Bacteria 5831
222 Ga0070716_100507809 3300006173 Bacteria 891
223 Ga0070712_100011349 3300006175 Bacteria 5646
224 Ga0070712_100016142 3300006175 Bacteria 4820
225 Ga0070712_100138048 3300006175 Bacteria 1857
226 Ga0070712_100441173 3300006175 Bacteria 1082
227 Ga0075362_10070669 3300006177 Bacteria 1594
228 Ga0075367_10005301 3300006178 Bacteria 6384
229 Ga0075367_10054630 3300006178 Bacteria 2368
230 Ga0075367_10073200 3300006178 Bacteria 2064
231 Ga0075367_10095861 3300006178 Bacteria 1809
232 Ga0075367_10110787 3300006178 Bacteria 1685
233 Ga0075367_10111473 3300006178 Bacteria 1680
234 Ga0075369_10048242 3300006186 Bacteria 1837
235 Ga0075369_10059901 3300006186 Bacteria 1659
236 Ga0075366_10009913 3300006195 Bacteria 5331
237 Ga0097621_100000416 3300006237 Bacteria 29698
238 Ga0075370_10020997 3300006353 Bacteria 3575
239 Ga0075370_10023683 3300006353 Bacteria 3384
240 Ga0068871_100000249 3300006358 Bacteria 37516
241 Ga0068871_100088776 3300006358 Bacteria 2573
242 Ga0075428_100112281 3300006844 Bacteria 2968
243 Ga0075428_100195241 3300006844 Bacteria 2189
244 Ga0075428_100400968 3300006844 Bacteria 1470
245 Ga0075430_100003208 3300006846 Bacteria 13694
246 Ga0075430_100724735 3300006846 Bacteria 820
247 Ga0075431_100010935 3300006847 Bacteria 9131
248 Ga0075431_100193623 3300006847 Bacteria 2082
249 Ga0075431_100654580 3300006847 Bacteria 1031
250 Ga0075433_10001150 3300006852 Bacteria 19214
251 Ga0075433_10020495 3300006852 Bacteria 5530
252 Ga0075433_10454385 3300006852 Bacteria 1129
253 Ga0075434_100003092 3300006871 Bacteria 14816
254 Ga0075434_100021891 3300006871 Bacteria 6222
255 Ga0075434_100026586 3300006871 Bacteria 5671
256 Ga0075429_100001089 3300006880 Bacteria 21839
257 Ga0075429_100167948 3300006880 Bacteria 1922
258 Ga0068865_100000248 3300006881 Bacteria 30110
259 Ga0068865_100190361 3300006881 Bacteria 1586
260 Ga0068865_100310605 3300006881 Bacteria 1265
261 Ga0097620_100011991 3300006931 Bacteria 8705
262 Ga0099824_1009878 3300006942 Bacteria 11544
263 Ga0075435_100004999 3300007076 Bacteria 9203
264 Ga0075435_100043198 3300007076 Bacteria 3608
265 Ga0075435_100202173 3300007076 Bacteria 1684
266 Ga0099794_10005449 3300007265 Bacteria 5100
267 Ga0099795_10000494 3300007788 Bacteria 7398
268 Ga0105244_10030241 3300009036 Bacteria 2883
269 Ga0105250_10053651 3300009092 Bacteria 1617
270 Ga0105240_10004584 3300009093 Bacteria 20953
271 Ga0105240_10014611 3300009093 Bacteria 10714
272 Ga0105240_10025786 3300009093 Bacteria 7720
273 Ga0111539_10002489 3300009094 Bacteria 24423
274 Ga0111539_10002685 3300009094 Bacteria 23545
275 Ga0111539_10005685 3300009094 Bacteria 16136
276 Ga0111539_10469478 3300009094 Bacteria 1465
277 Ga0105245_10004150 3300009098 Bacteria 12870
278 Ga0105245_10068796 3300009098 Bacteria 3209
279 Ga0105245_10474246 3300009098 Bacteria 1263
280 Ga0105247_10017876 3300009101 Bacteria 4253
281 Ga0114129_10000908 3300009147 Bacteria 38524
282 Ga0114129_10045722 3300009147 Bacteria 6153
283 Ga0114129_10050741 3300009147 Bacteria 5827
284 Ga0114129_10256316 3300009147 Bacteria 2346
285 Ga0114129_10484689 3300009147 Bacteria 1617
286 Ga0114129_10633574 3300009147 Bacteria 1382
287 Ga0105243_10001705 3300009148 Bacteria 18936
288 Ga0105243_10019792 3300009148 Bacteria 5103
289 Ga0105241_10002306 3300009174 Bacteria 14330
290 Ga0105241_10121376 3300009174 Bacteria 2105
291 Ga0105241_10481166 3300009174 Bacteria 1104
292 Ga0105241_10659342 3300009174 Bacteria 951
293 Ga0105242_10003502 3300009176 Bacteria 12201
294 Ga0105242_10116924 3300009176 Bacteria 2282
295 Ga0105248_10005936 3300009177 Bacteria 13420
296 Ga0105248_10084071 3300009177 Bacteria 3580
297 Ga0105248_10097795 3300009177 Bacteria 3307
298 Ga0105248_10161356 3300009177 Bacteria 2528
299 Ga0105237_10013233 3300009545 Bacteria 8656
300 Ga0105237_10065971 3300009545 Bacteria 3614
301 Ga0105237_10067888 3300009545 Bacteria 3559
302 Ga0105237_10092072 3300009545 Bacteria 3022
303 Ga0105237_10246667 3300009545 Bacteria 1788
304 Ga0105237_10629259 3300009545 Bacteria 1080
305 Ga0105238_10045534 3300009551 Bacteria 4431
306 Ga0105249_10000476 3300009553 Bacteria 37263
307 Ga0105249_10177455 3300009553 Bacteria 2070
308 Ga0099796_10001674 3300010159 Bacteria 4588
309 Ga0105239_10005274 3300010375 Bacteria 15193
310 Ga0105239_10007529 3300010375 Bacteria 12486
311 Ga0105239_10036783 3300010375 Bacteria 5370
312 Ga0105239_10047313 3300010375 Bacteria 4715
313 Ga0105239_10085761 3300010375 Bacteria 3471
314 Ga0105239_10119022 3300010375 Bacteria 2931
315 Ga0105239_10394303 3300010375 Bacteria 1566
316 Ga0105239_10430613 3300010375 Bacteria 1495
317 Ga0105246_10000057 3300011119 Bacteria 44951
318 Ga0105246_10079117 3300011119 Bacteria 2337
319 Ga0105246_10178660 3300011119 Bacteria 1632
320 Ga0157373_10045343 3300013100 Bacteria 3138
321 Ga0157371_10210214 3300013102 Bacteria 1396
322 Ga0157374_10004809 3300013296 Bacteria 11335
323 Ga0157378_10006604 3300013297 Bacteria 10133
324 Ga0157378_10205275 3300013297 Bacteria 1866
325 Ga0163162_10001937 3300013306 Bacteria 19439
326 Ga0163162_10109294 3300013306 Bacteria 2862
327 Ga0163162_10460225 3300013306 Bacteria 1404
328 Ga0157372_10009498 3300013307 Bacteria 10344
329 Ga0157372_10223159 3300013307 Bacteria 2184
330 Ga0157375_10003994 3300013308 Bacteria 12794
331 Ga0157375_10016002 3300013308 Bacteria 6728
332 Ga0157375_10209236 3300013308 Bacteria 2107
333 Ga0157375_10278650 3300013308 Bacteria 1835
334 Ga0157375_10421712 3300013308 Bacteria 1500
335 Ga0163163_10003757 3300014325 Bacteria 12927
336 Ga0163163_10013453 3300014325 Bacteria 7494
337 Ga0157380_10002362 3300014326 Bacteria 12682
338 Ga0182008_10277534 3300014497 Bacteria 871
339 Ga0157377_10001240 3300014745 Bacteria 10912
340 Ga0157379_10000293 3300014968 Bacteria 39625
341 Ga0157376_10000531 3300014969 Bacteria 24495
342 Ga0163161_10000209 3300017792 Bacteria 53534
343 Ga0214544_1000001 3300021320 Bacteria 783667
344 Ga0214542_1000065 3300021321 Bacteria 126045
345 Ga0214542_1040954 3300021321 Bacteria 1169
346 Ga0214545_1000003 3300021324 Bacteria 720274
347 Ga0214543_1000002 3300021327 Bacteria 712733
348 Ga0213872_10136594 3300021361 Bacteria 1078
349 Ga0213874_10032848 3300021377 Bacteria 1510
350 Ga0213876_10002386 3300021384 Bacteria 11055
351 Ga0213876_10127427 3300021384 Bacteria 1352
352 Ga0213876_10229112 3300021384 Bacteria 987
353 Ga0213875_10110282 3300021388 Bacteria 1284
354 Ga0207425_1003825 3300025245 Bacteria 4687
355 Ga0209677_100977 3300025253 Bacteria 13855
356 Ga0209677_105736 3300025253 Bacteria 3154
357 Ga0209148_1001125 3300025254 Bacteria 15820
358 Ga0209233_1001284 3300025261 Bacteria 10048
359 Ga0209233_1006642 3300025261 Bacteria 3710
360 Ga0207666_1000011 3300025271 Bacteria 46553
361 Ga0207666_1004198 3300025271 Bacteria 1799
362 Ga0209455_1001857 3300025272 Bacteria 8833
363 Ga0209455_1002722 3300025272 Bacteria 6636
364 Ga0209455_1005768 3300025272 Bacteria 3765
365 Ga0209673_1060169 3300025273 Bacteria 953
366 Ga0209130_1000348 3300025284 Bacteria 53200
367 Ga0207673_1002229 3300025290 Bacteria 2190
368 Ga0209564_1005319 3300025295 Bacteria 7412
369 Ga0209564_1006162 3300025295 Bacteria 6569
370 Ga0209758_1000011 3300025297 Bacteria 1049685
371 Ga0209758_1000720 3300025297 Bacteria 48767
372 Ga0209758_1001547 3300025297 Bacteria 26412
373 Ga0209758_1011623 3300025297 Bacteria 5066
374 Ga0209758_1024578 3300025297 Bacteria 2680
375 Ga0209256_1006935 3300025299 Bacteria 5789
376 Ga0209256_1016531 3300025299 Bacteria 2507
377 Ga0207426_1000212 3300025302 Bacteria 137314
378 Ga0207426_1000552 3300025302 Bacteria 51852
379 Ga0207426_1005997 3300025302 Bacteria 5380
380 Ga0207426_1015663 3300025302 Bacteria 2744
381 Ga0209257_1001276 3300025304 Bacteria 30845
382 Ga0209257_1016540 3300025304 Bacteria 2975
383 Ga0207697_10000044 3300025315 Bacteria 48337
384 Ga0207697_10005272 3300025315 Bacteria 6025
385 Ga0207697_10037963 3300025315 Bacteria 1975
386 Ga0207656_10019781 3300025321 Bacteria 2666
387 Ga0207656_10081117 3300025321 Bacteria 1458
388 Ga0207653_10001246 3300025885 Bacteria 8320
389 Ga0207653_10003208 3300025885 Bacteria 5168
390 Ga0207682_10000260 3300025893 Bacteria 23782
391 Ga0207642_10001373 3300025899 Bacteria 7553
392 Ga0207710_10008871 3300025900 Bacteria 4231
393 Ga0207688_10000723 3300025901 Bacteria 16367
394 Ga0207688_10216145 3300025901 Bacteria 1153
395 Ga0207680_10004972 3300025903 Bacteria 6331
396 Ga0207680_10032291 3300025903 Bacteria 2975
397 Ga0207680_10115834 3300025903 Bacteria 1746
398 Ga0207680_10236266 3300025903 Bacteria 1258
399 Ga0207647_10003122 3300025904 Bacteria 12444
400 Ga0207647_10006248 3300025904 Bacteria 8680
401 Ga0207647_10008700 3300025904 Bacteria 7251
402 Ga0207647_10047676 3300025904 Bacteria 2664
403 Ga0207685_10104404 3300025905 Bacteria 1217
404 Ga0207699_10014219 3300025906 Bacteria 4096
405 Ga0207699_10029949 3300025906 Bacteria 3041
406 Ga0207645_10000281 3300025907 Bacteria 42381
407 Ga0207643_10000012 3300025908 Bacteria 133318
408 Ga0207684_10372117 3300025910 Bacteria 1229
409 Ga0207684_10474748 3300025910 Bacteria 1073
410 Ga0207654_10002060 3300025911 Bacteria 10312
411 Ga0207654_10054694 3300025911 Bacteria 2308
412 Ga0207654_10099409 3300025911 Bacteria 1790
413 Ga0207654_10119217 3300025911 Bacteria 1654
414 Ga0207707_10000551 3300025912 Bacteria 38020
415 Ga0207707_10001093 3300025912 Bacteria 25844
416 Ga0207707_10210361 3300025912 Bacteria 1694
417 Ga0207695_10000163 3300025913 Bacteria 197030
418 Ga0207695_10145704 3300025913 Bacteria 2313
419 Ga0207695_10222988 3300025913 Bacteria 1792
420 Ga0207671_10055443 3300025914 Bacteria 2936
421 Ga0207671_10091800 3300025914 Bacteria 2289
422 Ga0207671_10148265 3300025914 Bacteria 1811
423 Ga0207693_10011724 3300025915 Bacteria 7089
424 Ga0207693_10051713 3300025915 Bacteria 3223
425 Ga0207693_10162005 3300025915 Bacteria 1760
426 Ga0207693_10275102 3300025915 Bacteria 1319
427 Ga0207693_10331519 3300025915 Bacteria 1191
428 Ga0207663_10013388 3300025916 Bacteria 4457
429 Ga0207663_10076746 3300025916 Bacteria 2172
430 Ga0207663_10412720 3300025916 Bacteria 1035
431 Ga0207660_10000992 3300025917 Bacteria 18816
432 Ga0207660_10077022 3300025917 Bacteria 2440
433 Ga0207662_10000123 3300025918 Bacteria 37327
434 Ga0207662_10059002 3300025918 Bacteria 2299
435 Ga0207662_10073039 3300025918 Bacteria 2080
436 Ga0207657_10000358 3300025919 Bacteria 48238
437 Ga0207657_10073133 3300025919 Bacteria 2898
438 Ga0207657_10118824 3300025919 Bacteria 2176
439 Ga0207649_10000545 3300025920 Bacteria 26032
440 Ga0207649_10230066 3300025920 Bacteria 1325
441 Ga0207649_10387089 3300025920 Bacteria 1043
442 Ga0207649_10409757 3300025920 Bacteria 1016
443 Ga0207652_10004318 3300025921 Bacteria 11589
444 Ga0207652_10009869 3300025921 Bacteria 7683
445 Ga0207652_10121046 3300025921 Bacteria 2328
446 Ga0207681_10000286 3300025923 Bacteria 37397
447 Ga0207681_10032000 3300025923 Bacteria 3440
448 Ga0207650_10006950 3300025925 Bacteria 7716
449 Ga0207659_10000023 3300025926 Bacteria 142947
450 Ga0207687_10000149 3300025927 Bacteria 46713
451 Ga0207700_10211876 3300025928 Bacteria 1638
452 Ga0207700_10227469 3300025928 Bacteria 1584
453 Ga0207664_10018761 3300025929 Bacteria 5102
454 Ga0207664_10254974 3300025929 Bacteria 1532
455 Ga0207644_10000724 3300025931 Bacteria 20908
456 Ga0207690_10000203 3300025932 Bacteria 46451
457 Ga0207690_10057188 3300025932 Bacteria 2634
458 Ga0207706_10002188 3300025933 Bacteria 19056
459 Ga0207706_10028672 3300025933 Bacteria 4969
460 Ga0207706_10127159 3300025933 Bacteria 2241
461 Ga0207706_10185280 3300025933 Bacteria 1828
462 Ga0207686_10007108 3300025934 Bacteria 6023
463 Ga0207686_10080323 3300025934 Bacteria 2126
464 Ga0207709_10000607 3300025935 Bacteria 29669
465 Ga0207709_10039610 3300025935 Bacteria 2816
466 Ga0207670_10000125 3300025936 Bacteria 50796
467 Ga0207669_10000357 3300025937 Bacteria 20792
468 Ga0207704_10001003 3300025938 Bacteria 12514
469 Ga0207704_10201670 3300025938 Bacteria 1457
470 Ga0207665_10014167 3300025939 Bacteria 5245
471 Ga0207665_10043517 3300025939 Bacteria 3003
472 Ga0207665_10082651 3300025939 Bacteria 2214
473 Ga0207665_10146124 3300025939 Bacteria 1690
474 Ga0207665_10231475 3300025939 Bacteria 1358
475 Ga0207691_10000256 3300025940 Bacteria 52748
476 Ga0207691_10128718 3300025940 Bacteria 2238
477 Ga0207691_10217610 3300025940 Bacteria 1657
478 Ga0207691_10385018 3300025940 Bacteria 1197
479 Ga0207711_10008837 3300025941 Bacteria 8420
480 Ga0207711_10360137 3300025941 Bacteria 1347
481 Ga0207689_10000008 3300025942 Bacteria 127942
482 Ga0207661_10000104 3300025944 Bacteria 53977
483 Ga0207679_10000196 3300025945 Bacteria 48433
484 Ga0207679_10040903 3300025945 Bacteria 3321
485 Ga0207679_10308220 3300025945 Bacteria 1367
486 Ga0207667_10023002 3300025949 Bacteria 6871
487 Ga0207667_10124933 3300025949 Bacteria 2650
488 Ga0207667_10128470 3300025949 Bacteria 2610
489 Ga0207667_10165639 3300025949 Bacteria 2273
490 Ga0207667_10512594 3300025949 Bacteria 1216
491 Ga0207651_10001000 3300025960 Bacteria 12479
492 Ga0207712_10000156 3300025961 Bacteria 70300
493 Ga0207712_10684860 3300025961 Bacteria 894
494 Ga0207668_10000251 3300025972 Bacteria 35861
495 Ga0207668_10232309 3300025972 Bacteria 1488
496 Ga0207640_10000157 3300025981 Bacteria 49126
497 Ga0207640_10186223 3300025981 Bacteria 1561
498 Ga0207640_10317462 3300025981 Bacteria 1239
499 Ga0207658_10001085 3300025986 Bacteria 22019
500 Ga0207658_10829230 3300025986 Bacteria 840
501 Ga0207677_10000609 3300026023 Bacteria 22003
502 Ga0207677_10514999 3300026023 Bacteria 1037
503 Ga0207703_10003859 3300026035 Bacteria 12455
504 Ga0207703_10270043 3300026035 Bacteria 1540
505 Ga0207639_10002440 3300026041 Bacteria 12492
506 Ga0207639_10035687 3300026041 Bacteria 3680
507 Ga0207639_10054642 3300026041 Bacteria 3053
508 Ga0207639_10169704 3300026041 Bacteria 1846
509 Ga0207639_10629026 3300026041 Bacteria 992
510 Ga0207678_10004329 3300026067 Bacteria 12744
511 Ga0207678_10018630 3300026067 Bacteria 6094
512 Ga0207678_10020490 3300026067 Bacteria 5797
513 Ga0207678_10055408 3300026067 Bacteria 3415
514 Ga0207708_10002782 3300026075 Bacteria 12851
515 Ga0207708_10017335 3300026075 Bacteria 5421
516 Ga0207702_10000127 3300026078 Bacteria 89755
517 Ga0207702_10003955 3300026078 Bacteria 13300
518 Ga0207641_10473589 3300026088 Bacteria 1213
519 Ga0207648_10005563 3300026089 Bacteria 12680
520 Ga0207648_10022367 3300026089 Bacteria 5680
521 Ga0207676_10003560 3300026095 Bacteria 11004
522 Ga0207676_10200740 3300026095 Bacteria 1762
523 Ga0207676_10414345 3300026095 Bacteria 1262
524 Ga0207674_10008031 3300026116 Bacteria 12231
525 Ga0207674_10009174 3300026116 Bacteria 11343
526 Ga0207674_10175551 3300026116 Bacteria 2095
527 Ga0207675_100000604 3300026118 Bacteria 35079
528 Ga0207675_100335833 3300026118 Bacteria 1478
529 Ga0207675_100789176 3300026118 Bacteria 962
530 Ga0207683_10000006 3300026121 Bacteria 181260
531 Ga0207683_10067537 3300026121 Bacteria 3154
532 Ga0207683_10731678 3300026121 Bacteria 918
533 Ga0207698_10000378 3300026142 Bacteria 25887
534 Ga0207698_10038120 3300026142 Bacteria 3548
535 Ga0207698_10104322 3300026142 Bacteria 2358
536 Ga0207698_10511362 3300026142 Bacteria 1170
537 Ga0209389_1000186 3300027296 Bacteria 47149
538 Ga0209389_1000261 3300027296 Bacteria 33507
539 Ga0209589_1001077 3300027357 Bacteria 43273
540 Ga0209489_100176 3300027361 Bacteria 100053
541 Ga0209489_116724 3300027361 Bacteria 3748
542 Ga0209489_116725 3300027361 Bacteria 3748
543 Ga0209700_101165 3300027363 Bacteria 53492
544 Ga0210002_1001101 3300027617 Bacteria 3755
545 Ga0209588_1007749 3300027671 Bacteria 3169
546 Ga0209971_1004999 3300027682 Bacteria 3151
547 Ga0209966_1004248 3300027695 Bacteria 2424
548 Ga0209998_10000566 3300027717 Bacteria 9989
549 Ga0209974_10002617 3300027876 Bacteria 6532
550 Ga0207428_10000165 3300027907 Bacteria 91701
551 Ga0207428_10000446 3300027907 Bacteria 50240
552 Ga0207428_10001251 3300027907 Bacteria 27203
553 Ga0268266_10002993 3300028379 Bacteria 17411
554 Ga0268266_10023620 3300028379 Bacteria 5233
555 Ga0268266_10490417 3300028379 Bacteria 1172
556 Ga0268266_10534930 3300028379 Bacteria 1121
557 Ga0268265_10001687 3300028380 Bacteria 18006
558 Ga0268265_10044616 3300028380 Bacteria 3302
559 Ga0268264_10002029 3300028381 Bacteria 18124
560 Ga0265337_1002902 3300028556 Bacteria 7628
561 Ga0265326_10022293 3300028558 Bacteria 1814
562 Ga0265334_10017005 3300028573 Bacteria 3008
563 Ga0265323_10003921 3300028653 Bacteria 6470
564 Ga0265322_10023262 3300028654 Bacteria 1772
565 Ga0265336_10000921 3300028666 Bacteria 14920
566 Ga0265338_10000085 3300028800 Bacteria 175080
567 Ga0265324_10032812 3300029957 Bacteria 1813
568 Ga0307513_10106256 3300031456 Bacteria 2814
569 Ga0307408_100188478 3300031548 Bacteria 1660
570 Ga0265314_10001137 3300031711 Bacteria 30830
571 Ga0307516_10045830 3300031730 Bacteria 4316
572 Ga0307415_100069955 3300032126 Bacteria 2463
573 Ga0307510_10052296 3300033180 Bacteria 4308
574 Ga0373930_0000066 3300034816 Bacteria 10144
575 Ga0373948_0000083 3300034817 Bacteria 9733
576 Ga0373950_0002205 3300034818 Bacteria 2655
577 Ga0373958_0000149 3300034819 Bacteria 7846
578 Ga0373958_0000888 3300034819 Bacteria 3858
579 Ga0373959_0000484 3300034820 Bacteria 7248
580 Ga0373938_0000806 3300034957 Bacteria 5081
581 Ga0373938_0000911 3300034957 Bacteria 4739
582 Ga0373938_0034030 3300034957 Bacteria 1105
583 Ga0373928_0024397 3300035084 Bacteria 1296
584 Ga0373928_0057184 3300035084 Bacteria 935
585 Ga0373940_0001846 3300035088 Bacteria 3966
586 Ga0373940_0002395 3300035088 Bacteria 3638
587 Ga0373949_0001224 3300035090 Bacteria 7585
588 Ga0373949_0002075 3300035090 Bacteria 5288
589 Ga0373951_0000469 3300035091 Bacteria 11565
590 Ga0373951_0000642 3300035091 Bacteria 9641
591 Ga0373952_0000323 3300035092 Bacteria 8035
592 Ga0373952_0001223 3300035092 Bacteria 4674
593 Ga0373932_0000757 3300035112 Bacteria 9626
594 Ga0373932_0001683 3300035112 Bacteria 6030
595 Ga0373932_0101858 3300035112 Bacteria 935
596 Ga0373939_0000487 3300035114 Bacteria 10018
597 Ga0373939_0001486 3300035114 Bacteria 5681
598 Ga0373941_0000083 3300035115 Bacteria 15466
599 Ga0373941_0001809 3300035115 Bacteria 4602
600 Ga0373960_0000185 3300035121 Bacteria 11147
601 Ga0373960_0000330 3300035121 Bacteria 9027
602 Ga0373943_0085146 3300035170 Bacteria 1628
603 Ga0373946_0063025 3300035171 Bacteria 1582
604 Ga0373942_0001462 3300035207 Bacteria 6070
605 Ga0373961_0000569 3300035241 Bacteria 13935
606 Ga0373961_0006670 3300035241 Bacteria 2775
607 Ga0373962_0000149 3300035242 Bacteria 14459
608 Ga0373931_0001480 3300035691 Bacteria 10101
609 Ga0373931_0001492 3300035691 Bacteria 10065
610 Ga0373931_0002244 3300035691 Bacteria 8538
611 Ga0373931_0118124 3300035691 Bacteria 1513
612 Ga0373927_0181305 3300035695 Bacteria 1381
613 Ga0373933_0000342 3300035724 Bacteria 29960
614 Ga0373933_0043948 3300035724 Bacteria 2645
615 Ga0373947_0052004 3300035725 Bacteria 2467
616 Ga0373937_0029802 3300036401 Bacteria 4943
617 Ga0373937_0051220 3300036401 Bacteria 3784
618 Ga0373937_0332732 3300036401 Bacteria 1437
619 Ga0373925_0010857 3300037068 Bacteria 6606
620 Ga0373925_0109741 3300037068 Bacteria 2130
621 Ga0373925_0797154 3300037068 Bacteria 779
622 Ga0395899_0037355 3300037312 Bacteria 3641
623 Ga0395899_0319074 3300037312 Bacteria 1047
624 Ga0395900_0004076 3300037418 Bacteria 15581
625 Ga0395900_0193180 3300037418 Bacteria 2064
626 Ga0395900_0198481 3300037418 Bacteria 2031
627 Ga0395898_0024467 3300037466 Bacteria 6091
628 Ga0395898_0393254 3300037466 Bacteria 1322
629 Ga0395905_0005831 3300037471 Bacteria 12515
630 Ga0395905_0106587 3300037471 Bacteria 2631
631 Ga0436364_0027260 3300037853 Bacteria 1001
632 Ga0436364_0673913 3300037853 Bacteria 3161
633 Ga0395901_0790983 3300038443 Bacteria 938
634 Ga0242420_009756 3300038996 Bacteria 1582
635 Ga0436365_0838985 3300039437 Bacteria 7476
636 Ga0436365_1236461 3300039437 Bacteria 4289
637 Ga0436365_1353610 3300039437 Bacteria 936
638 Ga0436365_1439170 3300039437 Bacteria 2050
639 Ga0436365_1531367 3300039437 Bacteria 8367
640 Ga0436365_1711180 3300039437 Bacteria 1589
641 Ga0436360_0399254 3300039438 Bacteria 2071
642 Ga0436360_1070844 3300039438 Bacteria 1094
643 Ga0436361_1162310 3300039447 Bacteria 4817
644 Ga0436363_0117807 3300039450 Bacteria 2645
645 Ga0436363_1314815 3300039450 Bacteria 3113
646 Ga0436363_1489710 3300039450 Bacteria 1716
647 Ga0436363_1588616 3300039450 Bacteria 1527
648 Ga0436362_0035727 3300039453 Bacteria 3821
649 Ga0451795_1428191 3300041456 Bacteria 1603
650 Ga0451853_3688248 3300041512 Bacteria 1273
651 Ga0439448_0063918 3300042005 Bacteria 1220
652 Ga0439455_0050506 3300042012 Bacteria 1086
653 Ga0439460_0022908 3300042461 Bacteria 1717
654 Ga0451577_0168912 3300042876 Bacteria 1971
655 Ga0439440_0065683 3300042993 Bacteria 935
656 Ga0466969_0008653 3300044656 Bacteria 5398
657 Ga0466972_0000379 3300044658 Bacteria 23860
658 Ga0466972_0019744 3300044658 Bacteria 3369
659 Ga0466972_0021835 3300044658 Bacteria 3189
660 Ga0466966_0001791 3300044684 Bacteria 13935
661 Ga0466961_0000005 3300044693 Bacteria 173105
662 Ga0466963_0004348 3300044694 Bacteria 8223
663 Ga0466964_0080834 3300044706 Bacteria 1395
664 Ga0453684_0069913 3300044712 Bacteria 4450
665 Ga0466957_0057848 3300044842 Bacteria 2374
666 Ga0466960_0126827 3300044901 Bacteria 1342
667 Ga0466959_0001046 3300045049 Bacteria 16580
668 Ga0466967_0268064 3300045976 Bacteria 1635
669 Ga0495592_0014234 3300046454 Bacteria 6043
670 Ga0495592_0426452 3300046454 Unclassified 835
671 Ga0495603_0014368 3300046455 Bacteria 4788
672 Ga0495603_0267579 3300046455 Bacteria 983
673 Ga0495638_0022206 3300046460 Bacteria 4168
674 Ga0495651_0002090 3300046462 Bacteria 15398
675 Ga0495651_0016305 3300046462 Bacteria 5753
676 Ga0495651_0065963 3300046462 Bacteria 2764
677 Ga0495651_0104547 3300046462 Bacteria 2102
678 Ga0495653_0037883 3300046463 Bacteria 3786
679 Ga0495605_0093891 3300046474 Bacteria 1387
680 Ga0495639_0234024 3300046475 Bacteria 905
681 Ga0495662_0037504 3300046476 Bacteria 2341
682 Ga0495664_0134266 3300046477 Bacteria 1499
683 Ga0495594_0073850 3300046499 Bacteria 1899
684 Ga0495606_0048065 3300046507 Bacteria 2809
685 Ga0495606_0049588 3300046507 Bacteria 2752
686 Ga0495608_0016921 3300046511 Bacteria 5047
687 Ga0495610_0042411 3300046512 Bacteria 2276
688 Ga0495610_0057299 3300046512 Bacteria 1869
689 Ga0495628_0006810 3300046516 Bacteria 9934
690 Ga0495630_0151915 3300046517 Bacteria 1762
691 Ga0495632_0026476 3300046519 Bacteria 3052
692 Ga0495643_0008122 3300046522 Bacteria 6684
693 Ga0495648_0065812 3300046524 Bacteria 2128
694 Ga0495648_0087505 3300046524 Bacteria 1754
695 Ga0495652_0009617 3300046529 Bacteria 8778
696 Ga0495652_0158347 3300046529 Bacteria 1761
697 Ga0495640_0035624 3300046533 Bacteria 3521
698 Ga0495640_0051480 3300046533 Bacteria 2831
699 Ga0495640_0061637 3300046533 Bacteria 2547
700 Ga0495587_0126564 3300046536 Unclassified 1461
701 Ga0495597_0059087 3300046542 Bacteria 1674
702 Ga0495645_0009151 3300046543 Bacteria 6921
703 Ga0495667_0003359 3300046559 Bacteria 10713
704 Ga0495667_0048501 3300046559 Bacteria 2804
705 Ga0495668_0097562 3300046616 Bacteria 1608
706 Ga0495668_0108936 3300046616 Bacteria 1515
707 Ga0495634_0259188 3300046642 Bacteria 1061
708 Ga0495625_0060472 3300046660 Bacteria 2684
709 Ga0495635_0043877 3300046663 Bacteria 3085
710 Ga0495657_0010047 3300046675 Bacteria 7136
711 Ga0495657_0078426 3300046675 Bacteria 2141
712 Ga0495657_0157252 3300046675 Unclassified 1408
713 Ga0495657_0265551 3300046675 Bacteria 1030
714 Ga0495599_0012264 3300046678 Bacteria 5279
715 Ga0495623_0032519 3300046679 Bacteria 3353
716 Ga0495646_0040929 3300046680 Bacteria 2850
717 Ga0495613_0098387 3300046689 Bacteria 2114
718 Ga0495649_0041408 3300046694 Bacteria 2519
719 Ga0495649_0157647 3300046694 Bacteria 1191
720 Ga0495600_0008131 3300046809 Bacteria 6437
721 Ga0495600_0322101 3300046809 Unclassified 972
722 Ga0495581_0065223 3300047315 Bacteria 2105
723 Ga0495604_0004129 3300047317 Bacteria 11530
724 Ga0495604_0062070 3300047317 Unclassified 2857
725 Ga0495674_0005198 3300047319 Bacteria 12501
726 Ga0495674_0026719 3300047319 Bacteria 5280
727 Ga0495674_0592592 3300047319 Bacteria 879
728 Ga0495672_0236905 3300047320 Bacteria 893
729 Ga0495680_0005133 3300047322 Bacteria 12364
730 Ga0495683_0062226 3300047323 Bacteria 1847
731 Ga0495683_0181260 3300047323 Bacteria 962
732 Ga0495687_005448 3300047443 Bacteria 8109
733 Ga0495686_0302681 3300047472 Bacteria 882
734 Ga0495602_0028597 3300048088 Bacteria 5329
735 Ga0496100_0006059 3300048903 Bacteria 6568
736 Ga0496100_0018610 3300048903 Bacteria 4124
737 Ga0496100_0084215 3300048903 Bacteria 2155
738 Ga0496101_0000464 3300048904 Bacteria 25674
739 Ga0496101_0034760 3300048904 Bacteria 3563
740 Ga0496101_0293207 3300048904 Bacteria 1273
741 Ga0496102_0001120 3300048905 Bacteria 24582
742 Ga0496102_0048143 3300048905 Bacteria 3876
743 Ga0496102_0213049 3300048905 Bacteria 1821
744 Ga0496102_0243784 3300048905 Bacteria 1694
745 Ga0496103_0000611 3300048906 Bacteria 27883
746 Ga0496103_0044090 3300048906 Bacteria 2747
747 Ga0496104_0000299 3300048907 Bacteria 43965
748 Ga0496104_0147953 3300048907 Bacteria 2255
749 Ga0496104_0147977 3300048907 Bacteria 2255
750 Ga0496104_0186552 3300048907 Bacteria 1985
751 Ga0496104_0330291 3300048907 Bacteria 1438
752 Ga0496104_0340191 3300048907 Bacteria 1413
753 Ga0496105_0001270 3300048908 Bacteria 17643
754 Ga0496105_0031850 3300048908 Bacteria 4324
755 Ga0496105_0392164 3300048908 Bacteria 1103
756 Ga0496106_0000541 3300048909 Bacteria 26824
757 Ga0496106_0005785 3300048909 Bacteria 9143
758 Ga0496106_0041454 3300048909 Bacteria 3450
759 Ga0496106_0050538 3300048909 Bacteria 3133
760 Ga0496106_0062700 3300048909 Bacteria 2823
761 Ga0496106_0433503 3300048909 Bacteria 1056
762 Ga0496107_0000493 3300048910 Bacteria 21794
763 Ga0496107_0034808 3300048910 Bacteria 3609
764 Ga0496107_0189859 3300048910 Bacteria 1526
765 Ga0496108_0001251 3300048911 Bacteria 19871
766 Ga0496108_0057762 3300048911 Bacteria 3260
767 Ga0496108_0065795 3300048911 Bacteria 3056
768 Ga0496108_0066535 3300048911 Bacteria 3039
769 Ga0496109_0003885 3300048912 Bacteria 12475
770 Ga0496109_0030152 3300048912 Bacteria 4862
771 Ga0496109_0130851 3300048912 Bacteria 2342
772 Ga0496109_0282165 3300048912 Bacteria 1565
773 Ga0496110_0026649 3300048913 Bacteria 4949
774 Ga0496110_0038036 3300048913 Bacteria 4185
775 Ga0496110_0047244 3300048913 Bacteria 3768
776 Ga0496110_0232793 3300048913 Bacteria 1676
777 Ga0496111_0029164 3300048914 Bacteria 3917
778 Ga0496111_0068476 3300048914 Bacteria 2580
779 Ga0496111_0121357 3300048914 Bacteria 1930
780 Ga0496112_0000045 3300048915 Bacteria 85873
781 Ga0496112_0107678 3300048915 Bacteria 2757
782 Ga0496112_0450735 3300048915 Bacteria 1224
783 Ga0496112_0561461 3300048915 Bacteria 1075
784 Ga0496113_0005714 3300048916 Bacteria 7791
785 Ga0496113_0020474 3300048916 Bacteria 4651
786 Ga0496113_0023321 3300048916 Bacteria 4388
787 Ga0496114_0003043 3300048917 Bacteria 12845
788 Ga0496114_0006370 3300048917 Bacteria 9287
789 Ga0496114_0008753 3300048917 Bacteria 8017
790 Ga0496114_0318028 3300048917 Bacteria 1375
791 Ga0496114_0440321 3300048917 Bacteria 1154
792 Ga0496114_0490373 3300048917 Bacteria 1087
793 Ga0496115_0010227 3300048918 Bacteria 7001
794 Ga0496115_0192946 3300048918 Bacteria 1683
795 Ga0496115_0203999 3300048918 Bacteria 1633
796 Ga0496116_0028618 3300048919 Bacteria 4032
797 Ga0496116_0131296 3300048919 Bacteria 1427
798 Ga0496117_0127632 3300048920 Bacteria 1549
799 Ga0496118_0024004 3300048921 Bacteria 5278
800 Ga0496118_0034765 3300048921 Bacteria 4105
801 Ga0496120_0071107 3300048923 Bacteria 1911
802 Ga0496121_0014125 3300048924 Bacteria 8508
803 Ga0496121_0094717 3300048924 Bacteria 2322
804 Ga0496121_0167506 3300048924 Bacteria 1600
805 Ga0496124_0036240 3300048927 Bacteria 4305
806 Ga0496124_0051639 3300048927 Bacteria 3497
807 Ga0496124_0238013 3300048927 Bacteria 1356
808 Ga0496125_0034413 3300048928 Bacteria 4466
809 Ga0496125_0057850 3300048928 Bacteria 3136
810 Ga0496125_0145474 3300048928 Bacteria 1639
811 Ga0496126_0015287 3300048929 Bacteria 7726
812 Ga0496126_0018065 3300048929 Bacteria 7005
813 Ga0496126_0029128 3300048929 Bacteria 5248
814 Ga0496126_0079333 3300048929 Bacteria 2906
815 Ga0495682_0100188 3300049460 Bacteria 1039
816 Ga0501032_0001029 3300049569 Bacteria 22396
817 Ga0501032_0159846 3300049569 Bacteria 1480
818 Ga0501033_0000163 3300049570 Bacteria 63913
819 Ga0501033_0003345 3300049570 Bacteria 13239
820 Ga0501033_0010958 3300049570 Bacteria 6949
821 Ga0501033_0118293 3300049570 Bacteria 1925
822 Ga0501034_0000202 3300049571 Bacteria 112985
823 Ga0501036_0000021 3300049572 Bacteria 114136
824 Ga0501036_0139651 3300049572 Bacteria 2045
825 Ga0501036_0222885 3300049572 Bacteria 1583
826 Ga0501036_0750571 3300049572 Bacteria 805
827 Ga0501037_0002107 3300049573 Bacteria 14422
828 Ga0501037_0002687 3300049573 Bacteria 12835
829 Ga0501038_0000226 3300049574 Bacteria 47831
830 Ga0501038_0008947 3300049574 Bacteria 9185
831 Ga0501038_0054839 3300049574 Bacteria 3427
832 Ga0501039_0001542 3300049575 Bacteria 16931
833 Ga0501039_0013937 3300049575 Bacteria 6150
834 Ga0501042_0025424 3300049578 Bacteria 4159
835 Ga0501042_0412234 3300049578 Bacteria 979
836 Ga0501043_0004017 3300049579 Bacteria 12024
837 Ga0501043_0005955 3300049579 Bacteria 9806
838 Ga0501043_0129945 3300049579 Bacteria 1974
839 Ga0501046_0000354 3300049580 Bacteria 46165
840 Ga0501046_0004244 3300049580 Bacteria 13045
841 Ga0501047_0000232 3300049581 Bacteria 66245
842 Ga0501048_0000050 3300049582 Bacteria 57921
843 Ga0501067_0002704 3300049583 Bacteria 9780
844 Ga0501067_0007984 3300049583 Bacteria 5878
845 Ga0501068_0000430 3300049584 Bacteria 21319
846 Ga0501068_0299219 3300049584 Bacteria 1030
847 Ga0501069_0004751 3300049585 Bacteria 7027
848 Ga0501070_0054610 3300049586 Bacteria 3312
849 Ga0501070_0330580 3300049586 Bacteria 1239
850 Ga0501071_0007174 3300049587 Bacteria 7290
851 Ga0501072_0002675 3300049588 Bacteria 13364
852 Ga0501072_0013429 3300049588 Bacteria 6269
853 Ga0501072_0263778 3300049588 Bacteria 1371
854 Ga0501073_0000329 3300049589 Bacteria 31824
855 Ga0501074_0000092 3300049590 Bacteria 43073
856 Ga0501076_0018017 3300049592 Bacteria 5374
857 Ga0501076_0027275 3300049592 Bacteria 4430
858 Ga0501076_0563209 3300049592 Bacteria 940
859 Ga0501077_0091114 3300049593 Bacteria 1932
860 Ga0501079_0003108 3300049741 Bacteria 12164
861 Ga0501079_0287057 3300049741 Bacteria 1287
862 Ga0501079_0328706 3300049741 Bacteria 1197
863 Ga0501080_0003432 3300049742 Bacteria 13983
864 Ga0501080_0585599 3300049742 Bacteria 991
865 Ga0501081_0188490 3300049743 Bacteria 1493
866 Ga0501081_0501503 3300049743 Bacteria 904
867 Ga0501083_0001578 3300049744 Bacteria 15557
868 Ga0501035_0000120 3300049822 Bacteria 94532
869 Ga0501035_0148468 3300049822 Bacteria 2035
870 Ga0501044_0001777 3300049823 Bacteria 25225
871 Ga0501044_0006711 3300049823 Bacteria 12684
872 Ga0501044_0010872 3300049823 Bacteria 9876
873 Ga0501044_0095699 3300049823 Bacteria 2992
874 Ga0501044_0242121 3300049823 Bacteria 1747
875 Ga0501044_0242223 3300049823 Bacteria 1747
876 Ga0501044_0762905 3300049823 Bacteria 849
877 Ga0501045_0168829 3300049824 Bacteria 1630
878 nmdc:mga00v17_182013_c1 3300050491 Bacteria 1356
879 nmdc:mga00v17_70201_c1 3300050491 Bacteria 2169
880 nmdc:mga0yw44_294500_c1 3300050492 Bacteria 1086
881 nmdc:mga0yw44_444272_c1 3300050492 Bacteria 879
882 nmdc:mga0k408_46943_c1 3300050493 Bacteria 2495
883 nmdc:mga06z11_31376_c1 3300050494 Bacteria 2581
884 nmdc:mga06z11_34191_c1 3300050494 Bacteria 2493
885 nmdc:mga06z11_56186_c1 3300050494 Bacteria 2035
886 nmdc:mga06z11_94615_c1 3300050494 Bacteria 1628
887 nmdc:mga04h51_13457_c1 3300050495 Bacteria 2316
888 nmdc:mga04h51_90706_c1 3300050495 Bacteria 1099
889 nmdc:mga07m45_48107_c1 3300050496 Bacteria 2398
890 nmdc:mga07m45_87522_c1 3300050496 Bacteria 1783
891 nmdc:mga05p37_102734_c1 3300050507 Bacteria 3519
892 nmdc:mga05p37_145573_c1 3300050507 Bacteria 2902
893 nmdc:mga05p37_2380_c1 3300050507 Bacteria 21888
894 nmdc:mga05p37_2697_c1 3300050507 Bacteria 19225
895 nmdc:mga09592_12517_c1 3300050508 Bacteria 6913
896 nmdc:mga09592_346752_c1 3300050508 Bacteria 1285
897 nmdc:mga0qj67_693_c1 3300050509 Bacteria 22941
898 nmdc:mga06r32_1056_c1 3300050510 Bacteria 24895
899 nmdc:mga06r32_174488_c1 3300050510 Bacteria 2134
900 nmdc:mga08y16_3020_c1 3300050511 Bacteria 17372
901 nmdc:mga08y16_3846_c1 3300050511 Bacteria 15611
902 nmdc:mga08y16_5716_c1 3300050511 Bacteria 13032
903 nmdc:mga0n895_1654_c1 3300050512 Bacteria 16850
904 nmdc:mga0n895_291_c1 3300050512 Bacteria 33000
905 nmdc:mga0n895_608308_c1 3300050512 Bacteria 1095
906 nmdc:mga0rr50_1013_c1 3300050513 Bacteria 15240
907 nmdc:mga0rr50_235823_c1 3300050513 Bacteria 1515
908 nmdc:mga0rr50_41977_c1 3300050513 Bacteria 3337
909 nmdc:mga0rr50_537860_c1 3300050513 Bacteria 995
910 nmdc:mga08x19_135375_c1 3300050514 Bacteria 1660
911 nmdc:mga08x19_188735_c1 3300050514 Bacteria 1409
912 nmdc:mga0a205_10048_c1 3300050515 Bacteria 8685
913 nmdc:mga0a205_4627_c1 3300050515 Bacteria 12336
914 nmdc:mga0sz30_14350_c2 3300050516 Bacteria 2289
915 Ga0495601_0006208 3300053077 Bacteria 6980
916 Ga0495601_0036758 3300053077 Bacteria 3060
917 Ga0495601_0087862 3300053077 Bacteria 1999
918 Ga0500635_0043319 3300053080 Bacteria 1513
919 Ga0495655_0009936 3300053083 Bacteria 1863
920 Ga0495595_0016861 3300053084 Bacteria 3133
921 Ga0495619_0000628 3300053085 Bacteria 23297
922 Ga0495619_0012374 3300053085 Bacteria 5372
923 Ga0495619_0295381 3300053085 Bacteria 1122
924 Ga0500578_0107212 3300053086 Bacteria 1764
925 Ga0500643_000047 3300053087 Bacteria 148938
926 Ga0500646_0119028 3300053090 Bacteria 847
927 Ga0500647_0116686 3300053091 Bacteria 1265
928 Ga0500566_0147200 3300053094 Bacteria 1243
929 Ga0500641_0093621 3300053096 Bacteria 1284
930 Ga0500556_0020528 3300053104 Bacteria 2115
931 Ga0500557_000025 3300053105 Bacteria 84884
932 Ga0500562_002601 3300053108 Bacteria 4498
933 Ga0500572_000369 3300053111 Bacteria 16000
934 Ga0500595_018682 3300053119 Bacteria 2531
935 Ga0500608_084709 3300053122 Bacteria 1490
936 Ga0500642_0023559 3300053130 Bacteria 2473
937 Ga0500652_000151 3300053131 Bacteria 26379
938 Ga0500655_020905 3300053133 Bacteria 1225
939 Ga0500559_0000301 3300053136 Bacteria 37742
940 Ga0500568_0059863 3300053139 Bacteria 1476
941 Ga0500577_0000162 3300053142 Bacteria 16748
942 Ga0500577_0107331 3300053142 Bacteria 1148
943 Ga0500590_039433 3300053148 Bacteria 2435
944 Ga0500604_0145674 3300053151 Bacteria 802
945 Ga0500616_0000028 3300053153 Bacteria 435722
946 Ga0500616_0053126 3300053153 Bacteria 2127
947 Ga0500616_0157140 3300053153 Bacteria 1046
948 Ga0500620_031443 3300053155 Bacteria 1683
949 Ga0500622_0048879 3300053156 Bacteria 2181
950 Ga0500627_0024855 3300053158 Bacteria 2456
951 Ga0500638_188735 3300053162 Bacteria 882
952 Ga0500636_0002008 3300053177 Bacteria 11199
953 Ga0500636_0014131 3300053177 Bacteria 4692
954 Ga0500636_0029309 3300053177 Bacteria 3251
955 Ga0500636_0224195 3300053177 Bacteria 977
956 Ga0500576_010498 3300053725 Bacteria 4091
957 Ga0500576_152348 3300053725 Bacteria 862
958 Ga0500645_032246 3300053730 Bacteria 1571
959 Ga0500645_035473 3300053730 Bacteria 1485
960 Ga0500596_004533 3300053735 Bacteria 2535
961 Ga0500601_000180 3300053737 Bacteria 13142
962 Ga0501084_0007176 3300054114 Bacteria 9179
963 Ga0501084_0070951 3300054114 Bacteria 2916
964 Ga0501084_0282148 3300054114 Bacteria 1403
965 Ga0501082_0003391 3300060353 Bacteria 13908
966 Ga0501082_0130285 3300060353 Bacteria 2182
967 Ga0530510_0056547 3300061734 Bacteria 2834
968 Ga0530510_0206472 3300061734 Bacteria 1460
969 2507507394 2507262055 Bacteria 8048963
970 2508541447 2508501009 Bacteria 7784016
971 2508693226 2508501042 Bacteria 8719808
972 2508725421 2508501050 Bacteria 9633614
973 2509080184 2508501114 Bacteria 7082538
974 2511395126 2511231028 Bacteria 8046582
975 2513621545 2513237092 Bacteria 8341956
976 2513636975 2513237094 Bacteria 8789602
977 2513652064 2513237095 Bacteria 8976980
978 2513693050 2513237101 Bacteria 7952346
979 2513704653 2513237102 Bacteria 7703324
980 2513879861 2513237139 Bacteria 8737671
981 2514011593 2513237161 Bacteria 8871253
982 2515629791 2515154112 Bacteria 8294334
983 2528850500 2528768022 Bacteria 10457665
984 2617351899 2617270735 Bacteria 9163226
985 2617373011 2617270741 Bacteria 8201522
986 2723843314 2721755755 Bacteria 8322773
987 2738743609 2738541281 Bacteria 5112672
988 2739352516 2738543032 Bacteria 5115625
989 2776261625 2775506901 Bacteria 9631051
990 2793061139 2791355196 Bacteria 7323613
991 2805918514 2802429603 Bacteria 8777136
992 2818236862 2816332527 Bacteria 8933356
993 2824602772 2824600985 Bacteria 8488197
994 2824613849 2824609381 Bacteria 8672835
995 2824621278 2824617872 Bacteria 8814715
996 2824630441 2824626560 Bacteria 8813858
997 2824639642 2824635225 Bacteria 8785348
998 2824651684 2824644064 Bacteria 8743947
999 2824658204 2824653114 Bacteria 8493680
1000 2824670574 2824661429 Bacteria 9877870
1001 2824678978 2824671348 Bacteria 8369588
1002 2824681511 2824679649 Bacteria 8248951
1003 2824695559 2824687955 Bacteria 8360029
1004 2824702375 2824696289 Bacteria 8335049
1005 2824709192 2824704595 Bacteria 9667483
1006 2824721825 2824714736 Bacteria 8717648
1007 2824727143 2824723954 Bacteria 8758240
1008 2824736544 2824732956 Bacteria 7810675
1009 2824746674 2824746037 Bacteria 7911610
1010 2824757771 2824753945 Bacteria 9787441
1011 2824768717 2824763712 Bacteria 9792355
1012 2824777248 2824773399 Bacteria 8360218
1013 2835316730 2835312727 Bacteria 7413381
1014 2838127247 2838122688 Bacteria 8803140
1015 2841947488 2841941048 Bacteria 8688029
1016 2841956242 2841949485 Bacteria 8680857
1017 2841962558 2841957949 Bacteria 8652217
1018 2841974371 2841966195 Bacteria 8673214
1019 2841980740 2841974524 Bacteria 8931498
1020 2841987347 2841983080 Bacteria 8395090
1021 2842040944 2842038055 Bacteria 8002051
1022 2842046111 2842045827 Bacteria 8006841
1023 2844320272 2844315083 Bacteria 8138177
1024 2847937594 2847930680 Bacteria 9342022
1025 2847948036 2847939898 Bacteria 8606328
1026 2849078136 2849076700 Bacteria 7039503
1027 2857511265 2857509624 Bacteria 7472071
1028 2874592844 2874590934 Bacteria 8299676
1029 2874611798 2874604998 Bacteria 7834745
1030 2874614405 2874612657 Bacteria 8252029
1031 2874623796 2874620515 Bacteria 8290088
1032 2874633046 2874628541 Bacteria 8630250
1033 2874650692 2874645413 Bacteria 8214782
1034 2876768493 2876761206 Bacteria 10111113
1035 2876776304 2876771140 Bacteria 8287509
1036 2876822264 2876818435 Bacteria 8274608
1037 2879080393 2879074833 Bacteria 8279565
1038 2879084090 2879083081 Bacteria 8587928
1039 2879103546 2879099564 Bacteria 10442239
1040 2879133449 2879127579 Bacteria 8294491
1041 2879145772 2879142872 Bacteria 8267021
1042 2881370234 2881364244 Bacteria 7710352
1043 2881667148 2881665667 Bacteria 8175609
1044 2885370260 2885366525 Bacteria 8326213
1045 2885418552 2885409591 Bacteria 9235467
1046 2888385785 2888378607 Bacteria 9652610
1047 2888392518 2888388044 Bacteria 7304136
1048 2888425882 2888419890 Bacteria 7857137
1049 2894233739 2894232714 Bacteria 8834183
1050 2903731552 2903727486 Bacteria 8281579
1051 2904674025 2904666416 Bacteria 8226587
1052 2904711619 2904711408 Bacteria 9771557
1053 2906608339 2906602504 Bacteria 8295279
1054 2906634282 2906626472 Bacteria 8826946
1055 2906645163 2906643746 Bacteria 8722424
1056 2908781462 2908775508 Bacteria 8092255
1057 2922376027
1058 2922393700 2922393267 Bacteria 8285685
1059 2929622859 2929615660 Bacteria 9193770
1060 2929631396 2929624759 Bacteria 9339455
1061 2932785278 2932784394 Bacteria 9704911
1062 2932810311 2932809354 Bacteria 9135765
1063 2932821884 2932818245 Bacteria 9955613
1064 2932831847 2932828146 Bacteria 9745859
1065 2933584936 2933577622 Bacteria 9116884
1066 2935610228 2935608549 Bacteria 8203142
1067 2935619466 2935616580 Bacteria 9032984
1068 2935638446 2935638405 Bacteria 10015038
1069 2935651203 2935648319 Bacteria 8801166
1070 2935659383 2935656913 Bacteria 8965014
1071 2935666702 2935665750 Bacteria 9571747
1072 2935682107 2935675223 Bacteria 9928132
1073 2935691233 2935684952 Bacteria 9590419
1074 2935694338 2935694250 Bacteria 9291695
1075 2935703450 2935703347 Bacteria 10242284
1076 2935718614 2935713505 Bacteria 9608509
1077 2935727406 2935722832 Bacteria 9608746
1078 2935736109 2935732158 Bacteria 9706831
1079 2935745489 2935741537 Bacteria 9707219
1080 2935755870 2935750917 Bacteria 9590372
1081 2935760871 2935760218 Bacteria 9817913
1082 2935771230 2935769743 Bacteria 7878163
1083 2935786069 2935785616 Bacteria 7962367
1084 2935797748 2935793552 Bacteria 8012592
1085 2935801589 2935801545 Bacteria 9301974
1086 2935815003 2935810662 Bacteria 9401221
1087 2935823389 2935819856 Bacteria 8261050
1088 2935827940 2935827899 Bacteria 10038562
1089 2935842145 2935837841 Bacteria 9454360
1090 2935848873 2935847175 Bacteria 8228321
1091 2935858218 2935855204 Bacteria 9035059
1092 2935868123 2935864058 Bacteria 9784707
1093 2935873854 2935873716 Bacteria 9632195
1094 2935912997 2935908558 Bacteria 8568796
1095 2935924430 2935916978 Bacteria 9113783
1096 2935930110 2935926038 Bacteria 8601059
1097 2935939011 2935934488 Bacteria 8602579
1098 2935945958 2935942939 Bacteria 8599779
1099 2935955295 2935951376 Bacteria 8602333
1100 2935962992 2935959822 Bacteria 7869783
1101 2935972334 2935967501 Bacteria 8603075
1102 2935976260 2935975950 Bacteria 8347125
1103 2935986247 2935984226 Bacteria 8302647
1104 2935993222 2935992306 Bacteria 9802711
1105 2936003159 2936002035 Bacteria 9362176
1106 2936013798 2936011229 Bacteria 8801034
1107 2936022678 2936019824 Bacteria 8804134
1108 2936033269 2936028420 Bacteria 8965941
1109 2936040353 2936037263 Bacteria 9446081
1110 2936048904 2936046547 Bacteria 8903709
1111 2936060519 2936055302 Bacteria 8785755
1112 2940562155 2940556831 Bacteria 9590747
1113 2941531478 2941531003 Bacteria 7653939
1114 2941542194 2941538514 Bacteria 9402094
1115 3005488544 3005483717 Bacteria 7877331
1116 3005508091 3005506211 Bacteria 6943378
1117 3005588365 3005587118 Bacteria 7794411
1118 3005600645 3005594810 Bacteria 8716512
1119 3005716085 3005710791 Bacteria 7622528
1120 3005723422 3005718088 Bacteria 8283608
1121 8006985037 8006984368 Bacteria 9651211
1122 8016520341 8016511872 Bacteria 9921665
1123 8016533537 8016530956 Bacteria 8155261
1124 8016546767 8016539877 Bacteria 8155419
1125 8016555350 8016548790 Bacteria 8155074
1126 8016563709 8016557553 Bacteria 8154380
1127 8016576083 8016575299 Bacteria 8154085
1128 8016594723 8016583857 Bacteria 10421953
1129 8016601441 8016595262 Bacteria 8149947
1130 8016608661 8016603502 Bacteria 8731218
1131 8016616213 8016613128 Bacteria 8794220
1132 8016625029 8016622563 Bacteria 7999408
1133 8016638870 8016630954 Bacteria 9217207
1134 8017065229 8017057580 Bacteria 10023680
1135 8019533329 8019530166 Bacteria 8155624
1136 8019552065 8019547302 Bacteria 7996444
1137 8019584624 8019576017 Bacteria 10049540
1138 8019592396 8019586578 Bacteria 10212056
1139 8019598882 8019597564 Bacteria 10041141
1140 8019609494 8019608314 Bacteria 10042931
1141 8019620101 8019619141 Bacteria 9218857
1142 8019633002 8019629233 Bacteria 8687553
1143 8019660869 8019659431 Bacteria 8577854
1144 8055744779 8055742211 Bacteria 9226248
1145 8056974786 8056967851 Bacteria 9038162
1146 Ga0070672_100150056
1147 2214736880
1148 ARcpr5yngRDRAFT_c000142
1149 ARSoilOldRDRAFT_c000054
1150 ARCol0yngRDRAFT_1000054
1151 JGI24746J21847_1001891
1152 JGI24740J21852_10017249
1153 JGI24739J22299_10009856
1154 JGI24739J22299_10018516
1155 JGI24737J22298_10001185
1156 JGI24737J22298_10001974
1157 JGI24750J21931_1000231
1158 JGI24745J21846_1000657
1159 JGI24748J21848_1000261
1160 JGI24738J21930_10002888
1161 JGI24744J21845_10000435
1162 JGI24035J26624_1000833
1163 JGI24034J26672_10000673
1164 JGI24742J22300_10000181
1165 JGI25406J46586_10008015
1166 JGI25153J46596_10000853
1167 JGI25153J46596_10023134
1168 JGI25160J50197_1000837
1169 JGI25160J50197_1002791
1170 JGI25160J50197_1029116
1171 JGI25404J52841_10029381
1172 Ga0055542_1007799
1173 Ga0055526_1044665
1174 Ga0055531_10002933
1175 Ga0055531_10050790
1176 Ga0055543_1003952
1177 Ga0055543_1020000
1178 Ga0065165_1000309
1179 Ga0065165_1000577
1180 Ga0065165_1002255
1181 Ga0065716_1001587
1182 Ga0065712_10076027
1183 Ga0065715_10006812
1184 Ga0065715_10089280
1185 Ga0070658_10319887
1186 Ga0070676_10000128
1187 Ga0070683_100000289
1188 Ga0070683_100181709
1189 Ga0070683_100669744
1190 Ga0070690_100000935
1191 Ga0070690_100030048
1192 Ga0070670_100003173
1193 Ga0070677_10000043
1194 Ga0068869_100000289
1195 Ga0070666_10008412
1196 Ga0070666_10137390
1197 Ga0070666_10155898
1198 Ga0070666_10277827
1199 Ga0070680_100002347
1200 Ga0070680_100068702
1201 Ga0070682_100004343
1202 Ga0068868_100000408
1203 Ga0068868_100404241
1204 Ga0070660_100000182
1205 Ga0070660_100112272
1206 Ga0070689_100000819
1207 Ga0070689_100014880
1208 Ga0070689_100047877
1209 Ga0070691_10056698
1210 Ga0070687_100000689
1211 Ga0070661_100000314
1212 Ga0070661_100128153
1213 Ga0070692_10000310
1214 Ga0070692_10109068
1215 Ga0070668_100000857
1216 Ga0070668_100033097
1217 Ga0070668_100043452
1218 Ga0070669_100002719
1219 Ga0070669_100119736
1220 Ga0070669_100244390
1221 Ga0070675_100002240
1222 Ga0070671_100000598
1223 Ga0070671_100067059
1224 Ga0070674_100002210
1225 Ga0070673_100000289
1226 Ga0070688_100000189
1227 Ga0070659_100003195
1228 Ga0070659_100009819
1229 Ga0070659_100216750
1230 Ga0070667_100000436
1231 Ga0070667_100150309
1232 Ga0070667_100645962
1233 Ga0070703_10055656
1234 Ga0070709_10084550
1235 Ga0070709_10355355
1236 Ga0070714_100003388
1237 Ga0070714_100057878
1238 Ga0070714_100077211
1239 Ga0070714_100424514
1240 Ga0070713_100010828
1241 Ga0070713_100089323
1242 Ga0070713_100295584
1243 Ga0070710_10018511
1244 Ga0070701_10000608
1245 Ga0070701_10100735
1246 Ga0070711_100002007
1247 Ga0070711_100186037
1248 Ga0070705_100000781
1249 Ga0070705_100135857
1250 Ga0070700_100002740
1251 Ga0070700_100039945
1252 Ga0070694_100001837
1253 Ga0070694_100044118
1254 Ga0070708_100027802
1255 Ga0070708_100394827
1256 Ga0070708_100427630
1257 Ga0070663_100000297
1258 Ga0070663_100041533
1259 Ga0070663_100065057
1260 Ga0070663_100203696
1261 Ga0070663_100234296
1262 Ga0070678_100001856
1263 Ga0070678_100183776
1264 Ga0070662_100011992
1265 Ga0070681_10005077
1266 Ga0070681_10027575
1267 Ga0070681_10093558
1268 Ga0068867_100003318
1269 Ga0068867_100026609
1270 Ga0070685_10001152
1271 Ga0070685_10096827
1272 Ga0070685_10262511
1273 Ga0070706_100513535
1274 Ga0070707_100566039
1275 Ga0070698_100531572
1276 Ga0070699_100001443
1277 Ga0070699_100171370
1278 Ga0070679_100003016
1279 Ga0070679_100029119
1280 Ga0070679_100170809
1281 Ga0070679_100293309
1282 Ga0070679_100462731
1283 Ga0070684_100002293
1284 Ga0068853_100011439
1285 Ga0068853_100070015
1286 Ga0068853_100097148
1287 Ga0068853_100115602
1288 Ga0070672_100000106
1289 Ga0070672_100092818
1290 Ga0070686_100000615
1291 Ga0070686_100016532
1292 Ga0070695_100001248
1293 Ga0070695_100030963
1294 Ga0070696_100005592
1295 Ga0070696_100257973
1296 Ga0070693_100001863
1297 Ga0070665_100031480
1298 Ga0070665_100059112
1299 Ga0070665_100642952
1300 Ga0070704_100004061
1301 Ga0070704_100122817
1302 Ga0068855_100012743
1303 Ga0068855_100137200
1304 Ga0068855_100687275
1305 Ga0070664_100009338
1306 Ga0068857_100000047
1307 Ga0068857_100007716
1308 Ga0068854_100003161
1309 Ga0068856_100000505
1310 Ga0068856_100001905
1311 Ga0068856_100037113
1312 Ga0068856_100079646
1313 Ga0068856_100264580
1314 Ga0070702_100001524
1315 Ga0068852_100003513
1316 Ga0068852_100070713
1317 Ga0068852_100160030
1318 Ga0068852_100213957
1319 Ga0068852_100678299
1320 Ga0068852_100749814
1321 Ga0068852_100808544
1322 Ga0068852_100912487
1323 Ga0068859_100011991
1324 Ga0068864_100000931
1325 Ga0068864_100347775
1326 Ga0068866_10000077
1327 Ga0068861_100004701
1328 Ga0068861_100420383
1329 Ga0068870_10000037
1330 Ga0068863_100000543
1331 Ga0068863_100155215
1332 Ga0068858_100002073
1333 Ga0068860_100006167
1334 Ga0068860_100571824
1335 Ga0068862_100000879
1336 Ga0068862_100033399
1337 Ga0081455_10000007
1338 Ga0081455_10005572
1339 Ga0081455_10015842
1340 Ga0081455_10097327
1341 Ga0081538_10005025
1342 Ga0081540_1001710
1343 Ga0081540_1003262
1344 Ga0081540_1003848
1345 Ga0081540_1008449
1346 Ga0081540_1014536
1347 Ga0081540_1018429
1348 Ga0081540_1034995
1349 Ga0081539_10000199
1350 Ga0081539_10000932
1351 Ga0070717_10028863
1352 Ga0070717_10118670
1353 Ga0070717_10133638
1354 Ga0070717_10528206
1355 Ga0070717_10554629
1356 Ga0075365_10011197
1357 Ga0075365_10160675
1358 Ga0075365_10211564
1359 Ga0075368_10018373
1360 Ga0075363_100037702
1361 Ga0075364_10009608
1362 Ga0075432_10014621
1363 Ga0075432_10026570
1364 Ga0070715_10202716
1365 Ga0070715_10278538
1366 Ga0070716_100006210
1367 Ga0070716_100507809
1368 Ga0070712_100011349
1369 Ga0070712_100016142
1370 Ga0070712_100138048
1371 Ga0070712_100441173
1372 Ga0075362_10070669
1373 Ga0075367_10005301
1374 Ga0075367_10054630
1375 Ga0075367_10073200
1376 Ga0075367_10095861
1377 Ga0075367_10110787
1378 Ga0075367_10111473
1379 Ga0075369_10048242
1380 Ga0075369_10059901
1381 Ga0075366_10009913
1382 Ga0097621_100000416
1383 Ga0075370_10020997
1384 Ga0075370_10023683
1385 Ga0068871_100000249
1386 Ga0068871_100088776
1387 Ga0075428_100112281
1388 Ga0075428_100195241
1389 Ga0075428_100400968
1390 Ga0075430_100003208
1391 Ga0075430_100724735
1392 Ga0075431_100010935
1393 Ga0075431_100193623
1394 Ga0075431_100654580
1395 Ga0075433_10001150
1396 Ga0075433_10020495
1397 Ga0075433_10454385
1398 Ga0075434_100003092
1399 Ga0075434_100021891
1400 Ga0075434_100026586
1401 Ga0075429_100001089
1402 Ga0075429_100167948
1403 Ga0068865_100000248
1404 Ga0068865_100190361
1405 Ga0068865_100310605
1406 Ga0097620_100011991
1407 Ga0099824_1009878
1408 Ga0075435_100004999
1409 Ga0075435_100043198
1410 Ga0075435_100202173
1411 Ga0099794_10005449
1412 Ga0099795_10000494
1413 Ga0105244_10030241
1414 Ga0105250_10053651
1415 Ga0105240_10004584
1416 Ga0105240_10014611
1417 Ga0105240_10025786
1418 Ga0111539_10002489
1419 Ga0111539_10002685
1420 Ga0111539_10005685
1421 Ga0111539_10469478
1422 Ga0105245_10004150
1423 Ga0105245_10068796
1424 Ga0105245_10474246
1425 Ga0105247_10017876
1426 Ga0114129_10000908
1427 Ga0114129_10045722
1428 Ga0114129_10050741
1429 Ga0114129_10256316
1430 Ga0114129_10484689
1431 Ga0114129_10633574
1432 Ga0105243_10001705
1433 Ga0105243_10019792
1434 Ga0105241_10002306
1435 Ga0105241_10121376
1436 Ga0105241_10481166
1437 Ga0105241_10659342
1438 Ga0105242_10003502
1439 Ga0105242_10116924
1440 Ga0105248_10005936
1441 Ga0105248_10084071
1442 Ga0105248_10097795
1443 Ga0105248_10161356
1444 Ga0105237_10013233
1445 Ga0105237_10065971
1446 Ga0105237_10067888
1447 Ga0105237_10092072
1448 Ga0105237_10246667
1449 Ga0105237_10629259
1450 Ga0105238_10045534
1451 Ga0105249_10000476
1452 Ga0105249_10177455
1453 Ga0099796_10001674
1454 Ga0105239_10005274
1455 Ga0105239_10007529
1456 Ga0105239_10036783
1457 Ga0105239_10047313
1458 Ga0105239_10085761
1459 Ga0105239_10119022
1460 Ga0105239_10394303
1461 Ga0105239_10430613
1462 Ga0105246_10000057
1463 Ga0105246_10079117
1464 Ga0105246_10178660
1465 Ga0157373_10045343
1466 Ga0157371_10210214
1467 Ga0157374_10004809
1468 Ga0157378_10006604
1469 Ga0157378_10205275
1470 Ga0163162_10001937
1471 Ga0163162_10109294
1472 Ga0163162_10460225
1473 Ga0157372_10009498
1474 Ga0157372_10223159
1475 Ga0157375_10003994
1476 Ga0157375_10016002
1477 Ga0157375_10209236
1478 Ga0157375_10278650
1479 Ga0157375_10421712
1480 Ga0163163_10003757
1481 Ga0163163_10013453
1482 Ga0157380_10002362
1483 Ga0182008_10277534
1484 Ga0157377_10001240
1485 Ga0157379_10000293
1486 Ga0157376_10000531
1487 Ga0163161_10000209
1488 Ga0214544_1000001
1489 Ga0214542_1000065
1490 Ga0214542_1040954
1491 Ga0214545_1000003
1492 Ga0214543_1000002
1493 Ga0213872_10136594
1494 Ga0213874_10032848
1495 Ga0213876_10002386
1496 Ga0213876_10127427
1497 Ga0213876_10229112
1498 Ga0213875_10110282
1499 Ga0207425_1003825
1500 Ga0209677_100977
1501 Ga0209677_105736
1502 Ga0209148_1001125
1503 Ga0209233_1001284
1504 Ga0209233_1006642
1505 Ga0207666_1000011
1506 Ga0207666_1004198
1507 Ga0209455_1001857
1508 Ga0209455_1002722
1509 Ga0209455_1005768
1510 Ga0209673_1060169
1511 Ga0209130_1000348
1512 Ga0207673_1002229
1513 Ga0209564_1005319
1514 Ga0209564_1006162
1515 Ga0209758_1000011
1516 Ga0209758_1000720
1517 Ga0209758_1001547
1518 Ga0209758_1011623
1519 Ga0209758_1024578
1520 Ga0209256_1006935
1521 Ga0209256_1016531
1522 Ga0207426_1000212
1523 Ga0207426_1000552
1524 Ga0207426_1005997
1525 Ga0207426_1015663
1526 Ga0209257_1001276
1527 Ga0209257_1016540
1528 Ga0207697_10000044
1529 Ga0207697_10005272
1530 Ga0207697_10037963
1531 Ga0207656_10019781
1532 Ga0207656_10081117
1533 Ga0207653_10001246
1534 Ga0207653_10003208
1535 Ga0207682_10000260
1536 Ga0207642_10001373
1537 Ga0207710_10008871
1538 Ga0207688_10000723
1539 Ga0207688_10216145
1540 Ga0207680_10004972
1541 Ga0207680_10032291
1542 Ga0207680_10115834
1543 Ga0207680_10236266
1544 Ga0207647_10003122
1545 Ga0207647_10006248
1546 Ga0207647_10008700
1547 Ga0207647_10047676
1548 Ga0207685_10104404
1549 Ga0207699_10014219
1550 Ga0207699_10029949
1551 Ga0207645_10000281
1552 Ga0207643_10000012
1553 Ga0207684_10372117
1554 Ga0207684_10474748
1555 Ga0207654_10002060
1556 Ga0207654_10054694
1557 Ga0207654_10099409
1558 Ga0207654_10119217
1559 Ga0207707_10000551
1560 Ga0207707_10001093
1561 Ga0207707_10210361
1562 Ga0207695_10000163
1563 Ga0207695_10145704
1564 Ga0207695_10222988
1565 Ga0207671_10055443
1566 Ga0207671_10091800
1567 Ga0207671_10148265
1568 Ga0207693_10011724
1569 Ga0207693_10051713
1570 Ga0207693_10162005
1571 Ga0207693_10275102
1572 Ga0207693_10331519
1573 Ga0207663_10013388
1574 Ga0207663_10076746
1575 Ga0207663_10412720
1576 Ga0207660_10000992
1577 Ga0207660_10077022
1578 Ga0207662_10000123
1579 Ga0207662_10059002
1580 Ga0207662_10073039
1581 Ga0207657_10000358
1582 Ga0207657_10073133
1583 Ga0207657_10118824
1584 Ga0207649_10000545
1585 Ga0207649_10230066
1586 Ga0207649_10387089
1587 Ga0207649_10409757
1588 Ga0207652_10004318
1589 Ga0207652_10009869
1590 Ga0207652_10121046
1591 Ga0207681_10000286
1592 Ga0207681_10032000
1593 Ga0207650_10006950
1594 Ga0207659_10000023
1595 Ga0207687_10000149
1596 Ga0207700_10211876
1597 Ga0207700_10227469
1598 Ga0207664_10018761
1599 Ga0207664_10254974
1600 Ga0207644_10000724
1601 Ga0207690_10000203
1602 Ga0207690_10057188
1603 Ga0207706_10002188
1604 Ga0207706_10028672
1605 Ga0207706_10127159
1606 Ga0207706_10185280
1607 Ga0207686_10007108
1608 Ga0207686_10080323
1609 Ga0207709_10000607
1610 Ga0207709_10039610
1611 Ga0207670_10000125
1612 Ga0207669_10000357
1613 Ga0207704_10001003
1614 Ga0207704_10201670
1615 Ga0207665_10014167
1616 Ga0207665_10043517
1617 Ga0207665_10082651
1618 Ga0207665_10146124
1619 Ga0207665_10231475
1620 Ga0207691_10000256
1621 Ga0207691_10128718
1622 Ga0207691_10217610
1623 Ga0207691_10385018
1624 Ga0207711_10008837
1625 Ga0207711_10360137
1626 Ga0207689_10000008
1627 Ga0207661_10000104
1628 Ga0207679_10000196
1629 Ga0207679_10040903
1630 Ga0207679_10308220
1631 Ga0207667_10023002
1632 Ga0207667_10124933
1633 Ga0207667_10128470
1634 Ga0207667_10165639
1635 Ga0207667_10512594
1636 Ga0207651_10001000
1637 Ga0207712_10000156
1638 Ga0207712_10684860
1639 Ga0207668_10000251
1640 Ga0207668_10232309
1641 Ga0207640_10000157
1642 Ga0207640_10186223
1643 Ga0207640_10317462
1644 Ga0207658_10001085
1645 Ga0207658_10829230
1646 Ga0207677_10000609
1647 Ga0207677_10514999
1648 Ga0207703_10003859
1649 Ga0207703_10270043
1650 Ga0207639_10002440
1651 Ga0207639_10035687
1652 Ga0207639_10054642
1653 Ga0207639_10169704
1654 Ga0207639_10629026
1655 Ga0207678_10004329
1656 Ga0207678_10018630
1657 Ga0207678_10020490
1658 Ga0207678_10055408
1659 Ga0207708_10002782
1660 Ga0207708_10017335
1661 Ga0207702_10000127
1662 Ga0207702_10003955
1663 Ga0207641_10473589
1664 Ga0207648_10005563
1665 Ga0207648_10022367
1666 Ga0207676_10003560
1667 Ga0207676_10200740
1668 Ga0207676_10414345
1669 Ga0207674_10008031
1670 Ga0207674_10009174
1671 Ga0207674_10175551
1672 Ga0207675_100000604
1673 Ga0207675_100335833
1674 Ga0207675_100789176
1675 Ga0207683_10000006
1676 Ga0207683_10067537
1677 Ga0207683_10731678
1678 Ga0207698_10000378
1679 Ga0207698_10038120
1680 Ga0207698_10104322
1681 Ga0207698_10511362
1682 Ga0209389_1000186
1683 Ga0209389_1000261
1684 Ga0209589_1001077
1685 Ga0209489_100176
1686 Ga0209489_116724
1687 Ga0209489_116725
1688 Ga0209700_101165
1689 Ga0210002_1001101
1690 Ga0209588_1007749
1691 Ga0209971_1004999
1692 Ga0209966_1004248
1693 Ga0209998_10000566
1694 Ga0209974_10002617
1695 Ga0207428_10000165
1696 Ga0207428_10000446
1697 Ga0207428_10001251
1698 Ga0268266_10002993
1699 Ga0268266_10023620
1700 Ga0268266_10490417
1701 Ga0268266_10534930
1702 Ga0268265_10001687
1703 Ga0268265_10044616
1704 Ga0268264_10002029
1705 Ga0265337_1002902
1706 Ga0265326_10022293
1707 Ga0265334_10017005
1708 Ga0265323_10003921
1709 Ga0265322_10023262
1710 Ga0265336_10000921
1711 Ga0265338_10000085
1712 Ga0265324_10032812
1713 Ga0307513_10106256
1714 Ga0307408_100188478
1715 Ga0265314_10001137
1716 Ga0307516_10045830
1717 Ga0307415_100069955
1718 Ga0307510_10052296
1719 Ga0373930_0000066
1720 Ga0373948_0000083
1721 Ga0373950_0002205
1722 Ga0373958_0000149
1723 Ga0373958_0000888
1724 Ga0373959_0000484
1725 Ga0373938_0000806
1726 Ga0373938_0000911
1727 Ga0373938_0034030
1728 Ga0373928_0024397
1729 Ga0373928_0057184
1730 Ga0373940_0001846
1731 Ga0373940_0002395
1732 Ga0373949_0001224
1733 Ga0373949_0002075
1734 Ga0373951_0000469
1735 Ga0373951_0000642
1736 Ga0373952_0000323
1737 Ga0373952_0001223
1738 Ga0373932_0000757
1739 Ga0373932_0001683
1740 Ga0373932_0101858
1741 Ga0373939_0000487
1742 Ga0373939_0001486
1743 Ga0373941_0000083
1744 Ga0373941_0001809
1745 Ga0373960_0000185
1746 Ga0373960_0000330
1747 Ga0373943_0085146
1748 Ga0373946_0063025
1749 Ga0373942_0001462
1750 Ga0373961_0000569
1751 Ga0373961_0006670
1752 Ga0373962_0000149
1753 Ga0373931_0001480
1754 Ga0373931_0001492
1755 Ga0373931_0002244
1756 Ga0373931_0118124
1757 Ga0373927_0181305
1758 Ga0373933_0000342
1759 Ga0373933_0043948
1760 Ga0373947_0052004
1761 Ga0373937_0029802
1762 Ga0373937_0051220
1763 Ga0373937_0332732
1764 Ga0373925_0010857
1765 Ga0373925_0109741
1766 Ga0373925_0797154
1767 Ga0395899_0037355
1768 Ga0395899_0319074
1769 Ga0395900_0004076
1770 Ga0395900_0193180
1771 Ga0395900_0198481
1772 Ga0395898_0024467
1773 Ga0395898_0393254
1774 Ga0395905_0005831
1775 Ga0395905_0106587
1776 Ga0436364_0027260
1777 Ga0436364_0673913
1778 Ga0395901_0790983
1779 Ga0242420_009756
1780 Ga0436365_0838985
1781 Ga0436365_1236461
1782 Ga0436365_1353610
1783 Ga0436365_1439170
1784 Ga0436365_1531367
1785 Ga0436365_1711180
1786 Ga0436360_0399254
1787 Ga0436360_1070844
1788 Ga0436361_1162310
1789 Ga0436363_0117807
1790 Ga0436363_1314815
1791 Ga0436363_1489710
1792 Ga0436363_1588616
1793 Ga0436362_0035727
1794 Ga0451795_1428191
1795 Ga0451853_3688248
1796 Ga0439448_0063918
1797 Ga0439455_0050506
1798 Ga0439460_0022908
1799 Ga0451577_0168912
1800 Ga0439440_0065683
1801 Ga0466969_0008653
1802 Ga0466972_0000379
1803 Ga0466972_0019744
1804 Ga0466972_0021835
1805 Ga0466966_0001791
1806 Ga0466961_0000005
1807 Ga0466963_0004348
1808 Ga0466964_0080834
1809 Ga0453684_0069913
1810 Ga0466957_0057848
1811 Ga0466960_0126827
1812 Ga0466959_0001046
1813 Ga0466967_0268064
1814 Ga0495592_0014234
1815 Ga0495592_0426452
1816 Ga0495603_0014368
1817 Ga0495603_0267579
1818 Ga0495638_0022206
1819 Ga0495651_0002090
1820 Ga0495651_0016305
1821 Ga0495651_0065963
1822 Ga0495651_0104547
1823 Ga0495653_0037883
1824 Ga0495605_0093891
1825 Ga0495639_0234024
1826 Ga0495662_0037504
1827 Ga0495664_0134266
1828 Ga0495594_0073850
1829 Ga0495606_0048065
1830 Ga0495606_0049588
1831 Ga0495608_0016921
1832 Ga0495610_0042411
1833 Ga0495610_0057299
1834 Ga0495628_0006810
1835 Ga0495630_0151915
1836 Ga0495632_0026476
1837 Ga0495643_0008122
1838 Ga0495648_0065812
1839 Ga0495648_0087505
1840 Ga0495652_0009617
1841 Ga0495652_0158347
1842 Ga0495640_0035624
1843 Ga0495640_0051480
1844 Ga0495640_0061637
1845 Ga0495587_0126564
1846 Ga0495597_0059087
1847 Ga0495645_0009151
1848 Ga0495667_0003359
1849 Ga0495667_0048501
1850 Ga0495668_0097562
1851 Ga0495668_0108936
1852 Ga0495634_0259188
1853 Ga0495625_0060472
1854 Ga0495635_0043877
1855 Ga0495657_0010047
1856 Ga0495657_0078426
1857 Ga0495657_0157252
1858 Ga0495657_0265551
1859 Ga0495599_0012264
1860 Ga0495623_0032519
1861 Ga0495646_0040929
1862 Ga0495613_0098387
1863 Ga0495649_0041408
1864 Ga0495649_0157647
1865 Ga0495600_0008131
1866 Ga0495600_0322101
1867 Ga0495581_0065223
1868 Ga0495604_0004129
1869 Ga0495604_0062070
1870 Ga0495674_0005198
1871 Ga0495674_0026719
1872 Ga0495674_0592592
1873 Ga0495672_0236905
1874 Ga0495680_0005133
1875 Ga0495683_0062226
1876 Ga0495683_0181260
1877 Ga0495687_005448
1878 Ga0495686_0302681
1879 Ga0495602_0028597
1880 Ga0496100_0006059
1881 Ga0496100_0018610
1882 Ga0496100_0084215
1883 Ga0496101_0000464
1884 Ga0496101_0034760
1885 Ga0496101_0293207
1886 Ga0496102_0001120
1887 Ga0496102_0048143
1888 Ga0496102_0213049
1889 Ga0496102_0243784
1890 Ga0496103_0000611
1891 Ga0496103_0044090
1892 Ga0496104_0000299
1893 Ga0496104_0147953
1894 Ga0496104_0147977
1895 Ga0496104_0186552
1896 Ga0496104_0330291
1897 Ga0496104_0340191
1898 Ga0496105_0001270
1899 Ga0496105_0031850
1900 Ga0496105_0392164
1901 Ga0496106_0000541
1902 Ga0496106_0005785
1903 Ga0496106_0041454
1904 Ga0496106_0050538
1905 Ga0496106_0062700
1906 Ga0496106_0433503
1907 Ga0496107_0000493
1908 Ga0496107_0034808
1909 Ga0496107_0189859
1910 Ga0496108_0001251
1911 Ga0496108_0057762
1912 Ga0496108_0065795
1913 Ga0496108_0066535
1914 Ga0496109_0003885
1915 Ga0496109_0030152
1916 Ga0496109_0130851
1917 Ga0496109_0282165
1918 Ga0496110_0026649
1919 Ga0496110_0038036
1920 Ga0496110_0047244
1921 Ga0496110_0232793
1922 Ga0496111_0029164
1923 Ga0496111_0068476
1924 Ga0496111_0121357
1925 Ga0496112_0000045
1926 Ga0496112_0107678
1927 Ga0496112_0450735
1928 Ga0496112_0561461
1929 Ga0496113_0005714
1930 Ga0496113_0020474
1931 Ga0496113_0023321
1932 Ga0496114_0003043
1933 Ga0496114_0006370
1934 Ga0496114_0008753
1935 Ga0496114_0318028
1936 Ga0496114_0440321
1937 Ga0496114_0490373
1938 Ga0496115_0010227
1939 Ga0496115_0192946
1940 Ga0496115_0203999
1941 Ga0496116_0028618
1942 Ga0496116_0131296
1943 Ga0496117_0127632
1944 Ga0496118_0024004
1945 Ga0496118_0034765
1946 Ga0496120_0071107
1947 Ga0496121_0014125
1948 Ga0496121_0094717
1949 Ga0496121_0167506
1950 Ga0496124_0036240
1951 Ga0496124_0051639
1952 Ga0496124_0238013
1953 Ga0496125_0034413
1954 Ga0496125_0057850
1955 Ga0496125_0145474
1956 Ga0496126_0015287
1957 Ga0496126_0018065
1958 Ga0496126_0029128
1959 Ga0496126_0079333
1960 Ga0495682_0100188
1961 Ga0501032_0001029
1962 Ga0501032_0159846
1963 Ga0501033_0000163
1964 Ga0501033_0003345
1965 Ga0501033_0010958
1966 Ga0501033_0118293
1967 Ga0501034_0000202
1968 Ga0501036_0000021
1969 Ga0501036_0139651
1970 Ga0501036_0222885
1971 Ga0501036_0750571
1972 Ga0501037_0002107
1973 Ga0501037_0002687
1974 Ga0501038_0000226
1975 Ga0501038_0008947
1976 Ga0501038_0054839
1977 Ga0501039_0001542
1978 Ga0501039_0013937
1979 Ga0501042_0025424
1980 Ga0501042_0412234
1981 Ga0501043_0004017
1982 Ga0501043_0005955
1983 Ga0501043_0129945
1984 Ga0501046_0000354
1985 Ga0501046_0004244
1986 Ga0501047_0000232
1987 Ga0501048_0000050
1988 Ga0501067_0002704
1989 Ga0501067_0007984
1990 Ga0501068_0000430
1991 Ga0501068_0299219
1992 Ga0501069_0004751
1993 Ga0501070_0054610
1994 Ga0501070_0330580
1995 Ga0501071_0007174
1996 Ga0501072_0002675
1997 Ga0501072_0013429
1998 Ga0501072_0263778
1999 Ga0501073_0000329
2000 Ga0501074_0000092
2001 Ga0501076_0018017
2002 Ga0501076_0027275
2003 Ga0501076_0563209
2004 Ga0501077_0091114
2005 Ga0501079_0003108
2006 Ga0501079_0287057
2007 Ga0501079_0328706
2008 Ga0501080_0003432
2009 Ga0501080_0585599
2010 Ga0501081_0188490
2011 Ga0501081_0501503
2012 Ga0501083_0001578
2013 Ga0501035_0000120
2014 Ga0501035_0148468
2015 Ga0501044_0001777
2016 Ga0501044_0006711
2017 Ga0501044_0010872
2018 Ga0501044_0095699
2019 Ga0501044_0242121
2020 Ga0501044_0242223
2021 Ga0501044_0762905
2022 Ga0501045_0168829
2023 nmdc:mga00v17_182013_c1
2024 nmdc:mga00v17_70201_c1
2025 nmdc:mga0yw44_294500_c1
2026 nmdc:mga0yw44_444272_c1
2027 nmdc:mga0k408_46943_c1
2028 nmdc:mga06z11_31376_c1
2029 nmdc:mga06z11_34191_c1
2030 nmdc:mga06z11_56186_c1
2031 nmdc:mga06z11_94615_c1
2032 nmdc:mga04h51_13457_c1
2033 nmdc:mga04h51_90706_c1
2034 nmdc:mga07m45_48107_c1
2035 nmdc:mga07m45_87522_c1
2036 nmdc:mga05p37_102734_c1
2037 nmdc:mga05p37_145573_c1
2038 nmdc:mga05p37_2380_c1
2039 nmdc:mga05p37_2697_c1
2040 nmdc:mga09592_12517_c1
2041 nmdc:mga09592_346752_c1
2042 nmdc:mga0qj67_693_c1
2043 nmdc:mga06r32_1056_c1
2044 nmdc:mga06r32_174488_c1
2045 nmdc:mga08y16_3020_c1
2046 nmdc:mga08y16_3846_c1
2047 nmdc:mga08y16_5716_c1
2048 nmdc:mga0n895_1654_c1
2049 nmdc:mga0n895_291_c1
2050 nmdc:mga0n895_608308_c1
2051 nmdc:mga0rr50_1013_c1
2052 nmdc:mga0rr50_235823_c1
2053 nmdc:mga0rr50_41977_c1
2054 nmdc:mga0rr50_537860_c1
2055 nmdc:mga08x19_135375_c1
2056 nmdc:mga08x19_188735_c1
2057 nmdc:mga0a205_10048_c1
2058 nmdc:mga0a205_4627_c1
2059 nmdc:mga0sz30_14350_c2
2060 Ga0495601_0006208
2061 Ga0495601_0036758
2062 Ga0495601_0087862
2063 Ga0500635_0043319
2064 Ga0495655_0009936
2065 Ga0495595_0016861
2066 Ga0495619_0000628
2067 Ga0495619_0012374
2068 Ga0495619_0295381
2069 Ga0500578_0107212
2070 Ga0500643_000047
2071 Ga0500646_0119028
2072 Ga0500647_0116686
2073 Ga0500566_0147200
2074 Ga0500641_0093621
2075 Ga0500556_0020528
2076 Ga0500557_000025
2077 Ga0500562_002601
2078 Ga0500572_000369
2079 Ga0500595_018682
2080 Ga0500608_084709
2081 Ga0500642_0023559
2082 Ga0500652_000151
2083 Ga0500655_020905
2084 Ga0500559_0000301
2085 Ga0500568_0059863
2086 Ga0500577_0000162
2087 Ga0500577_0107331
2088 Ga0500590_039433
2089 Ga0500604_0145674
2090 Ga0500616_0000028
2091 Ga0500616_0053126
2092 Ga0500616_0157140
2093 Ga0500620_031443
2094 Ga0500622_0048879
2095 Ga0500627_0024855
2096 Ga0500638_188735
2097 Ga0500636_0002008
2098 Ga0500636_0014131
2099 Ga0500636_0029309
2100 Ga0500636_0224195
2101 Ga0500576_010498
2102 Ga0500576_152348
2103 Ga0500645_032246
2104 Ga0500645_035473
2105 Ga0500596_004533
2106 Ga0500601_000180
2107 Ga0501084_0007176
2108 Ga0501084_0070951
2109 Ga0501084_0282148
2110 Ga0501082_0003391
2111 Ga0501082_0130285
2112 Ga0530510_0056547
2113 Ga0530510_0206472
2114 2507507394
2115 2508541447
2116 2508693226
2117 2508725421
2118 2509080184
2119 2511395126
2120 2513621545
2121 2513636975
2122 2513652064
2123 2513693050
2124 2513704653
2125 2513879861
2126 2514011593
2127 2515629791
2128 2528850500
2129 2617351899
2130 2617373011
2131 2723843314
2132 2738743609
2133 2739352516
2134 2776261625
2135 2793061139
2136 2805918514
2137 2818236862
2138 2824602772
2139 2824613849
2140 2824621278
2141 2824630441
2142 2824639642
2143 2824651684
2144 2824658204
2145 2824670574
2146 2824678978
2147 2824681511
2148 2824695559
2149 2824702375
2150 2824709192
2151 2824721825
2152 2824727143
2153 2824736544
2154 2824746674
2155 2824757771
2156 2824768717
2157 2824777248
2158 2835316730
2159 2838127247
2160 2841947488
2161 2841956242
2162 2841962558
2163 2841974371
2164 2841980740
2165 2841987347
2166 2842040944
2167 2842046111
2168 2844320272
2169 2847937594
2170 2847948036
2171 2849078136
2172 2857511265
2173 2874592844
2174 2874611798
2175 2874614405
2176 2874623796
2177 2874633046
2178 2874650692
2179 2876768493
2180 2876776304
2181 2876822264
2182 2879080393
2183 2879084090
2184 2879103546
2185 2879133449
2186 2879145772
2187 2881370234
2188 2881667148
2189 2885370260
2190 2885418552
2191 2888385785
2192 2888392518
2193 2888425882
2194 2894233739
2195 2903731552
2196 2904674025
2197 2904711619
2198 2906608339
2199 2906634282
2200 2906645163
2201 2908781462
2202 2922376027
2203 2922393700
2204 2929622859
2205 2929631396
2206 2932785278
2207 2932810311
2208 2932821884
2209 2932831847
2210 2933584936
2211 2935610228
2212 2935619466
2213 2935638446
2214 2935651203
2215 2935659383
2216 2935666702
2217 2935682107
2218 2935691233
2219 2935694338
2220 2935703450
2221 2935718614
2222 2935727406
2223 2935736109
2224 2935745489
2225 2935755870
2226 2935760871
2227 2935771230
2228 2935786069
2229 2935797748
2230 2935801589
2231 2935815003
2232 2935823389
2233 2935827940
2234 2935842145
2235 2935848873
2236 2935858218
2237 2935868123
2238 2935873854
2239 2935912997
2240 2935924430
2241 2935930110
2242 2935939011
2243 2935945958
2244 2935955295
2245 2935962992
2246 2935972334
2247 2935976260
2248 2935986247
2249 2935993222
2250 2936003159
2251 2936013798
2252 2936022678
2253 2936033269
2254 2936040353
2255 2936048904
2256 2936060519
2257 2940562155
2258 2941531478
2259 2941542194
2260 3005488544
2261 3005508091
2262 3005588365
2263 3005600645
2264 3005716085
2265 3005723422
2266 8006985037
2267 8016520341
2268 8016533537
2269 8016546767
2270 8016555350
2271 8016563709
2272 8016576083
2273 8016594723
2274 8016601441
2275 8016608661
2276 8016616213
2277 8016625029
2278 8016638870
2279 8017065229
2280 8019533329
2281 8019552065
2282 8019584624
2283 8019592396
2284 8019598882
2285 8019609494
2286 8019620101
2287 8019633002
2288 8019660869
2289 8055744779
2290 8056974786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

60

239

0.96

PF01479

S4

S4 domain

5

52

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9735 61 244
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.947 63 244
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9451 6 47
8btr-assembly1.cif.gz_SK giardia ribosome in pre-t hybrid state (d2) 0.9178 7 44
1h3e-assembly1.cif.gz_A-2 tyrosyl-trna synthetase from thermus thermophilus complexed with wild-type trnatyr(gua) and with atp and tyrosinol 0.9043 5 56
ID Description Score Start End Superfamily
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9739 68 243 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9663 61 244 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.947 63 244 3.40.50.150
af_Q4DSJ7_105_180_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9385 6 47 3.10.290.10
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9372 6 47 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A345ZVM5-F1-model_v4 TlyA family RNA methyltransferase 0.9838 3 244 GO:0003723
GO:0008168
GO:0032259
AF-A0A357V0D7-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9826 56 244 GO:0008168
GO:0032259
AF-A0A432H6S4-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9824 59 243 GO:0008168
GO:0032259
AF-A0A7C1B1B0-F1-model_v4 TlyA family RNA methyltransferase 0.9804 67 244 GO:0008168
GO:0032259
AF-A0A221C2H2-F1-model_v4 deleted 0.9801 59 243

Map