F490773
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1145 | 645 | 2291 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10002827|Ga0105240_100028278 |
| Length | 408 |
| Sequence | MRHAVYIRLGNALSALVSSIRPPSVNAAHTNVKNSQPAFRTICQRPLSAKAASATGDIFMKYRTLGRTDIKVSLICLGTMTWGSQNSEAEAHAQLDYAIGQGINFIDTAEGYPVTPVSRETQGKTEEFIGSWLARRGKRDDIIVATKVAGPSRDPVREFRGGNNRLDRRNIEQAIDDSLKRLRTDYVDLYQVHWPDRPVPSFGARGLAQIDDMPEIVPIEETLDALAGLVRAGKVRHVGVSNETPWGVSEYLRLARDQGVPRIASIQNAYNLLNRTFEGGLSEFALREGVGLLAYSPLAGGNLTGKYLGGVIPPGSRRDVAKQFGRYDLPGQGTASARYVAIAHAHGLDPAQMALAYVNSRDFVTANIIGATSMEQLEVNIASTSIVLSPEAVAAIEAVHREIPDPCP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 74 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 89 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 166 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 171 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 172 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 173 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 174 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 175 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 176 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 177 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 178 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 179 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 180 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 181 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 182 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 183 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 184 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 185 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 188 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 189 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 190 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 301 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 302 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 303 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 304 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 305 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 326 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 329 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 330 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 331 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 338 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 340 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 346 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 347 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 348 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 349 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 350 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 351 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 352 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 353 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 354 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 355 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 356 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 357 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 358 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 359 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 360 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 361 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 362 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 363 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 364 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 365 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 366 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 367 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 368 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 369 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 370 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 371 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 372 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 373 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 374 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 375 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 376 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 377 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 378 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 379 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 380 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 381 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 382 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 383 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 384 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 385 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 386 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 387 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 388 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 389 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 390 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 391 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 392 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 393 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 394 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 395 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 396 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 397 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 398 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 399 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 400 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 401 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 402 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 403 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 404 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 405 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 406 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 407 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 408 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 409 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 410 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 411 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 412 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 413 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 414 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 415 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 416 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 417 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 418 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 419 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 420 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 421 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 422 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 423 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 424 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 425 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 426 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 427 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 428 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 429 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 430 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 431 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 432 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 433 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 434 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 435 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 436 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 437 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 438 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 439 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 440 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 441 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 442 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 443 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 444 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 445 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 446 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 447 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 448 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 449 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 450 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 451 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 452 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 453 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 454 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 455 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 456 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 457 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 458 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 459 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 460 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 461 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 462 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 463 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 464 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 465 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 466 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 467 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 468 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 469 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 470 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 471 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 472 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 473 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 474 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 475 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 476 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 477 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 478 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 479 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 480 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 481 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 482 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 483 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 484 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 485 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 486 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 487 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 488 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 489 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 490 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 491 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 492 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 493 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 494 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 495 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 496 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 497 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 498 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 499 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 500 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 501 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 502 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 503 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 504 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 505 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 506 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 507 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 508 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 509 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 510 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 511 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 512 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 513 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 514 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 515 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 516 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 517 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 518 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 519 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 520 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 521 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 522 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 523 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 524 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 525 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 526 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 527 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 528 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 529 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 530 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 531 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 532 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 533 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 534 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 535 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 536 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 537 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 538 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 539 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 540 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 541 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 542 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 543 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 544 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 545 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 546 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 547 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 548 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 549 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 550 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 551 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 552 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 553 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 554 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 555 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 556 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 557 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 558 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 559 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 560 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 561 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 562 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 563 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 564 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 565 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 566 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 567 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 568 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 569 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 570 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 571 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 572 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 573 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 574 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 575 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 576 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 577 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 578 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 579 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 580 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 581 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 582 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 583 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 584 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 585 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 586 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 587 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 588 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 589 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 590 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 591 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 592 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 593 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 594 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 595 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 596 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 597 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 598 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 599 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 600 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 601 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 602 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 603 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 604 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 605 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 606 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 607 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 608 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 609 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 610 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 611 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 612 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 613 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 614 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 615 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 616 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 617 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 618 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 619 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 620 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 621 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 622 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 623 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 624 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 625 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 626 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 627 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 628 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 629 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 630 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 631 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 632 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 633 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 634 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 635 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 636 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 637 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 638 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 639 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 640 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 641 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 642 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 643 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 644 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 645 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.71 |
| Metatranscriptomes | 0 |
| Isolates | 26.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.76 |
| Nodule | 15.81 |
| Rhizoplane | 3.23 |
| Rhizosphere | 48.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10002827 | 3300009093 | Bacteria | 27459 |
| 2 | SwRhRL2b_contig_1380016 | 2162886007 | Bacteria | 5388 |
| 3 | JGI24741J21665_1001367 | 3300001915 | Bacteria | 7046 |
| 4 | JGI24741J21665_1002735 | 3300001915 | Bacteria | 4467 |
| 5 | JGI24740J21852_10000071 | 3300001979 | Bacteria | 33773 |
| 6 | JGI24740J21852_10001830 | 3300001979 | Bacteria | 9737 |
| 7 | JGI24739J22299_10001942 | 3300001989 | Bacteria | 7905 |
| 8 | JGI24739J22299_10012850 | 3300001989 | Bacteria | 3067 |
| 9 | JGI24737J22298_10005303 | 3300001990 | Bacteria | 4458 |
| 10 | JGI24737J22298_10010517 | 3300001990 | Bacteria | 3053 |
| 11 | JGI24737J22298_10023788 | 3300001990 | Bacteria | 1942 |
| 12 | JGI24735J21928_10000180 | 3300002067 | Bacteria | 22468 |
| 13 | JGI24735J21928_10000289 | 3300002067 | Bacteria | 17537 |
| 14 | JGI24735J21928_10000371 | 3300002067 | Bacteria | 15683 |
| 15 | JGI24735J21928_10008786 | 3300002067 | Bacteria | 3259 |
| 16 | JGI24738J21930_10000001 | 3300002075 | Bacteria | 133921 |
| 17 | JGI24738J21930_10003173 | 3300002075 | Bacteria | 4202 |
| 18 | JGI25156J39149_1000859 | 3300002705 | Bacteria | 15133 |
| 19 | JGI25156J39149_1001993 | 3300002705 | Bacteria | 7826 |
| 20 | JGI25156J39149_1005504 | 3300002705 | Bacteria | 3633 |
| 21 | JGI25158J39367_1000407 | 3300002739 | Bacteria | 8986 |
| 22 | JGI25152J39213_1000623 | 3300002773 | Bacteria | 18832 |
| 23 | JGI25152J39213_1003008 | 3300002773 | Bacteria | 5961 |
| 24 | JGI25150J39212_1000033 | 3300002774 | Bacteria | 96269 |
| 25 | JGI25150J39212_1001462 | 3300002774 | Bacteria | 6581 |
| 26 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 27 | JGI25151J46595_10015298 | 3300003187 | Bacteria | 3386 |
| 28 | JGI25165J46597_1001483 | 3300003214 | Bacteria | 12078 |
| 29 | JGI25165J46597_1002550 | 3300003214 | Bacteria | 5674 |
| 30 | JGI25153J46596_10000563 | 3300003215 | Bacteria | 22953 |
| 31 | JGI25153J46596_10009883 | 3300003215 | Bacteria | 4375 |
| 32 | rootH1_10038444 | 3300003316 | Bacteria | 1486 |
| 33 | rootH1_10038444 | 3300003323 | Bacteria | 3156 |
| 34 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 35 | JGI25160J50197_1000064 | 3300003354 | Bacteria | 115987 |
| 36 | JGI25160J50197_1012089 | 3300003354 | Bacteria | 3023 |
| 37 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 38 | Ga0055533_1000218 | 3300003756 | Bacteria | 41729 |
| 39 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 40 | Ga0055532_1000255 | 3300003758 | Bacteria | 36553 |
| 41 | Ga0055532_1000388 | 3300003758 | Bacteria | 22093 |
| 42 | Ga0055532_1000436 | 3300003758 | Bacteria | 19713 |
| 43 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 44 | Ga0055527_1000224 | 3300003760 | Bacteria | 36553 |
| 45 | Ga0055527_1004258 | 3300003760 | Bacteria | 1990 |
| 46 | Ga0055527_1007478 | 3300003760 | Bacteria | 1332 |
| 47 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 48 | Ga0055535_1000474 | 3300003761 | Bacteria | 36553 |
| 49 | Ga0055535_1000693 | 3300003761 | Bacteria | 25976 |
| 50 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 51 | Ga0055542_1000673 | 3300003762 | Bacteria | 27607 |
| 52 | Ga0055542_1006731 | 3300003762 | Bacteria | 2420 |
| 53 | Ga0055529_1000026 | 3300003763 | Bacteria | 293254 |
| 54 | Ga0055529_1000608 | 3300003763 | Bacteria | 27404 |
| 55 | Ga0055529_1005398 | 3300003763 | Bacteria | 1856 |
| 56 | Ga0055526_1026225 | 3300003771 | Bacteria | 1845 |
| 57 | Ga0055524_1003638 | 3300003775 | Bacteria | 7408 |
| 58 | Ga0055524_1014079 | 3300003775 | Bacteria | 2983 |
| 59 | Ga0055524_1026782 | 3300003775 | Bacteria | 1771 |
| 60 | Ga0055528_1003635 | 3300003790 | Bacteria | 7662 |
| 61 | Ga0055528_1005083 | 3300003790 | Bacteria | 6203 |
| 62 | Ga0055528_1007761 | 3300003790 | Bacteria | 4695 |
| 63 | Ga0055528_1012526 | 3300003790 | Bacteria | 3283 |
| 64 | Ga0055540_1008490 | 3300003792 | Bacteria | 3692 |
| 65 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 66 | Ga0065165_1000325 | 3300005262 | Bacteria | 77723 |
| 67 | Ga0065165_1003987 | 3300005262 | Bacteria | 9651 |
| 68 | Ga0065704_10001512 | 3300005289 | Bacteria | 9147 |
| 69 | Ga0065704_10071185 | 3300005289 | Bacteria | 12615 |
| 70 | Ga0070658_10010072 | 3300005327 | Bacteria | 7589 |
| 71 | Ga0070658_10052541 | 3300005327 | Bacteria | 3305 |
| 72 | Ga0070670_100042569 | 3300005331 | Bacteria | 3904 |
| 73 | Ga0070666_10014803 | 3300005335 | Bacteria | 4971 |
| 74 | Ga0070666_10307719 | 3300005335 | Bacteria | 1129 |
| 75 | Ga0070660_100000509 | 3300005339 | Bacteria | 25999 |
| 76 | Ga0070660_100001423 | 3300005339 | Bacteria | 16302 |
| 77 | Ga0070668_100000019 | 3300005347 | Bacteria | 98356 |
| 78 | Ga0070668_100008368 | 3300005347 | Bacteria | 7683 |
| 79 | Ga0070668_100062139 | 3300005347 | Bacteria | 2893 |
| 80 | Ga0070669_100016598 | 3300005353 | Bacteria | 5256 |
| 81 | Ga0070671_100009450 | 3300005355 | Bacteria | 7827 |
| 82 | Ga0070671_100033072 | 3300005355 | Bacteria | 4275 |
| 83 | Ga0070659_100000015 | 3300005366 | Bacteria | 176475 |
| 84 | Ga0070659_100036438 | 3300005366 | Bacteria | 3836 |
| 85 | Ga0070667_100000094 | 3300005367 | Bacteria | 111140 |
| 86 | Ga0070667_100102079 | 3300005367 | Bacteria | 2478 |
| 87 | Ga0070667_100148201 | 3300005367 | Bacteria | 2059 |
| 88 | Ga0070663_100000602 | 3300005455 | Bacteria | 19214 |
| 89 | Ga0070663_100169386 | 3300005455 | Bacteria | 1687 |
| 90 | Ga0070662_100000624 | 3300005457 | Bacteria | 21403 |
| 91 | Ga0068853_100001013 | 3300005539 | Bacteria | 19779 |
| 92 | Ga0068853_100001046 | 3300005539 | Bacteria | 19566 |
| 93 | Ga0068853_100030570 | 3300005539 | Bacteria | 4550 |
| 94 | Ga0070665_100001576 | 3300005548 | Bacteria | 26316 |
| 95 | Ga0070665_100052647 | 3300005548 | Bacteria | 4082 |
| 96 | Ga0070665_100208920 | 3300005548 | Bacteria | 1953 |
| 97 | Ga0068855_100009188 | 3300005563 | Bacteria | 11937 |
| 98 | Ga0068855_100009504 | 3300005563 | Bacteria | 11742 |
| 99 | Ga0068855_100011395 | 3300005563 | Bacteria | 10738 |
| 100 | Ga0068855_100161877 | 3300005563 | Bacteria | 2539 |
| 101 | Ga0068855_100224865 | 3300005563 | Bacteria | 2103 |
| 102 | Ga0070664_100291744 | 3300005564 | Bacteria | 1473 |
| 103 | Ga0068857_100004355 | 3300005577 | Bacteria | 11954 |
| 104 | Ga0068857_100036828 | 3300005577 | Bacteria | 4334 |
| 105 | Ga0068854_100012363 | 3300005578 | Bacteria | 5588 |
| 106 | Ga0068854_100040155 | 3300005578 | Bacteria | 3300 |
| 107 | Ga0068856_100000374 | 3300005614 | Bacteria | 49224 |
| 108 | Ga0068852_100014797 | 3300005616 | Bacteria | 6024 |
| 109 | Ga0068859_100092607 | 3300005617 | Bacteria | 3074 |
| 110 | Ga0068851_10002777 | 3300005834 | Bacteria | 7714 |
| 111 | Ga0068863_100000057 | 3300005841 | Bacteria | 123606 |
| 112 | Ga0068863_100001297 | 3300005841 | Bacteria | 24954 |
| 113 | Ga0068863_100041355 | 3300005841 | Bacteria | 4382 |
| 114 | Ga0068860_100000623 | 3300005843 | Bacteria | 41934 |
| 115 | Ga0068860_100004802 | 3300005843 | Bacteria | 13762 |
| 116 | Ga0068860_100101614 | 3300005843 | Bacteria | 2743 |
| 117 | Ga0068862_100000194 | 3300005844 | Bacteria | 67126 |
| 118 | Ga0068862_100048804 | 3300005844 | Bacteria | 3615 |
| 119 | Ga0075365_10001318 | 3300006038 | Bacteria | 11080 |
| 120 | Ga0075365_10009667 | 3300006038 | Bacteria | 5565 |
| 121 | Ga0075368_10000019 | 3300006042 | Bacteria | 40365 |
| 122 | Ga0075363_100006825 | 3300006048 | Bacteria | 5218 |
| 123 | Ga0075363_100014895 | 3300006048 | Bacteria | 3812 |
| 124 | Ga0075362_10003928 | 3300006177 | Bacteria | 5282 |
| 125 | Ga0075367_10000795 | 3300006178 | Bacteria | 12428 |
| 126 | Ga0075369_10000498 | 3300006186 | Bacteria | 12221 |
| 127 | Ga0075366_10008922 | 3300006195 | Bacteria | 5588 |
| 128 | Ga0075370_10004487 | 3300006353 | Bacteria | 6787 |
| 129 | Ga0075370_10010880 | 3300006353 | Bacteria | 4768 |
| 130 | Ga0075370_10014093 | 3300006353 | Bacteria | 4258 |
| 131 | Ga0097620_100092612 | 3300006931 | Bacteria | 3074 |
| 132 | Ga0079104_1011926 | 3300006946 | Bacteria | 2762 |
| 133 | Ga0105251_10000134 | 3300009011 | Bacteria | 74820 |
| 134 | Ga0105251_10000167 | 3300009011 | Bacteria | 67775 |
| 135 | Ga0105251_10001159 | 3300009011 | Bacteria | 22899 |
| 136 | Ga0105251_10002394 | 3300009011 | Bacteria | 14816 |
| 137 | Ga0105251_10004353 | 3300009011 | Bacteria | 9680 |
| 138 | Ga0105251_10031535 | 3300009011 | Bacteria | 2651 |
| 139 | Ga0105244_10043714 | 3300009036 | Bacteria | 2309 |
| 140 | Ga0105240_10001649 | 3300009093 | Bacteria | 37902 |
| 141 | Ga0105240_10001654 | 3300009093 | Bacteria | 37838 |
| 142 | Ga0105240_10002976 | 3300009093 | Bacteria | 26679 |
| 143 | Ga0105240_10010622 | 3300009093 | Bacteria | 12935 |
| 144 | Ga0105240_10020477 | 3300009093 | Bacteria | 8822 |
| 145 | Ga0105240_10054519 | 3300009093 | Bacteria | 5010 |
| 146 | Ga0105240_10075107 | 3300009093 | Bacteria | 4170 |
| 147 | Ga0105247_10003919 | 3300009101 | Bacteria | 9598 |
| 148 | Ga0105247_10038239 | 3300009101 | Bacteria | 2929 |
| 149 | Ga0105241_10017153 | 3300009174 | Bacteria | 5318 |
| 150 | Ga0105241_10121729 | 3300009174 | Bacteria | 2102 |
| 151 | Ga0105237_10011460 | 3300009545 | Bacteria | 9379 |
| 152 | Ga0105237_10087097 | 3300009545 | Bacteria | 3113 |
| 153 | Ga0105238_10026668 | 3300009551 | Bacteria | 5890 |
| 154 | Ga0105249_10000135 | 3300009553 | Bacteria | 96943 |
| 155 | Ga0105249_10194843 | 3300009553 | Bacteria | 1980 |
| 156 | Ga0123341_1000062 | 3300009765 | Bacteria | 45834 |
| 157 | Ga0123342_1014931 | 3300009766 | Bacteria | 7247 |
| 158 | Ga0105239_10001422 | 3300010375 | Bacteria | 31955 |
| 159 | Ga0105239_10011808 | 3300010375 | Bacteria | 9747 |
| 160 | Ga0105239_10044978 | 3300010375 | Bacteria | 4839 |
| 161 | Ga0105246_10181244 | 3300011119 | Unclassified | 1622 |
| 162 | Ga0105246_10235272 | 3300011119 | Bacteria | 1445 |
| 163 | Ga0157373_10000535 | 3300013100 | Bacteria | 29689 |
| 164 | Ga0157373_10001841 | 3300013100 | Bacteria | 16117 |
| 165 | Ga0157371_10003242 | 3300013102 | Bacteria | 14926 |
| 166 | Ga0157371_10006163 | 3300013102 | Bacteria | 9951 |
| 167 | Ga0157370_10001866 | 3300013104 | Bacteria | 25990 |
| 168 | Ga0157370_10010833 | 3300013104 | Bacteria | 9579 |
| 169 | Ga0157370_10028140 | 3300013104 | Bacteria | 5533 |
| 170 | Ga0157369_10001453 | 3300013105 | Bacteria | 29072 |
| 171 | Ga0157369_10008887 | 3300013105 | Bacteria | 11509 |
| 172 | Ga0157369_10115264 | 3300013105 | Bacteria | 2854 |
| 173 | Ga0157369_10145516 | 3300013105 | Bacteria | 2506 |
| 174 | Ga0157374_10000155 | 3300013296 | Bacteria | 63063 |
| 175 | Ga0157374_10207720 | 3300013296 | Bacteria | 1919 |
| 176 | Ga0157372_10003812 | 3300013307 | Bacteria | 16192 |
| 177 | Ga0157372_10007709 | 3300013307 | Bacteria | 11446 |
| 178 | Ga0182008_10020817 | 3300014497 | Bacteria | 3374 |
| 179 | Ga0182006_1052259 | 3300015261 | Bacteria | 1570 |
| 180 | Ga0182007_10000453 | 3300015262 | Bacteria | 24829 |
| 181 | Ga0182007_10045038 | 3300015262 | Bacteria | 1463 |
| 182 | Ga0183361_10013 | 3300016635 | Bacteria | 179680 |
| 183 | Ga0163161_10011715 | 3300017792 | Bacteria | 6084 |
| 184 | Ga0163161_10026686 | 3300017792 | Bacteria | 4092 |
| 185 | Ga0213872_10038064 | 3300021361 | Bacteria | 2196 |
| 186 | Ga0209436_111054 | 3300025208 | Bacteria | 1610 |
| 187 | Ga0209566_100485 | 3300025225 | Bacteria | 28134 |
| 188 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 189 | Ga0209674_100265 | 3300025226 | Bacteria | 41160 |
| 190 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 191 | Ga0209672_100037 | 3300025228 | Bacteria | 287776 |
| 192 | Ga0209672_100080 | 3300025228 | Bacteria | 143481 |
| 193 | Ga0209672_101567 | 3300025228 | Bacteria | 7772 |
| 194 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 195 | Ga0209147_100049 | 3300025229 | Bacteria | 274980 |
| 196 | Ga0209147_100071 | 3300025229 | Bacteria | 215861 |
| 197 | Ga0209147_100305 | 3300025229 | Bacteria | 39241 |
| 198 | Ga0209147_100358 | 3300025229 | Bacteria | 32865 |
| 199 | Ga0209563_100426 | 3300025230 | Bacteria | 14722 |
| 200 | Ga0207427_101045 | 3300025231 | Bacteria | 11506 |
| 201 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 202 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 203 | Ga0209258_100066 | 3300025242 | Bacteria | 287776 |
| 204 | Ga0209258_100082 | 3300025242 | Bacteria | 247739 |
| 205 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 206 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 207 | Ga0209148_1000168 | 3300025254 | Bacteria | 133952 |
| 208 | Ga0209148_1000755 | 3300025254 | Bacteria | 24715 |
| 209 | Ga0209759_1000029 | 3300025256 | Bacteria | 286968 |
| 210 | Ga0209759_1000232 | 3300025256 | Bacteria | 83288 |
| 211 | Ga0209759_1000284 | 3300025256 | Bacteria | 70505 |
| 212 | Ga0209759_1020083 | 3300025256 | Bacteria | 1564 |
| 213 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 214 | Ga0209129_1003371 | 3300025258 | Bacteria | 7023 |
| 215 | Ga0209129_1003477 | 3300025258 | Bacteria | 6822 |
| 216 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 217 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 218 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 219 | Ga0209455_1000141 | 3300025272 | Bacteria | 138212 |
| 220 | Ga0209455_1000406 | 3300025272 | Bacteria | 35054 |
| 221 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 222 | Ga0209673_1000076 | 3300025273 | Bacteria | 230907 |
| 223 | Ga0209673_1000319 | 3300025273 | Bacteria | 88129 |
| 224 | Ga0209673_1009838 | 3300025273 | Bacteria | 4094 |
| 225 | Ga0209673_1011121 | 3300025273 | Bacteria | 3734 |
| 226 | Ga0209673_1017384 | 3300025273 | Bacteria | 2651 |
| 227 | Ga0209673_1026238 | 3300025273 | Bacteria | 1917 |
| 228 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 229 | Ga0209130_1019763 | 3300025284 | Bacteria | 1554 |
| 230 | Ga0209130_1024712 | 3300025284 | Bacteria | 1308 |
| 231 | Ga0209676_1005581 | 3300025292 | Bacteria | 6505 |
| 232 | Ga0209676_1011391 | 3300025292 | Bacteria | 3591 |
| 233 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 234 | Ga0209025_1001440 | 3300025294 | Bacteria | 31293 |
| 235 | Ga0209025_1008335 | 3300025294 | Bacteria | 7472 |
| 236 | Ga0209025_1012200 | 3300025294 | Bacteria | 5541 |
| 237 | Ga0209025_1024975 | 3300025294 | Bacteria | 3061 |
| 238 | Ga0209564_1004356 | 3300025295 | Bacteria | 8708 |
| 239 | Ga0209564_1004856 | 3300025295 | Bacteria | 7991 |
| 240 | Ga0209564_1011003 | 3300025295 | Bacteria | 4099 |
| 241 | Ga0209564_1014511 | 3300025295 | Bacteria | 3272 |
| 242 | Ga0209564_1019962 | 3300025295 | Bacteria | 2479 |
| 243 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 244 | Ga0209758_1026335 | 3300025297 | Bacteria | 2520 |
| 245 | Ga0209758_1054374 | 3300025297 | Bacteria | 1368 |
| 246 | Ga0209050_1006521 | 3300025298 | Bacteria | 6879 |
| 247 | Ga0209256_1002348 | 3300025299 | Bacteria | 15760 |
| 248 | Ga0209256_1005095 | 3300025299 | Bacteria | 7802 |
| 249 | Ga0209256_1011373 | 3300025299 | Bacteria | 3569 |
| 250 | Ga0209256_1011458 | 3300025299 | Bacteria | 3541 |
| 251 | Ga0209256_1011586 | 3300025299 | Bacteria | 3505 |
| 252 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 253 | Ga0207426_1000050 | 3300025302 | Bacteria | 393022 |
| 254 | Ga0207426_1003692 | 3300025302 | Bacteria | 8027 |
| 255 | Ga0209051_1000514 | 3300025303 | Bacteria | 48877 |
| 256 | Ga0209051_1019345 | 3300025303 | Bacteria | 2975 |
| 257 | Ga0209257_1007417 | 3300025304 | Bacteria | 6627 |
| 258 | Ga0207656_10003457 | 3300025321 | Bacteria | 5430 |
| 259 | Ga0207655_1017087 | 3300025728 | Bacteria | 3929 |
| 260 | Ga0207713_1000287 | 3300025735 | Bacteria | 58430 |
| 261 | Ga0207713_1000353 | 3300025735 | Bacteria | 50352 |
| 262 | Ga0207713_1001378 | 3300025735 | Bacteria | 19723 |
| 263 | Ga0207710_10002272 | 3300025900 | Bacteria | 8995 |
| 264 | Ga0207710_10018232 | 3300025900 | Bacteria | 2984 |
| 265 | Ga0207680_10026506 | 3300025903 | Bacteria | 3214 |
| 266 | Ga0207647_10000378 | 3300025904 | Bacteria | 36270 |
| 267 | Ga0207647_10000955 | 3300025904 | Bacteria | 22364 |
| 268 | Ga0207647_10007158 | 3300025904 | Bacteria | 8092 |
| 269 | Ga0207647_10009767 | 3300025904 | Bacteria | 6807 |
| 270 | Ga0207647_10013606 | 3300025904 | Bacteria | 5633 |
| 271 | Ga0207647_10037821 | 3300025904 | Bacteria | 3057 |
| 272 | Ga0207654_10058678 | 3300025911 | Bacteria | 2241 |
| 273 | Ga0207695_10000978 | 3300025913 | Bacteria | 50823 |
| 274 | Ga0207695_10001867 | 3300025913 | Bacteria | 32990 |
| 275 | Ga0207695_10002000 | 3300025913 | Bacteria | 31464 |
| 276 | Ga0207695_10006039 | 3300025913 | Bacteria | 15818 |
| 277 | Ga0207695_10006482 | 3300025913 | Bacteria | 15183 |
| 278 | Ga0207695_10108988 | 3300025913 | Bacteria | 2752 |
| 279 | Ga0207695_10303128 | 3300025913 | Bacteria | 1489 |
| 280 | Ga0207671_10074044 | 3300025914 | Bacteria | 2545 |
| 281 | Ga0207657_10000014 | 3300025919 | Bacteria | 175779 |
| 282 | Ga0207657_10000817 | 3300025919 | Bacteria | 32878 |
| 283 | Ga0207649_10055074 | 3300025920 | Bacteria | 2478 |
| 284 | Ga0207681_10074006 | 3300025923 | Bacteria | 2385 |
| 285 | Ga0207694_10009008 | 3300025924 | Bacteria | 7535 |
| 286 | Ga0207694_10142748 | 3300025924 | Bacteria | 1926 |
| 287 | Ga0207650_10001915 | 3300025925 | Bacteria | 14658 |
| 288 | Ga0207650_10053914 | 3300025925 | Bacteria | 2981 |
| 289 | Ga0207650_10072351 | 3300025925 | Bacteria | 2595 |
| 290 | Ga0207644_10000980 | 3300025931 | Bacteria | 18238 |
| 291 | Ga0207690_10000023 | 3300025932 | Bacteria | 196155 |
| 292 | Ga0207690_10019011 | 3300025932 | Bacteria | 4220 |
| 293 | Ga0207706_10000383 | 3300025933 | Bacteria | 48348 |
| 294 | Ga0207706_10000803 | 3300025933 | Bacteria | 32563 |
| 295 | Ga0207711_10001289 | 3300025941 | Bacteria | 23752 |
| 296 | Ga0207667_10011185 | 3300025949 | Bacteria | 10446 |
| 297 | Ga0207667_10016938 | 3300025949 | Bacteria | 8221 |
| 298 | Ga0207667_10045434 | 3300025949 | Bacteria | 4652 |
| 299 | Ga0207667_10083774 | 3300025949 | Bacteria | 3302 |
| 300 | Ga0207667_10311208 | 3300025949 | Bacteria | 1609 |
| 301 | Ga0207712_10000101 | 3300025961 | Bacteria | 96961 |
| 302 | Ga0207668_10000059 | 3300025972 | Bacteria | 91172 |
| 303 | Ga0207668_10100688 | 3300025972 | Bacteria | 2146 |
| 304 | Ga0207640_10001832 | 3300025981 | Bacteria | 11402 |
| 305 | Ga0207640_10035218 | 3300025981 | Bacteria | 3131 |
| 306 | Ga0207658_10000072 | 3300025986 | Bacteria | 112469 |
| 307 | Ga0207658_10157198 | 3300025986 | Bacteria | 1859 |
| 308 | Ga0207639_10000264 | 3300026041 | Bacteria | 37756 |
| 309 | Ga0207639_10001734 | 3300026041 | Bacteria | 14684 |
| 310 | Ga0207639_10008995 | 3300026041 | Bacteria | 6877 |
| 311 | Ga0207678_10001433 | 3300026067 | Bacteria | 21885 |
| 312 | Ga0207678_10002131 | 3300026067 | Bacteria | 17922 |
| 313 | Ga0207678_10081418 | 3300026067 | Bacteria | 2771 |
| 314 | Ga0207678_10372999 | 3300026067 | Bacteria | 1233 |
| 315 | Ga0207702_10002199 | 3300026078 | Bacteria | 18684 |
| 316 | Ga0207641_10000096 | 3300026088 | Bacteria | 123585 |
| 317 | Ga0207641_10004130 | 3300026088 | Bacteria | 12654 |
| 318 | Ga0207641_10007904 | 3300026088 | Bacteria | 8821 |
| 319 | Ga0207674_10006865 | 3300026116 | Bacteria | 13348 |
| 320 | Ga0207698_10000442 | 3300026142 | Bacteria | 23870 |
| 321 | Ga0209371_1009354 | 3300027312 | Bacteria | 3125 |
| 322 | Ga0209813_10000046 | 3300027866 | Bacteria | 50246 |
| 323 | Ga0209813_10001560 | 3300027866 | Bacteria | 5139 |
| 324 | Ga0268266_10000387 | 3300028379 | Bacteria | 67080 |
| 325 | Ga0268266_10037403 | 3300028379 | Bacteria | 4136 |
| 326 | Ga0268266_10154101 | 3300028379 | Bacteria | 2074 |
| 327 | Ga0268265_10000151 | 3300028380 | Bacteria | 85523 |
| 328 | Ga0268265_10038765 | 3300028380 | Bacteria | 3507 |
| 329 | Ga0268265_10340962 | 3300028380 | Bacteria | 1364 |
| 330 | Ga0268264_10000303 | 3300028381 | Bacteria | 79730 |
| 331 | Ga0268264_10009257 | 3300028381 | Bacteria | 8154 |
| 332 | Ga0268264_10016664 | 3300028381 | Bacteria | 6018 |
| 333 | Ga0307515_10188949 | 3300028794 | Bacteria | 1978 |
| 334 | Ga0265338_10000022 | 3300028800 | Bacteria | 308414 |
| 335 | Ga0265338_10202898 | 3300028800 | Bacteria | 1494 |
| 336 | Ga0268256_1009896 | 3300030500 | Bacteria | 3125 |
| 337 | Ga0265327_10021679 | 3300031251 | Bacteria | 3869 |
| 338 | Ga0265327_10028444 | 3300031251 | Bacteria | 3198 |
| 339 | Ga0307513_10074356 | 3300031456 | Bacteria | 3534 |
| 340 | Ga0307408_100000134 | 3300031548 | Bacteria | 82703 |
| 341 | Ga0307408_100044834 | 3300031548 | Bacteria | 3154 |
| 342 | Ga0316578_10109153 | 3300031728 | Bacteria | 1661 |
| 343 | Ga0307405_10001276 | 3300031731 | Bacteria | 10496 |
| 344 | Ga0307405_10008943 | 3300031731 | Bacteria | 5111 |
| 345 | Ga0307405_10010173 | 3300031731 | Bacteria | 4858 |
| 346 | Ga0307407_10161317 | 3300031903 | Bacteria | 1467 |
| 347 | Ga0307412_10000024 | 3300031911 | Bacteria | 235467 |
| 348 | Ga0307412_10000516 | 3300031911 | Bacteria | 23055 |
| 349 | Ga0307412_10000862 | 3300031911 | Bacteria | 17463 |
| 350 | Ga0307412_10002325 | 3300031911 | Bacteria | 10520 |
| 351 | Ga0307412_10052752 | 3300031911 | Bacteria | 2694 |
| 352 | Ga0307409_100017939 | 3300031995 | Bacteria | 4736 |
| 353 | Ga0307416_100003840 | 3300032002 | Bacteria | 8935 |
| 354 | Ga0307416_100427521 | 3300032002 | Bacteria | 1370 |
| 355 | Ga0307414_10005205 | 3300032004 | Bacteria | 7141 |
| 356 | Ga0307411_10039379 | 3300032005 | Bacteria | 2989 |
| 357 | Ga0316583_10003812 | 3300032133 | Bacteria | 5344 |
| 358 | Ga0307510_10159989 | 3300033180 | Bacteria | 1851 |
| 359 | Ga0316574_0024916 | 3300035398 | Bacteria | 3586 |
| 360 | Ga0316582_0178756 | 3300036647 | Bacteria | 1443 |
| 361 | Ga0316584_0061527 | 3300036712 | Bacteria | 2812 |
| 362 | Ga0316584_0066494 | 3300036712 | Bacteria | 2701 |
| 363 | Ga0395898_0008451 | 3300037466 | Bacteria | 10881 |
| 364 | Ga0395905_0000041 | 3300037471 | Bacteria | 250958 |
| 365 | Ga0395905_0061057 | 3300037471 | Bacteria | 3525 |
| 366 | Ga0395905_0061884 | 3300037471 | Bacteria | 3501 |
| 367 | Ga0400484_20111 | 3300038725 | Bacteria | 2345 |
| 368 | Ga0400484_23104 | 3300038725 | Bacteria | 5641 |
| 369 | Ga0400484_35008 | 3300038725 | Bacteria | 2513 |
| 370 | Ga0400490_46345 | 3300038726 | Bacteria | 17465 |
| 371 | Ga0400490_48495 | 3300038726 | Bacteria | 4903 |
| 372 | Ga0400488_57407 | 3300038741 | Bacteria | 1743 |
| 373 | Ga0400483_001970 | 3300039062 | Bacteria | 1233 |
| 374 | Ga0400483_012467 | 3300039062 | Bacteria | 3885 |
| 375 | Ga0400483_043932 | 3300039062 | Bacteria | 2946 |
| 376 | Ga0400483_156899 | 3300039062 | Bacteria | 18579 |
| 377 | Ga0400483_169173 | 3300039062 | Bacteria | 6637 |
| 378 | Ga0400483_209372 | 3300039062 | Bacteria | 3693 |
| 379 | Ga0400489_67634 | 3300039093 | Bacteria | 4346 |
| 380 | Ga0400487_45314 | 3300039110 | Bacteria | 16850 |
| 381 | Ga0436361_0866616 | 3300039447 | Bacteria | 7110 |
| 382 | Ga0436361_1107681 | 3300039447 | Bacteria | 6320 |
| 383 | Ga0439465_0009811 | 3300041413 | Bacteria | 3016 |
| 384 | Ga0451833_0084816 | 3300041491 | Bacteria | 2314 |
| 385 | Ga0451835_0334487 | 3300041492 | Bacteria | 1212 |
| 386 | Ga0451837_0659144 | 3300041494 | Bacteria | 2305 |
| 387 | Ga0451841_0514518 | 3300041498 | Bacteria | 2226 |
| 388 | Ga0451845_0226581 | 3300041501 | Bacteria | 1323 |
| 389 | Ga0451849_0695212 | 3300041505 | Bacteria | 1777 |
| 390 | Ga0451843_0534843 | 3300041509 | Bacteria | 1410 |
| 391 | Ga0451855_0155246 | 3300041511 | Bacteria | 1174 |
| 392 | Ga0451853_1273235 | 3300041512 | Bacteria | 1573 |
| 393 | Ga0451853_1348410 | 3300041512 | Bacteria | 2507 |
| 394 | Ga0439448_0000074 | 3300042005 | Bacteria | 17207 |
| 395 | Ga0439449_0023893 | 3300042007 | Bacteria | 2286 |
| 396 | Ga0439456_000129 | 3300042013 | Bacteria | 23611 |
| 397 | Ga0439463_000319 | 3300042016 | Bacteria | 13504 |
| 398 | Ga0466969_0028950 | 3300044656 | Bacteria | 2830 |
| 399 | Ga0466961_0000305 | 3300044693 | Bacteria | 32559 |
| 400 | Ga0466970_0027842 | 3300044765 | Bacteria | 2967 |
| 401 | Ga0466959_0005513 | 3300045049 | Bacteria | 8678 |
| 402 | Ga0466959_0081253 | 3300045049 | Bacteria | 2336 |
| 403 | Ga0466967_0214492 | 3300045976 | Bacteria | 1827 |
| 404 | Ga0495617_017103 | 3300046452 | Bacteria | 2448 |
| 405 | Ga0495617_026763 | 3300046452 | Bacteria | 1942 |
| 406 | Ga0495617_050341 | 3300046452 | Bacteria | 1386 |
| 407 | Ga0495627_000036 | 3300046453 | Bacteria | 205589 |
| 408 | Ga0495627_000112 | 3300046453 | Bacteria | 101337 |
| 409 | Ga0495627_003895 | 3300046453 | Bacteria | 6388 |
| 410 | Ga0495592_0031280 | 3300046454 | Bacteria | 4023 |
| 411 | Ga0495592_0055849 | 3300046454 | Bacteria | 2919 |
| 412 | Ga0495603_0001311 | 3300046455 | Bacteria | 14447 |
| 413 | Ga0495603_0002931 | 3300046455 | Bacteria | 10085 |
| 414 | Ga0495603_0156817 | 3300046455 | Bacteria | 1321 |
| 415 | Ga0495590_0001712 | 3300046457 | Bacteria | 9325 |
| 416 | Ga0495591_000009 | 3300046458 | Bacteria | 331626 |
| 417 | Ga0495591_001145 | 3300046458 | Bacteria | 17397 |
| 418 | Ga0495591_001533 | 3300046458 | Bacteria | 14162 |
| 419 | Ga0495629_0000098 | 3300046459 | Bacteria | 75959 |
| 420 | Ga0495629_0004355 | 3300046459 | Bacteria | 10615 |
| 421 | Ga0495629_0027417 | 3300046459 | Bacteria | 4043 |
| 422 | Ga0495629_0031675 | 3300046459 | Bacteria | 3743 |
| 423 | Ga0495629_0062089 | 3300046459 | Bacteria | 2611 |
| 424 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 425 | Ga0495638_0000789 | 3300046460 | Bacteria | 33427 |
| 426 | Ga0495638_0023885 | 3300046460 | Bacteria | 3993 |
| 427 | Ga0495638_0073027 | 3300046460 | Bacteria | 2095 |
| 428 | Ga0495641_0015729 | 3300046461 | Bacteria | 4020 |
| 429 | Ga0495641_0071002 | 3300046461 | Bacteria | 1563 |
| 430 | Ga0495651_0018150 | 3300046462 | Bacteria | 5447 |
| 431 | Ga0495653_0001085 | 3300046463 | Bacteria | 20996 |
| 432 | Ga0495650_0000143 | 3300046471 | Bacteria | 168096 |
| 433 | Ga0495650_0001210 | 3300046471 | Bacteria | 27205 |
| 434 | Ga0495650_0001914 | 3300046471 | Bacteria | 18442 |
| 435 | Ga0495650_0004473 | 3300046471 | Bacteria | 9558 |
| 436 | Ga0495650_0017008 | 3300046471 | Bacteria | 3658 |
| 437 | Ga0495650_0093586 | 3300046471 | Bacteria | 1139 |
| 438 | Ga0495650_0095354 | 3300046471 | Bacteria | 1125 |
| 439 | Ga0495580_0000171 | 3300046472 | Bacteria | 48150 |
| 440 | Ga0495580_0000453 | 3300046472 | Bacteria | 34001 |
| 441 | Ga0495580_0004700 | 3300046472 | Bacteria | 11452 |
| 442 | Ga0495580_0007124 | 3300046472 | Bacteria | 9004 |
| 443 | Ga0495582_0000525 | 3300046473 | Bacteria | 21124 |
| 444 | Ga0495582_0016774 | 3300046473 | Bacteria | 4011 |
| 445 | Ga0495605_0000001 | 3300046474 | Bacteria | 614538 |
| 446 | Ga0495605_0001810 | 3300046474 | Bacteria | 13704 |
| 447 | Ga0495605_0010044 | 3300046474 | Bacteria | 5302 |
| 448 | Ga0495605_0030068 | 3300046474 | Bacteria | 2788 |
| 449 | Ga0495605_0031121 | 3300046474 | Bacteria | 2728 |
| 450 | Ga0495605_0041962 | 3300046474 | Bacteria | 2276 |
| 451 | Ga0495664_0000427 | 3300046477 | Bacteria | 20644 |
| 452 | Ga0495664_0009862 | 3300046477 | Bacteria | 5355 |
| 453 | Ga0495664_0024223 | 3300046477 | Bacteria | 3526 |
| 454 | Ga0495584_0002425 | 3300046491 | Bacteria | 10573 |
| 455 | Ga0495584_0003436 | 3300046491 | Bacteria | 8725 |
| 456 | Ga0495585_0000127 | 3300046492 | Bacteria | 82252 |
| 457 | Ga0495585_0011184 | 3300046492 | Bacteria | 5317 |
| 458 | Ga0495596_0016143 | 3300046500 | Bacteria | 3108 |
| 459 | Ga0495607_0000291 | 3300046501 | Bacteria | 52902 |
| 460 | Ga0495607_0036799 | 3300046501 | Bacteria | 2946 |
| 461 | Ga0495607_0041622 | 3300046501 | Bacteria | 2727 |
| 462 | Ga0495607_0055940 | 3300046501 | Bacteria | 2266 |
| 463 | Ga0495583_0000010 | 3300046506 | Bacteria | 353523 |
| 464 | Ga0495583_0000187 | 3300046506 | Bacteria | 104971 |
| 465 | Ga0495583_0003226 | 3300046506 | Bacteria | 12753 |
| 466 | Ga0495583_0009731 | 3300046506 | Bacteria | 5707 |
| 467 | Ga0495583_0012736 | 3300046506 | Bacteria | 4736 |
| 468 | Ga0495583_0025948 | 3300046506 | Bacteria | 2916 |
| 469 | Ga0495583_0028074 | 3300046506 | Bacteria | 2771 |
| 470 | Ga0495606_0000013 | 3300046507 | Bacteria | 292850 |
| 471 | Ga0495606_0000465 | 3300046507 | Bacteria | 66730 |
| 472 | Ga0495606_0006635 | 3300046507 | Bacteria | 10611 |
| 473 | Ga0495606_0015352 | 3300046507 | Bacteria | 5907 |
| 474 | Ga0495606_0029147 | 3300046507 | Bacteria | 3880 |
| 475 | Ga0495606_0034450 | 3300046507 | Bacteria | 3476 |
| 476 | Ga0495608_0050496 | 3300046511 | Bacteria | 2759 |
| 477 | Ga0495610_0000079 | 3300046512 | Bacteria | 115816 |
| 478 | Ga0495610_0000454 | 3300046512 | Bacteria | 42447 |
| 479 | Ga0495610_0006916 | 3300046512 | Bacteria | 7681 |
| 480 | Ga0495610_0019401 | 3300046512 | Bacteria | 3806 |
| 481 | Ga0495610_0026996 | 3300046512 | Bacteria | 3059 |
| 482 | Ga0495610_0083268 | 3300046512 | Bacteria | 1464 |
| 483 | Ga0495616_0031447 | 3300046513 | Bacteria | 2779 |
| 484 | Ga0495618_0004983 | 3300046514 | Bacteria | 8114 |
| 485 | Ga0495618_0077538 | 3300046514 | Bacteria | 2117 |
| 486 | Ga0495620_0000994 | 3300046515 | Bacteria | 17518 |
| 487 | Ga0495620_0012599 | 3300046515 | Bacteria | 4358 |
| 488 | Ga0495620_0018123 | 3300046515 | Bacteria | 3492 |
| 489 | Ga0495620_0060633 | 3300046515 | Bacteria | 1577 |
| 490 | Ga0495620_0063593 | 3300046515 | Bacteria | 1529 |
| 491 | Ga0495628_0001765 | 3300046516 | Bacteria | 19679 |
| 492 | Ga0495628_0038569 | 3300046516 | Bacteria | 3823 |
| 493 | Ga0495628_0082721 | 3300046516 | Bacteria | 2493 |
| 494 | Ga0495630_0013137 | 3300046517 | Bacteria | 6020 |
| 495 | Ga0495630_0036611 | 3300046517 | Bacteria | 3668 |
| 496 | Ga0495631_0023144 | 3300046518 | Bacteria | 2882 |
| 497 | Ga0495631_0024916 | 3300046518 | Bacteria | 2758 |
| 498 | Ga0495631_0041542 | 3300046518 | Bacteria | 2035 |
| 499 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 500 | Ga0495632_0000384 | 3300046519 | Bacteria | 42202 |
| 501 | Ga0495632_0002606 | 3300046519 | Bacteria | 13589 |
| 502 | Ga0495632_0012263 | 3300046519 | Bacteria | 4948 |
| 503 | Ga0495632_0013825 | 3300046519 | Bacteria | 4589 |
| 504 | Ga0495637_0000021 | 3300046520 | Bacteria | 179141 |
| 505 | Ga0495637_0000039 | 3300046520 | Bacteria | 117112 |
| 506 | Ga0495637_0000341 | 3300046520 | Bacteria | 35858 |
| 507 | Ga0495643_0000004 | 3300046522 | Bacteria | 519944 |
| 508 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 509 | Ga0495643_0008058 | 3300046522 | Bacteria | 6715 |
| 510 | Ga0495643_0008694 | 3300046522 | Bacteria | 6404 |
| 511 | Ga0495643_0061802 | 3300046522 | Bacteria | 1985 |
| 512 | Ga0495643_0072977 | 3300046522 | Bacteria | 1799 |
| 513 | Ga0495644_0006565 | 3300046523 | Bacteria | 4504 |
| 514 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 515 | Ga0495648_0008954 | 3300046524 | Bacteria | 7820 |
| 516 | Ga0495648_0014093 | 3300046524 | Bacteria | 5873 |
| 517 | Ga0495648_0014491 | 3300046524 | Bacteria | 5768 |
| 518 | Ga0495648_0049425 | 3300046524 | Bacteria | 2578 |
| 519 | Ga0495648_0053979 | 3300046524 | Bacteria | 2430 |
| 520 | Ga0495648_0063237 | 3300046524 | Bacteria | 2186 |
| 521 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 522 | Ga0495666_0000074 | 3300046526 | Bacteria | 38870 |
| 523 | Ga0495666_0004808 | 3300046526 | Bacteria | 6828 |
| 524 | Ga0495666_0025770 | 3300046526 | Bacteria | 2903 |
| 525 | Ga0495666_0041903 | 3300046526 | Bacteria | 2215 |
| 526 | Ga0495642_0018477 | 3300046528 | Bacteria | 2729 |
| 527 | Ga0495642_0032774 | 3300046528 | Bacteria | 2086 |
| 528 | Ga0495652_0007094 | 3300046529 | Bacteria | 10343 |
| 529 | Ga0495652_0030195 | 3300046529 | Bacteria | 4755 |
| 530 | Ga0495652_0059204 | 3300046529 | Bacteria | 3241 |
| 531 | Ga0495665_0004010 | 3300046531 | Bacteria | 7938 |
| 532 | Ga0495665_0020483 | 3300046531 | Bacteria | 3552 |
| 533 | Ga0495640_0001565 | 3300046533 | Bacteria | 18012 |
| 534 | Ga0495586_0000719 | 3300046535 | Bacteria | 18897 |
| 535 | Ga0495586_0072913 | 3300046535 | Bacteria | 1878 |
| 536 | Ga0495587_0002495 | 3300046536 | Bacteria | 12286 |
| 537 | Ga0495609_0000020 | 3300046538 | Bacteria | 294662 |
| 538 | Ga0495609_0000062 | 3300046538 | Bacteria | 138094 |
| 539 | Ga0495609_0034433 | 3300046538 | Bacteria | 2296 |
| 540 | Ga0495609_0092950 | 3300046538 | Bacteria | 1311 |
| 541 | Ga0495597_0018676 | 3300046542 | Bacteria | 3251 |
| 542 | Ga0495597_0042519 | 3300046542 | Bacteria | 2026 |
| 543 | Ga0495597_0062098 | 3300046542 | Bacteria | 1626 |
| 544 | Ga0495645_0000821 | 3300046543 | Bacteria | 21244 |
| 545 | Ga0495645_0017472 | 3300046543 | Bacteria | 5139 |
| 546 | Ga0495622_0000161 | 3300046557 | Bacteria | 56444 |
| 547 | Ga0495622_0003817 | 3300046557 | Bacteria | 7042 |
| 548 | Ga0495633_0000654 | 3300046558 | Bacteria | 32019 |
| 549 | Ga0495633_0002962 | 3300046558 | Bacteria | 11617 |
| 550 | Ga0495633_0038731 | 3300046558 | Bacteria | 2276 |
| 551 | Ga0495667_0030219 | 3300046559 | Bacteria | 3643 |
| 552 | Ga0495668_0002893 | 3300046616 | Bacteria | 13561 |
| 553 | Ga0495668_0003158 | 3300046616 | Bacteria | 12700 |
| 554 | Ga0495668_0162455 | 3300046616 | Bacteria | 1223 |
| 555 | Ga0495634_0030483 | 3300046642 | Bacteria | 3724 |
| 556 | Ga0495634_0063547 | 3300046642 | Bacteria | 2449 |
| 557 | Ga0495611_0000802 | 3300046648 | Bacteria | 17419 |
| 558 | Ga0495611_0014233 | 3300046648 | Bacteria | 3395 |
| 559 | Ga0495611_0018446 | 3300046648 | Bacteria | 2993 |
| 560 | Ga0495625_0000028 | 3300046660 | Bacteria | 256946 |
| 561 | Ga0495625_0088285 | 3300046660 | Bacteria | 2148 |
| 562 | Ga0495625_0130589 | 3300046660 | Bacteria | 1702 |
| 563 | Ga0495625_0166481 | 3300046660 | Bacteria | 1473 |
| 564 | Ga0495635_0001780 | 3300046663 | Bacteria | 14546 |
| 565 | Ga0495635_0011861 | 3300046663 | Bacteria | 6109 |
| 566 | Ga0495661_0000001 | 3300046665 | Bacteria | 898372 |
| 567 | Ga0495661_0000452 | 3300046665 | Bacteria | 43465 |
| 568 | Ga0495661_0002554 | 3300046665 | Bacteria | 13957 |
| 569 | Ga0495661_0020661 | 3300046665 | Bacteria | 4296 |
| 570 | Ga0495661_0066013 | 3300046665 | Bacteria | 2131 |
| 571 | Ga0495588_0089999 | 3300046674 | Bacteria | 1607 |
| 572 | Ga0495599_0001334 | 3300046678 | Bacteria | 14063 |
| 573 | Ga0495599_0086326 | 3300046678 | Bacteria | 1959 |
| 574 | Ga0495623_0030229 | 3300046679 | Bacteria | 3484 |
| 575 | Ga0495623_0055696 | 3300046679 | Bacteria | 2491 |
| 576 | Ga0495646_0004287 | 3300046680 | Bacteria | 8981 |
| 577 | Ga0495646_0060634 | 3300046680 | Bacteria | 2255 |
| 578 | Ga0495646_0063021 | 3300046680 | Bacteria | 2203 |
| 579 | Ga0495613_0001656 | 3300046689 | Bacteria | 16963 |
| 580 | Ga0495613_0022700 | 3300046689 | Bacteria | 4675 |
| 581 | Ga0495624_0000139 | 3300046690 | Bacteria | 52075 |
| 582 | Ga0495624_0001598 | 3300046690 | Bacteria | 17393 |
| 583 | Ga0495624_0017849 | 3300046690 | Bacteria | 4754 |
| 584 | Ga0495624_0041382 | 3300046690 | Bacteria | 2947 |
| 585 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 586 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 587 | Ga0495671_0021871 | 3300046692 | Bacteria | 3354 |
| 588 | Ga0495649_0001018 | 3300046694 | Bacteria | 22000 |
| 589 | Ga0495649_0029508 | 3300046694 | Bacteria | 3033 |
| 590 | Ga0495649_0090989 | 3300046694 | Bacteria | 1626 |
| 591 | Ga0495589_0001308 | 3300046794 | Bacteria | 14624 |
| 592 | Ga0495600_0006701 | 3300046809 | Bacteria | 7019 |
| 593 | Ga0495600_0017912 | 3300046809 | Bacteria | 4508 |
| 594 | Ga0495660_0001564 | 3300046810 | Bacteria | 15371 |
| 595 | Ga0495660_0004492 | 3300046810 | Bacteria | 8437 |
| 596 | Ga0495660_0005072 | 3300046810 | Bacteria | 7912 |
| 597 | Ga0495660_0043208 | 3300046810 | Bacteria | 2487 |
| 598 | Ga0495581_0003108 | 3300047315 | Bacteria | 9509 |
| 599 | Ga0495581_0037869 | 3300047315 | Bacteria | 2791 |
| 600 | Ga0495604_0005687 | 3300047317 | Bacteria | 9890 |
| 601 | Ga0495604_0006799 | 3300047317 | Bacteria | 9066 |
| 602 | Ga0495604_0010696 | 3300047317 | Bacteria | 7283 |
| 603 | Ga0495674_0017011 | 3300047319 | Bacteria | 6777 |
| 604 | Ga0495674_0019792 | 3300047319 | Bacteria | 6241 |
| 605 | Ga0495674_0025181 | 3300047319 | Bacteria | 5460 |
| 606 | Ga0495674_0089116 | 3300047319 | Bacteria | 2637 |
| 607 | Ga0495674_0131504 | 3300047319 | Bacteria | 2108 |
| 608 | Ga0495672_0002374 | 3300047320 | Bacteria | 17377 |
| 609 | Ga0495672_0093592 | 3300047320 | Bacteria | 1645 |
| 610 | Ga0495676_0000006 | 3300047321 | Bacteria | 280508 |
| 611 | Ga0495676_0012034 | 3300047321 | Bacteria | 7803 |
| 612 | Ga0495680_0001584 | 3300047322 | Bacteria | 24332 |
| 613 | Ga0495680_0036781 | 3300047322 | Bacteria | 3926 |
| 614 | Ga0495683_0004017 | 3300047323 | Bacteria | 8447 |
| 615 | Ga0495683_0008208 | 3300047323 | Bacteria | 5599 |
| 616 | Ga0495683_0011601 | 3300047323 | Bacteria | 4636 |
| 617 | Ga0495683_0077524 | 3300047323 | Bacteria | 1624 |
| 618 | Ga0495687_000022 | 3300047443 | Bacteria | 327353 |
| 619 | Ga0495687_013299 | 3300047443 | Bacteria | 4307 |
| 620 | Ga0495687_052200 | 3300047443 | Bacteria | 1730 |
| 621 | Ga0495675_0001909 | 3300047444 | Bacteria | 12420 |
| 622 | Ga0495675_0024964 | 3300047444 | Bacteria | 3812 |
| 623 | Ga0495679_000025 | 3300047446 | Bacteria | 198386 |
| 624 | Ga0495679_000150 | 3300047446 | Bacteria | 62726 |
| 625 | Ga0495679_001462 | 3300047446 | Bacteria | 13392 |
| 626 | Ga0495679_001545 | 3300047446 | Bacteria | 12992 |
| 627 | Ga0495679_002123 | 3300047446 | Bacteria | 10437 |
| 628 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 629 | Ga0495673_0001371 | 3300047469 | Bacteria | 19679 |
| 630 | Ga0495673_0018744 | 3300047469 | Bacteria | 3483 |
| 631 | Ga0495673_0077707 | 3300047469 | Bacteria | 1382 |
| 632 | Ga0495681_0000013 | 3300047470 | Bacteria | 189155 |
| 633 | Ga0495681_0006336 | 3300047470 | Bacteria | 7790 |
| 634 | Ga0495681_0007358 | 3300047470 | Bacteria | 7044 |
| 635 | Ga0495681_0017500 | 3300047470 | Bacteria | 3976 |
| 636 | Ga0495681_0063780 | 3300047470 | Bacteria | 1690 |
| 637 | Ga0495681_0069759 | 3300047470 | Bacteria | 1596 |
| 638 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 639 | Ga0495686_0001007 | 3300047472 | Bacteria | 34237 |
| 640 | Ga0495686_0007932 | 3300047472 | Bacteria | 7881 |
| 641 | Ga0495686_0008600 | 3300047472 | Bacteria | 7470 |
| 642 | Ga0495686_0010825 | 3300047472 | Bacteria | 6464 |
| 643 | Ga0495686_0022216 | 3300047472 | Bacteria | 4199 |
| 644 | Ga0495686_0047104 | 3300047472 | Bacteria | 2723 |
| 645 | Ga0495686_0151542 | 3300047472 | Bacteria | 1361 |
| 646 | Ga0495593_0016281 | 3300047673 | Bacteria | 4197 |
| 647 | Ga0495593_0027125 | 3300047673 | Bacteria | 3155 |
| 648 | Ga0495602_0023652 | 3300048088 | Bacteria | 5982 |
| 649 | Ga0495602_0092751 | 3300048088 | Bacteria | 2500 |
| 650 | Ga0495614_0019197 | 3300048089 | Bacteria | 2958 |
| 651 | Ga0495614_0020202 | 3300048089 | Bacteria | 2881 |
| 652 | Ga0495614_0107656 | 3300048089 | Bacteria | 1222 |
| 653 | Ga0495615_0000003 | 3300048090 | Bacteria | 127902 |
| 654 | Ga0495615_0019725 | 3300048090 | Bacteria | 1501 |
| 655 | Ga0495626_0000019 | 3300048091 | Bacteria | 225494 |
| 656 | Ga0495626_0046844 | 3300048091 | Bacteria | 2012 |
| 657 | Ga0495626_0070012 | 3300048091 | Bacteria | 1579 |
| 658 | Ga0496100_0011566 | 3300048903 | Bacteria | 5028 |
| 659 | Ga0496100_0054065 | 3300048903 | Bacteria | 2617 |
| 660 | Ga0496101_0000369 | 3300048904 | Bacteria | 29873 |
| 661 | Ga0496101_0005003 | 3300048904 | Bacteria | 8418 |
| 662 | Ga0496101_0062915 | 3300048904 | Bacteria | 2699 |
| 663 | Ga0496102_0000258 | 3300048905 | Bacteria | 68544 |
| 664 | Ga0496102_0000551 | 3300048905 | Bacteria | 40299 |
| 665 | Ga0496102_0015568 | 3300048905 | Bacteria | 6625 |
| 666 | Ga0496103_0000098 | 3300048906 | Bacteria | 96109 |
| 667 | Ga0496103_0000326 | 3300048906 | Bacteria | 43556 |
| 668 | Ga0496103_0004631 | 3300048906 | Bacteria | 8328 |
| 669 | Ga0496103_0019256 | 3300048906 | Bacteria | 4098 |
| 670 | Ga0496104_0004611 | 3300048907 | Bacteria | 12009 |
| 671 | Ga0496104_0155388 | 3300048907 | Bacteria | 2195 |
| 672 | Ga0496105_0055157 | 3300048908 | Bacteria | 3281 |
| 673 | Ga0496105_0089119 | 3300048908 | Bacteria | 2548 |
| 674 | Ga0496106_0003362 | 3300048909 | Bacteria | 11925 |
| 675 | Ga0496106_0023088 | 3300048909 | Bacteria | 4620 |
| 676 | Ga0496107_0001254 | 3300048910 | Bacteria | 15535 |
| 677 | Ga0496108_0000763 | 3300048911 | Bacteria | 25067 |
| 678 | Ga0496108_0145994 | 3300048911 | Bacteria | 2040 |
| 679 | Ga0496110_0008899 | 3300048913 | Bacteria | 8093 |
| 680 | Ga0496110_0014287 | 3300048913 | Bacteria | 6588 |
| 681 | Ga0496110_0177981 | 3300048913 | Bacteria | 1931 |
| 682 | Ga0496110_0320182 | 3300048913 | Bacteria | 1412 |
| 683 | Ga0496111_0001285 | 3300048914 | Bacteria | 14065 |
| 684 | Ga0496113_0004334 | 3300048916 | Bacteria | 8695 |
| 685 | Ga0496113_0336840 | 3300048916 | Bacteria | 1210 |
| 686 | Ga0496114_0000981 | 3300048917 | Bacteria | 21347 |
| 687 | Ga0496114_0017947 | 3300048917 | Bacteria | 5718 |
| 688 | Ga0496114_0031622 | 3300048917 | Bacteria | 4354 |
| 689 | Ga0496115_0178355 | 3300048918 | Bacteria | 1757 |
| 690 | Ga0496116_0001473 | 3300048919 | Bacteria | 26338 |
| 691 | Ga0496116_0009602 | 3300048919 | Bacteria | 8234 |
| 692 | Ga0496116_0017649 | 3300048919 | Bacteria | 5530 |
| 693 | Ga0496116_0025474 | 3300048919 | Bacteria | 4347 |
| 694 | Ga0496116_0028745 | 3300048919 | Bacteria | 4021 |
| 695 | Ga0496116_0031452 | 3300048919 | Bacteria | 3799 |
| 696 | Ga0496116_0112500 | 3300048919 | Bacteria | 1595 |
| 697 | Ga0496116_0168964 | 3300048919 | Bacteria | 1187 |
| 698 | Ga0496117_0000121 | 3300048920 | Bacteria | 171532 |
| 699 | Ga0496117_0001122 | 3300048920 | Bacteria | 40315 |
| 700 | Ga0496117_0002864 | 3300048920 | Bacteria | 20969 |
| 701 | Ga0496117_0007366 | 3300048920 | Bacteria | 10769 |
| 702 | Ga0496117_0007912 | 3300048920 | Bacteria | 10214 |
| 703 | Ga0496117_0013370 | 3300048920 | Bacteria | 7164 |
| 704 | Ga0496117_0018825 | 3300048920 | Bacteria | 5699 |
| 705 | Ga0496117_0034818 | 3300048920 | Bacteria | 3789 |
| 706 | Ga0496117_0045089 | 3300048920 | Bacteria | 3189 |
| 707 | Ga0496117_0100483 | 3300048920 | Bacteria | 1832 |
| 708 | Ga0496117_0106406 | 3300048920 | Bacteria | 1760 |
| 709 | Ga0496117_0118483 | 3300048920 | Bacteria | 1632 |
| 710 | Ga0496118_0000095 | 3300048921 | Bacteria | 164850 |
| 711 | Ga0496118_0001154 | 3300048921 | Bacteria | 40809 |
| 712 | Ga0496118_0003651 | 3300048921 | Bacteria | 19121 |
| 713 | Ga0496118_0004923 | 3300048921 | Bacteria | 15507 |
| 714 | Ga0496118_0005119 | 3300048921 | Bacteria | 15061 |
| 715 | Ga0496118_0008181 | 3300048921 | Bacteria | 10880 |
| 716 | Ga0496118_0029419 | 3300048921 | Bacteria | 4606 |
| 717 | Ga0496118_0061773 | 3300048921 | Bacteria | 2771 |
| 718 | Ga0496118_0121783 | 3300048921 | Bacteria | 1698 |
| 719 | Ga0496119_0012070 | 3300048922 | Bacteria | 7060 |
| 720 | Ga0496119_0013733 | 3300048922 | Bacteria | 6418 |
| 721 | Ga0496119_0016911 | 3300048922 | Bacteria | 5520 |
| 722 | Ga0496119_0019480 | 3300048922 | Bacteria | 4996 |
| 723 | Ga0496119_0141289 | 3300048922 | Bacteria | 1300 |
| 724 | Ga0496120_0005830 | 3300048923 | Bacteria | 9650 |
| 725 | Ga0496121_0000087 | 3300048924 | Bacteria | 222451 |
| 726 | Ga0496121_0000624 | 3300048924 | Bacteria | 65948 |
| 727 | Ga0496121_0004650 | 3300048924 | Bacteria | 18256 |
| 728 | Ga0496121_0006109 | 3300048924 | Bacteria | 15148 |
| 729 | Ga0496121_0007013 | 3300048924 | Bacteria | 13688 |
| 730 | Ga0496121_0024937 | 3300048924 | Bacteria | 5699 |
| 731 | Ga0496121_0029634 | 3300048924 | Bacteria | 5052 |
| 732 | Ga0496121_0034730 | 3300048924 | Bacteria | 4534 |
| 733 | Ga0496121_0042851 | 3300048924 | Bacteria | 3929 |
| 734 | Ga0496121_0114264 | 3300048924 | Bacteria | 2052 |
| 735 | Ga0496121_0173577 | 3300048924 | Bacteria | 1563 |
| 736 | Ga0496122_0000935 | 3300048925 | Bacteria | 53083 |
| 737 | Ga0496122_0001672 | 3300048925 | Bacteria | 34402 |
| 738 | Ga0496122_0006069 | 3300048925 | Bacteria | 14078 |
| 739 | Ga0496122_0024031 | 3300048925 | Bacteria | 5346 |
| 740 | Ga0496122_0039009 | 3300048925 | Bacteria | 3794 |
| 741 | Ga0496122_0043653 | 3300048925 | Bacteria | 3509 |
| 742 | Ga0496122_0044603 | 3300048925 | Bacteria | 3457 |
| 743 | Ga0496122_0068700 | 3300048925 | Bacteria | 2542 |
| 744 | Ga0496122_0132105 | 3300048925 | Bacteria | 1583 |
| 745 | Ga0496122_0177410 | 3300048925 | Bacteria | 1275 |
| 746 | Ga0496123_0000337 | 3300048926 | Bacteria | 88727 |
| 747 | Ga0496123_0001736 | 3300048926 | Bacteria | 28866 |
| 748 | Ga0496123_0006087 | 3300048926 | Bacteria | 11837 |
| 749 | Ga0496123_0016306 | 3300048926 | Bacteria | 6042 |
| 750 | Ga0496123_0024008 | 3300048926 | Bacteria | 4650 |
| 751 | Ga0496123_0035916 | 3300048926 | Bacteria | 3524 |
| 752 | Ga0496123_0054508 | 3300048926 | Bacteria | 2632 |
| 753 | Ga0496123_0127871 | 3300048926 | Bacteria | 1414 |
| 754 | Ga0496124_0000119 | 3300048927 | Bacteria | 163996 |
| 755 | Ga0496124_0006868 | 3300048927 | Bacteria | 12253 |
| 756 | Ga0496124_0015876 | 3300048927 | Bacteria | 7193 |
| 757 | Ga0496124_0016270 | 3300048927 | Bacteria | 7082 |
| 758 | Ga0496124_0025665 | 3300048927 | Bacteria | 5331 |
| 759 | Ga0496124_0030082 | 3300048927 | Bacteria | 4826 |
| 760 | Ga0496124_0045315 | 3300048927 | Bacteria | 3770 |
| 761 | Ga0496124_0078365 | 3300048927 | Bacteria | 2723 |
| 762 | Ga0496124_0079496 | 3300048927 | Bacteria | 2700 |
| 763 | Ga0496124_0100722 | 3300048927 | Bacteria | 2341 |
| 764 | Ga0496124_0104244 | 3300048927 | Bacteria | 2293 |
| 765 | Ga0496125_0002065 | 3300048928 | Bacteria | 27123 |
| 766 | Ga0496125_0003585 | 3300048928 | Bacteria | 18663 |
| 767 | Ga0496125_0004283 | 3300048928 | Bacteria | 16593 |
| 768 | Ga0496125_0004681 | 3300048928 | Bacteria | 15592 |
| 769 | Ga0496125_0008785 | 3300048928 | Bacteria | 10509 |
| 770 | Ga0496125_0009964 | 3300048928 | Bacteria | 9658 |
| 771 | Ga0496125_0018724 | 3300048928 | Bacteria | 6565 |
| 772 | Ga0496125_0032440 | 3300048928 | Bacteria | 4640 |
| 773 | Ga0496125_0040968 | 3300048928 | Bacteria | 3965 |
| 774 | Ga0496125_0069112 | 3300048928 | Bacteria | 2773 |
| 775 | Ga0496125_0096302 | 3300048928 | Bacteria | 2197 |
| 776 | Ga0496125_0130088 | 3300048928 | Bacteria | 1774 |
| 777 | Ga0496126_0000278 | 3300048929 | Bacteria | 107983 |
| 778 | Ga0496126_0000592 | 3300048929 | Bacteria | 68725 |
| 779 | Ga0496126_0004017 | 3300048929 | Bacteria | 17931 |
| 780 | Ga0496126_0011844 | 3300048929 | Bacteria | 8973 |
| 781 | Ga0496126_0021904 | 3300048929 | Bacteria | 6232 |
| 782 | Ga0496126_0024075 | 3300048929 | Bacteria | 5883 |
| 783 | Ga0496126_0093127 | 3300048929 | Bacteria | 2646 |
| 784 | Ga0496126_0140809 | 3300048929 | Bacteria | 2076 |
| 785 | Ga0496126_0188507 | 3300048929 | Bacteria | 1748 |
| 786 | Ga0496126_0319131 | 3300048929 | Bacteria | 1277 |
| 787 | Ga0495678_000083 | 3300049459 | Bacteria | 117558 |
| 788 | Ga0495678_005993 | 3300049459 | Bacteria | 6559 |
| 789 | Ga0495678_006390 | 3300049459 | Bacteria | 6279 |
| 790 | Ga0495678_036432 | 3300049459 | Bacteria | 2007 |
| 791 | Ga0495678_056561 | 3300049459 | Bacteria | 1490 |
| 792 | Ga0495678_059431 | 3300049459 | Bacteria | 1441 |
| 793 | Ga0495682_0015286 | 3300049460 | Bacteria | 2909 |
| 794 | Ga0501032_0053548 | 3300049569 | Bacteria | 2717 |
| 795 | Ga0501037_0123036 | 3300049573 | Bacteria | 1864 |
| 796 | Ga0501043_0099892 | 3300049579 | Bacteria | 2281 |
| 797 | Ga0501047_0218956 | 3300049581 | Bacteria | 1760 |
| 798 | Ga0501249_000141 | 3300049679 | Bacteria | 22514 |
| 799 | Ga0501083_0132883 | 3300049744 | Bacteria | 1631 |
| 800 | Ga0501280_001736 | 3300049776 | Bacteria | 3849 |
| 801 | Ga0501044_0077302 | 3300049823 | Bacteria | 3376 |
| 802 | Ga0501044_0139093 | 3300049823 | Bacteria | 2417 |
| 803 | nmdc:mga03683_85_c1 | 3300050489 | Bacteria | 34614 |
| 804 | nmdc:mga03n38_164724_c1 | 3300050490 | Bacteria | 1125 |
| 805 | nmdc:mga03n38_21095_c1 | 3300050490 | Bacteria | 2616 |
| 806 | nmdc:mga00v17_175452_c1 | 3300050491 | Bacteria | 1382 |
| 807 | nmdc:mga0yw44_9165_c1 | 3300050492 | Bacteria | 4982 |
| 808 | nmdc:mga06z11_37_c1 | 3300050494 | Bacteria | 55036 |
| 809 | nmdc:mga06z11_527_c1 | 3300050494 | Bacteria | 14116 |
| 810 | nmdc:mga04h51_16_c1 | 3300050495 | Bacteria | 75553 |
| 811 | nmdc:mga04h51_237_c1 | 3300050495 | Bacteria | 14548 |
| 812 | nmdc:mga07m45_54793_c1 | 3300050496 | Bacteria | 2253 |
| 813 | nmdc:mga07m45_7_c1 | 3300050496 | Bacteria | 223540 |
| 814 | nmdc:mga0sz30_93_c1 | 3300050516 | Bacteria | 34625 |
| 815 | Ga0500610_0029819 | 3300053079 | Bacteria | 2759 |
| 816 | Ga0500578_0083426 | 3300053086 | Bacteria | 2031 |
| 817 | Ga0500643_000362 | 3300053087 | Bacteria | 35932 |
| 818 | Ga0500643_000503 | 3300053087 | Bacteria | 27831 |
| 819 | Ga0500643_034605 | 3300053087 | Bacteria | 1520 |
| 820 | Ga0500566_0068981 | 3300053094 | Bacteria | 1987 |
| 821 | Ga0500555_000799 | 3300053103 | Bacteria | 11353 |
| 822 | Ga0500560_002179 | 3300053107 | Bacteria | 3672 |
| 823 | Ga0500569_007159 | 3300053109 | Bacteria | 2490 |
| 824 | Ga0500594_0004461 | 3300053118 | Bacteria | 3084 |
| 825 | Ga0500607_000035 | 3300053121 | Bacteria | 87430 |
| 826 | Ga0500607_000148 | 3300053121 | Bacteria | 59763 |
| 827 | Ga0500618_001727 | 3300053125 | Bacteria | 9283 |
| 828 | Ga0500658_0001182 | 3300053134 | Bacteria | 10638 |
| 829 | Ga0500559_0001018 | 3300053136 | Bacteria | 17198 |
| 830 | Ga0500559_0001082 | 3300053136 | Bacteria | 16527 |
| 831 | Ga0500559_0002069 | 3300053136 | Bacteria | 10734 |
| 832 | Ga0500568_0012950 | 3300053139 | Bacteria | 3817 |
| 833 | Ga0500568_0017868 | 3300053139 | Bacteria | 3119 |
| 834 | Ga0500616_0000982 | 3300053153 | Bacteria | 30793 |
| 835 | Ga0500616_0028841 | 3300053153 | Bacteria | 3056 |
| 836 | Ga0500622_0004006 | 3300053156 | Bacteria | 9491 |
| 837 | Ga0500624_000010 | 3300053157 | Bacteria | 172530 |
| 838 | Ga0500624_000058 | 3300053157 | Bacteria | 70829 |
| 839 | Ga0500624_001715 | 3300053157 | Bacteria | 3240 |
| 840 | Ga0500634_0078120 | 3300053161 | Bacteria | 1713 |
| 841 | Ga0500636_0001294 | 3300053177 | Bacteria | 13591 |
| 842 | Ga0500637_0001441 | 3300053178 | Bacteria | 10136 |
| 843 | Ga0500645_001940 | 3300053730 | Bacteria | 9809 |
| 844 | Ga0500661_007303 | 3300055283 | Bacteria | 2048 |
| 845 | Ga0501082_0426651 | 3300060353 | Bacteria | 1158 |
| 846 | 2501073591 | 2501025501 | Bacteria | 7768574 |
| 847 | 2501082268 | 2501025502 | Bacteria | 9641094 |
| 848 | 2501411016 | 2501025504 | Bacteria | 8008976 |
| 849 | 2509128639 | 2508501125 | Bacteria | 7208311 |
| 850 | 2509387713 | 2509276021 | Bacteria | 7634384 |
| 851 | 2509443072 | 2509276033 | Bacteria | 7180565 |
| 852 | 2510132300 | 2510065019 | Bacteria | 6903379 |
| 853 | 2510250843 | 2510065045 | Bacteria | 7761063 |
| 854 | 2510839686 | 2510461069 | Bacteria | 5505000 |
| 855 | 2510898639 | 2510461076 | Bacteria | 8618824 |
| 856 | 2511086386 | 2510917013 | Bacteria | 9951648 |
| 857 | 2511096531 | 2510917014 | Bacteria | 8296963 |
| 858 | 2511102832 | 2510917015 | Bacteria | 7950052 |
| 859 | 2511186365 | 2510917028 | Bacteria | 6185411 |
| 860 | 2511197192 | 2510917030 | Bacteria | 7460662 |
| 861 | 2512346258 | 2512047030 | Bacteria | 9031815 |
| 862 | 2512642976 | 2512564014 | Bacteria | 4639632 |
| 863 | 2513552138 | 2513237082 | Bacteria | 8640282 |
| 864 | 2513560924 | 2513237083 | Bacteria | 8410967 |
| 865 | 2513569138 | 2513237084 | Bacteria | 7231967 |
| 866 | 2513578808 | 2513237085 | Bacteria | 7695351 |
| 867 | 2513596255 | 2513237088 | Bacteria | 6927906 |
| 868 | 2513632754 | 2513237093 | Bacteria | 7545552 |
| 869 | 2513709205 | 2513237103 | Bacteria | 7647401 |
| 870 | 2513868775 | 2513237138 | Bacteria | 7368160 |
| 871 | 2513907519 | 2513237144 | Bacteria | 7530820 |
| 872 | 2513925709 | 2513237146 | Bacteria | 7166346 |
| 873 | 2513960967 | 2513237151 | Bacteria | 6309801 |
| 874 | 2514020750 | 2513237162 | Bacteria | 7468464 |
| 875 | 2514048161 | 2513237166 | Bacteria | 10373764 |
| 876 | 2515111285 | 2515075009 | Bacteria | 7288508 |
| 877 | 2515637835 | 2515154113 | Bacteria | 7807172 |
| 878 | 2515642581 | 2515154114 | Bacteria | 7848616 |
| 879 | 2515659190 | 2515154116 | Bacteria | 7552979 |
| 880 | 2515679710 | 2515154122 | Bacteria | 8609520 |
| 881 | 2515688719 | 2515154123 | Bacteria | 6387382 |
| 882 | 2515740465 | 2515154134 | Bacteria | 7220242 |
| 883 | 2516020301 | 2515154189 | Bacteria | 9629850 |
| 884 | 2517039925 | 2516653077 | Bacteria | 7555578 |
| 885 | 2517075470 | 2516653085 | Bacteria | 7346596 |
| 886 | 2517094057 | 2517093000 | Bacteria | 7412387 |
| 887 | 2517405877 | 2517287029 | Bacteria | 6905599 |
| 888 | 2519458676 | 2519103095 | Bacteria | 6629912 |
| 889 | 2520375275 | 2519899620 | Bacteria | 6499161 |
| 890 | 2524460644 | 2524023209 | Bacteria | 6679728 |
| 891 | 2527075205 | 2526164713 | Bacteria | 6780608 |
| 892 | 2530643890 | 2529292951 | Bacteria | 6916614 |
| 893 | 2535515724 | 2534681796 | Bacteria | 7146037 |
| 894 | 2563063040 | 2562617112 | Bacteria | 10918404 |
| 895 | 2585203084 | 2582581294 | Bacteria | 6626667 |
| 896 | 2585220997 | 2582581298 | Bacteria | 7315509 |
| 897 | 2585231489 | 2582581299 | Bacteria | 6518058 |
| 898 | 2585256609 | 2582581304 | Bacteria | 5831370 |
| 899 | 2585273257 | 2582581307 | Bacteria | 6597605 |
| 900 | 2585278909 | 2582581308 | Bacteria | 7413247 |
| 901 | 2585292333 | 2582581311 | Bacteria | 6763856 |
| 902 | 2585325477 | 2582581315 | Bacteria | 7318924 |
| 903 | 2585400118 | 2582581867 | Bacteria | 7184437 |
| 904 | 2585527966 | 2585427526 | Bacteria | 7258840 |
| 905 | 2585549903 | 2585427529 | Bacteria | 7395659 |
| 906 | 2585554886 | 2585427530 | Bacteria | 7383882 |
| 907 | 2585559443 | 2585427531 | Bacteria | 6992870 |
| 908 | 2585822677 | 2585427590 | Bacteria | 6824633 |
| 909 | 2585847212 | 2585427594 | Bacteria | 6180594 |
| 910 | 2585902114 | 2585427608 | Bacteria | 6544331 |
| 911 | 2585905181 | 2585427609 | Bacteria | 6667127 |
| 912 | 2587979704 | 2585428125 | Bacteria | 6662905 |
| 913 | 2599418588 | 2599185170 | Bacteria | 7295545 |
| 914 | 2599737262 | 2599185239 | Bacteria | 8686614 |
| 915 | 2599746999 | 2599185240 | Bacteria | 7968121 |
| 916 | 2600208843 | 2599185355 | Bacteria | 7968906 |
| 917 | 2600809782 | 2600255067 | Bacteria | 6795583 |
| 918 | 2616296210 | 2615840624 | Bacteria | 6557588 |
| 919 | 2644007931 | 2643221599 | Bacteria | 6292121 |
| 920 | 2644196520 | 2643221634 | Bacteria | 6705461 |
| 921 | 2644242888 | 2643221643 | Bacteria | 5749658 |
| 922 | 2644296827 | 2643221653 | Bacteria | 4569637 |
| 923 | 2644655081 | 2643221719 | Bacteria | 4568197 |
| 924 | 2676744565 | 2675903129 | Bacteria | 7964495 |
| 925 | 2713477241 | 2711768613 | Bacteria | 11048459 |
| 926 | 2719180294 | 2718217882 | Bacteria | 6556348 |
| 927 | 2719384862 | 2718217927 | Bacteria | 6972593 |
| 928 | 2719639980 | 2718217991 | Bacteria | 7829542 |
| 929 | 2719664617 | 2718217997 | Bacteria | 6740740 |
| 930 | 2719731043 | 2718218009 | Bacteria | 6478651 |
| 931 | 2720491037 | 2718218199 | Bacteria | 6740745 |
| 932 | 2720612399 | 2718218232 | Bacteria | 6720332 |
| 933 | 2720619238 | 2718218233 | Bacteria | 6662049 |
| 934 | 2720630638 | 2718218235 | Bacteria | 6630699 |
| 935 | 2720774331 | 2718218269 | Bacteria | 6906114 |
| 936 | 2721146388 | 2718218363 | Bacteria | 6524337 |
| 937 | 2721157910 | 2718218365 | Bacteria | 6274507 |
| 938 | 2721163267 | 2718218366 | Bacteria | 6425255 |
| 939 | 2721398582 | 2718218423 | Bacteria | 6438183 |
| 940 | 2722839437 | 2721755514 | Bacteria | 6424414 |
| 941 | 2723026058 | 2721755556 | Bacteria | 6745503 |
| 942 | 2723559603 | 2721755684 | Bacteria | 6859907 |
| 943 | 2723566219 | 2721755685 | Bacteria | 6704835 |
| 944 | 2724037395 | 2721755809 | Bacteria | 6438790 |
| 945 | 2724043799 | 2721755810 | Bacteria | 6479005 |
| 946 | 2724088938 | 2721755819 | Bacteria | 6906405 |
| 947 | 2724103484 | 2721755822 | Bacteria | 6726041 |
| 948 | 2724109330 | 2721755823 | Bacteria | 6752556 |
| 949 | 2725948488 | 2724679232 | Bacteria | 7646494 |
| 950 | 2730106994 | 2728369352 | Bacteria | 6745171 |
| 951 | 2730163531 | 2728369365 | Bacteria | 6555560 |
| 952 | 2730297542 | 2728369397 | Bacteria | 6274511 |
| 953 | 2738709686 | 2738541275 | Bacteria | 4830863 |
| 954 | 2738802167 | 2738541293 | Bacteria | 7065685 |
| 955 | 2738820724 | 2738541296 | Bacteria | 7285013 |
| 956 | 2738833204 | 2738541298 | Bacteria | 7286732 |
| 957 | 2738848111 | 2738541301 | Bacteria | 4834102 |
| 958 | 2738863840 | 2738541304 | Bacteria | 4833665 |
| 959 | 2738874732 | 2738541306 | Bacteria | 7284992 |
| 960 | 2739186361 | 2738543002 | Bacteria | 7284546 |
| 961 | 2739221330 | 2738543008 | Bacteria | 7282815 |
| 962 | 2739296358 | 2738543022 | Bacteria | 4835059 |
| 963 | 2739358036 | 2738543033 | Bacteria | 4833336 |
| 964 | 2746089597 | 2744054900 | Bacteria | 8399525 |
| 965 | 2746098456 | 2744054901 | Bacteria | 8397047 |
| 966 | 2753566699 | 2751185846 | Bacteria | 7242164 |
| 967 | 2765584518 | 2765235841 | Bacteria | 6137024 |
| 968 | 2766067603 | 2765235942 | Bacteria | 7445910 |
| 969 | 2792836487 | 2791355137 | Bacteria | 9654227 |
| 970 | 2793296200 | 2791355256 | Bacteria | 6798008 |
| 971 | 2793317526 | 2791355259 | Bacteria | 7254731 |
| 972 | 2793321096 | 2791355260 | Bacteria | 6598818 |
| 973 | 2793327128 | 2791355261 | Bacteria | 6661293 |
| 974 | 2793333615 | 2791355262 | Bacteria | 6774204 |
| 975 | 2793339796 | 2791355263 | Bacteria | 6872478 |
| 976 | 2793347936 | 2791355264 | Bacteria | 6429314 |
| 977 | 2793353574 | 2791355265 | Bacteria | 6539969 |
| 978 | 2793367851 | 2791355267 | Bacteria | 7222458 |
| 979 | 2805926577 | 2802429605 | Bacteria | 6875453 |
| 980 | 2805933384 | 2802429606 | Bacteria | 6346811 |
| 981 | 2817260955 | 2816332253 | Bacteria | 6764532 |
| 982 | 2817278651 | 2816332256 | Bacteria | 6891714 |
| 983 | 2817451726 | 2816332286 | Bacteria | 6853759 |
| 984 | 2819242539 | 2818991272 | Bacteria | 4622173 |
| 985 | 2819620167 | 2818991450 | Bacteria | 6962147 |
| 986 | 2819634865 | 2818991452 | Bacteria | 8442785 |
| 987 | 2819639247 | 2818991453 | Bacteria | 7181617 |
| 988 | 2838017287 | 2838016132 | Bacteria | 6577831 |
| 989 | 2838037717 | 2838035591 | Bacteria | 7166484 |
| 990 | 2838047983 | 2838042994 | Bacteria | 6046894 |
| 991 | 2838049229 | 2838048938 | Bacteria | 6044578 |
| 992 | 2838063325 | 2838061910 | Bacteria | 6794874 |
| 993 | 2838662729 | 2838661181 | Bacteria | 7385261 |
| 994 | 2838670847 | 2838668709 | Bacteria | 6671819 |
| 995 | 2838681341 | 2838680041 | Bacteria | 6545511 |
| 996 | 2838688614 | 2838686498 | Bacteria | 7807632 |
| 997 | 2838694624 | 2838694306 | Bacteria | 6853137 |
| 998 | 2838703218 | 2838701080 | Bacteria | 6669771 |
| 999 | 2838708002 | 2838707686 | Bacteria | 6619912 |
| 1000 | 2838730909 | 2838729681 | Bacteria | 7400765 |
| 1001 | 2838744197 | 2838742623 | Bacteria | 7396178 |
| 1002 | 2841856878 | 2841851746 | Bacteria | 7532261 |
| 1003 | 2841865473 | 2841864319 | Bacteria | 6742987 |
| 1004 | 2842080767 | 2842077413 | Bacteria | 6508645 |
| 1005 | 2842114976 | 2842110456 | Bacteria | 7656360 |
| 1006 | 2842121386 | 2842118031 | Bacteria | 7033875 |
| 1007 | 2842147558 | 2842146304 | Bacteria | 5957337 |
| 1008 | 2842160048 | 2842156927 | Bacteria | 6894975 |
| 1009 | 2842168291 | 2842163707 | Bacteria | 6916235 |
| 1010 | 2842183335 | 2842180545 | Bacteria | 6888678 |
| 1011 | 2842197950 | 2842192696 | Bacteria | 6147454 |
| 1012 | 2842207697 | 2842205361 | Bacteria | 6340321 |
| 1013 | 2842221203 | 2842217011 | Bacteria | 7497767 |
| 1014 | 2842235064 | 2842229732 | Bacteria | 7475766 |
| 1015 | 2842237413 | 2842237096 | Bacteria | 6620661 |
| 1016 | 2842245661 | 2842243621 | Bacteria | 7421798 |
| 1017 | 2842252624 | 2842250916 | Bacteria | 6579627 |
| 1018 | 2842259689 | 2842257432 | Bacteria | 7401195 |
| 1019 | 2842266928 | 2842264693 | Bacteria | 6472963 |
| 1020 | 2842274528 | 2842271015 | Bacteria | 7807131 |
| 1021 | 2842281508 | 2842278818 | Bacteria | 6340002 |
| 1022 | 2842287117 | 2842285085 | Bacteria | 6011953 |
| 1023 | 2842294423 | 2842291075 | Bacteria | 7076806 |
| 1024 | 2842302448 | 2842298080 | Bacteria | 6123127 |
| 1025 | 2842306772 | 2842304105 | Bacteria | 7023636 |
| 1026 | 2842314746 | 2842311132 | Bacteria | 6616990 |
| 1027 | 2842318651 | 2842317721 | Bacteria | 6793725 |
| 1028 | 2842327389 | 2842324504 | Bacteria | 9364110 |
| 1029 | 2842343592 | 2842341865 | Bacteria | 7003929 |
| 1030 | 2842352004 | 2842348783 | Bacteria | 9002918 |
| 1031 | 2842360819 | 2842357229 | Bacteria | 6485165 |
| 1032 | 2842365251 | 2842363717 | Bacteria | 6844742 |
| 1033 | 2842371804 | 2842370503 | Bacteria | 7038661 |
| 1034 | 2842380821 | 2842377471 | Bacteria | 7140707 |
| 1035 | 2842387892 | 2842384541 | Bacteria | 7057858 |
| 1036 | 2842398265 | 2842395702 | Bacteria | 6780583 |
| 1037 | 2842404385 | 2842402390 | Bacteria | 6681310 |
| 1038 | 2842410930 | 2842409023 | Bacteria | 6687331 |
| 1039 | 2842417614 | 2842415677 | Bacteria | 6596907 |
| 1040 | 2842427356 | 2842422224 | Bacteria | 6239196 |
| 1041 | 2842431059 | 2842428310 | Bacteria | 6767288 |
| 1042 | 2842436943 | 2842434925 | Bacteria | 6502746 |
| 1043 | 2842443021 | 2842441272 | Bacteria | 6769273 |
| 1044 | 2842453243 | 2842447887 | Bacteria | 6754142 |
| 1045 | 2842458246 | 2842454564 | Bacteria | 8730687 |
| 1046 | 2842465032 | 2842462802 | Bacteria | 6588055 |
| 1047 | 2842471742 | 2842469257 | Bacteria | 6752936 |
| 1048 | 2842493757 | 2842489311 | Bacteria | 6620893 |
| 1049 | 2842497286 | 2842495871 | Bacteria | 6820686 |
| 1050 | 2842509729 | 2842509118 | Bacteria | 6850950 |
| 1051 | 2844455130 | 2844454524 | Bacteria | 7952546 |
| 1052 | 2856293700 | 2856287931 | Bacteria | 7223934 |
| 1053 | 2857362382 | 2857357740 | Bacteria | 9937880 |
| 1054 | 2857520292 | 2857516855 | Bacteria | 7787325 |
| 1055 | 2857579177 | 2857576091 | Bacteria | 5465855 |
| 1056 | 2863424507 | 2863421361 | Bacteria | 7300805 |
| 1057 | 2870071574 | 2870068957 | Bacteria | 8925310 |
| 1058 | 2883088851 | 2883087390 | Bacteria | 9532701 |
| 1059 | 2885278780 | 2885270888 | Bacteria | 9831543 |
| 1060 | 2900635095 | 2900634093 | Bacteria | 10263517 |
| 1061 | 2902689642 | 2902682994 | Bacteria | 8951596 |
| 1062 | 2904434881 | 2904434214 | Bacteria | 6230908 |
| 1063 | 2904484878 | 2904483920 | Bacteria | 7545285 |
| 1064 | 2904568708 | 2904564687 | Bacteria | 7609577 |
| 1065 | 2904575750 | 2904571731 | Bacteria | 7608790 |
| 1066 | 2904617066 | 2904615490 | Bacteria | 10047340 |
| 1067 | 2919103834 | 2919100787 | Bacteria | 7710546 |
| 1068 | 2919139300 | 2919138771 | Bacteria | 5281312 |
| 1069 | 2919530603 | 2919527303 | Bacteria | 7718827 |
| 1070 | 2919710841 | 2919709256 | Bacteria | 4318106 |
| 1071 | 2921650498 | 2921643360 | Bacteria | 11448031 |
| 1072 | 2923557565 | 2923556063 | Bacteria | 6793593 |
| 1073 | 2928101241 | 2928100450 | Bacteria | 4837635 |
| 1074 | 2928110274 | 2928108538 | Bacteria | 7360024 |
| 1075 | 2928138592 | 2928135762 | Bacteria | 7259641 |
| 1076 | 2928160506 | 2928157003 | Bacteria | 7522202 |
| 1077 | 2928164973 | 2928163908 | Bacteria | 7561269 |
| 1078 | 2928172708 | 2928170801 | Bacteria | 8785406 |
| 1079 | 2928505345 | 2928503688 | Bacteria | 7268108 |
| 1080 | 2928540767 | 2928536128 | Bacteria | 7657547 |
| 1081 | 2928960348 | 2928959182 | Bacteria | 4725774 |
| 1082 | 2933016845 | 2933016740 | Bacteria | 6355406 |
| 1083 | 2933573114 | 2933570622 | Bacteria | 7023390 |
| 1084 | 2933591375 | 2933586486 | Bacteria | 7667493 |
| 1085 | 2933604605 | 2933599457 | Bacteria | 5858799 |
| 1086 | 2935895146 | 2935894831 | Bacteria | 6620579 |
| 1087 | 2935904136 | 2935901341 | Bacteria | 7341747 |
| 1088 | 2936368122 | 2936367885 | Bacteria | 7324495 |
| 1089 | 2936381485 | 2936375103 | Bacteria | 6652732 |
| 1090 | 2936387381 | 2936381700 | Bacteria | 7006523 |
| 1091 | 2939656394 | 2939651529 | Bacteria | 5895393 |
| 1092 | 2945936990 | 2945934425 | Bacteria | 7444609 |
| 1093 | 2945962551 | 2945961074 | Bacteria | 7342064 |
| 1094 | 2981996188 | 2981990288 | Bacteria | 7590678 |
| 1095 | 2989778185 | 2989776772 | Bacteria | 4843317 |
| 1096 | 2990706282 | 2990703756 | Bacteria | 7715990 |
| 1097 | 2996890799 | 2996887358 | Bacteria | 5795980 |
| 1098 | 2996895080 | 2996893221 | Bacteria | 5823108 |
| 1099 | 3005453451 | 3005452660 | Bacteria | 5889319 |
| 1100 | 639647433 | 639633055 | Bacteria | 7751309 |
| 1101 | 642423104 | 641736151 | Bacteria | 7477263 |
| 1102 | 642415689 | 641736154 | Bacteria | 7689995 |
| 1103 | 642593424 | 642555112 | Bacteria | 8676562 |
| 1104 | 642621325 | 642555113 | Bacteria | 8214658 |
| 1105 | 8003955492 | 8003955200 | Bacteria | 8601927 |
| 1106 | 8005251314 | 8005246636 | Bacteria | 4933972 |
| 1107 | 8005261812 | 8005258706 | Bacteria | 6184835 |
| 1108 | 8005279582 | 8005275841 | Bacteria | 6929066 |
| 1109 | 8005284782 | 8005282627 | Bacteria | 6675747 |
| 1110 | 8005292792 | 8005289223 | Bacteria | 6634003 |
| 1111 | 8005311088 | 8005307578 | Bacteria | 7395396 |
| 1112 | 8005325326 | 8005321885 | Bacteria | 5795980 |
| 1113 | 8005376608 | 8005376324 | Bacteria | 6590079 |
| 1114 | 8005385997 | 8005382845 | Bacteria | 6732062 |
| 1115 | 8005400220 | 8005395548 | Bacteria | 6806915 |
| 1116 | 8005432269 | 8005430974 | Bacteria | 6689030 |
| 1117 | 8005461929 | 8005460587 | Bacteria | 7157962 |
| 1118 | 8005499331 | 8005497431 | Bacteria | 6477605 |
| 1119 | 8005558926 | 8005556819 | Bacteria | 6908598 |
| 1120 | 8005570436 | 8005563573 | Bacteria | 7153261 |
| 1121 | 8005620526 | 8005619151 | Bacteria | 7030230 |
| 1122 | 8005627508 | 8005626139 | Bacteria | 6534237 |
| 1123 | 8005670747 | 8005668836 | Bacteria | 6953162 |
| 1124 | 8005698789 | 8005695170 | Bacteria | 6912330 |
| 1125 | 8018131333 | 8018127388 | Bacteria | 7351159 |
| 1126 | 8018169158 | 8018163183 | Bacteria | 7277977 |
| 1127 | 8018177243 | 8018176218 | Bacteria | 6896178 |
| 1128 | 8018849794 | 8018845410 | Bacteria | 8933938 |
| 1129 | 8020813169 | 8020807995 | Bacteria | 6801506 |
| 1130 | 8020942251 | 8020938398 | Bacteria | 7472757 |
| 1131 | 8020951339 | 8020945358 | Bacteria | 8467355 |
| 1132 | 8020957881 | 8020953355 | Bacteria | 7439080 |
| 1133 | 8021124394 | 8021120328 | Bacteria | 8782274 |
| 1134 | 8023686957 | 8023680758 | Bacteria | 7729763 |
| 1135 | 8024489752 | 8024486573 | Bacteria | 6540512 |
| 1136 | 8024503251 | 8024501048 | Bacteria | 6427847 |
| 1137 | 8039104753 | 8039098773 | Bacteria | 6602928 |
| 1138 | 8040169894 | 8040167225 | Bacteria | 6542727 |
| 1139 | 8040173361 | 8040173305 | Bacteria | 6827067 |
| 1140 | 8054931283 | 8054929484 | Bacteria | 5599761 |
| 1141 | 8055268320 | 8055266321 | Bacteria | 7999742 |
| 1142 | 8055302362 | 8055301274 | Bacteria | 8587385 |
| 1143 | 8055882678 | 8055878733 | Bacteria | 5907058 |
| 1144 | 8056380731 | 8056375014 | Bacteria | 7006639 |
| 1145 | 8056384752 | 8056382006 | Bacteria | 6408074 |
| 1146 | 8057879587 | 8057874678 | Bacteria | 7494653 |
| 1147 | Ga0105240_10002827 | |||
| 1148 | SwRhRL2b_contig_1380016 | |||
| 1149 | JGI24741J21665_1001367 | |||
| 1150 | JGI24741J21665_1002735 | |||
| 1151 | JGI24740J21852_10000071 | |||
| 1152 | JGI24740J21852_10001830 | |||
| 1153 | JGI24739J22299_10001942 | |||
| 1154 | JGI24739J22299_10012850 | |||
| 1155 | JGI24737J22298_10005303 | |||
| 1156 | JGI24737J22298_10010517 | |||
| 1157 | JGI24737J22298_10023788 | |||
| 1158 | JGI24735J21928_10000180 | |||
| 1159 | JGI24735J21928_10000289 | |||
| 1160 | JGI24735J21928_10000371 | |||
| 1161 | JGI24735J21928_10008786 | |||
| 1162 | JGI24738J21930_10000001 | |||
| 1163 | JGI24738J21930_10003173 | |||
| 1164 | JGI25156J39149_1000859 | |||
| 1165 | JGI25156J39149_1001993 | |||
| 1166 | JGI25156J39149_1005504 | |||
| 1167 | JGI25158J39367_1000407 | |||
| 1168 | JGI25152J39213_1000623 | |||
| 1169 | JGI25152J39213_1003008 | |||
| 1170 | JGI25150J39212_1000033 | |||
| 1171 | JGI25150J39212_1001462 | |||
| 1172 | JGI25151J46595_10000108 | |||
| 1173 | JGI25151J46595_10015298 | |||
| 1174 | JGI25165J46597_1001483 | |||
| 1175 | JGI25165J46597_1002550 | |||
| 1176 | JGI25153J46596_10000563 | |||
| 1177 | JGI25153J46596_10009883 | |||
| 1178 | rootH1_10038444 | |||
| 1179 | JGI25160J50197_1000015 | |||
| 1180 | JGI25160J50197_1000064 | |||
| 1181 | JGI25160J50197_1012089 | |||
| 1182 | JGI25161J50226_1000005 | |||
| 1183 | Ga0055533_1000218 | |||
| 1184 | Ga0055532_1000001 | |||
| 1185 | Ga0055532_1000255 | |||
| 1186 | Ga0055532_1000388 | |||
| 1187 | Ga0055532_1000436 | |||
| 1188 | Ga0055527_1000002 | |||
| 1189 | Ga0055527_1000224 | |||
| 1190 | Ga0055527_1004258 | |||
| 1191 | Ga0055527_1007478 | |||
| 1192 | Ga0055535_1000001 | |||
| 1193 | Ga0055535_1000474 | |||
| 1194 | Ga0055535_1000693 | |||
| 1195 | Ga0055542_1000001 | |||
| 1196 | Ga0055542_1000673 | |||
| 1197 | Ga0055542_1006731 | |||
| 1198 | Ga0055529_1000026 | |||
| 1199 | Ga0055529_1000608 | |||
| 1200 | Ga0055529_1005398 | |||
| 1201 | Ga0055526_1026225 | |||
| 1202 | Ga0055524_1003638 | |||
| 1203 | Ga0055524_1014079 | |||
| 1204 | Ga0055524_1026782 | |||
| 1205 | Ga0055528_1003635 | |||
| 1206 | Ga0055528_1005083 | |||
| 1207 | Ga0055528_1007761 | |||
| 1208 | Ga0055528_1012526 | |||
| 1209 | Ga0055540_1008490 | |||
| 1210 | Ga0055543_1000012 | |||
| 1211 | Ga0065165_1000325 | |||
| 1212 | Ga0065165_1003987 | |||
| 1213 | Ga0065704_10001512 | |||
| 1214 | Ga0065704_10071185 | |||
| 1215 | Ga0070658_10010072 | |||
| 1216 | Ga0070658_10052541 | |||
| 1217 | Ga0070670_100042569 | |||
| 1218 | Ga0070666_10014803 | |||
| 1219 | Ga0070666_10307719 | |||
| 1220 | Ga0070660_100000509 | |||
| 1221 | Ga0070660_100001423 | |||
| 1222 | Ga0070668_100000019 | |||
| 1223 | Ga0070668_100008368 | |||
| 1224 | Ga0070668_100062139 | |||
| 1225 | Ga0070669_100016598 | |||
| 1226 | Ga0070671_100009450 | |||
| 1227 | Ga0070671_100033072 | |||
| 1228 | Ga0070659_100000015 | |||
| 1229 | Ga0070659_100036438 | |||
| 1230 | Ga0070667_100000094 | |||
| 1231 | Ga0070667_100102079 | |||
| 1232 | Ga0070667_100148201 | |||
| 1233 | Ga0070663_100000602 | |||
| 1234 | Ga0070663_100169386 | |||
| 1235 | Ga0070662_100000624 | |||
| 1236 | Ga0068853_100001013 | |||
| 1237 | Ga0068853_100001046 | |||
| 1238 | Ga0068853_100030570 | |||
| 1239 | Ga0070665_100001576 | |||
| 1240 | Ga0070665_100052647 | |||
| 1241 | Ga0070665_100208920 | |||
| 1242 | Ga0068855_100009188 | |||
| 1243 | Ga0068855_100009504 | |||
| 1244 | Ga0068855_100011395 | |||
| 1245 | Ga0068855_100161877 | |||
| 1246 | Ga0068855_100224865 | |||
| 1247 | Ga0070664_100291744 | |||
| 1248 | Ga0068857_100004355 | |||
| 1249 | Ga0068857_100036828 | |||
| 1250 | Ga0068854_100012363 | |||
| 1251 | Ga0068854_100040155 | |||
| 1252 | Ga0068856_100000374 | |||
| 1253 | Ga0068852_100014797 | |||
| 1254 | Ga0068859_100092607 | |||
| 1255 | Ga0068851_10002777 | |||
| 1256 | Ga0068863_100000057 | |||
| 1257 | Ga0068863_100001297 | |||
| 1258 | Ga0068863_100041355 | |||
| 1259 | Ga0068860_100000623 | |||
| 1260 | Ga0068860_100004802 | |||
| 1261 | Ga0068860_100101614 | |||
| 1262 | Ga0068862_100000194 | |||
| 1263 | Ga0068862_100048804 | |||
| 1264 | Ga0075365_10001318 | |||
| 1265 | Ga0075365_10009667 | |||
| 1266 | Ga0075368_10000019 | |||
| 1267 | Ga0075363_100006825 | |||
| 1268 | Ga0075363_100014895 | |||
| 1269 | Ga0075362_10003928 | |||
| 1270 | Ga0075367_10000795 | |||
| 1271 | Ga0075369_10000498 | |||
| 1272 | Ga0075366_10008922 | |||
| 1273 | Ga0075370_10004487 | |||
| 1274 | Ga0075370_10010880 | |||
| 1275 | Ga0075370_10014093 | |||
| 1276 | Ga0097620_100092612 | |||
| 1277 | Ga0079104_1011926 | |||
| 1278 | Ga0105251_10000134 | |||
| 1279 | Ga0105251_10000167 | |||
| 1280 | Ga0105251_10001159 | |||
| 1281 | Ga0105251_10002394 | |||
| 1282 | Ga0105251_10004353 | |||
| 1283 | Ga0105251_10031535 | |||
| 1284 | Ga0105244_10043714 | |||
| 1285 | Ga0105240_10001649 | |||
| 1286 | Ga0105240_10001654 | |||
| 1287 | Ga0105240_10002976 | |||
| 1288 | Ga0105240_10010622 | |||
| 1289 | Ga0105240_10020477 | |||
| 1290 | Ga0105240_10054519 | |||
| 1291 | Ga0105240_10075107 | |||
| 1292 | Ga0105247_10003919 | |||
| 1293 | Ga0105247_10038239 | |||
| 1294 | Ga0105241_10017153 | |||
| 1295 | Ga0105241_10121729 | |||
| 1296 | Ga0105237_10011460 | |||
| 1297 | Ga0105237_10087097 | |||
| 1298 | Ga0105238_10026668 | |||
| 1299 | Ga0105249_10000135 | |||
| 1300 | Ga0105249_10194843 | |||
| 1301 | Ga0123341_1000062 | |||
| 1302 | Ga0123342_1014931 | |||
| 1303 | Ga0105239_10001422 | |||
| 1304 | Ga0105239_10011808 | |||
| 1305 | Ga0105239_10044978 | |||
| 1306 | Ga0105246_10181244 | |||
| 1307 | Ga0105246_10235272 | |||
| 1308 | Ga0157373_10000535 | |||
| 1309 | Ga0157373_10001841 | |||
| 1310 | Ga0157371_10003242 | |||
| 1311 | Ga0157371_10006163 | |||
| 1312 | Ga0157370_10001866 | |||
| 1313 | Ga0157370_10010833 | |||
| 1314 | Ga0157370_10028140 | |||
| 1315 | Ga0157369_10001453 | |||
| 1316 | Ga0157369_10008887 | |||
| 1317 | Ga0157369_10115264 | |||
| 1318 | Ga0157369_10145516 | |||
| 1319 | Ga0157374_10000155 | |||
| 1320 | Ga0157374_10207720 | |||
| 1321 | Ga0157372_10003812 | |||
| 1322 | Ga0157372_10007709 | |||
| 1323 | Ga0182008_10020817 | |||
| 1324 | Ga0182006_1052259 | |||
| 1325 | Ga0182007_10000453 | |||
| 1326 | Ga0182007_10045038 | |||
| 1327 | Ga0183361_10013 | |||
| 1328 | Ga0163161_10011715 | |||
| 1329 | Ga0163161_10026686 | |||
| 1330 | Ga0213872_10038064 | |||
| 1331 | Ga0209436_111054 | |||
| 1332 | Ga0209566_100485 | |||
| 1333 | Ga0209674_100005 | |||
| 1334 | Ga0209674_100265 | |||
| 1335 | Ga0209672_100001 | |||
| 1336 | Ga0209672_100037 | |||
| 1337 | Ga0209672_100080 | |||
| 1338 | Ga0209672_101567 | |||
| 1339 | Ga0209147_100001 | |||
| 1340 | Ga0209147_100049 | |||
| 1341 | Ga0209147_100071 | |||
| 1342 | Ga0209147_100305 | |||
| 1343 | Ga0209147_100358 | |||
| 1344 | Ga0209563_100426 | |||
| 1345 | Ga0207427_101045 | |||
| 1346 | Ga0209437_100033 | |||
| 1347 | Ga0209258_100001 | |||
| 1348 | Ga0209258_100066 | |||
| 1349 | Ga0209258_100082 | |||
| 1350 | Ga0207425_1000031 | |||
| 1351 | Ga0209148_1000003 | |||
| 1352 | Ga0209148_1000168 | |||
| 1353 | Ga0209148_1000755 | |||
| 1354 | Ga0209759_1000029 | |||
| 1355 | Ga0209759_1000232 | |||
| 1356 | Ga0209759_1000284 | |||
| 1357 | Ga0209759_1020083 | |||
| 1358 | Ga0209129_1000053 | |||
| 1359 | Ga0209129_1003371 | |||
| 1360 | Ga0209129_1003477 | |||
| 1361 | Ga0209233_1000043 | |||
| 1362 | Ga0209233_1000064 | |||
| 1363 | Ga0209455_1000001 | |||
| 1364 | Ga0209455_1000141 | |||
| 1365 | Ga0209455_1000406 | |||
| 1366 | Ga0209673_1000041 | |||
| 1367 | Ga0209673_1000076 | |||
| 1368 | Ga0209673_1000319 | |||
| 1369 | Ga0209673_1009838 | |||
| 1370 | Ga0209673_1011121 | |||
| 1371 | Ga0209673_1017384 | |||
| 1372 | Ga0209673_1026238 | |||
| 1373 | Ga0209130_1000018 | |||
| 1374 | Ga0209130_1019763 | |||
| 1375 | Ga0209130_1024712 | |||
| 1376 | Ga0209676_1005581 | |||
| 1377 | Ga0209676_1011391 | |||
| 1378 | Ga0209025_1000087 | |||
| 1379 | Ga0209025_1001440 | |||
| 1380 | Ga0209025_1008335 | |||
| 1381 | Ga0209025_1012200 | |||
| 1382 | Ga0209025_1024975 | |||
| 1383 | Ga0209564_1004356 | |||
| 1384 | Ga0209564_1004856 | |||
| 1385 | Ga0209564_1011003 | |||
| 1386 | Ga0209564_1014511 | |||
| 1387 | Ga0209564_1019962 | |||
| 1388 | Ga0209758_1000081 | |||
| 1389 | Ga0209758_1026335 | |||
| 1390 | Ga0209758_1054374 | |||
| 1391 | Ga0209050_1006521 | |||
| 1392 | Ga0209256_1002348 | |||
| 1393 | Ga0209256_1005095 | |||
| 1394 | Ga0209256_1011373 | |||
| 1395 | Ga0209256_1011458 | |||
| 1396 | Ga0209256_1011586 | |||
| 1397 | Ga0207426_1000044 | |||
| 1398 | Ga0207426_1000050 | |||
| 1399 | Ga0207426_1003692 | |||
| 1400 | Ga0209051_1000514 | |||
| 1401 | Ga0209051_1019345 | |||
| 1402 | Ga0209257_1007417 | |||
| 1403 | Ga0207656_10003457 | |||
| 1404 | Ga0207655_1017087 | |||
| 1405 | Ga0207713_1000287 | |||
| 1406 | Ga0207713_1000353 | |||
| 1407 | Ga0207713_1001378 | |||
| 1408 | Ga0207710_10002272 | |||
| 1409 | Ga0207710_10018232 | |||
| 1410 | Ga0207680_10026506 | |||
| 1411 | Ga0207647_10000378 | |||
| 1412 | Ga0207647_10000955 | |||
| 1413 | Ga0207647_10007158 | |||
| 1414 | Ga0207647_10009767 | |||
| 1415 | Ga0207647_10013606 | |||
| 1416 | Ga0207647_10037821 | |||
| 1417 | Ga0207654_10058678 | |||
| 1418 | Ga0207695_10000978 | |||
| 1419 | Ga0207695_10001867 | |||
| 1420 | Ga0207695_10002000 | |||
| 1421 | Ga0207695_10006039 | |||
| 1422 | Ga0207695_10006482 | |||
| 1423 | Ga0207695_10108988 | |||
| 1424 | Ga0207695_10303128 | |||
| 1425 | Ga0207671_10074044 | |||
| 1426 | Ga0207657_10000014 | |||
| 1427 | Ga0207657_10000817 | |||
| 1428 | Ga0207649_10055074 | |||
| 1429 | Ga0207681_10074006 | |||
| 1430 | Ga0207694_10009008 | |||
| 1431 | Ga0207694_10142748 | |||
| 1432 | Ga0207650_10001915 | |||
| 1433 | Ga0207650_10053914 | |||
| 1434 | Ga0207650_10072351 | |||
| 1435 | Ga0207644_10000980 | |||
| 1436 | Ga0207690_10000023 | |||
| 1437 | Ga0207690_10019011 | |||
| 1438 | Ga0207706_10000383 | |||
| 1439 | Ga0207706_10000803 | |||
| 1440 | Ga0207711_10001289 | |||
| 1441 | Ga0207667_10011185 | |||
| 1442 | Ga0207667_10016938 | |||
| 1443 | Ga0207667_10045434 | |||
| 1444 | Ga0207667_10083774 | |||
| 1445 | Ga0207667_10311208 | |||
| 1446 | Ga0207712_10000101 | |||
| 1447 | Ga0207668_10000059 | |||
| 1448 | Ga0207668_10100688 | |||
| 1449 | Ga0207640_10001832 | |||
| 1450 | Ga0207640_10035218 | |||
| 1451 | Ga0207658_10000072 | |||
| 1452 | Ga0207658_10157198 | |||
| 1453 | Ga0207639_10000264 | |||
| 1454 | Ga0207639_10001734 | |||
| 1455 | Ga0207639_10008995 | |||
| 1456 | Ga0207678_10001433 | |||
| 1457 | Ga0207678_10002131 | |||
| 1458 | Ga0207678_10081418 | |||
| 1459 | Ga0207678_10372999 | |||
| 1460 | Ga0207702_10002199 | |||
| 1461 | Ga0207641_10000096 | |||
| 1462 | Ga0207641_10004130 | |||
| 1463 | Ga0207641_10007904 | |||
| 1464 | Ga0207674_10006865 | |||
| 1465 | Ga0207698_10000442 | |||
| 1466 | Ga0209371_1009354 | |||
| 1467 | Ga0209813_10000046 | |||
| 1468 | Ga0209813_10001560 | |||
| 1469 | Ga0268266_10000387 | |||
| 1470 | Ga0268266_10037403 | |||
| 1471 | Ga0268266_10154101 | |||
| 1472 | Ga0268265_10000151 | |||
| 1473 | Ga0268265_10038765 | |||
| 1474 | Ga0268265_10340962 | |||
| 1475 | Ga0268264_10000303 | |||
| 1476 | Ga0268264_10009257 | |||
| 1477 | Ga0268264_10016664 | |||
| 1478 | Ga0307515_10188949 | |||
| 1479 | Ga0265338_10000022 | |||
| 1480 | Ga0265338_10202898 | |||
| 1481 | Ga0268256_1009896 | |||
| 1482 | Ga0265327_10021679 | |||
| 1483 | Ga0265327_10028444 | |||
| 1484 | Ga0307513_10074356 | |||
| 1485 | Ga0307408_100000134 | |||
| 1486 | Ga0307408_100044834 | |||
| 1487 | Ga0316578_10109153 | |||
| 1488 | Ga0307405_10001276 | |||
| 1489 | Ga0307405_10008943 | |||
| 1490 | Ga0307405_10010173 | |||
| 1491 | Ga0307407_10161317 | |||
| 1492 | Ga0307412_10000024 | |||
| 1493 | Ga0307412_10000516 | |||
| 1494 | Ga0307412_10000862 | |||
| 1495 | Ga0307412_10002325 | |||
| 1496 | Ga0307412_10052752 | |||
| 1497 | Ga0307409_100017939 | |||
| 1498 | Ga0307416_100003840 | |||
| 1499 | Ga0307416_100427521 | |||
| 1500 | Ga0307414_10005205 | |||
| 1501 | Ga0307411_10039379 | |||
| 1502 | Ga0316583_10003812 | |||
| 1503 | Ga0307510_10159989 | |||
| 1504 | Ga0316574_0024916 | |||
| 1505 | Ga0316582_0178756 | |||
| 1506 | Ga0316584_0061527 | |||
| 1507 | Ga0316584_0066494 | |||
| 1508 | Ga0395898_0008451 | |||
| 1509 | Ga0395905_0000041 | |||
| 1510 | Ga0395905_0061057 | |||
| 1511 | Ga0395905_0061884 | |||
| 1512 | Ga0400484_20111 | |||
| 1513 | Ga0400484_23104 | |||
| 1514 | Ga0400484_35008 | |||
| 1515 | Ga0400490_46345 | |||
| 1516 | Ga0400490_48495 | |||
| 1517 | Ga0400488_57407 | |||
| 1518 | Ga0400483_001970 | |||
| 1519 | Ga0400483_012467 | |||
| 1520 | Ga0400483_043932 | |||
| 1521 | Ga0400483_156899 | |||
| 1522 | Ga0400483_169173 | |||
| 1523 | Ga0400483_209372 | |||
| 1524 | Ga0400489_67634 | |||
| 1525 | Ga0400487_45314 | |||
| 1526 | Ga0436361_0866616 | |||
| 1527 | Ga0436361_1107681 | |||
| 1528 | Ga0439465_0009811 | |||
| 1529 | Ga0451833_0084816 | |||
| 1530 | Ga0451835_0334487 | |||
| 1531 | Ga0451837_0659144 | |||
| 1532 | Ga0451841_0514518 | |||
| 1533 | Ga0451845_0226581 | |||
| 1534 | Ga0451849_0695212 | |||
| 1535 | Ga0451843_0534843 | |||
| 1536 | Ga0451855_0155246 | |||
| 1537 | Ga0451853_1273235 | |||
| 1538 | Ga0451853_1348410 | |||
| 1539 | Ga0439448_0000074 | |||
| 1540 | Ga0439449_0023893 | |||
| 1541 | Ga0439456_000129 | |||
| 1542 | Ga0439463_000319 | |||
| 1543 | Ga0466969_0028950 | |||
| 1544 | Ga0466961_0000305 | |||
| 1545 | Ga0466970_0027842 | |||
| 1546 | Ga0466959_0005513 | |||
| 1547 | Ga0466959_0081253 | |||
| 1548 | Ga0466967_0214492 | |||
| 1549 | Ga0495617_017103 | |||
| 1550 | Ga0495617_026763 | |||
| 1551 | Ga0495617_050341 | |||
| 1552 | Ga0495627_000036 | |||
| 1553 | Ga0495627_000112 | |||
| 1554 | Ga0495627_003895 | |||
| 1555 | Ga0495592_0031280 | |||
| 1556 | Ga0495592_0055849 | |||
| 1557 | Ga0495603_0001311 | |||
| 1558 | Ga0495603_0002931 | |||
| 1559 | Ga0495603_0156817 | |||
| 1560 | Ga0495590_0001712 | |||
| 1561 | Ga0495591_000009 | |||
| 1562 | Ga0495591_001145 | |||
| 1563 | Ga0495591_001533 | |||
| 1564 | Ga0495629_0000098 | |||
| 1565 | Ga0495629_0004355 | |||
| 1566 | Ga0495629_0027417 | |||
| 1567 | Ga0495629_0031675 | |||
| 1568 | Ga0495629_0062089 | |||
| 1569 | Ga0495638_0000018 | |||
| 1570 | Ga0495638_0000789 | |||
| 1571 | Ga0495638_0023885 | |||
| 1572 | Ga0495638_0073027 | |||
| 1573 | Ga0495641_0015729 | |||
| 1574 | Ga0495641_0071002 | |||
| 1575 | Ga0495651_0018150 | |||
| 1576 | Ga0495653_0001085 | |||
| 1577 | Ga0495650_0000143 | |||
| 1578 | Ga0495650_0001210 | |||
| 1579 | Ga0495650_0001914 | |||
| 1580 | Ga0495650_0004473 | |||
| 1581 | Ga0495650_0017008 | |||
| 1582 | Ga0495650_0093586 | |||
| 1583 | Ga0495650_0095354 | |||
| 1584 | Ga0495580_0000171 | |||
| 1585 | Ga0495580_0000453 | |||
| 1586 | Ga0495580_0004700 | |||
| 1587 | Ga0495580_0007124 | |||
| 1588 | Ga0495582_0000525 | |||
| 1589 | Ga0495582_0016774 | |||
| 1590 | Ga0495605_0000001 | |||
| 1591 | Ga0495605_0001810 | |||
| 1592 | Ga0495605_0010044 | |||
| 1593 | Ga0495605_0030068 | |||
| 1594 | Ga0495605_0031121 | |||
| 1595 | Ga0495605_0041962 | |||
| 1596 | Ga0495664_0000427 | |||
| 1597 | Ga0495664_0009862 | |||
| 1598 | Ga0495664_0024223 | |||
| 1599 | Ga0495584_0002425 | |||
| 1600 | Ga0495584_0003436 | |||
| 1601 | Ga0495585_0000127 | |||
| 1602 | Ga0495585_0011184 | |||
| 1603 | Ga0495596_0016143 | |||
| 1604 | Ga0495607_0000291 | |||
| 1605 | Ga0495607_0036799 | |||
| 1606 | Ga0495607_0041622 | |||
| 1607 | Ga0495607_0055940 | |||
| 1608 | Ga0495583_0000010 | |||
| 1609 | Ga0495583_0000187 | |||
| 1610 | Ga0495583_0003226 | |||
| 1611 | Ga0495583_0009731 | |||
| 1612 | Ga0495583_0012736 | |||
| 1613 | Ga0495583_0025948 | |||
| 1614 | Ga0495583_0028074 | |||
| 1615 | Ga0495606_0000013 | |||
| 1616 | Ga0495606_0000465 | |||
| 1617 | Ga0495606_0006635 | |||
| 1618 | Ga0495606_0015352 | |||
| 1619 | Ga0495606_0029147 | |||
| 1620 | Ga0495606_0034450 | |||
| 1621 | Ga0495608_0050496 | |||
| 1622 | Ga0495610_0000079 | |||
| 1623 | Ga0495610_0000454 | |||
| 1624 | Ga0495610_0006916 | |||
| 1625 | Ga0495610_0019401 | |||
| 1626 | Ga0495610_0026996 | |||
| 1627 | Ga0495610_0083268 | |||
| 1628 | Ga0495616_0031447 | |||
| 1629 | Ga0495618_0004983 | |||
| 1630 | Ga0495618_0077538 | |||
| 1631 | Ga0495620_0000994 | |||
| 1632 | Ga0495620_0012599 | |||
| 1633 | Ga0495620_0018123 | |||
| 1634 | Ga0495620_0060633 | |||
| 1635 | Ga0495620_0063593 | |||
| 1636 | Ga0495628_0001765 | |||
| 1637 | Ga0495628_0038569 | |||
| 1638 | Ga0495628_0082721 | |||
| 1639 | Ga0495630_0013137 | |||
| 1640 | Ga0495630_0036611 | |||
| 1641 | Ga0495631_0023144 | |||
| 1642 | Ga0495631_0024916 | |||
| 1643 | Ga0495631_0041542 | |||
| 1644 | Ga0495632_0000001 | |||
| 1645 | Ga0495632_0000384 | |||
| 1646 | Ga0495632_0002606 | |||
| 1647 | Ga0495632_0012263 | |||
| 1648 | Ga0495632_0013825 | |||
| 1649 | Ga0495637_0000021 | |||
| 1650 | Ga0495637_0000039 | |||
| 1651 | Ga0495637_0000341 | |||
| 1652 | Ga0495643_0000004 | |||
| 1653 | Ga0495643_0000006 | |||
| 1654 | Ga0495643_0008058 | |||
| 1655 | Ga0495643_0008694 | |||
| 1656 | Ga0495643_0061802 | |||
| 1657 | Ga0495643_0072977 | |||
| 1658 | Ga0495644_0006565 | |||
| 1659 | Ga0495648_0000018 | |||
| 1660 | Ga0495648_0008954 | |||
| 1661 | Ga0495648_0014093 | |||
| 1662 | Ga0495648_0014491 | |||
| 1663 | Ga0495648_0049425 | |||
| 1664 | Ga0495648_0053979 | |||
| 1665 | Ga0495648_0063237 | |||
| 1666 | Ga0495663_0000001 | |||
| 1667 | Ga0495666_0000074 | |||
| 1668 | Ga0495666_0004808 | |||
| 1669 | Ga0495666_0025770 | |||
| 1670 | Ga0495666_0041903 | |||
| 1671 | Ga0495642_0018477 | |||
| 1672 | Ga0495642_0032774 | |||
| 1673 | Ga0495652_0007094 | |||
| 1674 | Ga0495652_0030195 | |||
| 1675 | Ga0495652_0059204 | |||
| 1676 | Ga0495665_0004010 | |||
| 1677 | Ga0495665_0020483 | |||
| 1678 | Ga0495640_0001565 | |||
| 1679 | Ga0495586_0000719 | |||
| 1680 | Ga0495586_0072913 | |||
| 1681 | Ga0495587_0002495 | |||
| 1682 | Ga0495609_0000020 | |||
| 1683 | Ga0495609_0000062 | |||
| 1684 | Ga0495609_0034433 | |||
| 1685 | Ga0495609_0092950 | |||
| 1686 | Ga0495597_0018676 | |||
| 1687 | Ga0495597_0042519 | |||
| 1688 | Ga0495597_0062098 | |||
| 1689 | Ga0495645_0000821 | |||
| 1690 | Ga0495645_0017472 | |||
| 1691 | Ga0495622_0000161 | |||
| 1692 | Ga0495622_0003817 | |||
| 1693 | Ga0495633_0000654 | |||
| 1694 | Ga0495633_0002962 | |||
| 1695 | Ga0495633_0038731 | |||
| 1696 | Ga0495667_0030219 | |||
| 1697 | Ga0495668_0002893 | |||
| 1698 | Ga0495668_0003158 | |||
| 1699 | Ga0495668_0162455 | |||
| 1700 | Ga0495634_0030483 | |||
| 1701 | Ga0495634_0063547 | |||
| 1702 | Ga0495611_0000802 | |||
| 1703 | Ga0495611_0014233 | |||
| 1704 | Ga0495611_0018446 | |||
| 1705 | Ga0495625_0000028 | |||
| 1706 | Ga0495625_0088285 | |||
| 1707 | Ga0495625_0130589 | |||
| 1708 | Ga0495625_0166481 | |||
| 1709 | Ga0495635_0001780 | |||
| 1710 | Ga0495635_0011861 | |||
| 1711 | Ga0495661_0000001 | |||
| 1712 | Ga0495661_0000452 | |||
| 1713 | Ga0495661_0002554 | |||
| 1714 | Ga0495661_0020661 | |||
| 1715 | Ga0495661_0066013 | |||
| 1716 | Ga0495588_0089999 | |||
| 1717 | Ga0495599_0001334 | |||
| 1718 | Ga0495599_0086326 | |||
| 1719 | Ga0495623_0030229 | |||
| 1720 | Ga0495623_0055696 | |||
| 1721 | Ga0495646_0004287 | |||
| 1722 | Ga0495646_0060634 | |||
| 1723 | Ga0495646_0063021 | |||
| 1724 | Ga0495613_0001656 | |||
| 1725 | Ga0495613_0022700 | |||
| 1726 | Ga0495624_0000139 | |||
| 1727 | Ga0495624_0001598 | |||
| 1728 | Ga0495624_0017849 | |||
| 1729 | Ga0495624_0041382 | |||
| 1730 | Ga0495671_0000008 | |||
| 1731 | Ga0495671_0000011 | |||
| 1732 | Ga0495671_0021871 | |||
| 1733 | Ga0495649_0001018 | |||
| 1734 | Ga0495649_0029508 | |||
| 1735 | Ga0495649_0090989 | |||
| 1736 | Ga0495589_0001308 | |||
| 1737 | Ga0495600_0006701 | |||
| 1738 | Ga0495600_0017912 | |||
| 1739 | Ga0495660_0001564 | |||
| 1740 | Ga0495660_0004492 | |||
| 1741 | Ga0495660_0005072 | |||
| 1742 | Ga0495660_0043208 | |||
| 1743 | Ga0495581_0003108 | |||
| 1744 | Ga0495581_0037869 | |||
| 1745 | Ga0495604_0005687 | |||
| 1746 | Ga0495604_0006799 | |||
| 1747 | Ga0495604_0010696 | |||
| 1748 | Ga0495674_0017011 | |||
| 1749 | Ga0495674_0019792 | |||
| 1750 | Ga0495674_0025181 | |||
| 1751 | Ga0495674_0089116 | |||
| 1752 | Ga0495674_0131504 | |||
| 1753 | Ga0495672_0002374 | |||
| 1754 | Ga0495672_0093592 | |||
| 1755 | Ga0495676_0000006 | |||
| 1756 | Ga0495676_0012034 | |||
| 1757 | Ga0495680_0001584 | |||
| 1758 | Ga0495680_0036781 | |||
| 1759 | Ga0495683_0004017 | |||
| 1760 | Ga0495683_0008208 | |||
| 1761 | Ga0495683_0011601 | |||
| 1762 | Ga0495683_0077524 | |||
| 1763 | Ga0495687_000022 | |||
| 1764 | Ga0495687_013299 | |||
| 1765 | Ga0495687_052200 | |||
| 1766 | Ga0495675_0001909 | |||
| 1767 | Ga0495675_0024964 | |||
| 1768 | Ga0495679_000025 | |||
| 1769 | Ga0495679_000150 | |||
| 1770 | Ga0495679_001462 | |||
| 1771 | Ga0495679_001545 | |||
| 1772 | Ga0495679_002123 | |||
| 1773 | Ga0495673_0000013 | |||
| 1774 | Ga0495673_0001371 | |||
| 1775 | Ga0495673_0018744 | |||
| 1776 | Ga0495673_0077707 | |||
| 1777 | Ga0495681_0000013 | |||
| 1778 | Ga0495681_0006336 | |||
| 1779 | Ga0495681_0007358 | |||
| 1780 | Ga0495681_0017500 | |||
| 1781 | Ga0495681_0063780 | |||
| 1782 | Ga0495681_0069759 | |||
| 1783 | Ga0495686_0000002 | |||
| 1784 | Ga0495686_0001007 | |||
| 1785 | Ga0495686_0007932 | |||
| 1786 | Ga0495686_0008600 | |||
| 1787 | Ga0495686_0010825 | |||
| 1788 | Ga0495686_0022216 | |||
| 1789 | Ga0495686_0047104 | |||
| 1790 | Ga0495686_0151542 | |||
| 1791 | Ga0495593_0016281 | |||
| 1792 | Ga0495593_0027125 | |||
| 1793 | Ga0495602_0023652 | |||
| 1794 | Ga0495602_0092751 | |||
| 1795 | Ga0495614_0019197 | |||
| 1796 | Ga0495614_0020202 | |||
| 1797 | Ga0495614_0107656 | |||
| 1798 | Ga0495615_0000003 | |||
| 1799 | Ga0495615_0019725 | |||
| 1800 | Ga0495626_0000019 | |||
| 1801 | Ga0495626_0046844 | |||
| 1802 | Ga0495626_0070012 | |||
| 1803 | Ga0496100_0011566 | |||
| 1804 | Ga0496100_0054065 | |||
| 1805 | Ga0496101_0000369 | |||
| 1806 | Ga0496101_0005003 | |||
| 1807 | Ga0496101_0062915 | |||
| 1808 | Ga0496102_0000258 | |||
| 1809 | Ga0496102_0000551 | |||
| 1810 | Ga0496102_0015568 | |||
| 1811 | Ga0496103_0000098 | |||
| 1812 | Ga0496103_0000326 | |||
| 1813 | Ga0496103_0004631 | |||
| 1814 | Ga0496103_0019256 | |||
| 1815 | Ga0496104_0004611 | |||
| 1816 | Ga0496104_0155388 | |||
| 1817 | Ga0496105_0055157 | |||
| 1818 | Ga0496105_0089119 | |||
| 1819 | Ga0496106_0003362 | |||
| 1820 | Ga0496106_0023088 | |||
| 1821 | Ga0496107_0001254 | |||
| 1822 | Ga0496108_0000763 | |||
| 1823 | Ga0496108_0145994 | |||
| 1824 | Ga0496110_0008899 | |||
| 1825 | Ga0496110_0014287 | |||
| 1826 | Ga0496110_0177981 | |||
| 1827 | Ga0496110_0320182 | |||
| 1828 | Ga0496111_0001285 | |||
| 1829 | Ga0496113_0004334 | |||
| 1830 | Ga0496113_0336840 | |||
| 1831 | Ga0496114_0000981 | |||
| 1832 | Ga0496114_0017947 | |||
| 1833 | Ga0496114_0031622 | |||
| 1834 | Ga0496115_0178355 | |||
| 1835 | Ga0496116_0001473 | |||
| 1836 | Ga0496116_0009602 | |||
| 1837 | Ga0496116_0017649 | |||
| 1838 | Ga0496116_0025474 | |||
| 1839 | Ga0496116_0028745 | |||
| 1840 | Ga0496116_0031452 | |||
| 1841 | Ga0496116_0112500 | |||
| 1842 | Ga0496116_0168964 | |||
| 1843 | Ga0496117_0000121 | |||
| 1844 | Ga0496117_0001122 | |||
| 1845 | Ga0496117_0002864 | |||
| 1846 | Ga0496117_0007366 | |||
| 1847 | Ga0496117_0007912 | |||
| 1848 | Ga0496117_0013370 | |||
| 1849 | Ga0496117_0018825 | |||
| 1850 | Ga0496117_0034818 | |||
| 1851 | Ga0496117_0045089 | |||
| 1852 | Ga0496117_0100483 | |||
| 1853 | Ga0496117_0106406 | |||
| 1854 | Ga0496117_0118483 | |||
| 1855 | Ga0496118_0000095 | |||
| 1856 | Ga0496118_0001154 | |||
| 1857 | Ga0496118_0003651 | |||
| 1858 | Ga0496118_0004923 | |||
| 1859 | Ga0496118_0005119 | |||
| 1860 | Ga0496118_0008181 | |||
| 1861 | Ga0496118_0029419 | |||
| 1862 | Ga0496118_0061773 | |||
| 1863 | Ga0496118_0121783 | |||
| 1864 | Ga0496119_0012070 | |||
| 1865 | Ga0496119_0013733 | |||
| 1866 | Ga0496119_0016911 | |||
| 1867 | Ga0496119_0019480 | |||
| 1868 | Ga0496119_0141289 | |||
| 1869 | Ga0496120_0005830 | |||
| 1870 | Ga0496121_0000087 | |||
| 1871 | Ga0496121_0000624 | |||
| 1872 | Ga0496121_0004650 | |||
| 1873 | Ga0496121_0006109 | |||
| 1874 | Ga0496121_0007013 | |||
| 1875 | Ga0496121_0024937 | |||
| 1876 | Ga0496121_0029634 | |||
| 1877 | Ga0496121_0034730 | |||
| 1878 | Ga0496121_0042851 | |||
| 1879 | Ga0496121_0114264 | |||
| 1880 | Ga0496121_0173577 | |||
| 1881 | Ga0496122_0000935 | |||
| 1882 | Ga0496122_0001672 | |||
| 1883 | Ga0496122_0006069 | |||
| 1884 | Ga0496122_0024031 | |||
| 1885 | Ga0496122_0039009 | |||
| 1886 | Ga0496122_0043653 | |||
| 1887 | Ga0496122_0044603 | |||
| 1888 | Ga0496122_0068700 | |||
| 1889 | Ga0496122_0132105 | |||
| 1890 | Ga0496122_0177410 | |||
| 1891 | Ga0496123_0000337 | |||
| 1892 | Ga0496123_0001736 | |||
| 1893 | Ga0496123_0006087 | |||
| 1894 | Ga0496123_0016306 | |||
| 1895 | Ga0496123_0024008 | |||
| 1896 | Ga0496123_0035916 | |||
| 1897 | Ga0496123_0054508 | |||
| 1898 | Ga0496123_0127871 | |||
| 1899 | Ga0496124_0000119 | |||
| 1900 | Ga0496124_0006868 | |||
| 1901 | Ga0496124_0015876 | |||
| 1902 | Ga0496124_0016270 | |||
| 1903 | Ga0496124_0025665 | |||
| 1904 | Ga0496124_0030082 | |||
| 1905 | Ga0496124_0045315 | |||
| 1906 | Ga0496124_0078365 | |||
| 1907 | Ga0496124_0079496 | |||
| 1908 | Ga0496124_0100722 | |||
| 1909 | Ga0496124_0104244 | |||
| 1910 | Ga0496125_0002065 | |||
| 1911 | Ga0496125_0003585 | |||
| 1912 | Ga0496125_0004283 | |||
| 1913 | Ga0496125_0004681 | |||
| 1914 | Ga0496125_0008785 | |||
| 1915 | Ga0496125_0009964 | |||
| 1916 | Ga0496125_0018724 | |||
| 1917 | Ga0496125_0032440 | |||
| 1918 | Ga0496125_0040968 | |||
| 1919 | Ga0496125_0069112 | |||
| 1920 | Ga0496125_0096302 | |||
| 1921 | Ga0496125_0130088 | |||
| 1922 | Ga0496126_0000278 | |||
| 1923 | Ga0496126_0000592 | |||
| 1924 | Ga0496126_0004017 | |||
| 1925 | Ga0496126_0011844 | |||
| 1926 | Ga0496126_0021904 | |||
| 1927 | Ga0496126_0024075 | |||
| 1928 | Ga0496126_0093127 | |||
| 1929 | Ga0496126_0140809 | |||
| 1930 | Ga0496126_0188507 | |||
| 1931 | Ga0496126_0319131 | |||
| 1932 | Ga0495678_000083 | |||
| 1933 | Ga0495678_005993 | |||
| 1934 | Ga0495678_006390 | |||
| 1935 | Ga0495678_036432 | |||
| 1936 | Ga0495678_056561 | |||
| 1937 | Ga0495678_059431 | |||
| 1938 | Ga0495682_0015286 | |||
| 1939 | Ga0501032_0053548 | |||
| 1940 | Ga0501037_0123036 | |||
| 1941 | Ga0501043_0099892 | |||
| 1942 | Ga0501047_0218956 | |||
| 1943 | Ga0501249_000141 | |||
| 1944 | Ga0501083_0132883 | |||
| 1945 | Ga0501280_001736 | |||
| 1946 | Ga0501044_0077302 | |||
| 1947 | Ga0501044_0139093 | |||
| 1948 | nmdc:mga03683_85_c1 | |||
| 1949 | nmdc:mga03n38_164724_c1 | |||
| 1950 | nmdc:mga03n38_21095_c1 | |||
| 1951 | nmdc:mga00v17_175452_c1 | |||
| 1952 | nmdc:mga0yw44_9165_c1 | |||
| 1953 | nmdc:mga06z11_37_c1 | |||
| 1954 | nmdc:mga06z11_527_c1 | |||
| 1955 | nmdc:mga04h51_16_c1 | |||
| 1956 | nmdc:mga04h51_237_c1 | |||
| 1957 | nmdc:mga07m45_54793_c1 | |||
| 1958 | nmdc:mga07m45_7_c1 | |||
| 1959 | nmdc:mga0sz30_93_c1 | |||
| 1960 | Ga0500610_0029819 | |||
| 1961 | Ga0500578_0083426 | |||
| 1962 | Ga0500643_000362 | |||
| 1963 | Ga0500643_000503 | |||
| 1964 | Ga0500643_034605 | |||
| 1965 | Ga0500566_0068981 | |||
| 1966 | Ga0500555_000799 | |||
| 1967 | Ga0500560_002179 | |||
| 1968 | Ga0500569_007159 | |||
| 1969 | Ga0500594_0004461 | |||
| 1970 | Ga0500607_000035 | |||
| 1971 | Ga0500607_000148 | |||
| 1972 | Ga0500618_001727 | |||
| 1973 | Ga0500658_0001182 | |||
| 1974 | Ga0500559_0001018 | |||
| 1975 | Ga0500559_0001082 | |||
| 1976 | Ga0500559_0002069 | |||
| 1977 | Ga0500568_0012950 | |||
| 1978 | Ga0500568_0017868 | |||
| 1979 | Ga0500616_0000982 | |||
| 1980 | Ga0500616_0028841 | |||
| 1981 | Ga0500622_0004006 | |||
| 1982 | Ga0500624_000010 | |||
| 1983 | Ga0500624_000058 | |||
| 1984 | Ga0500624_001715 | |||
| 1985 | Ga0500634_0078120 | |||
| 1986 | Ga0500636_0001294 | |||
| 1987 | Ga0500637_0001441 | |||
| 1988 | Ga0500645_001940 | |||
| 1989 | Ga0500661_007303 | |||
| 1990 | Ga0501082_0426651 | |||
| 1991 | 2501073591 | |||
| 1992 | 2501082268 | |||
| 1993 | 2501411016 | |||
| 1994 | 2509128639 | |||
| 1995 | 2509387713 | |||
| 1996 | 2509443072 | |||
| 1997 | 2510132300 | |||
| 1998 | 2510250843 | |||
| 1999 | 2510839686 | |||
| 2000 | 2510898639 | |||
| 2001 | 2511086386 | |||
| 2002 | 2511096531 | |||
| 2003 | 2511102832 | |||
| 2004 | 2511186365 | |||
| 2005 | 2511197192 | |||
| 2006 | 2512346258 | |||
| 2007 | 2512642976 | |||
| 2008 | 2513552138 | |||
| 2009 | 2513560924 | |||
| 2010 | 2513569138 | |||
| 2011 | 2513578808 | |||
| 2012 | 2513596255 | |||
| 2013 | 2513632754 | |||
| 2014 | 2513709205 | |||
| 2015 | 2513868775 | |||
| 2016 | 2513907519 | |||
| 2017 | 2513925709 | |||
| 2018 | 2513960967 | |||
| 2019 | 2514020750 | |||
| 2020 | 2514048161 | |||
| 2021 | 2515111285 | |||
| 2022 | 2515637835 | |||
| 2023 | 2515642581 | |||
| 2024 | 2515659190 | |||
| 2025 | 2515679710 | |||
| 2026 | 2515688719 | |||
| 2027 | 2515740465 | |||
| 2028 | 2516020301 | |||
| 2029 | 2517039925 | |||
| 2030 | 2517075470 | |||
| 2031 | 2517094057 | |||
| 2032 | 2517405877 | |||
| 2033 | 2519458676 | |||
| 2034 | 2520375275 | |||
| 2035 | 2524460644 | |||
| 2036 | 2527075205 | |||
| 2037 | 2530643890 | |||
| 2038 | 2535515724 | |||
| 2039 | 2563063040 | |||
| 2040 | 2585203084 | |||
| 2041 | 2585220997 | |||
| 2042 | 2585231489 | |||
| 2043 | 2585256609 | |||
| 2044 | 2585273257 | |||
| 2045 | 2585278909 | |||
| 2046 | 2585292333 | |||
| 2047 | 2585325477 | |||
| 2048 | 2585400118 | |||
| 2049 | 2585527966 | |||
| 2050 | 2585549903 | |||
| 2051 | 2585554886 | |||
| 2052 | 2585559443 | |||
| 2053 | 2585822677 | |||
| 2054 | 2585847212 | |||
| 2055 | 2585902114 | |||
| 2056 | 2585905181 | |||
| 2057 | 2587979704 | |||
| 2058 | 2599418588 | |||
| 2059 | 2599737262 | |||
| 2060 | 2599746999 | |||
| 2061 | 2600208843 | |||
| 2062 | 2600809782 | |||
| 2063 | 2616296210 | |||
| 2064 | 2644007931 | |||
| 2065 | 2644196520 | |||
| 2066 | 2644242888 | |||
| 2067 | 2644296827 | |||
| 2068 | 2644655081 | |||
| 2069 | 2676744565 | |||
| 2070 | 2713477241 | |||
| 2071 | 2719180294 | |||
| 2072 | 2719384862 | |||
| 2073 | 2719639980 | |||
| 2074 | 2719664617 | |||
| 2075 | 2719731043 | |||
| 2076 | 2720491037 | |||
| 2077 | 2720612399 | |||
| 2078 | 2720619238 | |||
| 2079 | 2720630638 | |||
| 2080 | 2720774331 | |||
| 2081 | 2721146388 | |||
| 2082 | 2721157910 | |||
| 2083 | 2721163267 | |||
| 2084 | 2721398582 | |||
| 2085 | 2722839437 | |||
| 2086 | 2723026058 | |||
| 2087 | 2723559603 | |||
| 2088 | 2723566219 | |||
| 2089 | 2724037395 | |||
| 2090 | 2724043799 | |||
| 2091 | 2724088938 | |||
| 2092 | 2724103484 | |||
| 2093 | 2724109330 | |||
| 2094 | 2725948488 | |||
| 2095 | 2730106994 | |||
| 2096 | 2730163531 | |||
| 2097 | 2730297542 | |||
| 2098 | 2738709686 | |||
| 2099 | 2738802167 | |||
| 2100 | 2738820724 | |||
| 2101 | 2738833204 | |||
| 2102 | 2738848111 | |||
| 2103 | 2738863840 | |||
| 2104 | 2738874732 | |||
| 2105 | 2739186361 | |||
| 2106 | 2739221330 | |||
| 2107 | 2739296358 | |||
| 2108 | 2739358036 | |||
| 2109 | 2746089597 | |||
| 2110 | 2746098456 | |||
| 2111 | 2753566699 | |||
| 2112 | 2765584518 | |||
| 2113 | 2766067603 | |||
| 2114 | 2792836487 | |||
| 2115 | 2793296200 | |||
| 2116 | 2793317526 | |||
| 2117 | 2793321096 | |||
| 2118 | 2793327128 | |||
| 2119 | 2793333615 | |||
| 2120 | 2793339796 | |||
| 2121 | 2793347936 | |||
| 2122 | 2793353574 | |||
| 2123 | 2793367851 | |||
| 2124 | 2805926577 | |||
| 2125 | 2805933384 | |||
| 2126 | 2817260955 | |||
| 2127 | 2817278651 | |||
| 2128 | 2817451726 | |||
| 2129 | 2819242539 | |||
| 2130 | 2819620167 | |||
| 2131 | 2819634865 | |||
| 2132 | 2819639247 | |||
| 2133 | 2838017287 | |||
| 2134 | 2838037717 | |||
| 2135 | 2838047983 | |||
| 2136 | 2838049229 | |||
| 2137 | 2838063325 | |||
| 2138 | 2838662729 | |||
| 2139 | 2838670847 | |||
| 2140 | 2838681341 | |||
| 2141 | 2838688614 | |||
| 2142 | 2838694624 | |||
| 2143 | 2838703218 | |||
| 2144 | 2838708002 | |||
| 2145 | 2838730909 | |||
| 2146 | 2838744197 | |||
| 2147 | 2841856878 | |||
| 2148 | 2841865473 | |||
| 2149 | 2842080767 | |||
| 2150 | 2842114976 | |||
| 2151 | 2842121386 | |||
| 2152 | 2842147558 | |||
| 2153 | 2842160048 | |||
| 2154 | 2842168291 | |||
| 2155 | 2842183335 | |||
| 2156 | 2842197950 | |||
| 2157 | 2842207697 | |||
| 2158 | 2842221203 | |||
| 2159 | 2842235064 | |||
| 2160 | 2842237413 | |||
| 2161 | 2842245661 | |||
| 2162 | 2842252624 | |||
| 2163 | 2842259689 | |||
| 2164 | 2842266928 | |||
| 2165 | 2842274528 | |||
| 2166 | 2842281508 | |||
| 2167 | 2842287117 | |||
| 2168 | 2842294423 | |||
| 2169 | 2842302448 | |||
| 2170 | 2842306772 | |||
| 2171 | 2842314746 | |||
| 2172 | 2842318651 | |||
| 2173 | 2842327389 | |||
| 2174 | 2842343592 | |||
| 2175 | 2842352004 | |||
| 2176 | 2842360819 | |||
| 2177 | 2842365251 | |||
| 2178 | 2842371804 | |||
| 2179 | 2842380821 | |||
| 2180 | 2842387892 | |||
| 2181 | 2842398265 | |||
| 2182 | 2842404385 | |||
| 2183 | 2842410930 | |||
| 2184 | 2842417614 | |||
| 2185 | 2842427356 | |||
| 2186 | 2842431059 | |||
| 2187 | 2842436943 | |||
| 2188 | 2842443021 | |||
| 2189 | 2842453243 | |||
| 2190 | 2842458246 | |||
| 2191 | 2842465032 | |||
| 2192 | 2842471742 | |||
| 2193 | 2842493757 | |||
| 2194 | 2842497286 | |||
| 2195 | 2842509729 | |||
| 2196 | 2844455130 | |||
| 2197 | 2856293700 | |||
| 2198 | 2857362382 | |||
| 2199 | 2857520292 | |||
| 2200 | 2857579177 | |||
| 2201 | 2863424507 | |||
| 2202 | 2870071574 | |||
| 2203 | 2883088851 | |||
| 2204 | 2885278780 | |||
| 2205 | 2900635095 | |||
| 2206 | 2902689642 | |||
| 2207 | 2904434881 | |||
| 2208 | 2904484878 | |||
| 2209 | 2904568708 | |||
| 2210 | 2904575750 | |||
| 2211 | 2904617066 | |||
| 2212 | 2919103834 | |||
| 2213 | 2919139300 | |||
| 2214 | 2919530603 | |||
| 2215 | 2919710841 | |||
| 2216 | 2921650498 | |||
| 2217 | 2923557565 | |||
| 2218 | 2928101241 | |||
| 2219 | 2928110274 | |||
| 2220 | 2928138592 | |||
| 2221 | 2928160506 | |||
| 2222 | 2928164973 | |||
| 2223 | 2928172708 | |||
| 2224 | 2928505345 | |||
| 2225 | 2928540767 | |||
| 2226 | 2928960348 | |||
| 2227 | 2933016845 | |||
| 2228 | 2933573114 | |||
| 2229 | 2933591375 | |||
| 2230 | 2933604605 | |||
| 2231 | 2935895146 | |||
| 2232 | 2935904136 | |||
| 2233 | 2936368122 | |||
| 2234 | 2936381485 | |||
| 2235 | 2936387381 | |||
| 2236 | 2939656394 | |||
| 2237 | 2945936990 | |||
| 2238 | 2945962551 | |||
| 2239 | 2981996188 | |||
| 2240 | 2989778185 | |||
| 2241 | 2990706282 | |||
| 2242 | 2996890799 | |||
| 2243 | 2996895080 | |||
| 2244 | 3005453451 | |||
| 2245 | 639647433 | |||
| 2246 | 642423104 | |||
| 2247 | 642415689 | |||
| 2248 | 642593424 | |||
| 2249 | 642621325 | |||
| 2250 | 8003955492 | |||
| 2251 | 8005251314 | |||
| 2252 | 8005261812 | |||
| 2253 | 8005279582 | |||
| 2254 | 8005284782 | |||
| 2255 | 8005292792 | |||
| 2256 | 8005311088 | |||
| 2257 | 8005325326 | |||
| 2258 | 8005376608 | |||
| 2259 | 8005385997 | |||
| 2260 | 8005400220 | |||
| 2261 | 8005432269 | |||
| 2262 | 8005461929 | |||
| 2263 | 8005499331 | |||
| 2264 | 8005558926 | |||
| 2265 | 8005570436 | |||
| 2266 | 8005620526 | |||
| 2267 | 8005627508 | |||
| 2268 | 8005670747 | |||
| 2269 | 8005698789 | |||
| 2270 | 8018131333 | |||
| 2271 | 8018169158 | |||
| 2272 | 8018177243 | |||
| 2273 | 8018849794 | |||
| 2274 | 8020813169 | |||
| 2275 | 8020942251 | |||
| 2276 | 8020951339 | |||
| 2277 | 8020957881 | |||
| 2278 | 8021124394 | |||
| 2279 | 8023686957 | |||
| 2280 | 8024489752 | |||
| 2281 | 8024503251 | |||
| 2282 | 8039104753 | |||
| 2283 | 8040169894 | |||
| 2284 | 8040173361 | |||
| 2285 | 8054931283 | |||
| 2286 | 8055268320 | |||
| 2287 | 8055302362 | |||
| 2288 | 8055882678 | |||
| 2289 | 8056380731 | |||
| 2290 | 8056384752 | |||
| 2291 | 8057879587 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lqa-assembly1.cif.gz_A | tas protein from escherichia coli in complex with nadph | 0.9773 | 1 | 349 |
| 1lqa-assembly1.cif.gz_A | tas protein from escherichia coli in complex with nadph | 0.9745 | 1 | 349 |
| 7utf-assembly2.cif.gz_B | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9105 | 1 | 340 |
| 3erp-assembly1.cif.gz_B-5 | structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium | 0.9065 | 1 | 343 |
| 7utf-assembly1.cif.gz_C | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9049 | 1 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lqaB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9716 | 1 | 349 | 3.20.20.100 |
| 1lqaB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9689 | 1 | 349 | 3.20.20.100 |
| af_I1KSL2_10_358_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9505 | 10 | 349 | 3.20.20.100 |
| af_Q8VZ23_56_411_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9443 | 1 | 348 | 3.20.20.100 |
| af_Q8VZ23_56_411_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9391 | 1 | 348 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A7C1M6-F1-model_v4 | deleted | 0.9892 | 165 | 349 |
|
| AF-A0A3T1DHM4-F1-model_v4 | deleted | 0.988 | 177 | 349 |
|
| AF-A0A7B6C3X1-F1-model_v4 | deleted | 0.9823 | 207 | 349 |
|
| AF-A0A7X4K1N4-F1-model_v4 | deleted | 0.9813 | 1 | 349 |
|
| AF-A0A7X4K1N4-F1-model_v4 | deleted | 0.9784 | 1 | 349 |
|