F490773

General Info

Members Datasets Scaffolds Average Seq Length
1145 645 2291 347

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10002827|Ga0105240_100028278
Length 408
Sequence MRHAVYIRLGNALSALVSSIRPPSVNAAHTNVKNSQPAFRTICQRPLSAKAASATGDIFMKYRTLGRTDIKVSLICLGTMTWGSQNSEAEAHAQLDYAIGQGINFIDTAEGYPVTPVSRETQGKTEEFIGSWLARRGKRDDIIVATKVAGPSRDPVREFRGGNNRLDRRNIEQAIDDSLKRLRTDYVDLYQVHWPDRPVPSFGARGLAQIDDMPEIVPIEETLDALAGLVRAGKVRHVGVSNETPWGVSEYLRLARDQGVPRIASIQNAYNLLNRTFEGGLSEFALREGVGLLAYSPLAGGNLTGKYLGGVIPPGSRRDVAKQFGRYDLPGQGTASARYVAIAHAHGLDPAQMALAYVNSRDFVTANIIGATSMEQLEVNIASTSIVLSPEAVAAIEAVHREIPDPCP

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
74 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
171 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
172 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
173 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
174 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
183 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
190 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
306 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
324 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
325 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
326 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
327 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
328 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
329 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
330 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
331 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
339 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
346 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
347 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
348 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
349 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
350 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
351 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
352 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
353 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
354 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
355 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
356 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
357 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
358 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
359 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
360 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
361 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
362 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
363 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
364 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
365 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
366 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
367 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
368 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
369 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
370 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
371 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
372 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
373 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
374 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
375 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
376 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
377 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
378 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
379 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
380 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
381 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
382 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
383 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
384 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
385 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
386 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
387 2519103095 Burkholderia sp. KJ006 Isolate Nodule
388 2519899620 Rhizobium sp. Pop5 Isolate Nodule
389 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
390 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
391 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
392 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
393 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
394 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
395 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
396 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
397 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
398 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
399 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
400 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
401 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
402 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
403 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
404 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
405 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
406 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
407 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
408 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
409 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
410 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
411 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
412 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
413 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
414 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
415 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
416 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
417 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
418 2643221599 Rhizobium sp. Root708 Isolate Unclassified
419 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
420 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
421 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
422 2643221719 Rhizobium sp. Root274 Isolate Unclassified
423 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
424 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
425 2718217882 Rhizobium sp. N741 Isolate Nodule
426 2718217927 Rhizobium sp. N324 Isolate Nodule
427 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
428 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
429 2718218009 Rhizobium sp. N561 Isolate Nodule
430 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
431 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
432 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
433 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
434 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
435 2718218363 Rhizobium sp. N113 Isolate Nodule
436 2718218365 Rhizobium sp. N731 Isolate Nodule
437 2718218366 Rhizobium sp. N621 Isolate Nodule
438 2718218423 Rhizobium sp. N941 Isolate Nodule
439 2721755514 Rhizobium sp. N6212 Isolate Nodule
440 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
441 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
442 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
443 2721755809 Rhizobium sp. N541 Isolate Nodule
444 2721755810 Rhizobium sp. N871 Isolate Nodule
445 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
446 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
447 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
448 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
449 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
450 2728369365 Rhizobium sp. N1341 Isolate Nodule
451 2728369397 Rhizobium sp. N1314 Isolate Nodule
452 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
453 2738541293 Rhizobium sp. GV031 Isolate Unclassified
454 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
455 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
456 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
457 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
458 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
459 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
460 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
461 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
462 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
463 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
464 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
465 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
466 2765235841 Pseudomonas putida AA7 Isolate Unclassified
467 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
468 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
469 2791355256 Rhizobium sp. M10 Isolate Nodule
470 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
471 2791355260 Rhizobium sp. L9 Isolate Nodule
472 2791355261 Rhizobium sp. J15 Isolate Nodule
473 2791355262 Rhizobium sp. M1 Isolate Nodule
474 2791355263 Rhizobium chutanense C5 Isolate Nodule
475 2791355264 Rhizobium sp. S9 Isolate Nodule
476 2791355265 Rhizobium sp. H4 Isolate Nodule
477 2791355267 Rhizobium sp. L18 Isolate Nodule
478 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
479 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
480 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
481 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
482 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
483 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
484 2818991450 Burkholderia sp. 604 Isolate Unclassified
485 2818991452 Burkholderia cepacia 561 Isolate Unclassified
486 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
487 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
488 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
489 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
490 2838048938 Rhizobium pisi 27/80 Isolate Nodule
491 2838061910 Rhizobium phaseoli L15 Isolate Nodule
492 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
493 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
494 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
495 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
496 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
497 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
498 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
499 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
500 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
501 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
502 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
503 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
504 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
505 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
506 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
507 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
508 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
509 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
510 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
511 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
512 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
513 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
514 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
515 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
516 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
517 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
518 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
519 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
520 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
521 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
522 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
523 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
524 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
525 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
526 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
527 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
528 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
529 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
530 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
531 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
532 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
533 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
534 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
535 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
536 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
537 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
538 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
539 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
540 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
541 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
542 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
543 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
544 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
545 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
546 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
547 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
548 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
549 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
550 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
551 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
552 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
553 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
554 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
555 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
556 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
557 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
558 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
559 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
560 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
561 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
562 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
563 2904564687 Burkholderia sp. 571 Isolate Unclassified
564 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
565 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
566 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
567 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
568 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
569 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
570 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
571 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
572 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
573 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
574 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
575 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
576 2928163908 Burkholderia sp. 567 Isolate Unclassified
577 2928170801 Burkholderia sp. 572 Isolate Unclassified
578 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
579 2928536128 Burkholderia sola 565 Isolate Unclassified
580 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
581 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
582 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
583 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
584 2933599457 Rhizobium phaseoli M3 Isolate Nodule
585 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
586 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
587 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
588 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
589 2936381700 Rhizobium chutanense C16 Isolate Unclassified
590 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
591 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
592 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
593 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
594 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
595 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
596 2996887358 Rhizobium sp. R711 Isolate Nodule
597 2996893221 Rhizobium sp. R635 Isolate Nodule
598 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
599 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
600 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
601 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
602 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
603 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
604 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
605 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
606 8005258706 Rhizobium sp. R693 Isolate Nodule
607 8005275841 Rhizobium sp. N4311 Isolate Nodule
608 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
609 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
610 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
611 8005321885 Rhizobium sp. R72 Isolate Nodule
612 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
613 8005382845 Rhizobium sp. R634 Isolate Nodule
614 8005395548 Rhizobium sp. R339 Isolate Nodule
615 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
616 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
617 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
618 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
619 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
620 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
621 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
622 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
623 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
624 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
625 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
626 8018176218 Rhizobium sp. N122 Isolate Nodule
627 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
628 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
629 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
630 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
631 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
632 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
633 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
634 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
635 8024501048 Rhizobium sp. H4 Isolate Nodule
636 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
637 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
638 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
639 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
640 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
641 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
642 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
643 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
644 8056382006 Rhizobium croatiense 13T Isolate Nodule
645 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.71
Metatranscriptomes 0
Isolates 26.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.76
Nodule 15.81
Rhizoplane 3.23
Rhizosphere 48.91
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10002827 3300009093 Bacteria 27459
2 SwRhRL2b_contig_1380016 2162886007 Bacteria 5388
3 JGI24741J21665_1001367 3300001915 Bacteria 7046
4 JGI24741J21665_1002735 3300001915 Bacteria 4467
5 JGI24740J21852_10000071 3300001979 Bacteria 33773
6 JGI24740J21852_10001830 3300001979 Bacteria 9737
7 JGI24739J22299_10001942 3300001989 Bacteria 7905
8 JGI24739J22299_10012850 3300001989 Bacteria 3067
9 JGI24737J22298_10005303 3300001990 Bacteria 4458
10 JGI24737J22298_10010517 3300001990 Bacteria 3053
11 JGI24737J22298_10023788 3300001990 Bacteria 1942
12 JGI24735J21928_10000180 3300002067 Bacteria 22468
13 JGI24735J21928_10000289 3300002067 Bacteria 17537
14 JGI24735J21928_10000371 3300002067 Bacteria 15683
15 JGI24735J21928_10008786 3300002067 Bacteria 3259
16 JGI24738J21930_10000001 3300002075 Bacteria 133921
17 JGI24738J21930_10003173 3300002075 Bacteria 4202
18 JGI25156J39149_1000859 3300002705 Bacteria 15133
19 JGI25156J39149_1001993 3300002705 Bacteria 7826
20 JGI25156J39149_1005504 3300002705 Bacteria 3633
21 JGI25158J39367_1000407 3300002739 Bacteria 8986
22 JGI25152J39213_1000623 3300002773 Bacteria 18832
23 JGI25152J39213_1003008 3300002773 Bacteria 5961
24 JGI25150J39212_1000033 3300002774 Bacteria 96269
25 JGI25150J39212_1001462 3300002774 Bacteria 6581
26 JGI25151J46595_10000108 3300003187 Bacteria 112874
27 JGI25151J46595_10015298 3300003187 Bacteria 3386
28 JGI25165J46597_1001483 3300003214 Bacteria 12078
29 JGI25165J46597_1002550 3300003214 Bacteria 5674
30 JGI25153J46596_10000563 3300003215 Bacteria 22953
31 JGI25153J46596_10009883 3300003215 Bacteria 4375
32 rootH1_10038444 3300003316 Bacteria 1486
33 rootH1_10038444 3300003323 Bacteria 3156
34 JGI25160J50197_1000015 3300003354 Bacteria 250902
35 JGI25160J50197_1000064 3300003354 Bacteria 115987
36 JGI25160J50197_1012089 3300003354 Bacteria 3023
37 JGI25161J50226_1000005 3300003374 Bacteria 292548
38 Ga0055533_1000218 3300003756 Bacteria 41729
39 Ga0055532_1000001 3300003758 Bacteria 1119836
40 Ga0055532_1000255 3300003758 Bacteria 36553
41 Ga0055532_1000388 3300003758 Bacteria 22093
42 Ga0055532_1000436 3300003758 Bacteria 19713
43 Ga0055527_1000002 3300003760 Bacteria 830488
44 Ga0055527_1000224 3300003760 Bacteria 36553
45 Ga0055527_1004258 3300003760 Bacteria 1990
46 Ga0055527_1007478 3300003760 Bacteria 1332
47 Ga0055535_1000001 3300003761 Bacteria 1119836
48 Ga0055535_1000474 3300003761 Bacteria 36553
49 Ga0055535_1000693 3300003761 Bacteria 25976
50 Ga0055542_1000001 3300003762 Bacteria 1119836
51 Ga0055542_1000673 3300003762 Bacteria 27607
52 Ga0055542_1006731 3300003762 Bacteria 2420
53 Ga0055529_1000026 3300003763 Bacteria 293254
54 Ga0055529_1000608 3300003763 Bacteria 27404
55 Ga0055529_1005398 3300003763 Bacteria 1856
56 Ga0055526_1026225 3300003771 Bacteria 1845
57 Ga0055524_1003638 3300003775 Bacteria 7408
58 Ga0055524_1014079 3300003775 Bacteria 2983
59 Ga0055524_1026782 3300003775 Bacteria 1771
60 Ga0055528_1003635 3300003790 Bacteria 7662
61 Ga0055528_1005083 3300003790 Bacteria 6203
62 Ga0055528_1007761 3300003790 Bacteria 4695
63 Ga0055528_1012526 3300003790 Bacteria 3283
64 Ga0055540_1008490 3300003792 Bacteria 3692
65 Ga0055543_1000012 3300004625 Bacteria 186581
66 Ga0065165_1000325 3300005262 Bacteria 77723
67 Ga0065165_1003987 3300005262 Bacteria 9651
68 Ga0065704_10001512 3300005289 Bacteria 9147
69 Ga0065704_10071185 3300005289 Bacteria 12615
70 Ga0070658_10010072 3300005327 Bacteria 7589
71 Ga0070658_10052541 3300005327 Bacteria 3305
72 Ga0070670_100042569 3300005331 Bacteria 3904
73 Ga0070666_10014803 3300005335 Bacteria 4971
74 Ga0070666_10307719 3300005335 Bacteria 1129
75 Ga0070660_100000509 3300005339 Bacteria 25999
76 Ga0070660_100001423 3300005339 Bacteria 16302
77 Ga0070668_100000019 3300005347 Bacteria 98356
78 Ga0070668_100008368 3300005347 Bacteria 7683
79 Ga0070668_100062139 3300005347 Bacteria 2893
80 Ga0070669_100016598 3300005353 Bacteria 5256
81 Ga0070671_100009450 3300005355 Bacteria 7827
82 Ga0070671_100033072 3300005355 Bacteria 4275
83 Ga0070659_100000015 3300005366 Bacteria 176475
84 Ga0070659_100036438 3300005366 Bacteria 3836
85 Ga0070667_100000094 3300005367 Bacteria 111140
86 Ga0070667_100102079 3300005367 Bacteria 2478
87 Ga0070667_100148201 3300005367 Bacteria 2059
88 Ga0070663_100000602 3300005455 Bacteria 19214
89 Ga0070663_100169386 3300005455 Bacteria 1687
90 Ga0070662_100000624 3300005457 Bacteria 21403
91 Ga0068853_100001013 3300005539 Bacteria 19779
92 Ga0068853_100001046 3300005539 Bacteria 19566
93 Ga0068853_100030570 3300005539 Bacteria 4550
94 Ga0070665_100001576 3300005548 Bacteria 26316
95 Ga0070665_100052647 3300005548 Bacteria 4082
96 Ga0070665_100208920 3300005548 Bacteria 1953
97 Ga0068855_100009188 3300005563 Bacteria 11937
98 Ga0068855_100009504 3300005563 Bacteria 11742
99 Ga0068855_100011395 3300005563 Bacteria 10738
100 Ga0068855_100161877 3300005563 Bacteria 2539
101 Ga0068855_100224865 3300005563 Bacteria 2103
102 Ga0070664_100291744 3300005564 Bacteria 1473
103 Ga0068857_100004355 3300005577 Bacteria 11954
104 Ga0068857_100036828 3300005577 Bacteria 4334
105 Ga0068854_100012363 3300005578 Bacteria 5588
106 Ga0068854_100040155 3300005578 Bacteria 3300
107 Ga0068856_100000374 3300005614 Bacteria 49224
108 Ga0068852_100014797 3300005616 Bacteria 6024
109 Ga0068859_100092607 3300005617 Bacteria 3074
110 Ga0068851_10002777 3300005834 Bacteria 7714
111 Ga0068863_100000057 3300005841 Bacteria 123606
112 Ga0068863_100001297 3300005841 Bacteria 24954
113 Ga0068863_100041355 3300005841 Bacteria 4382
114 Ga0068860_100000623 3300005843 Bacteria 41934
115 Ga0068860_100004802 3300005843 Bacteria 13762
116 Ga0068860_100101614 3300005843 Bacteria 2743
117 Ga0068862_100000194 3300005844 Bacteria 67126
118 Ga0068862_100048804 3300005844 Bacteria 3615
119 Ga0075365_10001318 3300006038 Bacteria 11080
120 Ga0075365_10009667 3300006038 Bacteria 5565
121 Ga0075368_10000019 3300006042 Bacteria 40365
122 Ga0075363_100006825 3300006048 Bacteria 5218
123 Ga0075363_100014895 3300006048 Bacteria 3812
124 Ga0075362_10003928 3300006177 Bacteria 5282
125 Ga0075367_10000795 3300006178 Bacteria 12428
126 Ga0075369_10000498 3300006186 Bacteria 12221
127 Ga0075366_10008922 3300006195 Bacteria 5588
128 Ga0075370_10004487 3300006353 Bacteria 6787
129 Ga0075370_10010880 3300006353 Bacteria 4768
130 Ga0075370_10014093 3300006353 Bacteria 4258
131 Ga0097620_100092612 3300006931 Bacteria 3074
132 Ga0079104_1011926 3300006946 Bacteria 2762
133 Ga0105251_10000134 3300009011 Bacteria 74820
134 Ga0105251_10000167 3300009011 Bacteria 67775
135 Ga0105251_10001159 3300009011 Bacteria 22899
136 Ga0105251_10002394 3300009011 Bacteria 14816
137 Ga0105251_10004353 3300009011 Bacteria 9680
138 Ga0105251_10031535 3300009011 Bacteria 2651
139 Ga0105244_10043714 3300009036 Bacteria 2309
140 Ga0105240_10001649 3300009093 Bacteria 37902
141 Ga0105240_10001654 3300009093 Bacteria 37838
142 Ga0105240_10002976 3300009093 Bacteria 26679
143 Ga0105240_10010622 3300009093 Bacteria 12935
144 Ga0105240_10020477 3300009093 Bacteria 8822
145 Ga0105240_10054519 3300009093 Bacteria 5010
146 Ga0105240_10075107 3300009093 Bacteria 4170
147 Ga0105247_10003919 3300009101 Bacteria 9598
148 Ga0105247_10038239 3300009101 Bacteria 2929
149 Ga0105241_10017153 3300009174 Bacteria 5318
150 Ga0105241_10121729 3300009174 Bacteria 2102
151 Ga0105237_10011460 3300009545 Bacteria 9379
152 Ga0105237_10087097 3300009545 Bacteria 3113
153 Ga0105238_10026668 3300009551 Bacteria 5890
154 Ga0105249_10000135 3300009553 Bacteria 96943
155 Ga0105249_10194843 3300009553 Bacteria 1980
156 Ga0123341_1000062 3300009765 Bacteria 45834
157 Ga0123342_1014931 3300009766 Bacteria 7247
158 Ga0105239_10001422 3300010375 Bacteria 31955
159 Ga0105239_10011808 3300010375 Bacteria 9747
160 Ga0105239_10044978 3300010375 Bacteria 4839
161 Ga0105246_10181244 3300011119 Unclassified 1622
162 Ga0105246_10235272 3300011119 Bacteria 1445
163 Ga0157373_10000535 3300013100 Bacteria 29689
164 Ga0157373_10001841 3300013100 Bacteria 16117
165 Ga0157371_10003242 3300013102 Bacteria 14926
166 Ga0157371_10006163 3300013102 Bacteria 9951
167 Ga0157370_10001866 3300013104 Bacteria 25990
168 Ga0157370_10010833 3300013104 Bacteria 9579
169 Ga0157370_10028140 3300013104 Bacteria 5533
170 Ga0157369_10001453 3300013105 Bacteria 29072
171 Ga0157369_10008887 3300013105 Bacteria 11509
172 Ga0157369_10115264 3300013105 Bacteria 2854
173 Ga0157369_10145516 3300013105 Bacteria 2506
174 Ga0157374_10000155 3300013296 Bacteria 63063
175 Ga0157374_10207720 3300013296 Bacteria 1919
176 Ga0157372_10003812 3300013307 Bacteria 16192
177 Ga0157372_10007709 3300013307 Bacteria 11446
178 Ga0182008_10020817 3300014497 Bacteria 3374
179 Ga0182006_1052259 3300015261 Bacteria 1570
180 Ga0182007_10000453 3300015262 Bacteria 24829
181 Ga0182007_10045038 3300015262 Bacteria 1463
182 Ga0183361_10013 3300016635 Bacteria 179680
183 Ga0163161_10011715 3300017792 Bacteria 6084
184 Ga0163161_10026686 3300017792 Bacteria 4092
185 Ga0213872_10038064 3300021361 Bacteria 2196
186 Ga0209436_111054 3300025208 Bacteria 1610
187 Ga0209566_100485 3300025225 Bacteria 28134
188 Ga0209674_100005 3300025226 Bacteria 1708125
189 Ga0209674_100265 3300025226 Bacteria 41160
190 Ga0209672_100001 3300025228 Bacteria 2828210
191 Ga0209672_100037 3300025228 Bacteria 287776
192 Ga0209672_100080 3300025228 Bacteria 143481
193 Ga0209672_101567 3300025228 Bacteria 7772
194 Ga0209147_100001 3300025229 Bacteria 2384371
195 Ga0209147_100049 3300025229 Bacteria 274980
196 Ga0209147_100071 3300025229 Bacteria 215861
197 Ga0209147_100305 3300025229 Bacteria 39241
198 Ga0209147_100358 3300025229 Bacteria 32865
199 Ga0209563_100426 3300025230 Bacteria 14722
200 Ga0207427_101045 3300025231 Bacteria 11506
201 Ga0209437_100033 3300025233 Bacteria 512520
202 Ga0209258_100001 3300025242 Bacteria 2384269
203 Ga0209258_100066 3300025242 Bacteria 287776
204 Ga0209258_100082 3300025242 Bacteria 247739
205 Ga0207425_1000031 3300025245 Bacteria 261181
206 Ga0209148_1000003 3300025254 Bacteria 2384288
207 Ga0209148_1000168 3300025254 Bacteria 133952
208 Ga0209148_1000755 3300025254 Bacteria 24715
209 Ga0209759_1000029 3300025256 Bacteria 286968
210 Ga0209759_1000232 3300025256 Bacteria 83288
211 Ga0209759_1000284 3300025256 Bacteria 70505
212 Ga0209759_1020083 3300025256 Bacteria 1564
213 Ga0209129_1000053 3300025258 Bacteria 262823
214 Ga0209129_1003371 3300025258 Bacteria 7023
215 Ga0209129_1003477 3300025258 Bacteria 6822
216 Ga0209233_1000043 3300025261 Bacteria 509723
217 Ga0209233_1000064 3300025261 Bacteria 392156
218 Ga0209455_1000001 3300025272 Bacteria 2384278
219 Ga0209455_1000141 3300025272 Bacteria 138212
220 Ga0209455_1000406 3300025272 Bacteria 35054
221 Ga0209673_1000041 3300025273 Bacteria 307397
222 Ga0209673_1000076 3300025273 Bacteria 230907
223 Ga0209673_1000319 3300025273 Bacteria 88129
224 Ga0209673_1009838 3300025273 Bacteria 4094
225 Ga0209673_1011121 3300025273 Bacteria 3734
226 Ga0209673_1017384 3300025273 Bacteria 2651
227 Ga0209673_1026238 3300025273 Bacteria 1917
228 Ga0209130_1000018 3300025284 Bacteria 388301
229 Ga0209130_1019763 3300025284 Bacteria 1554
230 Ga0209130_1024712 3300025284 Bacteria 1308
231 Ga0209676_1005581 3300025292 Bacteria 6505
232 Ga0209676_1011391 3300025292 Bacteria 3591
233 Ga0209025_1000087 3300025294 Bacteria 261181
234 Ga0209025_1001440 3300025294 Bacteria 31293
235 Ga0209025_1008335 3300025294 Bacteria 7472
236 Ga0209025_1012200 3300025294 Bacteria 5541
237 Ga0209025_1024975 3300025294 Bacteria 3061
238 Ga0209564_1004356 3300025295 Bacteria 8708
239 Ga0209564_1004856 3300025295 Bacteria 7991
240 Ga0209564_1011003 3300025295 Bacteria 4099
241 Ga0209564_1014511 3300025295 Bacteria 3272
242 Ga0209564_1019962 3300025295 Bacteria 2479
243 Ga0209758_1000081 3300025297 Bacteria 261181
244 Ga0209758_1026335 3300025297 Bacteria 2520
245 Ga0209758_1054374 3300025297 Bacteria 1368
246 Ga0209050_1006521 3300025298 Bacteria 6879
247 Ga0209256_1002348 3300025299 Bacteria 15760
248 Ga0209256_1005095 3300025299 Bacteria 7802
249 Ga0209256_1011373 3300025299 Bacteria 3569
250 Ga0209256_1011458 3300025299 Bacteria 3541
251 Ga0209256_1011586 3300025299 Bacteria 3505
252 Ga0207426_1000044 3300025302 Bacteria 428043
253 Ga0207426_1000050 3300025302 Bacteria 393022
254 Ga0207426_1003692 3300025302 Bacteria 8027
255 Ga0209051_1000514 3300025303 Bacteria 48877
256 Ga0209051_1019345 3300025303 Bacteria 2975
257 Ga0209257_1007417 3300025304 Bacteria 6627
258 Ga0207656_10003457 3300025321 Bacteria 5430
259 Ga0207655_1017087 3300025728 Bacteria 3929
260 Ga0207713_1000287 3300025735 Bacteria 58430
261 Ga0207713_1000353 3300025735 Bacteria 50352
262 Ga0207713_1001378 3300025735 Bacteria 19723
263 Ga0207710_10002272 3300025900 Bacteria 8995
264 Ga0207710_10018232 3300025900 Bacteria 2984
265 Ga0207680_10026506 3300025903 Bacteria 3214
266 Ga0207647_10000378 3300025904 Bacteria 36270
267 Ga0207647_10000955 3300025904 Bacteria 22364
268 Ga0207647_10007158 3300025904 Bacteria 8092
269 Ga0207647_10009767 3300025904 Bacteria 6807
270 Ga0207647_10013606 3300025904 Bacteria 5633
271 Ga0207647_10037821 3300025904 Bacteria 3057
272 Ga0207654_10058678 3300025911 Bacteria 2241
273 Ga0207695_10000978 3300025913 Bacteria 50823
274 Ga0207695_10001867 3300025913 Bacteria 32990
275 Ga0207695_10002000 3300025913 Bacteria 31464
276 Ga0207695_10006039 3300025913 Bacteria 15818
277 Ga0207695_10006482 3300025913 Bacteria 15183
278 Ga0207695_10108988 3300025913 Bacteria 2752
279 Ga0207695_10303128 3300025913 Bacteria 1489
280 Ga0207671_10074044 3300025914 Bacteria 2545
281 Ga0207657_10000014 3300025919 Bacteria 175779
282 Ga0207657_10000817 3300025919 Bacteria 32878
283 Ga0207649_10055074 3300025920 Bacteria 2478
284 Ga0207681_10074006 3300025923 Bacteria 2385
285 Ga0207694_10009008 3300025924 Bacteria 7535
286 Ga0207694_10142748 3300025924 Bacteria 1926
287 Ga0207650_10001915 3300025925 Bacteria 14658
288 Ga0207650_10053914 3300025925 Bacteria 2981
289 Ga0207650_10072351 3300025925 Bacteria 2595
290 Ga0207644_10000980 3300025931 Bacteria 18238
291 Ga0207690_10000023 3300025932 Bacteria 196155
292 Ga0207690_10019011 3300025932 Bacteria 4220
293 Ga0207706_10000383 3300025933 Bacteria 48348
294 Ga0207706_10000803 3300025933 Bacteria 32563
295 Ga0207711_10001289 3300025941 Bacteria 23752
296 Ga0207667_10011185 3300025949 Bacteria 10446
297 Ga0207667_10016938 3300025949 Bacteria 8221
298 Ga0207667_10045434 3300025949 Bacteria 4652
299 Ga0207667_10083774 3300025949 Bacteria 3302
300 Ga0207667_10311208 3300025949 Bacteria 1609
301 Ga0207712_10000101 3300025961 Bacteria 96961
302 Ga0207668_10000059 3300025972 Bacteria 91172
303 Ga0207668_10100688 3300025972 Bacteria 2146
304 Ga0207640_10001832 3300025981 Bacteria 11402
305 Ga0207640_10035218 3300025981 Bacteria 3131
306 Ga0207658_10000072 3300025986 Bacteria 112469
307 Ga0207658_10157198 3300025986 Bacteria 1859
308 Ga0207639_10000264 3300026041 Bacteria 37756
309 Ga0207639_10001734 3300026041 Bacteria 14684
310 Ga0207639_10008995 3300026041 Bacteria 6877
311 Ga0207678_10001433 3300026067 Bacteria 21885
312 Ga0207678_10002131 3300026067 Bacteria 17922
313 Ga0207678_10081418 3300026067 Bacteria 2771
314 Ga0207678_10372999 3300026067 Bacteria 1233
315 Ga0207702_10002199 3300026078 Bacteria 18684
316 Ga0207641_10000096 3300026088 Bacteria 123585
317 Ga0207641_10004130 3300026088 Bacteria 12654
318 Ga0207641_10007904 3300026088 Bacteria 8821
319 Ga0207674_10006865 3300026116 Bacteria 13348
320 Ga0207698_10000442 3300026142 Bacteria 23870
321 Ga0209371_1009354 3300027312 Bacteria 3125
322 Ga0209813_10000046 3300027866 Bacteria 50246
323 Ga0209813_10001560 3300027866 Bacteria 5139
324 Ga0268266_10000387 3300028379 Bacteria 67080
325 Ga0268266_10037403 3300028379 Bacteria 4136
326 Ga0268266_10154101 3300028379 Bacteria 2074
327 Ga0268265_10000151 3300028380 Bacteria 85523
328 Ga0268265_10038765 3300028380 Bacteria 3507
329 Ga0268265_10340962 3300028380 Bacteria 1364
330 Ga0268264_10000303 3300028381 Bacteria 79730
331 Ga0268264_10009257 3300028381 Bacteria 8154
332 Ga0268264_10016664 3300028381 Bacteria 6018
333 Ga0307515_10188949 3300028794 Bacteria 1978
334 Ga0265338_10000022 3300028800 Bacteria 308414
335 Ga0265338_10202898 3300028800 Bacteria 1494
336 Ga0268256_1009896 3300030500 Bacteria 3125
337 Ga0265327_10021679 3300031251 Bacteria 3869
338 Ga0265327_10028444 3300031251 Bacteria 3198
339 Ga0307513_10074356 3300031456 Bacteria 3534
340 Ga0307408_100000134 3300031548 Bacteria 82703
341 Ga0307408_100044834 3300031548 Bacteria 3154
342 Ga0316578_10109153 3300031728 Bacteria 1661
343 Ga0307405_10001276 3300031731 Bacteria 10496
344 Ga0307405_10008943 3300031731 Bacteria 5111
345 Ga0307405_10010173 3300031731 Bacteria 4858
346 Ga0307407_10161317 3300031903 Bacteria 1467
347 Ga0307412_10000024 3300031911 Bacteria 235467
348 Ga0307412_10000516 3300031911 Bacteria 23055
349 Ga0307412_10000862 3300031911 Bacteria 17463
350 Ga0307412_10002325 3300031911 Bacteria 10520
351 Ga0307412_10052752 3300031911 Bacteria 2694
352 Ga0307409_100017939 3300031995 Bacteria 4736
353 Ga0307416_100003840 3300032002 Bacteria 8935
354 Ga0307416_100427521 3300032002 Bacteria 1370
355 Ga0307414_10005205 3300032004 Bacteria 7141
356 Ga0307411_10039379 3300032005 Bacteria 2989
357 Ga0316583_10003812 3300032133 Bacteria 5344
358 Ga0307510_10159989 3300033180 Bacteria 1851
359 Ga0316574_0024916 3300035398 Bacteria 3586
360 Ga0316582_0178756 3300036647 Bacteria 1443
361 Ga0316584_0061527 3300036712 Bacteria 2812
362 Ga0316584_0066494 3300036712 Bacteria 2701
363 Ga0395898_0008451 3300037466 Bacteria 10881
364 Ga0395905_0000041 3300037471 Bacteria 250958
365 Ga0395905_0061057 3300037471 Bacteria 3525
366 Ga0395905_0061884 3300037471 Bacteria 3501
367 Ga0400484_20111 3300038725 Bacteria 2345
368 Ga0400484_23104 3300038725 Bacteria 5641
369 Ga0400484_35008 3300038725 Bacteria 2513
370 Ga0400490_46345 3300038726 Bacteria 17465
371 Ga0400490_48495 3300038726 Bacteria 4903
372 Ga0400488_57407 3300038741 Bacteria 1743
373 Ga0400483_001970 3300039062 Bacteria 1233
374 Ga0400483_012467 3300039062 Bacteria 3885
375 Ga0400483_043932 3300039062 Bacteria 2946
376 Ga0400483_156899 3300039062 Bacteria 18579
377 Ga0400483_169173 3300039062 Bacteria 6637
378 Ga0400483_209372 3300039062 Bacteria 3693
379 Ga0400489_67634 3300039093 Bacteria 4346
380 Ga0400487_45314 3300039110 Bacteria 16850
381 Ga0436361_0866616 3300039447 Bacteria 7110
382 Ga0436361_1107681 3300039447 Bacteria 6320
383 Ga0439465_0009811 3300041413 Bacteria 3016
384 Ga0451833_0084816 3300041491 Bacteria 2314
385 Ga0451835_0334487 3300041492 Bacteria 1212
386 Ga0451837_0659144 3300041494 Bacteria 2305
387 Ga0451841_0514518 3300041498 Bacteria 2226
388 Ga0451845_0226581 3300041501 Bacteria 1323
389 Ga0451849_0695212 3300041505 Bacteria 1777
390 Ga0451843_0534843 3300041509 Bacteria 1410
391 Ga0451855_0155246 3300041511 Bacteria 1174
392 Ga0451853_1273235 3300041512 Bacteria 1573
393 Ga0451853_1348410 3300041512 Bacteria 2507
394 Ga0439448_0000074 3300042005 Bacteria 17207
395 Ga0439449_0023893 3300042007 Bacteria 2286
396 Ga0439456_000129 3300042013 Bacteria 23611
397 Ga0439463_000319 3300042016 Bacteria 13504
398 Ga0466969_0028950 3300044656 Bacteria 2830
399 Ga0466961_0000305 3300044693 Bacteria 32559
400 Ga0466970_0027842 3300044765 Bacteria 2967
401 Ga0466959_0005513 3300045049 Bacteria 8678
402 Ga0466959_0081253 3300045049 Bacteria 2336
403 Ga0466967_0214492 3300045976 Bacteria 1827
404 Ga0495617_017103 3300046452 Bacteria 2448
405 Ga0495617_026763 3300046452 Bacteria 1942
406 Ga0495617_050341 3300046452 Bacteria 1386
407 Ga0495627_000036 3300046453 Bacteria 205589
408 Ga0495627_000112 3300046453 Bacteria 101337
409 Ga0495627_003895 3300046453 Bacteria 6388
410 Ga0495592_0031280 3300046454 Bacteria 4023
411 Ga0495592_0055849 3300046454 Bacteria 2919
412 Ga0495603_0001311 3300046455 Bacteria 14447
413 Ga0495603_0002931 3300046455 Bacteria 10085
414 Ga0495603_0156817 3300046455 Bacteria 1321
415 Ga0495590_0001712 3300046457 Bacteria 9325
416 Ga0495591_000009 3300046458 Bacteria 331626
417 Ga0495591_001145 3300046458 Bacteria 17397
418 Ga0495591_001533 3300046458 Bacteria 14162
419 Ga0495629_0000098 3300046459 Bacteria 75959
420 Ga0495629_0004355 3300046459 Bacteria 10615
421 Ga0495629_0027417 3300046459 Bacteria 4043
422 Ga0495629_0031675 3300046459 Bacteria 3743
423 Ga0495629_0062089 3300046459 Bacteria 2611
424 Ga0495638_0000018 3300046460 Bacteria 389696
425 Ga0495638_0000789 3300046460 Bacteria 33427
426 Ga0495638_0023885 3300046460 Bacteria 3993
427 Ga0495638_0073027 3300046460 Bacteria 2095
428 Ga0495641_0015729 3300046461 Bacteria 4020
429 Ga0495641_0071002 3300046461 Bacteria 1563
430 Ga0495651_0018150 3300046462 Bacteria 5447
431 Ga0495653_0001085 3300046463 Bacteria 20996
432 Ga0495650_0000143 3300046471 Bacteria 168096
433 Ga0495650_0001210 3300046471 Bacteria 27205
434 Ga0495650_0001914 3300046471 Bacteria 18442
435 Ga0495650_0004473 3300046471 Bacteria 9558
436 Ga0495650_0017008 3300046471 Bacteria 3658
437 Ga0495650_0093586 3300046471 Bacteria 1139
438 Ga0495650_0095354 3300046471 Bacteria 1125
439 Ga0495580_0000171 3300046472 Bacteria 48150
440 Ga0495580_0000453 3300046472 Bacteria 34001
441 Ga0495580_0004700 3300046472 Bacteria 11452
442 Ga0495580_0007124 3300046472 Bacteria 9004
443 Ga0495582_0000525 3300046473 Bacteria 21124
444 Ga0495582_0016774 3300046473 Bacteria 4011
445 Ga0495605_0000001 3300046474 Bacteria 614538
446 Ga0495605_0001810 3300046474 Bacteria 13704
447 Ga0495605_0010044 3300046474 Bacteria 5302
448 Ga0495605_0030068 3300046474 Bacteria 2788
449 Ga0495605_0031121 3300046474 Bacteria 2728
450 Ga0495605_0041962 3300046474 Bacteria 2276
451 Ga0495664_0000427 3300046477 Bacteria 20644
452 Ga0495664_0009862 3300046477 Bacteria 5355
453 Ga0495664_0024223 3300046477 Bacteria 3526
454 Ga0495584_0002425 3300046491 Bacteria 10573
455 Ga0495584_0003436 3300046491 Bacteria 8725
456 Ga0495585_0000127 3300046492 Bacteria 82252
457 Ga0495585_0011184 3300046492 Bacteria 5317
458 Ga0495596_0016143 3300046500 Bacteria 3108
459 Ga0495607_0000291 3300046501 Bacteria 52902
460 Ga0495607_0036799 3300046501 Bacteria 2946
461 Ga0495607_0041622 3300046501 Bacteria 2727
462 Ga0495607_0055940 3300046501 Bacteria 2266
463 Ga0495583_0000010 3300046506 Bacteria 353523
464 Ga0495583_0000187 3300046506 Bacteria 104971
465 Ga0495583_0003226 3300046506 Bacteria 12753
466 Ga0495583_0009731 3300046506 Bacteria 5707
467 Ga0495583_0012736 3300046506 Bacteria 4736
468 Ga0495583_0025948 3300046506 Bacteria 2916
469 Ga0495583_0028074 3300046506 Bacteria 2771
470 Ga0495606_0000013 3300046507 Bacteria 292850
471 Ga0495606_0000465 3300046507 Bacteria 66730
472 Ga0495606_0006635 3300046507 Bacteria 10611
473 Ga0495606_0015352 3300046507 Bacteria 5907
474 Ga0495606_0029147 3300046507 Bacteria 3880
475 Ga0495606_0034450 3300046507 Bacteria 3476
476 Ga0495608_0050496 3300046511 Bacteria 2759
477 Ga0495610_0000079 3300046512 Bacteria 115816
478 Ga0495610_0000454 3300046512 Bacteria 42447
479 Ga0495610_0006916 3300046512 Bacteria 7681
480 Ga0495610_0019401 3300046512 Bacteria 3806
481 Ga0495610_0026996 3300046512 Bacteria 3059
482 Ga0495610_0083268 3300046512 Bacteria 1464
483 Ga0495616_0031447 3300046513 Bacteria 2779
484 Ga0495618_0004983 3300046514 Bacteria 8114
485 Ga0495618_0077538 3300046514 Bacteria 2117
486 Ga0495620_0000994 3300046515 Bacteria 17518
487 Ga0495620_0012599 3300046515 Bacteria 4358
488 Ga0495620_0018123 3300046515 Bacteria 3492
489 Ga0495620_0060633 3300046515 Bacteria 1577
490 Ga0495620_0063593 3300046515 Bacteria 1529
491 Ga0495628_0001765 3300046516 Bacteria 19679
492 Ga0495628_0038569 3300046516 Bacteria 3823
493 Ga0495628_0082721 3300046516 Bacteria 2493
494 Ga0495630_0013137 3300046517 Bacteria 6020
495 Ga0495630_0036611 3300046517 Bacteria 3668
496 Ga0495631_0023144 3300046518 Bacteria 2882
497 Ga0495631_0024916 3300046518 Bacteria 2758
498 Ga0495631_0041542 3300046518 Bacteria 2035
499 Ga0495632_0000001 3300046519 Bacteria 873295
500 Ga0495632_0000384 3300046519 Bacteria 42202
501 Ga0495632_0002606 3300046519 Bacteria 13589
502 Ga0495632_0012263 3300046519 Bacteria 4948
503 Ga0495632_0013825 3300046519 Bacteria 4589
504 Ga0495637_0000021 3300046520 Bacteria 179141
505 Ga0495637_0000039 3300046520 Bacteria 117112
506 Ga0495637_0000341 3300046520 Bacteria 35858
507 Ga0495643_0000004 3300046522 Bacteria 519944
508 Ga0495643_0000006 3300046522 Bacteria 419524
509 Ga0495643_0008058 3300046522 Bacteria 6715
510 Ga0495643_0008694 3300046522 Bacteria 6404
511 Ga0495643_0061802 3300046522 Bacteria 1985
512 Ga0495643_0072977 3300046522 Bacteria 1799
513 Ga0495644_0006565 3300046523 Bacteria 4504
514 Ga0495648_0000018 3300046524 Bacteria 282490
515 Ga0495648_0008954 3300046524 Bacteria 7820
516 Ga0495648_0014093 3300046524 Bacteria 5873
517 Ga0495648_0014491 3300046524 Bacteria 5768
518 Ga0495648_0049425 3300046524 Bacteria 2578
519 Ga0495648_0053979 3300046524 Bacteria 2430
520 Ga0495648_0063237 3300046524 Bacteria 2186
521 Ga0495663_0000001 3300046525 Bacteria 595264
522 Ga0495666_0000074 3300046526 Bacteria 38870
523 Ga0495666_0004808 3300046526 Bacteria 6828
524 Ga0495666_0025770 3300046526 Bacteria 2903
525 Ga0495666_0041903 3300046526 Bacteria 2215
526 Ga0495642_0018477 3300046528 Bacteria 2729
527 Ga0495642_0032774 3300046528 Bacteria 2086
528 Ga0495652_0007094 3300046529 Bacteria 10343
529 Ga0495652_0030195 3300046529 Bacteria 4755
530 Ga0495652_0059204 3300046529 Bacteria 3241
531 Ga0495665_0004010 3300046531 Bacteria 7938
532 Ga0495665_0020483 3300046531 Bacteria 3552
533 Ga0495640_0001565 3300046533 Bacteria 18012
534 Ga0495586_0000719 3300046535 Bacteria 18897
535 Ga0495586_0072913 3300046535 Bacteria 1878
536 Ga0495587_0002495 3300046536 Bacteria 12286
537 Ga0495609_0000020 3300046538 Bacteria 294662
538 Ga0495609_0000062 3300046538 Bacteria 138094
539 Ga0495609_0034433 3300046538 Bacteria 2296
540 Ga0495609_0092950 3300046538 Bacteria 1311
541 Ga0495597_0018676 3300046542 Bacteria 3251
542 Ga0495597_0042519 3300046542 Bacteria 2026
543 Ga0495597_0062098 3300046542 Bacteria 1626
544 Ga0495645_0000821 3300046543 Bacteria 21244
545 Ga0495645_0017472 3300046543 Bacteria 5139
546 Ga0495622_0000161 3300046557 Bacteria 56444
547 Ga0495622_0003817 3300046557 Bacteria 7042
548 Ga0495633_0000654 3300046558 Bacteria 32019
549 Ga0495633_0002962 3300046558 Bacteria 11617
550 Ga0495633_0038731 3300046558 Bacteria 2276
551 Ga0495667_0030219 3300046559 Bacteria 3643
552 Ga0495668_0002893 3300046616 Bacteria 13561
553 Ga0495668_0003158 3300046616 Bacteria 12700
554 Ga0495668_0162455 3300046616 Bacteria 1223
555 Ga0495634_0030483 3300046642 Bacteria 3724
556 Ga0495634_0063547 3300046642 Bacteria 2449
557 Ga0495611_0000802 3300046648 Bacteria 17419
558 Ga0495611_0014233 3300046648 Bacteria 3395
559 Ga0495611_0018446 3300046648 Bacteria 2993
560 Ga0495625_0000028 3300046660 Bacteria 256946
561 Ga0495625_0088285 3300046660 Bacteria 2148
562 Ga0495625_0130589 3300046660 Bacteria 1702
563 Ga0495625_0166481 3300046660 Bacteria 1473
564 Ga0495635_0001780 3300046663 Bacteria 14546
565 Ga0495635_0011861 3300046663 Bacteria 6109
566 Ga0495661_0000001 3300046665 Bacteria 898372
567 Ga0495661_0000452 3300046665 Bacteria 43465
568 Ga0495661_0002554 3300046665 Bacteria 13957
569 Ga0495661_0020661 3300046665 Bacteria 4296
570 Ga0495661_0066013 3300046665 Bacteria 2131
571 Ga0495588_0089999 3300046674 Bacteria 1607
572 Ga0495599_0001334 3300046678 Bacteria 14063
573 Ga0495599_0086326 3300046678 Bacteria 1959
574 Ga0495623_0030229 3300046679 Bacteria 3484
575 Ga0495623_0055696 3300046679 Bacteria 2491
576 Ga0495646_0004287 3300046680 Bacteria 8981
577 Ga0495646_0060634 3300046680 Bacteria 2255
578 Ga0495646_0063021 3300046680 Bacteria 2203
579 Ga0495613_0001656 3300046689 Bacteria 16963
580 Ga0495613_0022700 3300046689 Bacteria 4675
581 Ga0495624_0000139 3300046690 Bacteria 52075
582 Ga0495624_0001598 3300046690 Bacteria 17393
583 Ga0495624_0017849 3300046690 Bacteria 4754
584 Ga0495624_0041382 3300046690 Bacteria 2947
585 Ga0495671_0000008 3300046692 Bacteria 419524
586 Ga0495671_0000011 3300046692 Bacteria 365582
587 Ga0495671_0021871 3300046692 Bacteria 3354
588 Ga0495649_0001018 3300046694 Bacteria 22000
589 Ga0495649_0029508 3300046694 Bacteria 3033
590 Ga0495649_0090989 3300046694 Bacteria 1626
591 Ga0495589_0001308 3300046794 Bacteria 14624
592 Ga0495600_0006701 3300046809 Bacteria 7019
593 Ga0495600_0017912 3300046809 Bacteria 4508
594 Ga0495660_0001564 3300046810 Bacteria 15371
595 Ga0495660_0004492 3300046810 Bacteria 8437
596 Ga0495660_0005072 3300046810 Bacteria 7912
597 Ga0495660_0043208 3300046810 Bacteria 2487
598 Ga0495581_0003108 3300047315 Bacteria 9509
599 Ga0495581_0037869 3300047315 Bacteria 2791
600 Ga0495604_0005687 3300047317 Bacteria 9890
601 Ga0495604_0006799 3300047317 Bacteria 9066
602 Ga0495604_0010696 3300047317 Bacteria 7283
603 Ga0495674_0017011 3300047319 Bacteria 6777
604 Ga0495674_0019792 3300047319 Bacteria 6241
605 Ga0495674_0025181 3300047319 Bacteria 5460
606 Ga0495674_0089116 3300047319 Bacteria 2637
607 Ga0495674_0131504 3300047319 Bacteria 2108
608 Ga0495672_0002374 3300047320 Bacteria 17377
609 Ga0495672_0093592 3300047320 Bacteria 1645
610 Ga0495676_0000006 3300047321 Bacteria 280508
611 Ga0495676_0012034 3300047321 Bacteria 7803
612 Ga0495680_0001584 3300047322 Bacteria 24332
613 Ga0495680_0036781 3300047322 Bacteria 3926
614 Ga0495683_0004017 3300047323 Bacteria 8447
615 Ga0495683_0008208 3300047323 Bacteria 5599
616 Ga0495683_0011601 3300047323 Bacteria 4636
617 Ga0495683_0077524 3300047323 Bacteria 1624
618 Ga0495687_000022 3300047443 Bacteria 327353
619 Ga0495687_013299 3300047443 Bacteria 4307
620 Ga0495687_052200 3300047443 Bacteria 1730
621 Ga0495675_0001909 3300047444 Bacteria 12420
622 Ga0495675_0024964 3300047444 Bacteria 3812
623 Ga0495679_000025 3300047446 Bacteria 198386
624 Ga0495679_000150 3300047446 Bacteria 62726
625 Ga0495679_001462 3300047446 Bacteria 13392
626 Ga0495679_001545 3300047446 Bacteria 12992
627 Ga0495679_002123 3300047446 Bacteria 10437
628 Ga0495673_0000013 3300047469 Bacteria 612902
629 Ga0495673_0001371 3300047469 Bacteria 19679
630 Ga0495673_0018744 3300047469 Bacteria 3483
631 Ga0495673_0077707 3300047469 Bacteria 1382
632 Ga0495681_0000013 3300047470 Bacteria 189155
633 Ga0495681_0006336 3300047470 Bacteria 7790
634 Ga0495681_0007358 3300047470 Bacteria 7044
635 Ga0495681_0017500 3300047470 Bacteria 3976
636 Ga0495681_0063780 3300047470 Bacteria 1690
637 Ga0495681_0069759 3300047470 Bacteria 1596
638 Ga0495686_0000002 3300047472 Bacteria 1050777
639 Ga0495686_0001007 3300047472 Bacteria 34237
640 Ga0495686_0007932 3300047472 Bacteria 7881
641 Ga0495686_0008600 3300047472 Bacteria 7470
642 Ga0495686_0010825 3300047472 Bacteria 6464
643 Ga0495686_0022216 3300047472 Bacteria 4199
644 Ga0495686_0047104 3300047472 Bacteria 2723
645 Ga0495686_0151542 3300047472 Bacteria 1361
646 Ga0495593_0016281 3300047673 Bacteria 4197
647 Ga0495593_0027125 3300047673 Bacteria 3155
648 Ga0495602_0023652 3300048088 Bacteria 5982
649 Ga0495602_0092751 3300048088 Bacteria 2500
650 Ga0495614_0019197 3300048089 Bacteria 2958
651 Ga0495614_0020202 3300048089 Bacteria 2881
652 Ga0495614_0107656 3300048089 Bacteria 1222
653 Ga0495615_0000003 3300048090 Bacteria 127902
654 Ga0495615_0019725 3300048090 Bacteria 1501
655 Ga0495626_0000019 3300048091 Bacteria 225494
656 Ga0495626_0046844 3300048091 Bacteria 2012
657 Ga0495626_0070012 3300048091 Bacteria 1579
658 Ga0496100_0011566 3300048903 Bacteria 5028
659 Ga0496100_0054065 3300048903 Bacteria 2617
660 Ga0496101_0000369 3300048904 Bacteria 29873
661 Ga0496101_0005003 3300048904 Bacteria 8418
662 Ga0496101_0062915 3300048904 Bacteria 2699
663 Ga0496102_0000258 3300048905 Bacteria 68544
664 Ga0496102_0000551 3300048905 Bacteria 40299
665 Ga0496102_0015568 3300048905 Bacteria 6625
666 Ga0496103_0000098 3300048906 Bacteria 96109
667 Ga0496103_0000326 3300048906 Bacteria 43556
668 Ga0496103_0004631 3300048906 Bacteria 8328
669 Ga0496103_0019256 3300048906 Bacteria 4098
670 Ga0496104_0004611 3300048907 Bacteria 12009
671 Ga0496104_0155388 3300048907 Bacteria 2195
672 Ga0496105_0055157 3300048908 Bacteria 3281
673 Ga0496105_0089119 3300048908 Bacteria 2548
674 Ga0496106_0003362 3300048909 Bacteria 11925
675 Ga0496106_0023088 3300048909 Bacteria 4620
676 Ga0496107_0001254 3300048910 Bacteria 15535
677 Ga0496108_0000763 3300048911 Bacteria 25067
678 Ga0496108_0145994 3300048911 Bacteria 2040
679 Ga0496110_0008899 3300048913 Bacteria 8093
680 Ga0496110_0014287 3300048913 Bacteria 6588
681 Ga0496110_0177981 3300048913 Bacteria 1931
682 Ga0496110_0320182 3300048913 Bacteria 1412
683 Ga0496111_0001285 3300048914 Bacteria 14065
684 Ga0496113_0004334 3300048916 Bacteria 8695
685 Ga0496113_0336840 3300048916 Bacteria 1210
686 Ga0496114_0000981 3300048917 Bacteria 21347
687 Ga0496114_0017947 3300048917 Bacteria 5718
688 Ga0496114_0031622 3300048917 Bacteria 4354
689 Ga0496115_0178355 3300048918 Bacteria 1757
690 Ga0496116_0001473 3300048919 Bacteria 26338
691 Ga0496116_0009602 3300048919 Bacteria 8234
692 Ga0496116_0017649 3300048919 Bacteria 5530
693 Ga0496116_0025474 3300048919 Bacteria 4347
694 Ga0496116_0028745 3300048919 Bacteria 4021
695 Ga0496116_0031452 3300048919 Bacteria 3799
696 Ga0496116_0112500 3300048919 Bacteria 1595
697 Ga0496116_0168964 3300048919 Bacteria 1187
698 Ga0496117_0000121 3300048920 Bacteria 171532
699 Ga0496117_0001122 3300048920 Bacteria 40315
700 Ga0496117_0002864 3300048920 Bacteria 20969
701 Ga0496117_0007366 3300048920 Bacteria 10769
702 Ga0496117_0007912 3300048920 Bacteria 10214
703 Ga0496117_0013370 3300048920 Bacteria 7164
704 Ga0496117_0018825 3300048920 Bacteria 5699
705 Ga0496117_0034818 3300048920 Bacteria 3789
706 Ga0496117_0045089 3300048920 Bacteria 3189
707 Ga0496117_0100483 3300048920 Bacteria 1832
708 Ga0496117_0106406 3300048920 Bacteria 1760
709 Ga0496117_0118483 3300048920 Bacteria 1632
710 Ga0496118_0000095 3300048921 Bacteria 164850
711 Ga0496118_0001154 3300048921 Bacteria 40809
712 Ga0496118_0003651 3300048921 Bacteria 19121
713 Ga0496118_0004923 3300048921 Bacteria 15507
714 Ga0496118_0005119 3300048921 Bacteria 15061
715 Ga0496118_0008181 3300048921 Bacteria 10880
716 Ga0496118_0029419 3300048921 Bacteria 4606
717 Ga0496118_0061773 3300048921 Bacteria 2771
718 Ga0496118_0121783 3300048921 Bacteria 1698
719 Ga0496119_0012070 3300048922 Bacteria 7060
720 Ga0496119_0013733 3300048922 Bacteria 6418
721 Ga0496119_0016911 3300048922 Bacteria 5520
722 Ga0496119_0019480 3300048922 Bacteria 4996
723 Ga0496119_0141289 3300048922 Bacteria 1300
724 Ga0496120_0005830 3300048923 Bacteria 9650
725 Ga0496121_0000087 3300048924 Bacteria 222451
726 Ga0496121_0000624 3300048924 Bacteria 65948
727 Ga0496121_0004650 3300048924 Bacteria 18256
728 Ga0496121_0006109 3300048924 Bacteria 15148
729 Ga0496121_0007013 3300048924 Bacteria 13688
730 Ga0496121_0024937 3300048924 Bacteria 5699
731 Ga0496121_0029634 3300048924 Bacteria 5052
732 Ga0496121_0034730 3300048924 Bacteria 4534
733 Ga0496121_0042851 3300048924 Bacteria 3929
734 Ga0496121_0114264 3300048924 Bacteria 2052
735 Ga0496121_0173577 3300048924 Bacteria 1563
736 Ga0496122_0000935 3300048925 Bacteria 53083
737 Ga0496122_0001672 3300048925 Bacteria 34402
738 Ga0496122_0006069 3300048925 Bacteria 14078
739 Ga0496122_0024031 3300048925 Bacteria 5346
740 Ga0496122_0039009 3300048925 Bacteria 3794
741 Ga0496122_0043653 3300048925 Bacteria 3509
742 Ga0496122_0044603 3300048925 Bacteria 3457
743 Ga0496122_0068700 3300048925 Bacteria 2542
744 Ga0496122_0132105 3300048925 Bacteria 1583
745 Ga0496122_0177410 3300048925 Bacteria 1275
746 Ga0496123_0000337 3300048926 Bacteria 88727
747 Ga0496123_0001736 3300048926 Bacteria 28866
748 Ga0496123_0006087 3300048926 Bacteria 11837
749 Ga0496123_0016306 3300048926 Bacteria 6042
750 Ga0496123_0024008 3300048926 Bacteria 4650
751 Ga0496123_0035916 3300048926 Bacteria 3524
752 Ga0496123_0054508 3300048926 Bacteria 2632
753 Ga0496123_0127871 3300048926 Bacteria 1414
754 Ga0496124_0000119 3300048927 Bacteria 163996
755 Ga0496124_0006868 3300048927 Bacteria 12253
756 Ga0496124_0015876 3300048927 Bacteria 7193
757 Ga0496124_0016270 3300048927 Bacteria 7082
758 Ga0496124_0025665 3300048927 Bacteria 5331
759 Ga0496124_0030082 3300048927 Bacteria 4826
760 Ga0496124_0045315 3300048927 Bacteria 3770
761 Ga0496124_0078365 3300048927 Bacteria 2723
762 Ga0496124_0079496 3300048927 Bacteria 2700
763 Ga0496124_0100722 3300048927 Bacteria 2341
764 Ga0496124_0104244 3300048927 Bacteria 2293
765 Ga0496125_0002065 3300048928 Bacteria 27123
766 Ga0496125_0003585 3300048928 Bacteria 18663
767 Ga0496125_0004283 3300048928 Bacteria 16593
768 Ga0496125_0004681 3300048928 Bacteria 15592
769 Ga0496125_0008785 3300048928 Bacteria 10509
770 Ga0496125_0009964 3300048928 Bacteria 9658
771 Ga0496125_0018724 3300048928 Bacteria 6565
772 Ga0496125_0032440 3300048928 Bacteria 4640
773 Ga0496125_0040968 3300048928 Bacteria 3965
774 Ga0496125_0069112 3300048928 Bacteria 2773
775 Ga0496125_0096302 3300048928 Bacteria 2197
776 Ga0496125_0130088 3300048928 Bacteria 1774
777 Ga0496126_0000278 3300048929 Bacteria 107983
778 Ga0496126_0000592 3300048929 Bacteria 68725
779 Ga0496126_0004017 3300048929 Bacteria 17931
780 Ga0496126_0011844 3300048929 Bacteria 8973
781 Ga0496126_0021904 3300048929 Bacteria 6232
782 Ga0496126_0024075 3300048929 Bacteria 5883
783 Ga0496126_0093127 3300048929 Bacteria 2646
784 Ga0496126_0140809 3300048929 Bacteria 2076
785 Ga0496126_0188507 3300048929 Bacteria 1748
786 Ga0496126_0319131 3300048929 Bacteria 1277
787 Ga0495678_000083 3300049459 Bacteria 117558
788 Ga0495678_005993 3300049459 Bacteria 6559
789 Ga0495678_006390 3300049459 Bacteria 6279
790 Ga0495678_036432 3300049459 Bacteria 2007
791 Ga0495678_056561 3300049459 Bacteria 1490
792 Ga0495678_059431 3300049459 Bacteria 1441
793 Ga0495682_0015286 3300049460 Bacteria 2909
794 Ga0501032_0053548 3300049569 Bacteria 2717
795 Ga0501037_0123036 3300049573 Bacteria 1864
796 Ga0501043_0099892 3300049579 Bacteria 2281
797 Ga0501047_0218956 3300049581 Bacteria 1760
798 Ga0501249_000141 3300049679 Bacteria 22514
799 Ga0501083_0132883 3300049744 Bacteria 1631
800 Ga0501280_001736 3300049776 Bacteria 3849
801 Ga0501044_0077302 3300049823 Bacteria 3376
802 Ga0501044_0139093 3300049823 Bacteria 2417
803 nmdc:mga03683_85_c1 3300050489 Bacteria 34614
804 nmdc:mga03n38_164724_c1 3300050490 Bacteria 1125
805 nmdc:mga03n38_21095_c1 3300050490 Bacteria 2616
806 nmdc:mga00v17_175452_c1 3300050491 Bacteria 1382
807 nmdc:mga0yw44_9165_c1 3300050492 Bacteria 4982
808 nmdc:mga06z11_37_c1 3300050494 Bacteria 55036
809 nmdc:mga06z11_527_c1 3300050494 Bacteria 14116
810 nmdc:mga04h51_16_c1 3300050495 Bacteria 75553
811 nmdc:mga04h51_237_c1 3300050495 Bacteria 14548
812 nmdc:mga07m45_54793_c1 3300050496 Bacteria 2253
813 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
814 nmdc:mga0sz30_93_c1 3300050516 Bacteria 34625
815 Ga0500610_0029819 3300053079 Bacteria 2759
816 Ga0500578_0083426 3300053086 Bacteria 2031
817 Ga0500643_000362 3300053087 Bacteria 35932
818 Ga0500643_000503 3300053087 Bacteria 27831
819 Ga0500643_034605 3300053087 Bacteria 1520
820 Ga0500566_0068981 3300053094 Bacteria 1987
821 Ga0500555_000799 3300053103 Bacteria 11353
822 Ga0500560_002179 3300053107 Bacteria 3672
823 Ga0500569_007159 3300053109 Bacteria 2490
824 Ga0500594_0004461 3300053118 Bacteria 3084
825 Ga0500607_000035 3300053121 Bacteria 87430
826 Ga0500607_000148 3300053121 Bacteria 59763
827 Ga0500618_001727 3300053125 Bacteria 9283
828 Ga0500658_0001182 3300053134 Bacteria 10638
829 Ga0500559_0001018 3300053136 Bacteria 17198
830 Ga0500559_0001082 3300053136 Bacteria 16527
831 Ga0500559_0002069 3300053136 Bacteria 10734
832 Ga0500568_0012950 3300053139 Bacteria 3817
833 Ga0500568_0017868 3300053139 Bacteria 3119
834 Ga0500616_0000982 3300053153 Bacteria 30793
835 Ga0500616_0028841 3300053153 Bacteria 3056
836 Ga0500622_0004006 3300053156 Bacteria 9491
837 Ga0500624_000010 3300053157 Bacteria 172530
838 Ga0500624_000058 3300053157 Bacteria 70829
839 Ga0500624_001715 3300053157 Bacteria 3240
840 Ga0500634_0078120 3300053161 Bacteria 1713
841 Ga0500636_0001294 3300053177 Bacteria 13591
842 Ga0500637_0001441 3300053178 Bacteria 10136
843 Ga0500645_001940 3300053730 Bacteria 9809
844 Ga0500661_007303 3300055283 Bacteria 2048
845 Ga0501082_0426651 3300060353 Bacteria 1158
846 2501073591 2501025501 Bacteria 7768574
847 2501082268 2501025502 Bacteria 9641094
848 2501411016 2501025504 Bacteria 8008976
849 2509128639 2508501125 Bacteria 7208311
850 2509387713 2509276021 Bacteria 7634384
851 2509443072 2509276033 Bacteria 7180565
852 2510132300 2510065019 Bacteria 6903379
853 2510250843 2510065045 Bacteria 7761063
854 2510839686 2510461069 Bacteria 5505000
855 2510898639 2510461076 Bacteria 8618824
856 2511086386 2510917013 Bacteria 9951648
857 2511096531 2510917014 Bacteria 8296963
858 2511102832 2510917015 Bacteria 7950052
859 2511186365 2510917028 Bacteria 6185411
860 2511197192 2510917030 Bacteria 7460662
861 2512346258 2512047030 Bacteria 9031815
862 2512642976 2512564014 Bacteria 4639632
863 2513552138 2513237082 Bacteria 8640282
864 2513560924 2513237083 Bacteria 8410967
865 2513569138 2513237084 Bacteria 7231967
866 2513578808 2513237085 Bacteria 7695351
867 2513596255 2513237088 Bacteria 6927906
868 2513632754 2513237093 Bacteria 7545552
869 2513709205 2513237103 Bacteria 7647401
870 2513868775 2513237138 Bacteria 7368160
871 2513907519 2513237144 Bacteria 7530820
872 2513925709 2513237146 Bacteria 7166346
873 2513960967 2513237151 Bacteria 6309801
874 2514020750 2513237162 Bacteria 7468464
875 2514048161 2513237166 Bacteria 10373764
876 2515111285 2515075009 Bacteria 7288508
877 2515637835 2515154113 Bacteria 7807172
878 2515642581 2515154114 Bacteria 7848616
879 2515659190 2515154116 Bacteria 7552979
880 2515679710 2515154122 Bacteria 8609520
881 2515688719 2515154123 Bacteria 6387382
882 2515740465 2515154134 Bacteria 7220242
883 2516020301 2515154189 Bacteria 9629850
884 2517039925 2516653077 Bacteria 7555578
885 2517075470 2516653085 Bacteria 7346596
886 2517094057 2517093000 Bacteria 7412387
887 2517405877 2517287029 Bacteria 6905599
888 2519458676 2519103095 Bacteria 6629912
889 2520375275 2519899620 Bacteria 6499161
890 2524460644 2524023209 Bacteria 6679728
891 2527075205 2526164713 Bacteria 6780608
892 2530643890 2529292951 Bacteria 6916614
893 2535515724 2534681796 Bacteria 7146037
894 2563063040 2562617112 Bacteria 10918404
895 2585203084 2582581294 Bacteria 6626667
896 2585220997 2582581298 Bacteria 7315509
897 2585231489 2582581299 Bacteria 6518058
898 2585256609 2582581304 Bacteria 5831370
899 2585273257 2582581307 Bacteria 6597605
900 2585278909 2582581308 Bacteria 7413247
901 2585292333 2582581311 Bacteria 6763856
902 2585325477 2582581315 Bacteria 7318924
903 2585400118 2582581867 Bacteria 7184437
904 2585527966 2585427526 Bacteria 7258840
905 2585549903 2585427529 Bacteria 7395659
906 2585554886 2585427530 Bacteria 7383882
907 2585559443 2585427531 Bacteria 6992870
908 2585822677 2585427590 Bacteria 6824633
909 2585847212 2585427594 Bacteria 6180594
910 2585902114 2585427608 Bacteria 6544331
911 2585905181 2585427609 Bacteria 6667127
912 2587979704 2585428125 Bacteria 6662905
913 2599418588 2599185170 Bacteria 7295545
914 2599737262 2599185239 Bacteria 8686614
915 2599746999 2599185240 Bacteria 7968121
916 2600208843 2599185355 Bacteria 7968906
917 2600809782 2600255067 Bacteria 6795583
918 2616296210 2615840624 Bacteria 6557588
919 2644007931 2643221599 Bacteria 6292121
920 2644196520 2643221634 Bacteria 6705461
921 2644242888 2643221643 Bacteria 5749658
922 2644296827 2643221653 Bacteria 4569637
923 2644655081 2643221719 Bacteria 4568197
924 2676744565 2675903129 Bacteria 7964495
925 2713477241 2711768613 Bacteria 11048459
926 2719180294 2718217882 Bacteria 6556348
927 2719384862 2718217927 Bacteria 6972593
928 2719639980 2718217991 Bacteria 7829542
929 2719664617 2718217997 Bacteria 6740740
930 2719731043 2718218009 Bacteria 6478651
931 2720491037 2718218199 Bacteria 6740745
932 2720612399 2718218232 Bacteria 6720332
933 2720619238 2718218233 Bacteria 6662049
934 2720630638 2718218235 Bacteria 6630699
935 2720774331 2718218269 Bacteria 6906114
936 2721146388 2718218363 Bacteria 6524337
937 2721157910 2718218365 Bacteria 6274507
938 2721163267 2718218366 Bacteria 6425255
939 2721398582 2718218423 Bacteria 6438183
940 2722839437 2721755514 Bacteria 6424414
941 2723026058 2721755556 Bacteria 6745503
942 2723559603 2721755684 Bacteria 6859907
943 2723566219 2721755685 Bacteria 6704835
944 2724037395 2721755809 Bacteria 6438790
945 2724043799 2721755810 Bacteria 6479005
946 2724088938 2721755819 Bacteria 6906405
947 2724103484 2721755822 Bacteria 6726041
948 2724109330 2721755823 Bacteria 6752556
949 2725948488 2724679232 Bacteria 7646494
950 2730106994 2728369352 Bacteria 6745171
951 2730163531 2728369365 Bacteria 6555560
952 2730297542 2728369397 Bacteria 6274511
953 2738709686 2738541275 Bacteria 4830863
954 2738802167 2738541293 Bacteria 7065685
955 2738820724 2738541296 Bacteria 7285013
956 2738833204 2738541298 Bacteria 7286732
957 2738848111 2738541301 Bacteria 4834102
958 2738863840 2738541304 Bacteria 4833665
959 2738874732 2738541306 Bacteria 7284992
960 2739186361 2738543002 Bacteria 7284546
961 2739221330 2738543008 Bacteria 7282815
962 2739296358 2738543022 Bacteria 4835059
963 2739358036 2738543033 Bacteria 4833336
964 2746089597 2744054900 Bacteria 8399525
965 2746098456 2744054901 Bacteria 8397047
966 2753566699 2751185846 Bacteria 7242164
967 2765584518 2765235841 Bacteria 6137024
968 2766067603 2765235942 Bacteria 7445910
969 2792836487 2791355137 Bacteria 9654227
970 2793296200 2791355256 Bacteria 6798008
971 2793317526 2791355259 Bacteria 7254731
972 2793321096 2791355260 Bacteria 6598818
973 2793327128 2791355261 Bacteria 6661293
974 2793333615 2791355262 Bacteria 6774204
975 2793339796 2791355263 Bacteria 6872478
976 2793347936 2791355264 Bacteria 6429314
977 2793353574 2791355265 Bacteria 6539969
978 2793367851 2791355267 Bacteria 7222458
979 2805926577 2802429605 Bacteria 6875453
980 2805933384 2802429606 Bacteria 6346811
981 2817260955 2816332253 Bacteria 6764532
982 2817278651 2816332256 Bacteria 6891714
983 2817451726 2816332286 Bacteria 6853759
984 2819242539 2818991272 Bacteria 4622173
985 2819620167 2818991450 Bacteria 6962147
986 2819634865 2818991452 Bacteria 8442785
987 2819639247 2818991453 Bacteria 7181617
988 2838017287 2838016132 Bacteria 6577831
989 2838037717 2838035591 Bacteria 7166484
990 2838047983 2838042994 Bacteria 6046894
991 2838049229 2838048938 Bacteria 6044578
992 2838063325 2838061910 Bacteria 6794874
993 2838662729 2838661181 Bacteria 7385261
994 2838670847 2838668709 Bacteria 6671819
995 2838681341 2838680041 Bacteria 6545511
996 2838688614 2838686498 Bacteria 7807632
997 2838694624 2838694306 Bacteria 6853137
998 2838703218 2838701080 Bacteria 6669771
999 2838708002 2838707686 Bacteria 6619912
1000 2838730909 2838729681 Bacteria 7400765
1001 2838744197 2838742623 Bacteria 7396178
1002 2841856878 2841851746 Bacteria 7532261
1003 2841865473 2841864319 Bacteria 6742987
1004 2842080767 2842077413 Bacteria 6508645
1005 2842114976 2842110456 Bacteria 7656360
1006 2842121386 2842118031 Bacteria 7033875
1007 2842147558 2842146304 Bacteria 5957337
1008 2842160048 2842156927 Bacteria 6894975
1009 2842168291 2842163707 Bacteria 6916235
1010 2842183335 2842180545 Bacteria 6888678
1011 2842197950 2842192696 Bacteria 6147454
1012 2842207697 2842205361 Bacteria 6340321
1013 2842221203 2842217011 Bacteria 7497767
1014 2842235064 2842229732 Bacteria 7475766
1015 2842237413 2842237096 Bacteria 6620661
1016 2842245661 2842243621 Bacteria 7421798
1017 2842252624 2842250916 Bacteria 6579627
1018 2842259689 2842257432 Bacteria 7401195
1019 2842266928 2842264693 Bacteria 6472963
1020 2842274528 2842271015 Bacteria 7807131
1021 2842281508 2842278818 Bacteria 6340002
1022 2842287117 2842285085 Bacteria 6011953
1023 2842294423 2842291075 Bacteria 7076806
1024 2842302448 2842298080 Bacteria 6123127
1025 2842306772 2842304105 Bacteria 7023636
1026 2842314746 2842311132 Bacteria 6616990
1027 2842318651 2842317721 Bacteria 6793725
1028 2842327389 2842324504 Bacteria 9364110
1029 2842343592 2842341865 Bacteria 7003929
1030 2842352004 2842348783 Bacteria 9002918
1031 2842360819 2842357229 Bacteria 6485165
1032 2842365251 2842363717 Bacteria 6844742
1033 2842371804 2842370503 Bacteria 7038661
1034 2842380821 2842377471 Bacteria 7140707
1035 2842387892 2842384541 Bacteria 7057858
1036 2842398265 2842395702 Bacteria 6780583
1037 2842404385 2842402390 Bacteria 6681310
1038 2842410930 2842409023 Bacteria 6687331
1039 2842417614 2842415677 Bacteria 6596907
1040 2842427356 2842422224 Bacteria 6239196
1041 2842431059 2842428310 Bacteria 6767288
1042 2842436943 2842434925 Bacteria 6502746
1043 2842443021 2842441272 Bacteria 6769273
1044 2842453243 2842447887 Bacteria 6754142
1045 2842458246 2842454564 Bacteria 8730687
1046 2842465032 2842462802 Bacteria 6588055
1047 2842471742 2842469257 Bacteria 6752936
1048 2842493757 2842489311 Bacteria 6620893
1049 2842497286 2842495871 Bacteria 6820686
1050 2842509729 2842509118 Bacteria 6850950
1051 2844455130 2844454524 Bacteria 7952546
1052 2856293700 2856287931 Bacteria 7223934
1053 2857362382 2857357740 Bacteria 9937880
1054 2857520292 2857516855 Bacteria 7787325
1055 2857579177 2857576091 Bacteria 5465855
1056 2863424507 2863421361 Bacteria 7300805
1057 2870071574 2870068957 Bacteria 8925310
1058 2883088851 2883087390 Bacteria 9532701
1059 2885278780 2885270888 Bacteria 9831543
1060 2900635095 2900634093 Bacteria 10263517
1061 2902689642 2902682994 Bacteria 8951596
1062 2904434881 2904434214 Bacteria 6230908
1063 2904484878 2904483920 Bacteria 7545285
1064 2904568708 2904564687 Bacteria 7609577
1065 2904575750 2904571731 Bacteria 7608790
1066 2904617066 2904615490 Bacteria 10047340
1067 2919103834 2919100787 Bacteria 7710546
1068 2919139300 2919138771 Bacteria 5281312
1069 2919530603 2919527303 Bacteria 7718827
1070 2919710841 2919709256 Bacteria 4318106
1071 2921650498 2921643360 Bacteria 11448031
1072 2923557565 2923556063 Bacteria 6793593
1073 2928101241 2928100450 Bacteria 4837635
1074 2928110274 2928108538 Bacteria 7360024
1075 2928138592 2928135762 Bacteria 7259641
1076 2928160506 2928157003 Bacteria 7522202
1077 2928164973 2928163908 Bacteria 7561269
1078 2928172708 2928170801 Bacteria 8785406
1079 2928505345 2928503688 Bacteria 7268108
1080 2928540767 2928536128 Bacteria 7657547
1081 2928960348 2928959182 Bacteria 4725774
1082 2933016845 2933016740 Bacteria 6355406
1083 2933573114 2933570622 Bacteria 7023390
1084 2933591375 2933586486 Bacteria 7667493
1085 2933604605 2933599457 Bacteria 5858799
1086 2935895146 2935894831 Bacteria 6620579
1087 2935904136 2935901341 Bacteria 7341747
1088 2936368122 2936367885 Bacteria 7324495
1089 2936381485 2936375103 Bacteria 6652732
1090 2936387381 2936381700 Bacteria 7006523
1091 2939656394 2939651529 Bacteria 5895393
1092 2945936990 2945934425 Bacteria 7444609
1093 2945962551 2945961074 Bacteria 7342064
1094 2981996188 2981990288 Bacteria 7590678
1095 2989778185 2989776772 Bacteria 4843317
1096 2990706282 2990703756 Bacteria 7715990
1097 2996890799 2996887358 Bacteria 5795980
1098 2996895080 2996893221 Bacteria 5823108
1099 3005453451 3005452660 Bacteria 5889319
1100 639647433 639633055 Bacteria 7751309
1101 642423104 641736151 Bacteria 7477263
1102 642415689 641736154 Bacteria 7689995
1103 642593424 642555112 Bacteria 8676562
1104 642621325 642555113 Bacteria 8214658
1105 8003955492 8003955200 Bacteria 8601927
1106 8005251314 8005246636 Bacteria 4933972
1107 8005261812 8005258706 Bacteria 6184835
1108 8005279582 8005275841 Bacteria 6929066
1109 8005284782 8005282627 Bacteria 6675747
1110 8005292792 8005289223 Bacteria 6634003
1111 8005311088 8005307578 Bacteria 7395396
1112 8005325326 8005321885 Bacteria 5795980
1113 8005376608 8005376324 Bacteria 6590079
1114 8005385997 8005382845 Bacteria 6732062
1115 8005400220 8005395548 Bacteria 6806915
1116 8005432269 8005430974 Bacteria 6689030
1117 8005461929 8005460587 Bacteria 7157962
1118 8005499331 8005497431 Bacteria 6477605
1119 8005558926 8005556819 Bacteria 6908598
1120 8005570436 8005563573 Bacteria 7153261
1121 8005620526 8005619151 Bacteria 7030230
1122 8005627508 8005626139 Bacteria 6534237
1123 8005670747 8005668836 Bacteria 6953162
1124 8005698789 8005695170 Bacteria 6912330
1125 8018131333 8018127388 Bacteria 7351159
1126 8018169158 8018163183 Bacteria 7277977
1127 8018177243 8018176218 Bacteria 6896178
1128 8018849794 8018845410 Bacteria 8933938
1129 8020813169 8020807995 Bacteria 6801506
1130 8020942251 8020938398 Bacteria 7472757
1131 8020951339 8020945358 Bacteria 8467355
1132 8020957881 8020953355 Bacteria 7439080
1133 8021124394 8021120328 Bacteria 8782274
1134 8023686957 8023680758 Bacteria 7729763
1135 8024489752 8024486573 Bacteria 6540512
1136 8024503251 8024501048 Bacteria 6427847
1137 8039104753 8039098773 Bacteria 6602928
1138 8040169894 8040167225 Bacteria 6542727
1139 8040173361 8040173305 Bacteria 6827067
1140 8054931283 8054929484 Bacteria 5599761
1141 8055268320 8055266321 Bacteria 7999742
1142 8055302362 8055301274 Bacteria 8587385
1143 8055882678 8055878733 Bacteria 5907058
1144 8056380731 8056375014 Bacteria 7006639
1145 8056384752 8056382006 Bacteria 6408074
1146 8057879587 8057874678 Bacteria 7494653
1147 Ga0105240_10002827
1148 SwRhRL2b_contig_1380016
1149 JGI24741J21665_1001367
1150 JGI24741J21665_1002735
1151 JGI24740J21852_10000071
1152 JGI24740J21852_10001830
1153 JGI24739J22299_10001942
1154 JGI24739J22299_10012850
1155 JGI24737J22298_10005303
1156 JGI24737J22298_10010517
1157 JGI24737J22298_10023788
1158 JGI24735J21928_10000180
1159 JGI24735J21928_10000289
1160 JGI24735J21928_10000371
1161 JGI24735J21928_10008786
1162 JGI24738J21930_10000001
1163 JGI24738J21930_10003173
1164 JGI25156J39149_1000859
1165 JGI25156J39149_1001993
1166 JGI25156J39149_1005504
1167 JGI25158J39367_1000407
1168 JGI25152J39213_1000623
1169 JGI25152J39213_1003008
1170 JGI25150J39212_1000033
1171 JGI25150J39212_1001462
1172 JGI25151J46595_10000108
1173 JGI25151J46595_10015298
1174 JGI25165J46597_1001483
1175 JGI25165J46597_1002550
1176 JGI25153J46596_10000563
1177 JGI25153J46596_10009883
1178 rootH1_10038444
1179 JGI25160J50197_1000015
1180 JGI25160J50197_1000064
1181 JGI25160J50197_1012089
1182 JGI25161J50226_1000005
1183 Ga0055533_1000218
1184 Ga0055532_1000001
1185 Ga0055532_1000255
1186 Ga0055532_1000388
1187 Ga0055532_1000436
1188 Ga0055527_1000002
1189 Ga0055527_1000224
1190 Ga0055527_1004258
1191 Ga0055527_1007478
1192 Ga0055535_1000001
1193 Ga0055535_1000474
1194 Ga0055535_1000693
1195 Ga0055542_1000001
1196 Ga0055542_1000673
1197 Ga0055542_1006731
1198 Ga0055529_1000026
1199 Ga0055529_1000608
1200 Ga0055529_1005398
1201 Ga0055526_1026225
1202 Ga0055524_1003638
1203 Ga0055524_1014079
1204 Ga0055524_1026782
1205 Ga0055528_1003635
1206 Ga0055528_1005083
1207 Ga0055528_1007761
1208 Ga0055528_1012526
1209 Ga0055540_1008490
1210 Ga0055543_1000012
1211 Ga0065165_1000325
1212 Ga0065165_1003987
1213 Ga0065704_10001512
1214 Ga0065704_10071185
1215 Ga0070658_10010072
1216 Ga0070658_10052541
1217 Ga0070670_100042569
1218 Ga0070666_10014803
1219 Ga0070666_10307719
1220 Ga0070660_100000509
1221 Ga0070660_100001423
1222 Ga0070668_100000019
1223 Ga0070668_100008368
1224 Ga0070668_100062139
1225 Ga0070669_100016598
1226 Ga0070671_100009450
1227 Ga0070671_100033072
1228 Ga0070659_100000015
1229 Ga0070659_100036438
1230 Ga0070667_100000094
1231 Ga0070667_100102079
1232 Ga0070667_100148201
1233 Ga0070663_100000602
1234 Ga0070663_100169386
1235 Ga0070662_100000624
1236 Ga0068853_100001013
1237 Ga0068853_100001046
1238 Ga0068853_100030570
1239 Ga0070665_100001576
1240 Ga0070665_100052647
1241 Ga0070665_100208920
1242 Ga0068855_100009188
1243 Ga0068855_100009504
1244 Ga0068855_100011395
1245 Ga0068855_100161877
1246 Ga0068855_100224865
1247 Ga0070664_100291744
1248 Ga0068857_100004355
1249 Ga0068857_100036828
1250 Ga0068854_100012363
1251 Ga0068854_100040155
1252 Ga0068856_100000374
1253 Ga0068852_100014797
1254 Ga0068859_100092607
1255 Ga0068851_10002777
1256 Ga0068863_100000057
1257 Ga0068863_100001297
1258 Ga0068863_100041355
1259 Ga0068860_100000623
1260 Ga0068860_100004802
1261 Ga0068860_100101614
1262 Ga0068862_100000194
1263 Ga0068862_100048804
1264 Ga0075365_10001318
1265 Ga0075365_10009667
1266 Ga0075368_10000019
1267 Ga0075363_100006825
1268 Ga0075363_100014895
1269 Ga0075362_10003928
1270 Ga0075367_10000795
1271 Ga0075369_10000498
1272 Ga0075366_10008922
1273 Ga0075370_10004487
1274 Ga0075370_10010880
1275 Ga0075370_10014093
1276 Ga0097620_100092612
1277 Ga0079104_1011926
1278 Ga0105251_10000134
1279 Ga0105251_10000167
1280 Ga0105251_10001159
1281 Ga0105251_10002394
1282 Ga0105251_10004353
1283 Ga0105251_10031535
1284 Ga0105244_10043714
1285 Ga0105240_10001649
1286 Ga0105240_10001654
1287 Ga0105240_10002976
1288 Ga0105240_10010622
1289 Ga0105240_10020477
1290 Ga0105240_10054519
1291 Ga0105240_10075107
1292 Ga0105247_10003919
1293 Ga0105247_10038239
1294 Ga0105241_10017153
1295 Ga0105241_10121729
1296 Ga0105237_10011460
1297 Ga0105237_10087097
1298 Ga0105238_10026668
1299 Ga0105249_10000135
1300 Ga0105249_10194843
1301 Ga0123341_1000062
1302 Ga0123342_1014931
1303 Ga0105239_10001422
1304 Ga0105239_10011808
1305 Ga0105239_10044978
1306 Ga0105246_10181244
1307 Ga0105246_10235272
1308 Ga0157373_10000535
1309 Ga0157373_10001841
1310 Ga0157371_10003242
1311 Ga0157371_10006163
1312 Ga0157370_10001866
1313 Ga0157370_10010833
1314 Ga0157370_10028140
1315 Ga0157369_10001453
1316 Ga0157369_10008887
1317 Ga0157369_10115264
1318 Ga0157369_10145516
1319 Ga0157374_10000155
1320 Ga0157374_10207720
1321 Ga0157372_10003812
1322 Ga0157372_10007709
1323 Ga0182008_10020817
1324 Ga0182006_1052259
1325 Ga0182007_10000453
1326 Ga0182007_10045038
1327 Ga0183361_10013
1328 Ga0163161_10011715
1329 Ga0163161_10026686
1330 Ga0213872_10038064
1331 Ga0209436_111054
1332 Ga0209566_100485
1333 Ga0209674_100005
1334 Ga0209674_100265
1335 Ga0209672_100001
1336 Ga0209672_100037
1337 Ga0209672_100080
1338 Ga0209672_101567
1339 Ga0209147_100001
1340 Ga0209147_100049
1341 Ga0209147_100071
1342 Ga0209147_100305
1343 Ga0209147_100358
1344 Ga0209563_100426
1345 Ga0207427_101045
1346 Ga0209437_100033
1347 Ga0209258_100001
1348 Ga0209258_100066
1349 Ga0209258_100082
1350 Ga0207425_1000031
1351 Ga0209148_1000003
1352 Ga0209148_1000168
1353 Ga0209148_1000755
1354 Ga0209759_1000029
1355 Ga0209759_1000232
1356 Ga0209759_1000284
1357 Ga0209759_1020083
1358 Ga0209129_1000053
1359 Ga0209129_1003371
1360 Ga0209129_1003477
1361 Ga0209233_1000043
1362 Ga0209233_1000064
1363 Ga0209455_1000001
1364 Ga0209455_1000141
1365 Ga0209455_1000406
1366 Ga0209673_1000041
1367 Ga0209673_1000076
1368 Ga0209673_1000319
1369 Ga0209673_1009838
1370 Ga0209673_1011121
1371 Ga0209673_1017384
1372 Ga0209673_1026238
1373 Ga0209130_1000018
1374 Ga0209130_1019763
1375 Ga0209130_1024712
1376 Ga0209676_1005581
1377 Ga0209676_1011391
1378 Ga0209025_1000087
1379 Ga0209025_1001440
1380 Ga0209025_1008335
1381 Ga0209025_1012200
1382 Ga0209025_1024975
1383 Ga0209564_1004356
1384 Ga0209564_1004856
1385 Ga0209564_1011003
1386 Ga0209564_1014511
1387 Ga0209564_1019962
1388 Ga0209758_1000081
1389 Ga0209758_1026335
1390 Ga0209758_1054374
1391 Ga0209050_1006521
1392 Ga0209256_1002348
1393 Ga0209256_1005095
1394 Ga0209256_1011373
1395 Ga0209256_1011458
1396 Ga0209256_1011586
1397 Ga0207426_1000044
1398 Ga0207426_1000050
1399 Ga0207426_1003692
1400 Ga0209051_1000514
1401 Ga0209051_1019345
1402 Ga0209257_1007417
1403 Ga0207656_10003457
1404 Ga0207655_1017087
1405 Ga0207713_1000287
1406 Ga0207713_1000353
1407 Ga0207713_1001378
1408 Ga0207710_10002272
1409 Ga0207710_10018232
1410 Ga0207680_10026506
1411 Ga0207647_10000378
1412 Ga0207647_10000955
1413 Ga0207647_10007158
1414 Ga0207647_10009767
1415 Ga0207647_10013606
1416 Ga0207647_10037821
1417 Ga0207654_10058678
1418 Ga0207695_10000978
1419 Ga0207695_10001867
1420 Ga0207695_10002000
1421 Ga0207695_10006039
1422 Ga0207695_10006482
1423 Ga0207695_10108988
1424 Ga0207695_10303128
1425 Ga0207671_10074044
1426 Ga0207657_10000014
1427 Ga0207657_10000817
1428 Ga0207649_10055074
1429 Ga0207681_10074006
1430 Ga0207694_10009008
1431 Ga0207694_10142748
1432 Ga0207650_10001915
1433 Ga0207650_10053914
1434 Ga0207650_10072351
1435 Ga0207644_10000980
1436 Ga0207690_10000023
1437 Ga0207690_10019011
1438 Ga0207706_10000383
1439 Ga0207706_10000803
1440 Ga0207711_10001289
1441 Ga0207667_10011185
1442 Ga0207667_10016938
1443 Ga0207667_10045434
1444 Ga0207667_10083774
1445 Ga0207667_10311208
1446 Ga0207712_10000101
1447 Ga0207668_10000059
1448 Ga0207668_10100688
1449 Ga0207640_10001832
1450 Ga0207640_10035218
1451 Ga0207658_10000072
1452 Ga0207658_10157198
1453 Ga0207639_10000264
1454 Ga0207639_10001734
1455 Ga0207639_10008995
1456 Ga0207678_10001433
1457 Ga0207678_10002131
1458 Ga0207678_10081418
1459 Ga0207678_10372999
1460 Ga0207702_10002199
1461 Ga0207641_10000096
1462 Ga0207641_10004130
1463 Ga0207641_10007904
1464 Ga0207674_10006865
1465 Ga0207698_10000442
1466 Ga0209371_1009354
1467 Ga0209813_10000046
1468 Ga0209813_10001560
1469 Ga0268266_10000387
1470 Ga0268266_10037403
1471 Ga0268266_10154101
1472 Ga0268265_10000151
1473 Ga0268265_10038765
1474 Ga0268265_10340962
1475 Ga0268264_10000303
1476 Ga0268264_10009257
1477 Ga0268264_10016664
1478 Ga0307515_10188949
1479 Ga0265338_10000022
1480 Ga0265338_10202898
1481 Ga0268256_1009896
1482 Ga0265327_10021679
1483 Ga0265327_10028444
1484 Ga0307513_10074356
1485 Ga0307408_100000134
1486 Ga0307408_100044834
1487 Ga0316578_10109153
1488 Ga0307405_10001276
1489 Ga0307405_10008943
1490 Ga0307405_10010173
1491 Ga0307407_10161317
1492 Ga0307412_10000024
1493 Ga0307412_10000516
1494 Ga0307412_10000862
1495 Ga0307412_10002325
1496 Ga0307412_10052752
1497 Ga0307409_100017939
1498 Ga0307416_100003840
1499 Ga0307416_100427521
1500 Ga0307414_10005205
1501 Ga0307411_10039379
1502 Ga0316583_10003812
1503 Ga0307510_10159989
1504 Ga0316574_0024916
1505 Ga0316582_0178756
1506 Ga0316584_0061527
1507 Ga0316584_0066494
1508 Ga0395898_0008451
1509 Ga0395905_0000041
1510 Ga0395905_0061057
1511 Ga0395905_0061884
1512 Ga0400484_20111
1513 Ga0400484_23104
1514 Ga0400484_35008
1515 Ga0400490_46345
1516 Ga0400490_48495
1517 Ga0400488_57407
1518 Ga0400483_001970
1519 Ga0400483_012467
1520 Ga0400483_043932
1521 Ga0400483_156899
1522 Ga0400483_169173
1523 Ga0400483_209372
1524 Ga0400489_67634
1525 Ga0400487_45314
1526 Ga0436361_0866616
1527 Ga0436361_1107681
1528 Ga0439465_0009811
1529 Ga0451833_0084816
1530 Ga0451835_0334487
1531 Ga0451837_0659144
1532 Ga0451841_0514518
1533 Ga0451845_0226581
1534 Ga0451849_0695212
1535 Ga0451843_0534843
1536 Ga0451855_0155246
1537 Ga0451853_1273235
1538 Ga0451853_1348410
1539 Ga0439448_0000074
1540 Ga0439449_0023893
1541 Ga0439456_000129
1542 Ga0439463_000319
1543 Ga0466969_0028950
1544 Ga0466961_0000305
1545 Ga0466970_0027842
1546 Ga0466959_0005513
1547 Ga0466959_0081253
1548 Ga0466967_0214492
1549 Ga0495617_017103
1550 Ga0495617_026763
1551 Ga0495617_050341
1552 Ga0495627_000036
1553 Ga0495627_000112
1554 Ga0495627_003895
1555 Ga0495592_0031280
1556 Ga0495592_0055849
1557 Ga0495603_0001311
1558 Ga0495603_0002931
1559 Ga0495603_0156817
1560 Ga0495590_0001712
1561 Ga0495591_000009
1562 Ga0495591_001145
1563 Ga0495591_001533
1564 Ga0495629_0000098
1565 Ga0495629_0004355
1566 Ga0495629_0027417
1567 Ga0495629_0031675
1568 Ga0495629_0062089
1569 Ga0495638_0000018
1570 Ga0495638_0000789
1571 Ga0495638_0023885
1572 Ga0495638_0073027
1573 Ga0495641_0015729
1574 Ga0495641_0071002
1575 Ga0495651_0018150
1576 Ga0495653_0001085
1577 Ga0495650_0000143
1578 Ga0495650_0001210
1579 Ga0495650_0001914
1580 Ga0495650_0004473
1581 Ga0495650_0017008
1582 Ga0495650_0093586
1583 Ga0495650_0095354
1584 Ga0495580_0000171
1585 Ga0495580_0000453
1586 Ga0495580_0004700
1587 Ga0495580_0007124
1588 Ga0495582_0000525
1589 Ga0495582_0016774
1590 Ga0495605_0000001
1591 Ga0495605_0001810
1592 Ga0495605_0010044
1593 Ga0495605_0030068
1594 Ga0495605_0031121
1595 Ga0495605_0041962
1596 Ga0495664_0000427
1597 Ga0495664_0009862
1598 Ga0495664_0024223
1599 Ga0495584_0002425
1600 Ga0495584_0003436
1601 Ga0495585_0000127
1602 Ga0495585_0011184
1603 Ga0495596_0016143
1604 Ga0495607_0000291
1605 Ga0495607_0036799
1606 Ga0495607_0041622
1607 Ga0495607_0055940
1608 Ga0495583_0000010
1609 Ga0495583_0000187
1610 Ga0495583_0003226
1611 Ga0495583_0009731
1612 Ga0495583_0012736
1613 Ga0495583_0025948
1614 Ga0495583_0028074
1615 Ga0495606_0000013
1616 Ga0495606_0000465
1617 Ga0495606_0006635
1618 Ga0495606_0015352
1619 Ga0495606_0029147
1620 Ga0495606_0034450
1621 Ga0495608_0050496
1622 Ga0495610_0000079
1623 Ga0495610_0000454
1624 Ga0495610_0006916
1625 Ga0495610_0019401
1626 Ga0495610_0026996
1627 Ga0495610_0083268
1628 Ga0495616_0031447
1629 Ga0495618_0004983
1630 Ga0495618_0077538
1631 Ga0495620_0000994
1632 Ga0495620_0012599
1633 Ga0495620_0018123
1634 Ga0495620_0060633
1635 Ga0495620_0063593
1636 Ga0495628_0001765
1637 Ga0495628_0038569
1638 Ga0495628_0082721
1639 Ga0495630_0013137
1640 Ga0495630_0036611
1641 Ga0495631_0023144
1642 Ga0495631_0024916
1643 Ga0495631_0041542
1644 Ga0495632_0000001
1645 Ga0495632_0000384
1646 Ga0495632_0002606
1647 Ga0495632_0012263
1648 Ga0495632_0013825
1649 Ga0495637_0000021
1650 Ga0495637_0000039
1651 Ga0495637_0000341
1652 Ga0495643_0000004
1653 Ga0495643_0000006
1654 Ga0495643_0008058
1655 Ga0495643_0008694
1656 Ga0495643_0061802
1657 Ga0495643_0072977
1658 Ga0495644_0006565
1659 Ga0495648_0000018
1660 Ga0495648_0008954
1661 Ga0495648_0014093
1662 Ga0495648_0014491
1663 Ga0495648_0049425
1664 Ga0495648_0053979
1665 Ga0495648_0063237
1666 Ga0495663_0000001
1667 Ga0495666_0000074
1668 Ga0495666_0004808
1669 Ga0495666_0025770
1670 Ga0495666_0041903
1671 Ga0495642_0018477
1672 Ga0495642_0032774
1673 Ga0495652_0007094
1674 Ga0495652_0030195
1675 Ga0495652_0059204
1676 Ga0495665_0004010
1677 Ga0495665_0020483
1678 Ga0495640_0001565
1679 Ga0495586_0000719
1680 Ga0495586_0072913
1681 Ga0495587_0002495
1682 Ga0495609_0000020
1683 Ga0495609_0000062
1684 Ga0495609_0034433
1685 Ga0495609_0092950
1686 Ga0495597_0018676
1687 Ga0495597_0042519
1688 Ga0495597_0062098
1689 Ga0495645_0000821
1690 Ga0495645_0017472
1691 Ga0495622_0000161
1692 Ga0495622_0003817
1693 Ga0495633_0000654
1694 Ga0495633_0002962
1695 Ga0495633_0038731
1696 Ga0495667_0030219
1697 Ga0495668_0002893
1698 Ga0495668_0003158
1699 Ga0495668_0162455
1700 Ga0495634_0030483
1701 Ga0495634_0063547
1702 Ga0495611_0000802
1703 Ga0495611_0014233
1704 Ga0495611_0018446
1705 Ga0495625_0000028
1706 Ga0495625_0088285
1707 Ga0495625_0130589
1708 Ga0495625_0166481
1709 Ga0495635_0001780
1710 Ga0495635_0011861
1711 Ga0495661_0000001
1712 Ga0495661_0000452
1713 Ga0495661_0002554
1714 Ga0495661_0020661
1715 Ga0495661_0066013
1716 Ga0495588_0089999
1717 Ga0495599_0001334
1718 Ga0495599_0086326
1719 Ga0495623_0030229
1720 Ga0495623_0055696
1721 Ga0495646_0004287
1722 Ga0495646_0060634
1723 Ga0495646_0063021
1724 Ga0495613_0001656
1725 Ga0495613_0022700
1726 Ga0495624_0000139
1727 Ga0495624_0001598
1728 Ga0495624_0017849
1729 Ga0495624_0041382
1730 Ga0495671_0000008
1731 Ga0495671_0000011
1732 Ga0495671_0021871
1733 Ga0495649_0001018
1734 Ga0495649_0029508
1735 Ga0495649_0090989
1736 Ga0495589_0001308
1737 Ga0495600_0006701
1738 Ga0495600_0017912
1739 Ga0495660_0001564
1740 Ga0495660_0004492
1741 Ga0495660_0005072
1742 Ga0495660_0043208
1743 Ga0495581_0003108
1744 Ga0495581_0037869
1745 Ga0495604_0005687
1746 Ga0495604_0006799
1747 Ga0495604_0010696
1748 Ga0495674_0017011
1749 Ga0495674_0019792
1750 Ga0495674_0025181
1751 Ga0495674_0089116
1752 Ga0495674_0131504
1753 Ga0495672_0002374
1754 Ga0495672_0093592
1755 Ga0495676_0000006
1756 Ga0495676_0012034
1757 Ga0495680_0001584
1758 Ga0495680_0036781
1759 Ga0495683_0004017
1760 Ga0495683_0008208
1761 Ga0495683_0011601
1762 Ga0495683_0077524
1763 Ga0495687_000022
1764 Ga0495687_013299
1765 Ga0495687_052200
1766 Ga0495675_0001909
1767 Ga0495675_0024964
1768 Ga0495679_000025
1769 Ga0495679_000150
1770 Ga0495679_001462
1771 Ga0495679_001545
1772 Ga0495679_002123
1773 Ga0495673_0000013
1774 Ga0495673_0001371
1775 Ga0495673_0018744
1776 Ga0495673_0077707
1777 Ga0495681_0000013
1778 Ga0495681_0006336
1779 Ga0495681_0007358
1780 Ga0495681_0017500
1781 Ga0495681_0063780
1782 Ga0495681_0069759
1783 Ga0495686_0000002
1784 Ga0495686_0001007
1785 Ga0495686_0007932
1786 Ga0495686_0008600
1787 Ga0495686_0010825
1788 Ga0495686_0022216
1789 Ga0495686_0047104
1790 Ga0495686_0151542
1791 Ga0495593_0016281
1792 Ga0495593_0027125
1793 Ga0495602_0023652
1794 Ga0495602_0092751
1795 Ga0495614_0019197
1796 Ga0495614_0020202
1797 Ga0495614_0107656
1798 Ga0495615_0000003
1799 Ga0495615_0019725
1800 Ga0495626_0000019
1801 Ga0495626_0046844
1802 Ga0495626_0070012
1803 Ga0496100_0011566
1804 Ga0496100_0054065
1805 Ga0496101_0000369
1806 Ga0496101_0005003
1807 Ga0496101_0062915
1808 Ga0496102_0000258
1809 Ga0496102_0000551
1810 Ga0496102_0015568
1811 Ga0496103_0000098
1812 Ga0496103_0000326
1813 Ga0496103_0004631
1814 Ga0496103_0019256
1815 Ga0496104_0004611
1816 Ga0496104_0155388
1817 Ga0496105_0055157
1818 Ga0496105_0089119
1819 Ga0496106_0003362
1820 Ga0496106_0023088
1821 Ga0496107_0001254
1822 Ga0496108_0000763
1823 Ga0496108_0145994
1824 Ga0496110_0008899
1825 Ga0496110_0014287
1826 Ga0496110_0177981
1827 Ga0496110_0320182
1828 Ga0496111_0001285
1829 Ga0496113_0004334
1830 Ga0496113_0336840
1831 Ga0496114_0000981
1832 Ga0496114_0017947
1833 Ga0496114_0031622
1834 Ga0496115_0178355
1835 Ga0496116_0001473
1836 Ga0496116_0009602
1837 Ga0496116_0017649
1838 Ga0496116_0025474
1839 Ga0496116_0028745
1840 Ga0496116_0031452
1841 Ga0496116_0112500
1842 Ga0496116_0168964
1843 Ga0496117_0000121
1844 Ga0496117_0001122
1845 Ga0496117_0002864
1846 Ga0496117_0007366
1847 Ga0496117_0007912
1848 Ga0496117_0013370
1849 Ga0496117_0018825
1850 Ga0496117_0034818
1851 Ga0496117_0045089
1852 Ga0496117_0100483
1853 Ga0496117_0106406
1854 Ga0496117_0118483
1855 Ga0496118_0000095
1856 Ga0496118_0001154
1857 Ga0496118_0003651
1858 Ga0496118_0004923
1859 Ga0496118_0005119
1860 Ga0496118_0008181
1861 Ga0496118_0029419
1862 Ga0496118_0061773
1863 Ga0496118_0121783
1864 Ga0496119_0012070
1865 Ga0496119_0013733
1866 Ga0496119_0016911
1867 Ga0496119_0019480
1868 Ga0496119_0141289
1869 Ga0496120_0005830
1870 Ga0496121_0000087
1871 Ga0496121_0000624
1872 Ga0496121_0004650
1873 Ga0496121_0006109
1874 Ga0496121_0007013
1875 Ga0496121_0024937
1876 Ga0496121_0029634
1877 Ga0496121_0034730
1878 Ga0496121_0042851
1879 Ga0496121_0114264
1880 Ga0496121_0173577
1881 Ga0496122_0000935
1882 Ga0496122_0001672
1883 Ga0496122_0006069
1884 Ga0496122_0024031
1885 Ga0496122_0039009
1886 Ga0496122_0043653
1887 Ga0496122_0044603
1888 Ga0496122_0068700
1889 Ga0496122_0132105
1890 Ga0496122_0177410
1891 Ga0496123_0000337
1892 Ga0496123_0001736
1893 Ga0496123_0006087
1894 Ga0496123_0016306
1895 Ga0496123_0024008
1896 Ga0496123_0035916
1897 Ga0496123_0054508
1898 Ga0496123_0127871
1899 Ga0496124_0000119
1900 Ga0496124_0006868
1901 Ga0496124_0015876
1902 Ga0496124_0016270
1903 Ga0496124_0025665
1904 Ga0496124_0030082
1905 Ga0496124_0045315
1906 Ga0496124_0078365
1907 Ga0496124_0079496
1908 Ga0496124_0100722
1909 Ga0496124_0104244
1910 Ga0496125_0002065
1911 Ga0496125_0003585
1912 Ga0496125_0004283
1913 Ga0496125_0004681
1914 Ga0496125_0008785
1915 Ga0496125_0009964
1916 Ga0496125_0018724
1917 Ga0496125_0032440
1918 Ga0496125_0040968
1919 Ga0496125_0069112
1920 Ga0496125_0096302
1921 Ga0496125_0130088
1922 Ga0496126_0000278
1923 Ga0496126_0000592
1924 Ga0496126_0004017
1925 Ga0496126_0011844
1926 Ga0496126_0021904
1927 Ga0496126_0024075
1928 Ga0496126_0093127
1929 Ga0496126_0140809
1930 Ga0496126_0188507
1931 Ga0496126_0319131
1932 Ga0495678_000083
1933 Ga0495678_005993
1934 Ga0495678_006390
1935 Ga0495678_036432
1936 Ga0495678_056561
1937 Ga0495678_059431
1938 Ga0495682_0015286
1939 Ga0501032_0053548
1940 Ga0501037_0123036
1941 Ga0501043_0099892
1942 Ga0501047_0218956
1943 Ga0501249_000141
1944 Ga0501083_0132883
1945 Ga0501280_001736
1946 Ga0501044_0077302
1947 Ga0501044_0139093
1948 nmdc:mga03683_85_c1
1949 nmdc:mga03n38_164724_c1
1950 nmdc:mga03n38_21095_c1
1951 nmdc:mga00v17_175452_c1
1952 nmdc:mga0yw44_9165_c1
1953 nmdc:mga06z11_37_c1
1954 nmdc:mga06z11_527_c1
1955 nmdc:mga04h51_16_c1
1956 nmdc:mga04h51_237_c1
1957 nmdc:mga07m45_54793_c1
1958 nmdc:mga07m45_7_c1
1959 nmdc:mga0sz30_93_c1
1960 Ga0500610_0029819
1961 Ga0500578_0083426
1962 Ga0500643_000362
1963 Ga0500643_000503
1964 Ga0500643_034605
1965 Ga0500566_0068981
1966 Ga0500555_000799
1967 Ga0500560_002179
1968 Ga0500569_007159
1969 Ga0500594_0004461
1970 Ga0500607_000035
1971 Ga0500607_000148
1972 Ga0500618_001727
1973 Ga0500658_0001182
1974 Ga0500559_0001018
1975 Ga0500559_0001082
1976 Ga0500559_0002069
1977 Ga0500568_0012950
1978 Ga0500568_0017868
1979 Ga0500616_0000982
1980 Ga0500616_0028841
1981 Ga0500622_0004006
1982 Ga0500624_000010
1983 Ga0500624_000058
1984 Ga0500624_001715
1985 Ga0500634_0078120
1986 Ga0500636_0001294
1987 Ga0500637_0001441
1988 Ga0500645_001940
1989 Ga0500661_007303
1990 Ga0501082_0426651
1991 2501073591
1992 2501082268
1993 2501411016
1994 2509128639
1995 2509387713
1996 2509443072
1997 2510132300
1998 2510250843
1999 2510839686
2000 2510898639
2001 2511086386
2002 2511096531
2003 2511102832
2004 2511186365
2005 2511197192
2006 2512346258
2007 2512642976
2008 2513552138
2009 2513560924
2010 2513569138
2011 2513578808
2012 2513596255
2013 2513632754
2014 2513709205
2015 2513868775
2016 2513907519
2017 2513925709
2018 2513960967
2019 2514020750
2020 2514048161
2021 2515111285
2022 2515637835
2023 2515642581
2024 2515659190
2025 2515679710
2026 2515688719
2027 2515740465
2028 2516020301
2029 2517039925
2030 2517075470
2031 2517094057
2032 2517405877
2033 2519458676
2034 2520375275
2035 2524460644
2036 2527075205
2037 2530643890
2038 2535515724
2039 2563063040
2040 2585203084
2041 2585220997
2042 2585231489
2043 2585256609
2044 2585273257
2045 2585278909
2046 2585292333
2047 2585325477
2048 2585400118
2049 2585527966
2050 2585549903
2051 2585554886
2052 2585559443
2053 2585822677
2054 2585847212
2055 2585902114
2056 2585905181
2057 2587979704
2058 2599418588
2059 2599737262
2060 2599746999
2061 2600208843
2062 2600809782
2063 2616296210
2064 2644007931
2065 2644196520
2066 2644242888
2067 2644296827
2068 2644655081
2069 2676744565
2070 2713477241
2071 2719180294
2072 2719384862
2073 2719639980
2074 2719664617
2075 2719731043
2076 2720491037
2077 2720612399
2078 2720619238
2079 2720630638
2080 2720774331
2081 2721146388
2082 2721157910
2083 2721163267
2084 2721398582
2085 2722839437
2086 2723026058
2087 2723559603
2088 2723566219
2089 2724037395
2090 2724043799
2091 2724088938
2092 2724103484
2093 2724109330
2094 2725948488
2095 2730106994
2096 2730163531
2097 2730297542
2098 2738709686
2099 2738802167
2100 2738820724
2101 2738833204
2102 2738848111
2103 2738863840
2104 2738874732
2105 2739186361
2106 2739221330
2107 2739296358
2108 2739358036
2109 2746089597
2110 2746098456
2111 2753566699
2112 2765584518
2113 2766067603
2114 2792836487
2115 2793296200
2116 2793317526
2117 2793321096
2118 2793327128
2119 2793333615
2120 2793339796
2121 2793347936
2122 2793353574
2123 2793367851
2124 2805926577
2125 2805933384
2126 2817260955
2127 2817278651
2128 2817451726
2129 2819242539
2130 2819620167
2131 2819634865
2132 2819639247
2133 2838017287
2134 2838037717
2135 2838047983
2136 2838049229
2137 2838063325
2138 2838662729
2139 2838670847
2140 2838681341
2141 2838688614
2142 2838694624
2143 2838703218
2144 2838708002
2145 2838730909
2146 2838744197
2147 2841856878
2148 2841865473
2149 2842080767
2150 2842114976
2151 2842121386
2152 2842147558
2153 2842160048
2154 2842168291
2155 2842183335
2156 2842197950
2157 2842207697
2158 2842221203
2159 2842235064
2160 2842237413
2161 2842245661
2162 2842252624
2163 2842259689
2164 2842266928
2165 2842274528
2166 2842281508
2167 2842287117
2168 2842294423
2169 2842302448
2170 2842306772
2171 2842314746
2172 2842318651
2173 2842327389
2174 2842343592
2175 2842352004
2176 2842360819
2177 2842365251
2178 2842371804
2179 2842380821
2180 2842387892
2181 2842398265
2182 2842404385
2183 2842410930
2184 2842417614
2185 2842427356
2186 2842431059
2187 2842436943
2188 2842443021
2189 2842453243
2190 2842458246
2191 2842465032
2192 2842471742
2193 2842493757
2194 2842497286
2195 2842509729
2196 2844455130
2197 2856293700
2198 2857362382
2199 2857520292
2200 2857579177
2201 2863424507
2202 2870071574
2203 2883088851
2204 2885278780
2205 2900635095
2206 2902689642
2207 2904434881
2208 2904484878
2209 2904568708
2210 2904575750
2211 2904617066
2212 2919103834
2213 2919139300
2214 2919530603
2215 2919710841
2216 2921650498
2217 2923557565
2218 2928101241
2219 2928110274
2220 2928138592
2221 2928160506
2222 2928164973
2223 2928172708
2224 2928505345
2225 2928540767
2226 2928960348
2227 2933016845
2228 2933573114
2229 2933591375
2230 2933604605
2231 2935895146
2232 2935904136
2233 2936368122
2234 2936381485
2235 2936387381
2236 2939656394
2237 2945936990
2238 2945962551
2239 2981996188
2240 2989778185
2241 2990706282
2242 2996890799
2243 2996895080
2244 3005453451
2245 639647433
2246 642423104
2247 642415689
2248 642593424
2249 642621325
2250 8003955492
2251 8005251314
2252 8005261812
2253 8005279582
2254 8005284782
2255 8005292792
2256 8005311088
2257 8005325326
2258 8005376608
2259 8005385997
2260 8005400220
2261 8005432269
2262 8005461929
2263 8005499331
2264 8005558926
2265 8005570436
2266 8005620526
2267 8005627508
2268 8005670747
2269 8005698789
2270 8018131333
2271 8018169158
2272 8018177243
2273 8018849794
2274 8020813169
2275 8020942251
2276 8020951339
2277 8020957881
2278 8021124394
2279 8023686957
2280 8024489752
2281 8024503251
2282 8039104753
2283 8040169894
2284 8040173361
2285 8054931283
2286 8055268320
2287 8055302362
2288 8055882678
2289 8056380731
2290 8056384752
2291 8057879587

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

74

401

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lqa-assembly1.cif.gz_A tas protein from escherichia coli in complex with nadph 0.9773 1 349
1lqa-assembly1.cif.gz_A tas protein from escherichia coli in complex with nadph 0.9745 1 349
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9105 1 340
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9065 1 343
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9049 1 340
ID Description Score Start End Superfamily
1lqaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9716 1 349 3.20.20.100
1lqaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9689 1 349 3.20.20.100
af_I1KSL2_10_358_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9505 10 349 3.20.20.100
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9443 1 348 3.20.20.100
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9391 1 348 3.20.20.100
ID Description Score Start End GO Terms
AF-A7C1M6-F1-model_v4 deleted 0.9892 165 349
AF-A0A3T1DHM4-F1-model_v4 deleted 0.988 177 349
AF-A0A7B6C3X1-F1-model_v4 deleted 0.9823 207 349
AF-A0A7X4K1N4-F1-model_v4 deleted 0.9813 1 349
AF-A0A7X4K1N4-F1-model_v4 deleted 0.9784 1 349

Map