F490784

General Info

Members Datasets Scaffolds Average Seq Length
1145 339 1145 99

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_1185506|Ga0501045_1185506_53_361
Length 102
Sequence MSVGLPHYLVVSAALFSLGVLGLLTRRNAVNVLMSIELLLNAANVNLVAFSRYAAGNLDGQVFAVFVIVVAAAEVAVGLAIVLTLYRLRRTPNLDEADILKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
117 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
204 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
235 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
236 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
237 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
238 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
241 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
309 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
312 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
313 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
319 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
320 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 0.61
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_47150 2162886007 Bacteria 1834
2 JGI24746J21847_1001951 3300001977 Bacteria 3285
3 JGI24750J21931_1036437 3300002070 Bacteria 736
4 JGI24745J21846_1042295 3300002073 Bacteria 566
5 JGI24744J21845_10110202 3300002077 Bacteria 511
6 JGI24033J26618_1040659 3300002155 Bacteria 648
7 JGI25406J46586_10000120 3300003203 Bacteria 34396
8 JGI25406J46586_10002893 3300003203 Bacteria 8098
9 JGI25406J46586_10230258 3300003203 Bacteria 543
10 JGI25405J52794_10007265 3300003911 Bacteria 2041
11 Ga0065714_10022432 3300005288 Bacteria 1287
12 Ga0065704_10555065 3300005289 Bacteria 632
13 Ga0065704_10637319 3300005289 Bacteria 589
14 Ga0065704_10786870 3300005289 Bacteria 529
15 Ga0065704_10809916 3300005289 Bacteria 522
16 Ga0065712_10002361 3300005290 Bacteria 8212
17 Ga0065712_10044208 3300005290 Bacteria 946
18 Ga0065712_10068087 3300005290 Bacteria 15101
19 Ga0065712_10416474 3300005290 Bacteria 716
20 Ga0065712_10495543 3300005290 Bacteria 653
21 Ga0065715_10005733 3300005293 Bacteria 4040
22 Ga0065715_10032568 3300005293 Bacteria 1748
23 Ga0065715_10140458 3300005293 Bacteria 1862
24 Ga0065715_10307877 3300005293 Bacteria 1027
25 Ga0065715_10430131 3300005293 Bacteria 848
26 Ga0065715_10539117 3300005293 Bacteria 742
27 Ga0065707_10002595 3300005295 Bacteria 6960
28 Ga0065707_10059554 3300005295 Bacteria 706
29 Ga0065707_10223056 3300005295 Bacteria 1217
30 Ga0065707_10275393 3300005295 Unclassified 1061
31 Ga0065707_10335677 3300005295 Bacteria 942
32 Ga0065707_10816707 3300005295 Bacteria 593
33 Ga0065707_10887380 3300005295 Bacteria 571
34 Ga0065707_10925811 3300005295 Bacteria 559
35 Ga0065707_10950298 3300005295 Bacteria 552
36 Ga0065707_11138320 3300005295 Bacteria 507
37 Ga0070676_10032474 3300005328 Bacteria 2991
38 Ga0070676_10520244 3300005328 Bacteria 847
39 Ga0070683_100188506 3300005329 Bacteria 1958
40 Ga0070683_100680413 3300005329 Bacteria 985
41 Ga0070683_101061149 3300005329 Bacteria 778
42 Ga0070683_101578385 3300005329 Bacteria 631
43 Ga0070690_100082077 3300005330 Unclassified 2110
44 Ga0070690_100194641 3300005330 Bacteria 1407
45 Ga0070690_100263525 3300005330 Bacteria 1223
46 Ga0070670_100029541 3300005331 Bacteria 4719
47 Ga0070670_100444072 3300005331 Unclassified 1149
48 Ga0070670_101096431 3300005331 Bacteria 726
49 Ga0070677_10002331 3300005333 Bacteria 6065
50 Ga0070677_10105855 3300005333 Bacteria 1248
51 Ga0070677_10635424 3300005333 Bacteria 595
52 Ga0068869_100002011 3300005334 Bacteria 12219
53 Ga0068869_100010384 3300005334 Bacteria 6073
54 Ga0068869_100095270 3300005334 Bacteria 2246
55 Ga0068869_100171937 3300005334 Bacteria 1693
56 Ga0068869_100204359 3300005334 Bacteria 1559
57 Ga0068869_100805168 3300005334 Bacteria 808
58 Ga0070666_10029185 3300005335 Bacteria 3624
59 Ga0070666_10103656 3300005335 Bacteria 1963
60 Ga0070666_10282459 3300005335 Bacteria 1180
61 Ga0070666_10384378 3300005335 Bacteria 1008
62 Ga0070666_10677981 3300005335 Bacteria 755
63 Ga0070680_100447086 3300005336 Bacteria 1104
64 Ga0070680_100499426 3300005336 Bacteria 1041
65 Ga0070680_100783123 3300005336 Bacteria 821
66 Ga0068868_100018603 3300005338 Bacteria 5197
67 Ga0068868_100489238 3300005338 Bacteria 1076
68 Ga0068868_100683023 3300005338 Bacteria 917
69 Ga0070660_100744426 3300005339 Bacteria 823
70 Ga0070660_101352452 3300005339 Bacteria 605
71 Ga0070689_100179427 3300005340 Bacteria 1719
72 Ga0070689_100274466 3300005340 Bacteria 1397
73 Ga0070689_100313133 3300005340 Bacteria 1309
74 Ga0070689_100321381 3300005340 Bacteria 1292
75 Ga0070689_100909534 3300005340 Bacteria 779
76 Ga0070691_10162871 3300005341 Bacteria 1151
77 Ga0070691_10268802 3300005341 Bacteria 921
78 Ga0070691_10436806 3300005341 Bacteria 745
79 Ga0070687_100015745 3300005343 Bacteria 3427
80 Ga0070687_100087406 3300005343 Bacteria 1716
81 Ga0070661_100323592 3300005344 Bacteria 1205
82 Ga0070661_101128696 3300005344 Bacteria 654
83 Ga0070692_10034824 3300005345 Bacteria 2546
84 Ga0070692_10111153 3300005345 Bacteria 1516
85 Ga0070692_10218309 3300005345 Bacteria 1126
86 Ga0070692_10567199 3300005345 Unclassified 746
87 Ga0070668_100021604 3300005347 Bacteria 4862
88 Ga0070668_100049143 3300005347 Bacteria 3246
89 Ga0070668_100197353 3300005347 Bacteria 1651
90 Ga0070668_100399699 3300005347 Bacteria 1173
91 Ga0070669_100012365 3300005353 Bacteria 6055
92 Ga0070669_100017022 3300005353 Bacteria 5189
93 Ga0070669_100042163 3300005353 Bacteria 3320
94 Ga0070669_100107685 3300005353 Bacteria 2111
95 Ga0070669_100195573 3300005353 Bacteria 1588
96 Ga0070669_100457497 3300005353 Bacteria 1053
97 Ga0070669_100663674 3300005353 Bacteria 878
98 Ga0070669_100819323 3300005353 Bacteria 792
99 Ga0070675_100003563 3300005354 Bacteria 11830
100 Ga0070675_100011263 3300005354 Bacteria 7003
101 Ga0070675_100016428 3300005354 Bacteria 5874
102 Ga0070675_100029346 3300005354 Bacteria 4435
103 Ga0070675_100075745 3300005354 Bacteria 2797
104 Ga0070675_100085167 3300005354 Bacteria 2640
105 Ga0070675_100390813 3300005354 Unclassified 1239
106 Ga0070675_100598389 3300005354 Bacteria 1000
107 Ga0070671_100044691 3300005355 Bacteria 3681
108 Ga0070671_100306964 3300005355 Bacteria 1351
109 Ga0070671_100768316 3300005355 Bacteria 838
110 Ga0070674_100070035 3300005356 Bacteria 2476
111 Ga0070674_100086628 3300005356 Bacteria 2250
112 Ga0070674_100107787 3300005356 Bacteria 2040
113 Ga0070674_100138352 3300005356 Bacteria 1824
114 Ga0070674_100997044 3300005356 Bacteria 735
115 Ga0070674_101063989 3300005356 Bacteria 713
116 Ga0070673_100004953 3300005364 Bacteria 8487
117 Ga0070673_100032242 3300005364 Bacteria 3942
118 Ga0070673_100043953 3300005364 Bacteria 3456
119 Ga0070673_100124601 3300005364 Bacteria 2154
120 Ga0070673_100326327 3300005364 Bacteria 1357
121 Ga0070673_100730355 3300005364 Bacteria 911
122 Ga0070673_101274949 3300005364 Bacteria 690
123 Ga0070673_102249565 3300005364 Bacteria 518
124 Ga0070688_100030594 3300005365 Bacteria 3232
125 Ga0070688_100032093 3300005365 Bacteria 3164
126 Ga0070688_100048283 3300005365 Bacteria 2644
127 Ga0070659_100102975 3300005366 Bacteria 2299
128 Ga0070659_100518934 3300005366 Bacteria 1017
129 Ga0070667_100034478 3300005367 Bacteria 4234
130 Ga0070667_100236304 3300005367 Bacteria 1631
131 Ga0070667_101343353 3300005367 Bacteria 670
132 Ga0070703_10133781 3300005406 Bacteria 914
133 Ga0070703_10421141 3300005406 Bacteria 586
134 Ga0070709_10852947 3300005434 Bacteria 718
135 Ga0070713_100750187 3300005436 Bacteria 934
136 Ga0070701_10008052 3300005438 Bacteria 4536
137 Ga0070701_10017782 3300005438 Bacteria 3329
138 Ga0070701_10017788 3300005438 Bacteria 3329
139 Ga0070701_10038494 3300005438 Bacteria 2420
140 Ga0070711_101099147 3300005439 Bacteria 685
141 Ga0070705_100001862 3300005440 Bacteria 10869
142 Ga0070705_100111209 3300005440 Bacteria 1751
143 Ga0070705_100344098 3300005440 Bacteria 1085
144 Ga0070705_100405455 3300005440 Bacteria 1011
145 Ga0070705_100448107 3300005440 Bacteria 968
146 Ga0070705_100665329 3300005440 Bacteria 814
147 Ga0070705_100726644 3300005440 Bacteria 783
148 Ga0070705_100943433 3300005440 Bacteria 697
149 Ga0070705_100961846 3300005440 Bacteria 691
150 Ga0070705_101120932 3300005440 Bacteria 645
151 Ga0070705_101604422 3300005440 Bacteria 548
152 Ga0070705_101940549 3300005440 Bacteria 502
153 Ga0070700_100183364 3300005441 Bacteria 1458
154 Ga0070700_100295219 3300005441 Bacteria 1181
155 Ga0070700_100391766 3300005441 Bacteria 1042
156 Ga0070700_101093137 3300005441 Bacteria 661
157 Ga0070694_100006222 3300005444 Bacteria 7245
158 Ga0070694_100023227 3300005444 Bacteria 3985
159 Ga0070694_100035820 3300005444 Bacteria 3284
160 Ga0070694_100049676 3300005444 Bacteria 2825
161 Ga0070694_100181157 3300005444 Bacteria 1558
162 Ga0070694_100345192 3300005444 Bacteria 1152
163 Ga0070694_100356504 3300005444 Bacteria 1134
164 Ga0070694_100747054 3300005444 Bacteria 799
165 Ga0070708_100087544 3300005445 Bacteria 2830
166 Ga0070708_100333926 3300005445 Bacteria 1428
167 Ga0070708_100437080 3300005445 Bacteria 1234
168 Ga0070708_100828039 3300005445 Bacteria 870
169 Ga0070708_101608306 3300005445 Bacteria 605
170 Ga0070663_101015172 3300005455 Bacteria 722
171 Ga0070678_100016025 3300005456 Bacteria 4780
172 Ga0070678_100058630 3300005456 Bacteria 2827
173 Ga0070678_100290207 3300005456 Bacteria 1386
174 Ga0070678_100399936 3300005456 Bacteria 1193
175 Ga0070662_100057020 3300005457 Bacteria 2837
176 Ga0070681_10118989 3300005458 Bacteria 2578
177 Ga0068867_100030066 3300005459 Bacteria 3917
178 Ga0068867_100038646 3300005459 Bacteria 3475
179 Ga0068867_100151872 3300005459 Bacteria 1820
180 Ga0068867_100957619 3300005459 Bacteria 774
181 Ga0068867_101189515 3300005459 Bacteria 700
182 Ga0070685_10009166 3300005466 Bacteria 5108
183 Ga0070685_10230971 3300005466 Bacteria 1217
184 Ga0070685_10876151 3300005466 Bacteria 667
185 Ga0070706_100013213 3300005467 Bacteria 7639
186 Ga0070706_100116122 3300005467 Bacteria 2493
187 Ga0070706_100277962 3300005467 Bacteria 1562
188 Ga0070706_100334820 3300005467 Bacteria 1411
189 Ga0070706_100532267 3300005467 Bacteria 1093
190 Ga0070706_100615355 3300005467 Bacteria 1009
191 Ga0070706_100798774 3300005467 Bacteria 873
192 Ga0070707_100138098 3300005468 Bacteria 2372
193 Ga0070707_100369536 3300005468 Bacteria 1393
194 Ga0070707_100424279 3300005468 Bacteria 1290
195 Ga0070707_100444487 3300005468 Bacteria 1257
196 Ga0070707_100493067 3300005468 Bacteria 1187
197 Ga0070707_100535907 3300005468 Unclassified 1133
198 Ga0070707_101123101 3300005468 Bacteria 752
199 Ga0070707_101562831 3300005468 Bacteria 627
200 Ga0070707_101751196 3300005468 Bacteria 588
201 Ga0070707_102084580 3300005468 Bacteria 535
202 Ga0070698_100007713 3300005471 Bacteria 11640
203 Ga0070698_100010269 3300005471 Bacteria 10002
204 Ga0070698_100016413 3300005471 Bacteria 7815
205 Ga0070698_100064519 3300005471 Bacteria 3689
206 Ga0070698_100085437 3300005471 Bacteria 3142
207 Ga0070698_100108397 3300005471 Bacteria 2744
208 Ga0070698_100111260 3300005471 Bacteria 2704
209 Ga0070698_100134909 3300005471 Bacteria 2423
210 Ga0070698_100209013 3300005471 Bacteria 1887
211 Ga0070698_101934461 3300005471 Bacteria 543
212 Ga0070699_100000712 3300005518 Bacteria 30836
213 Ga0070699_100008025 3300005518 Bacteria 9167
214 Ga0070699_100020623 3300005518 Bacteria 5686
215 Ga0070699_100023130 3300005518 Bacteria 5354
216 Ga0070699_100103902 3300005518 Bacteria 2491
217 Ga0070699_100150910 3300005518 Bacteria 2055
218 Ga0070699_100186996 3300005518 Bacteria 1839
219 Ga0070699_100279325 3300005518 Bacteria 1496
220 Ga0070699_100330080 3300005518 Bacteria 1372
221 Ga0070679_100481925 3300005530 Bacteria 1185
222 Ga0070679_101541655 3300005530 Bacteria 612
223 Ga0070684_100048966 3300005535 Bacteria 3667
224 Ga0070684_102241676 3300005535 Bacteria 515
225 Ga0070697_100029575 3300005536 Bacteria 4393
226 Ga0070697_100063206 3300005536 Bacteria 3022
227 Ga0070697_100322996 3300005536 Bacteria 1329
228 Ga0070697_100407940 3300005536 Bacteria 1180
229 Ga0070697_101093382 3300005536 Bacteria 710
230 Ga0070697_101603251 3300005536 Bacteria 582
231 Ga0068853_100936029 3300005539 Bacteria 833
232 Ga0070672_100014619 3300005543 Bacteria 5567
233 Ga0070672_100035906 3300005543 Bacteria 3771
234 Ga0070672_100069321 3300005543 Bacteria 2799
235 Ga0070672_100276074 3300005543 Bacteria 1420
236 Ga0070672_100370524 3300005543 Bacteria 1223
237 Ga0070672_100636349 3300005543 Bacteria 931
238 Ga0070672_101466765 3300005543 Bacteria 611
239 Ga0070686_100049367 3300005544 Bacteria 2669
240 Ga0070686_100064257 3300005544 Bacteria 2380
241 Ga0070686_100070785 3300005544 Bacteria 2281
242 Ga0070686_100174043 3300005544 Bacteria 1525
243 Ga0070695_100000112 3300005545 Bacteria 36134
244 Ga0070695_100010416 3300005545 Bacteria 5551
245 Ga0070695_100056269 3300005545 Bacteria 2538
246 Ga0070695_100109708 3300005545 Bacteria 1870
247 Ga0070695_100161054 3300005545 Bacteria 1575
248 Ga0070695_100217988 3300005545 Bacteria 1373
249 Ga0070695_101290580 3300005545 Bacteria 603
250 Ga0070695_101512869 3300005545 Unclassified 559
251 Ga0070696_100027987 3300005546 Bacteria 3845
252 Ga0070696_100049679 3300005546 Bacteria 2914
253 Ga0070696_100137699 3300005546 Bacteria 1781
254 Ga0070696_100281943 3300005546 Bacteria 1267
255 Ga0070693_100275924 3300005547 Bacteria 1124
256 Ga0070693_101499810 3300005547 Unclassified 527
257 Ga0070665_100044178 3300005548 Bacteria 4475
258 Ga0070665_100567843 3300005548 Bacteria 1147
259 Ga0070704_100031186 3300005549 Bacteria 3582
260 Ga0070704_100034877 3300005549 Bacteria 3416
261 Ga0070704_100088178 3300005549 Bacteria 2304
262 Ga0070704_100218668 3300005549 Bacteria 1548
263 Ga0070704_100241768 3300005549 Bacteria 1478
264 Ga0070704_100563574 3300005549 Bacteria 997
265 Ga0070704_100934201 3300005549 Bacteria 782
266 Ga0070704_100951981 3300005549 Bacteria 775
267 Ga0070704_101168906 3300005549 Bacteria 701
268 Ga0070704_101252365 3300005549 Bacteria 678
269 Ga0070664_100024184 3300005564 Bacteria 5023
270 Ga0070664_100091167 3300005564 Bacteria 2638
271 Ga0070664_100418153 3300005564 Bacteria 1227
272 Ga0070664_100569270 3300005564 Bacteria 1049
273 Ga0068857_100008027 3300005577 Bacteria 9103
274 Ga0068857_100441993 3300005577 Bacteria 1215
275 Ga0068857_100512152 3300005577 Bacteria 1127
276 Ga0068857_100858673 3300005577 Bacteria 869
277 Ga0068857_101149576 3300005577 Bacteria 751
278 Ga0068857_101662098 3300005577 Bacteria 624
279 Ga0068854_100115278 3300005578 Bacteria 2032
280 Ga0068854_100139823 3300005578 Bacteria 1857
281 Ga0068854_100313426 3300005578 Bacteria 1273
282 Ga0068854_101622860 3300005578 Bacteria 590
283 Ga0070702_100031310 3300005615 Bacteria 2909
284 Ga0070702_100195867 3300005615 Bacteria 1333
285 Ga0070702_100263505 3300005615 Bacteria 1175
286 Ga0070702_100303926 3300005615 Bacteria 1105
287 Ga0070702_100966332 3300005615 Unclassified 672
288 Ga0068852_101953964 3300005616 Bacteria 609
289 Ga0068859_100046788 3300005617 Bacteria 4344
290 Ga0068859_100074781 3300005617 Bacteria 3427
291 Ga0068859_100102459 3300005617 Bacteria 2920
292 Ga0068859_100436306 3300005617 Bacteria 1406
293 Ga0068859_100491396 3300005617 Unclassified 1323
294 Ga0068859_100691970 3300005617 Bacteria 1110
295 Ga0068859_101528343 3300005617 Bacteria 737
296 Ga0068864_100061602 3300005618 Bacteria 3250
297 Ga0068864_100587619 3300005618 Bacteria 1079
298 Ga0068864_100705993 3300005618 Bacteria 986
299 Ga0068866_10023915 3300005718 Bacteria 2848
300 Ga0068861_100005274 3300005719 Bacteria 8718
301 Ga0068861_100178774 3300005719 Bacteria 1764
302 Ga0068861_100413867 3300005719 Bacteria 1199
303 Ga0068861_100652124 3300005719 Bacteria 973
304 Ga0068861_100706069 3300005719 Bacteria 938
305 Ga0068861_101336355 3300005719 Bacteria 698
306 Ga0068870_10002979 3300005840 Bacteria 7138
307 Ga0068870_10030196 3300005840 Bacteria 2737
308 Ga0068870_10056742 3300005840 Bacteria 2091
309 Ga0068870_10308883 3300005840 Bacteria 1001
310 Ga0068863_100025327 3300005841 Bacteria 5656
311 Ga0068863_100079921 3300005841 Bacteria 3097
312 Ga0068863_100141547 3300005841 Bacteria 2299
313 Ga0068863_100214672 3300005841 Bacteria 1853
314 Ga0068863_100738601 3300005841 Bacteria 980
315 Ga0068863_101534619 3300005841 Bacteria 675
316 Ga0068858_100034467 3300005842 Bacteria 4696
317 Ga0068858_100056039 3300005842 Bacteria 3644
318 Ga0068858_100080652 3300005842 Bacteria 3024
319 Ga0068858_100114085 3300005842 Bacteria 2524
320 Ga0068858_101224818 3300005842 Bacteria 738
321 Ga0068860_100027366 3300005843 Bacteria 5493
322 Ga0068860_100070854 3300005843 Bacteria 3314
323 Ga0068860_100332345 3300005843 Bacteria 1493
324 Ga0068860_100359758 3300005843 Bacteria 1434
325 Ga0068860_100705271 3300005843 Bacteria 1019
326 Ga0068860_100707885 3300005843 Bacteria 1017
327 Ga0068860_100907846 3300005843 Bacteria 897
328 Ga0068860_101116897 3300005843 Unclassified 808
329 Ga0068862_100026860 3300005844 Bacteria 4842
330 Ga0068862_100039181 3300005844 Bacteria 4023
331 Ga0068862_100043004 3300005844 Bacteria 3850
332 Ga0068862_100126478 3300005844 Bacteria 2257
333 Ga0068862_101738228 3300005844 Bacteria 632
334 Ga0068862_102644755 3300005844 Bacteria 513
335 Ga0081455_10000868 3300005937 Bacteria 39013
336 Ga0081455_10118098 3300005937 Bacteria 2095
337 Ga0081455_10800085 3300005937 Unclassified 592
338 Ga0081538_10003260 3300005981 Bacteria 15419
339 Ga0081539_10000024 3300005985 Bacteria 354702
340 Ga0081539_10000096 3300005985 Bacteria 204059
341 Ga0081539_10002353 3300005985 Bacteria 27164
342 Ga0075365_10817599 3300006038 Bacteria 657
343 Ga0075364_10169992 3300006051 Bacteria 1473
344 Ga0075432_10390362 3300006058 Bacteria 599
345 Ga0075432_10481468 3300006058 Bacteria 550
346 Ga0075432_10497270 3300006058 Bacteria 543
347 Ga0070716_100035251 3300006173 Bacteria 2750
348 Ga0075367_10163763 3300006178 Bacteria 1383
349 Ga0097621_100068844 3300006237 Bacteria 2921
350 Ga0097621_100070646 3300006237 Bacteria 2883
351 Ga0097621_100228817 3300006237 Bacteria 1623
352 Ga0097621_100362880 3300006237 Bacteria 1291
353 Ga0097621_101481160 3300006237 Bacteria 644
354 Ga0075370_10040982 3300006353 Bacteria 2614
355 Ga0068871_100053801 3300006358 Bacteria 3264
356 Ga0068871_100200215 3300006358 Unclassified 1724
357 Ga0068871_101893464 3300006358 Bacteria 567
358 Ga0075428_100004648 3300006844 Bacteria 15196
359 Ga0075428_100004968 3300006844 Bacteria 14767
360 Ga0075428_100036865 3300006844 Bacteria 5385
361 Ga0075428_100038501 3300006844 Bacteria 5263
362 Ga0075428_100119768 3300006844 Unclassified 2865
363 Ga0075428_100161676 3300006844 Bacteria 2430
364 Ga0075428_100197201 3300006844 Bacteria 2177
365 Ga0075428_100276515 3300006844 Bacteria 1806
366 Ga0075428_100556253 3300006844 Bacteria 1226
367 Ga0075428_100634272 3300006844 Bacteria 1140
368 Ga0075428_100683412 3300006844 Bacteria 1094
369 Ga0075428_101734208 3300006844 Bacteria 651
370 Ga0075430_100007192 3300006846 Bacteria 9388
371 Ga0075430_100019149 3300006846 Bacteria 5821
372 Ga0075430_100029617 3300006846 Bacteria 4646
373 Ga0075430_100212742 3300006846 Bacteria 1604
374 Ga0075430_100267132 3300006846 Bacteria 1416
375 Ga0075430_100473874 3300006846 Unclassified 1033
376 Ga0075430_101030802 3300006846 Bacteria 678
377 Ga0075430_101074181 3300006846 Bacteria 663
378 Ga0075431_100001687 3300006847 Bacteria 20728
379 Ga0075431_100030494 3300006847 Bacteria 5554
380 Ga0075431_100150391 3300006847 Bacteria 2397
381 Ga0075431_100260488 3300006847 Bacteria 1760
382 Ga0075431_101393331 3300006847 Unclassified 661
383 Ga0075431_101956526 3300006847 Bacteria 542
384 Ga0075433_10000839 3300006852 Bacteria 21522
385 Ga0075433_10002893 3300006852 Bacteria 13158
386 Ga0075433_10005550 3300006852 Bacteria 9906
387 Ga0075433_10006319 3300006852 Bacteria 9359
388 Ga0075433_10018854 3300006852 Bacteria 5741
389 Ga0075433_10027506 3300006852 Bacteria 4824
390 Ga0075433_10152422 3300006852 Bacteria 2056
391 Ga0075433_10177914 3300006852 Bacteria 1893
392 Ga0075433_10279678 3300006852 Bacteria 1478
393 Ga0075433_10281322 3300006852 Bacteria 1474
394 Ga0075433_11456901 3300006852 Bacteria 592
395 Ga0075434_100001347 3300006871 Bacteria 20612
396 Ga0075434_100032100 3300006871 Bacteria 5178
397 Ga0075434_100040188 3300006871 Bacteria 4633
398 Ga0075434_100105126 3300006871 Bacteria 2833
399 Ga0075434_100109724 3300006871 Bacteria 2769
400 Ga0075434_100120623 3300006871 Bacteria 2637
401 Ga0075434_100140362 3300006871 Bacteria 2435
402 Ga0075434_100260002 3300006871 Bacteria 1755
403 Ga0075434_100322629 3300006871 Bacteria 1565
404 Ga0075434_100457482 3300006871 Bacteria 1297
405 Ga0075434_100492669 3300006871 Bacteria 1246
406 Ga0075434_100507371 3300006871 Bacteria 1227
407 Ga0075434_100656106 3300006871 Bacteria 1067
408 Ga0075434_100994290 3300006871 Bacteria 853
409 Ga0075434_101671582 3300006871 Bacteria 645
410 Ga0075429_100015287 3300006880 Bacteria 6652
411 Ga0075429_100023887 3300006880 Bacteria 5305
412 Ga0075429_100064236 3300006880 Bacteria 3197
413 Ga0075429_100187116 3300006880 Bacteria 1814
414 Ga0075429_100196391 3300006880 Bacteria 1767
415 Ga0075429_100219258 3300006880 Bacteria 1667
416 Ga0075429_100448887 3300006880 Bacteria 1130
417 Ga0075429_100473830 3300006880 Unclassified 1097
418 Ga0075429_101935177 3300006880 Unclassified 511
419 Ga0068865_100025088 3300006881 Bacteria 3918
420 Ga0068865_100057029 3300006881 Bacteria 2724
421 Ga0068865_100157174 3300006881 Bacteria 1731
422 Ga0068865_100480235 3300006881 Bacteria 1033
423 Ga0068865_100507095 3300006881 Bacteria 1007
424 Ga0075436_100319187 3300006914 Bacteria 1116
425 Ga0075436_100441716 3300006914 Bacteria 946
426 Ga0097620_100046795 3300006931 Bacteria 4344
427 Ga0097620_100074773 3300006931 Bacteria 3427
428 Ga0097620_100102452 3300006931 Bacteria 2920
429 Ga0097620_100436300 3300006931 Bacteria 1406
430 Ga0097620_100491395 3300006931 Unclassified 1323
431 Ga0097620_100692012 3300006931 Bacteria 1110
432 Ga0097620_101528071 3300006931 Bacteria 737
433 Ga0075435_100008503 3300007076 Bacteria 7370
434 Ga0075435_100039285 3300007076 Bacteria 3776
435 Ga0075435_100055028 3300007076 Bacteria 3212
436 Ga0075435_100063505 3300007076 Bacteria 2999
437 Ga0075435_100103053 3300007076 Bacteria 2366
438 Ga0075435_100139166 3300007076 Bacteria 2036
439 Ga0075435_100177631 3300007076 Unclassified 1798
440 Ga0075435_100464211 3300007076 Bacteria 1093
441 Ga0075435_100593283 3300007076 Bacteria 960
442 Ga0075435_101886846 3300007076 Bacteria 524
443 Ga0099794_10004256 3300007265 Bacteria 5592
444 Ga0099794_10097975 3300007265 Bacteria 1461
445 Ga0105240_12187269 3300009093 Bacteria 574
446 Ga0111539_10000463 3300009094 Bacteria 51027
447 Ga0111539_10001789 3300009094 Bacteria 28570
448 Ga0111539_10002439 3300009094 Bacteria 24735
449 Ga0111539_10006594 3300009094 Bacteria 14961
450 Ga0111539_10012644 3300009094 Bacteria 10575
451 Ga0111539_10099987 3300009094 Bacteria 3405
452 Ga0111539_10114103 3300009094 Bacteria 3169
453 Ga0111539_10152507 3300009094 Bacteria 2705
454 Ga0111539_10203254 3300009094 Bacteria 2310
455 Ga0111539_10300301 3300009094 Bacteria 1869
456 Ga0111539_10302283 3300009094 Unclassified 1862
457 Ga0111539_10480399 3300009094 Bacteria 1447
458 Ga0111539_10519714 3300009094 Bacteria 1387
459 Ga0111539_10784627 3300009094 Bacteria 1109
460 Ga0111539_11232907 3300009094 Bacteria 868
461 Ga0111539_11254841 3300009094 Bacteria 860
462 Ga0111539_11580791 3300009094 Bacteria 761
463 Ga0111539_12675332 3300009094 Bacteria 578
464 Ga0105245_10146503 3300009098 Bacteria 2228
465 Ga0105245_10180236 3300009098 Bacteria 2018
466 Ga0105245_10483565 3300009098 Bacteria 1252
467 Ga0105245_10529811 3300009098 Unclassified 1198
468 Ga0105245_11954895 3300009098 Bacteria 640
469 Ga0105245_13159986 3300009098 Bacteria 510
470 Ga0105247_10816183 3300009101 Bacteria 713
471 Ga0114129_10001511 3300009147 Bacteria 31462
472 Ga0114129_10003221 3300009147 Bacteria 22900
473 Ga0114129_10025730 3300009147 Bacteria 8337
474 Ga0114129_10031560 3300009147 Bacteria 7488
475 Ga0114129_10054988 3300009147 Bacteria 5579
476 Ga0114129_10129219 3300009147 Bacteria 3472
477 Ga0114129_10167321 3300009147 Bacteria 2999
478 Ga0114129_10211158 3300009147 Bacteria 2624
479 Ga0114129_10244796 3300009147 Bacteria 2410
480 Ga0114129_10271552 3300009147 Bacteria 2268
481 Ga0114129_10373446 3300009147 Bacteria 1884
482 Ga0114129_10382845 3300009147 Bacteria 1857
483 Ga0114129_10413676 3300009147 Bacteria 1775
484 Ga0114129_10610916 3300009147 Unclassified 1412
485 Ga0114129_11288975 3300009147 Bacteria 906
486 Ga0114129_11884284 3300009147 Bacteria 725
487 Ga0114129_12332620 3300009147 Archaea 642
488 Ga0114129_12471794 3300009147 Unclassified 621
489 Ga0105243_10189089 3300009148 Bacteria 1797
490 Ga0105243_10218214 3300009148 Bacteria 1684
491 Ga0105243_10226498 3300009148 Bacteria 1656
492 Ga0105243_11068623 3300009148 Bacteria 814
493 Ga0105242_10432658 3300009176 Bacteria 1236
494 Ga0105242_10823188 3300009176 Bacteria 921
495 Ga0105248_10090515 3300009177 Bacteria 3445
496 Ga0105248_10128201 3300009177 Bacteria 2862
497 Ga0105248_10133601 3300009177 Bacteria 2799
498 Ga0105248_12810120 3300009177 Bacteria 555
499 Ga0105238_10384021 3300009551 Bacteria 1396
500 Ga0105249_10008153 3300009553 Bacteria 9132
501 Ga0105249_10018474 3300009553 Bacteria 6205
502 Ga0105249_10170834 3300009553 Bacteria 2108
503 Ga0105249_10171281 3300009553 Bacteria 2105
504 Ga0105249_11473945 3300009553 Archaea 753
505 Ga0105239_10387526 3300010375 Bacteria 1580
506 Ga0105239_13260376 3300010375 Unclassified 528
507 Ga0105246_10038109 3300011119 Bacteria 3230
508 Ga0105246_10982167 3300011119 Bacteria 763
509 Ga0157339_1042486 3300012505 Bacteria 575
510 Ga0157324_1049104 3300012506 Bacteria 543
511 Ga0157371_10173274 3300013102 Bacteria 1542
512 Ga0157371_10263672 3300013102 Unclassified 1242
513 Ga0157374_10284132 3300013296 Bacteria 1634
514 Ga0157378_10137339 3300013297 Bacteria 2267
515 Ga0157378_10222809 3300013297 Archaea 1793
516 Ga0157378_11459389 3300013297 Bacteria 728
517 Ga0163162_10055861 3300013306 Bacteria 3976
518 Ga0163162_10148124 3300013306 Bacteria 2464
519 Ga0163162_10219016 3300013306 Bacteria 2033
520 Ga0163162_10327365 3300013306 Bacteria 1665
521 Ga0163162_10557886 3300013306 Bacteria 1273
522 Ga0163162_10905775 3300013306 Archaea 995
523 Ga0163162_12073617 3300013306 Bacteria 652
524 Ga0157375_10090064 3300013308 Bacteria 3125
525 Ga0157375_10255663 3300013308 Bacteria 1913
526 Ga0157375_10646215 3300013308 Bacteria 1214
527 Ga0157375_10736668 3300013308 Bacteria 1138
528 Ga0157375_10938618 3300013308 Bacteria 1007
529 Ga0157375_11184520 3300013308 Bacteria 896
530 Ga0163163_10025725 3300014325 Bacteria 5613
531 Ga0163163_10710865 3300014325 Bacteria 1068
532 Ga0163163_11617471 3300014325 Bacteria 709
533 Ga0157380_10003226 3300014326 Bacteria 11146
534 Ga0157380_10124967 3300014326 Bacteria 2185
535 Ga0157380_10152244 3300014326 Bacteria 2001
536 Ga0157380_10236682 3300014326 Bacteria 1643
537 Ga0157380_10251829 3300014326 Bacteria 1599
538 Ga0157380_10311765 3300014326 Bacteria 1454
539 Ga0157380_10450940 3300014326 Bacteria 1235
540 Ga0157380_13233172 3300014326 Bacteria 520
541 Ga0157377_10005724 3300014745 Bacteria 5860
542 Ga0157377_10055331 3300014745 Bacteria 2249
543 Ga0157377_10191641 3300014745 Bacteria 1292
544 Ga0157377_10501305 3300014745 Bacteria 848
545 Ga0157377_11187905 3300014745 Bacteria 590
546 Ga0157379_10422569 3300014968 Bacteria 1228
547 Ga0157379_12464871 3300014968 Bacteria 520
548 Ga0157376_10453181 3300014969 Bacteria 1252
549 Ga0157376_10485717 3300014969 Bacteria 1211
550 Ga0157376_10511408 3300014969 Bacteria 1182
551 Ga0163161_10058861 3300017792 Bacteria 2793
552 Ga0163161_10484093 3300017792 Bacteria 1005
553 Ga0163161_11704090 3300017792 Bacteria 558
554 Ga0207697_10001435 3300025315 Bacteria 13051
555 Ga0207697_10031538 3300025315 Bacteria 2168
556 Ga0207653_10067691 3300025885 Bacteria 1215
557 Ga0207653_10088143 3300025885 Bacteria 1083
558 Ga0207653_10094861 3300025885 Bacteria 1049
559 Ga0207682_10015059 3300025893 Bacteria 3011
560 Ga0207682_10130382 3300025893 Bacteria 1122
561 Ga0207642_10048892 3300025899 Bacteria 1898
562 Ga0207688_10001607 3300025901 Bacteria 11929
563 Ga0207688_10025562 3300025901 Bacteria 3243
564 Ga0207680_10023261 3300025903 Bacteria 3381
565 Ga0207680_10054725 3300025903 Bacteria 2402
566 Ga0207680_10091937 3300025903 Bacteria 1932
567 Ga0207647_10547238 3300025904 Bacteria 642
568 Ga0207685_10226730 3300025905 Bacteria 892
569 Ga0207645_10008679 3300025907 Bacteria 7079
570 Ga0207645_10032645 3300025907 Bacteria 3347
571 Ga0207645_10172604 3300025907 Bacteria 1418
572 Ga0207643_10000732 3300025908 Bacteria 20161
573 Ga0207643_10016610 3300025908 Bacteria 4014
574 Ga0207643_10052943 3300025908 Bacteria 2306
575 Ga0207643_10094574 3300025908 Bacteria 1746
576 Ga0207643_10218456 3300025908 Bacteria 1166
577 Ga0207684_10030947 3300025910 Bacteria 4554
578 Ga0207684_10064862 3300025910 Bacteria 3101
579 Ga0207684_10084506 3300025910 Bacteria 2703
580 Ga0207684_10111950 3300025910 Bacteria 2336
581 Ga0207684_10471456 3300025910 Bacteria 1077
582 Ga0207684_10638079 3300025910 Bacteria 908
583 Ga0207707_10184798 3300025912 Bacteria 1819
584 Ga0207707_10760510 3300025912 Unclassified 810
585 Ga0207693_10407794 3300025915 Bacteria 1062
586 Ga0207663_11084288 3300025916 Bacteria 644
587 Ga0207660_10432334 3300025917 Archaea 1063
588 Ga0207660_10614139 3300025917 Bacteria 886
589 Ga0207662_10000891 3300025918 Bacteria 13817
590 Ga0207662_10039826 3300025918 Bacteria 2758
591 Ga0207662_10155036 3300025918 Bacteria 1459
592 Ga0207657_10454193 3300025919 Bacteria 1005
593 Ga0207649_10111059 3300025920 Bacteria 1831
594 Ga0207649_10158827 3300025920 Unclassified 1565
595 Ga0207652_10614889 3300025921 Archaea 974
596 Ga0207652_11472205 3300025921 Bacteria 585
597 Ga0207646_10161550 3300025922 Bacteria 2022
598 Ga0207646_10163787 3300025922 Bacteria 2007
599 Ga0207646_10360712 3300025922 Bacteria 1313
600 Ga0207646_10385565 3300025922 Bacteria 1266
601 Ga0207646_10483532 3300025922 Bacteria 1116
602 Ga0207646_10486722 3300025922 Unclassified 1112
603 Ga0207646_10524185 3300025922 Bacteria 1066
604 Ga0207646_10754954 3300025922 Bacteria 868
605 Ga0207646_10808486 3300025922 Bacteria 835
606 Ga0207646_11249739 3300025922 Bacteria 650
607 Ga0207681_10004865 3300025923 Bacteria 8251
608 Ga0207681_10008334 3300025923 Bacteria 6339
609 Ga0207681_10066116 3300025923 Bacteria 2502
610 Ga0207681_10131785 3300025923 Bacteria 1849
611 Ga0207681_10376233 3300025923 Bacteria 1142
612 Ga0207681_10412966 3300025923 Bacteria 1092
613 Ga0207681_10674185 3300025923 Bacteria 858
614 Ga0207681_10914367 3300025923 Bacteria 735
615 Ga0207650_10017271 3300025925 Bacteria 5051
616 Ga0207650_10372758 3300025925 Bacteria 1178
617 Ga0207650_10457803 3300025925 Bacteria 1062
618 Ga0207650_11282048 3300025925 Bacteria 624
619 Ga0207659_10002998 3300025926 Bacteria 10064
620 Ga0207659_10003928 3300025926 Bacteria 8970
621 Ga0207659_10010902 3300025926 Bacteria 5724
622 Ga0207659_10051272 3300025926 Bacteria 2934
623 Ga0207659_10057795 3300025926 Bacteria 2783
624 Ga0207659_10157104 3300025926 Bacteria 1782
625 Ga0207659_10291501 3300025926 Bacteria 1337
626 Ga0207659_10678745 3300025926 Bacteria 881
627 Ga0207687_10268549 3300025927 Bacteria 1363
628 Ga0207687_10441460 3300025927 Archaea 1078
629 Ga0207687_10514328 3300025927 Bacteria 1001
630 Ga0207644_10040212 3300025931 Bacteria 3304
631 Ga0207644_10380470 3300025931 Unclassified 1151
632 Ga0207644_10590966 3300025931 Bacteria 921
633 Ga0207644_11133080 3300025931 Bacteria 657
634 Ga0207706_10058439 3300025933 Bacteria 3397
635 Ga0207706_10068582 3300025933 Bacteria 3120
636 Ga0207706_10160764 3300025933 Bacteria 1974
637 Ga0207706_10196924 3300025933 Bacteria 1767
638 Ga0207706_10693258 3300025933 Bacteria 870
639 Ga0207686_10169311 3300025934 Bacteria 1539
640 Ga0207686_10596343 3300025934 Bacteria 869
641 Ga0207709_10141615 3300025935 Bacteria 1654
642 Ga0207709_10160309 3300025935 Bacteria 1568
643 Ga0207709_10171488 3300025935 Bacteria 1523
644 Ga0207670_10181069 3300025936 Unclassified 1587
645 Ga0207670_10184352 3300025936 Bacteria 1574
646 Ga0207670_10337921 3300025936 Bacteria 1189
647 Ga0207669_10103922 3300025937 Bacteria 1885
648 Ga0207669_10179197 3300025937 Bacteria 1517
649 Ga0207669_10339106 3300025937 Bacteria 1157
650 Ga0207669_10564216 3300025937 Bacteria 920
651 Ga0207669_11505596 3300025937 Bacteria 574
652 Ga0207704_10109826 3300025938 Bacteria 1861
653 Ga0207704_10182352 3300025938 Bacteria 1518
654 Ga0207665_10007130 3300025939 Bacteria 7399
655 Ga0207691_10010524 3300025940 Bacteria 8877
656 Ga0207691_10106017 3300025940 Bacteria 2503
657 Ga0207691_10114519 3300025940 Bacteria 2396
658 Ga0207691_10230449 3300025940 Bacteria 1604
659 Ga0207691_10819835 3300025940 Bacteria 781
660 Ga0207711_10082589 3300025941 Bacteria 2809
661 Ga0207711_10105501 3300025941 Bacteria 2499
662 Ga0207711_10578188 3300025941 Bacteria 1048
663 Ga0207689_10006142 3300025942 Bacteria 10632
664 Ga0207689_10044373 3300025942 Bacteria 3676
665 Ga0207689_10046149 3300025942 Bacteria 3602
666 Ga0207689_10183265 3300025942 Bacteria 1727
667 Ga0207689_10208497 3300025942 Bacteria 1614
668 Ga0207689_10906838 3300025942 Bacteria 744
669 Ga0207689_10907973 3300025942 Bacteria 743
670 Ga0207661_10082731 3300025944 Bacteria 2655
671 Ga0207661_11002771 3300025944 Bacteria 769
672 Ga0207679_10010677 3300025945 Bacteria 5920
673 Ga0207679_10123508 3300025945 Bacteria 2065
674 Ga0207679_10329701 3300025945 Bacteria 1324
675 Ga0207679_10354593 3300025945 Bacteria 1280
676 Ga0207679_11243163 3300025945 Bacteria 683
677 Ga0207651_10030607 3300025960 Bacteria 3430
678 Ga0207651_10072361 3300025960 Bacteria 2447
679 Ga0207651_10121224 3300025960 Bacteria 1983
680 Ga0207651_10356488 3300025960 Bacteria 1233
681 Ga0207651_10534526 3300025960 Bacteria 1017
682 Ga0207651_10696310 3300025960 Bacteria 895
683 Ga0207651_10719901 3300025960 Bacteria 880
684 Ga0207712_10135770 3300025961 Bacteria 1881
685 Ga0207712_10194380 3300025961 Bacteria 1604
686 Ga0207712_10584556 3300025961 Bacteria 964
687 Ga0207668_10016771 3300025972 Bacteria 4579
688 Ga0207668_10211429 3300025972 Bacteria 1552
689 Ga0207640_10020989 3300025981 Bacteria 3884
690 Ga0207640_10058881 3300025981 Bacteria 2533
691 Ga0207658_10078126 3300025986 Bacteria 2528
692 Ga0207658_10167120 3300025986 Bacteria 1808
693 Ga0207658_10308506 3300025986 Bacteria 1366
694 Ga0207658_11276202 3300025986 Bacteria 671
695 Ga0207703_10029241 3300026035 Bacteria 4347
696 Ga0207703_10113861 3300026035 Bacteria 2312
697 Ga0207703_10338812 3300026035 Bacteria 1381
698 Ga0207703_10519059 3300026035 Unclassified 1120
699 Ga0207639_10927307 3300026041 Unclassified 814
700 Ga0207639_10929610 3300026041 Bacteria 813
701 Ga0207678_11632290 3300026067 Bacteria 567
702 Ga0207708_10012722 3300026075 Bacteria 6275
703 Ga0207708_10093271 3300026075 Bacteria 2324
704 Ga0207708_10181902 3300026075 Bacteria 1669
705 Ga0207708_10183062 3300026075 Bacteria 1664
706 Ga0207708_10234878 3300026075 Bacteria 1473
707 Ga0207708_10292117 3300026075 Bacteria 1323
708 Ga0207708_10293292 3300026075 Unclassified 1321
709 Ga0207708_11085461 3300026075 Archaea 697
710 Ga0207641_10058835 3300026088 Bacteria 3272
711 Ga0207641_10110548 3300026088 Bacteria 2435
712 Ga0207641_10215059 3300026088 Bacteria 1779
713 Ga0207641_10391301 3300026088 Bacteria 1333
714 Ga0207641_10604914 3300026088 Unclassified 1074
715 Ga0207641_12329168 3300026088 Bacteria 535
716 Ga0207641_12601614 3300026088 Bacteria 504
717 Ga0207648_10033849 3300026089 Bacteria 4506
718 Ga0207648_10087451 3300026089 Bacteria 2720
719 Ga0207648_10150282 3300026089 Bacteria 2055
720 Ga0207676_10048586 3300026095 Bacteria 3295
721 Ga0207676_10062298 3300026095 Bacteria 2958
722 Ga0207676_10523081 3300026095 Bacteria 1129
723 Ga0207674_10073397 3300026116 Bacteria 3435
724 Ga0207674_10244843 3300026116 Bacteria 1740
725 Ga0207674_10276266 3300026116 Bacteria 1628
726 Ga0207674_10369070 3300026116 Bacteria 1387
727 Ga0207674_10395006 3300026116 Bacteria 1336
728 Ga0207675_100000947 3300026118 Bacteria 28984
729 Ga0207675_100012281 3300026118 Bacteria 8002
730 Ga0207675_100093252 3300026118 Bacteria 2832
731 Ga0207675_100173853 3300026118 Bacteria 2060
732 Ga0207675_100211179 3300026118 Bacteria 1867
733 Ga0207675_101912130 3300026118 Unclassified 612
734 Ga0207683_10007833 3300026121 Bacteria 9145
735 Ga0207683_10050501 3300026121 Bacteria 3643
736 Ga0207683_10141601 3300026121 Bacteria 2167
737 Ga0207683_10430262 3300026121 Bacteria 1216
738 Ga0207698_11649866 3300026142 Bacteria 656
739 Ga0209995_1081825 3300027471 Bacteria 554
740 Ga0209588_1005595 3300027671 Bacteria 3610
741 Ga0209588_1048902 3300027671 Bacteria 1368
742 Ga0209998_10129991 3300027717 Unclassified 639
743 Ga0209998_10150856 3300027717 Bacteria 597
744 Ga0207428_10000245 3300027907 Bacteria 74009
745 Ga0207428_10000849 3300027907 Bacteria 34443
746 Ga0207428_10005064 3300027907 Bacteria 12382
747 Ga0207428_10007874 3300027907 Bacteria 9688
748 Ga0207428_10008043 3300027907 Bacteria 9569
749 Ga0207428_10020343 3300027907 Bacteria 5639
750 Ga0207428_10092168 3300027907 Bacteria 2352
751 Ga0207428_10914374 3300027907 Bacteria 619
752 Ga0268266_10437784 3300028379 Unclassified 1241
753 Ga0268266_11723356 3300028379 Bacteria 602
754 Ga0268265_10007675 3300028380 Bacteria 7280
755 Ga0268265_10018708 3300028380 Bacteria 4804
756 Ga0268265_10031665 3300028380 Bacteria 3821
757 Ga0268265_10161847 3300028380 Bacteria 1902
758 Ga0268265_11777409 3300028380 Bacteria 623
759 Ga0268264_10075993 3300028381 Bacteria 2857
760 Ga0268264_10113298 3300028381 Bacteria 2379
761 Ga0268264_10127853 3300028381 Bacteria 2248
762 Ga0268264_10254504 3300028381 Bacteria 1633
763 Ga0268264_10561589 3300028381 Bacteria 1121
764 Ga0268264_10824501 3300028381 Bacteria 928
765 Ga0268264_10946128 3300028381 Unclassified 866
766 Ga0268264_11183455 3300028381 Bacteria 774
767 Ga0307408_100205223 3300031548 Bacteria 1598
768 Ga0307408_100945535 3300031548 Bacteria 791
769 Ga0316579_10011617 3300031691 Bacteria 3746
770 Ga0316576_10037984 3300031727 Bacteria 3450
771 Ga0316576_10135810 3300031727 Bacteria 1851
772 Ga0316578_10007788 3300031728 Bacteria 5406
773 Ga0316578_10054368 3300031728 Bacteria 2348
774 Ga0307405_10123246 3300031731 Unclassified 1777
775 Ga0307405_10915101 3300031731 Bacteria 743
776 Ga0307405_11949433 3300031731 Unclassified 525
777 Ga0316577_10000150 3300031733 Bacteria 21398
778 Ga0316577_10413776 3300031733 Bacteria 766
779 Ga0307413_10391913 3300031824 Bacteria 1085
780 Ga0307406_10485606 3300031901 Bacteria 999
781 Ga0307412_10288160 3300031911 Unclassified 1292
782 Ga0307412_10715555 3300031911 Bacteria 861
783 Ga0307412_11693710 3300031911 Unclassified 579
784 Ga0307409_100445183 3300031995 Unclassified 1249
785 Ga0307409_102783271 3300031995 Unclassified 517
786 Ga0307416_100251533 3300032002 Bacteria 1720
787 Ga0307416_100745093 3300032002 Unclassified 1072
788 Ga0307414_11400291 3300032004 Bacteria 650
789 Ga0307411_11132852 3300032005 Bacteria 707
790 Ga0307411_12238295 3300032005 Bacteria 513
791 Ga0307415_100221167 3300032126 Bacteria 1518
792 Ga0307415_101115443 3300032126 Bacteria 739
793 Ga0316585_10022784 3300032137 Bacteria 1928
794 Ga0373930_0209875 3300034816 Bacteria 510
795 Ga0373950_0027984 3300034818 Bacteria 1031
796 Ga0373958_0048755 3300034819 Bacteria 889
797 Ga0373959_0175564 3300034820 Bacteria 554
798 Ga0373938_0170143 3300034957 Bacteria 590
799 Ga0373926_0294007 3300035083 Bacteria 634
800 Ga0373928_0113764 3300035084 Bacteria 718
801 Ga0373929_0055139 3300035085 Bacteria 918
802 Ga0373940_0014879 3300035088 Bacteria 1905
803 Ga0373940_0060180 3300035088 Unclassified 1085
804 Ga0373949_0265966 3300035090 Bacteria 535
805 Ga0373952_0052533 3300035092 Unclassified 976
806 Ga0373952_0117428 3300035092 Bacteria 718
807 Ga0373932_0052326 3300035112 Bacteria 1216
808 Ga0373939_0025212 3300035114 Bacteria 1665
809 Ga0373939_0532840 3300035114 Bacteria 505
810 Ga0373953_0245737 3300035117 Bacteria 777
811 Ga0373960_0099627 3300035121 Bacteria 940
812 Ga0373942_0180712 3300035207 Bacteria 691
813 Ga0373962_0067457 3300035242 Bacteria 1062
814 Ga0316574_0052433 3300035398 Bacteria 2544
815 Ga0316574_0386549 3300035398 Bacteria 882
816 Ga0373931_0081609 3300035691 Bacteria 1786
817 Ga0373931_0133132 3300035691 Unclassified 1433
818 Ga0373935_0256656 3300035692 Unclassified 1225
819 Ga0373947_0955651 3300035725 Bacteria 585
820 Ga0373937_0025681 3300036401 Bacteria 5320
821 Ga0316582_0001357 3300036647 Bacteria 10630
822 Ga0316582_1217702 3300036647 Bacteria 512
823 Ga0316584_0002564 3300036712 Bacteria 11534
824 Ga0316584_0277436 3300036712 Unclassified 1219
825 Ga0373925_0560631 3300037068 Bacteria 940
826 Ga0316581_0062722 3300037588 Bacteria 1141
827 Ga0439436_0076849 3300041404 Bacteria 930
828 Ga0439439_0189547 3300041406 Archaea 595
829 Ga0439453_0011997 3300041408 Bacteria 1453
830 Ga0439431_0270420 3300041997 Bacteria 507
831 Ga0439450_062070 3300042008 Bacteria 905
832 Ga0439455_0112882 3300042012 Unclassified 757
833 Ga0439455_0173809 3300042012 Bacteria 619
834 Ga0439457_023617 3300042014 Bacteria 1361
835 Ga0450892_015169 3300042130 Bacteria 717
836 Ga0450896_072453 3300042133 Bacteria 572
837 Ga0439434_0318086 3300042435 Bacteria 540
838 Ga0439434_0365699 3300042435 Bacteria 505
839 Ga0439435_0041885 3300042436 Bacteria 1284
840 Ga0439435_0080982 3300042436 Bacteria 974
841 Ga0439435_0244752 3300042436 Bacteria 602
842 Ga0439444_0046250 3300042437 Bacteria 871
843 Ga0439459_0028451 3300042438 Bacteria 1122
844 Ga0439460_0284332 3300042461 Bacteria 576
845 Ga0439460_0329560 3300042461 Bacteria 536
846 Ga0439460_0378904 3300042461 Bacteria 501
847 Ga0451577_0014387 3300042876 Bacteria 7379
848 Ga0451577_0335791 3300042876 Unclassified 1371
849 Ga0451577_0435081 3300042876 Bacteria 1191
850 Ga0439440_0013716 3300042993 Archaea 1742
851 Ga0439440_0150235 3300042993 Bacteria 667
852 Ga0439440_0197963 3300042993 Bacteria 595
853 Ga0453683_0034615 3300044673 Bacteria 3184
854 Ga0453683_0351684 3300044673 Unclassified 947
855 Ga0453683_0921676 3300044673 Bacteria 578
856 Ga0453684_0023625 3300044712 Bacteria 9036
857 Ga0451576_0004364 3300045051 Bacteria 18442
858 Ga0451576_0012148 3300045051 Bacteria 9709
859 Ga0451576_0030406 3300045051 Bacteria 5771
860 Ga0451576_0031179 3300045051 Bacteria 5686
861 Ga0451576_0104360 3300045051 Bacteria 2948
862 Ga0451576_0117028 3300045051 Bacteria 2774
863 Ga0451576_0172853 3300045051 Bacteria 2255
864 Ga0451576_0638681 3300045051 Bacteria 1118
865 Ga0451576_1959513 3300045051 Bacteria 604
866 Ga0451576_2225671 3300045051 Bacteria 562
867 Ga0495603_0159384 3300046455 Bacteria 1309
868 Ga0495603_0200936 3300046455 Bacteria 1152
869 Ga0495629_0038310 3300046459 Bacteria 3377
870 Ga0495580_0303417 3300046472 Bacteria 1087
871 Ga0495580_0908600 3300046472 Bacteria 565
872 Ga0495582_0097077 3300046473 Bacteria 1648
873 Ga0495584_0042121 3300046491 Bacteria 2304
874 Ga0495584_0074113 3300046491 Bacteria 1711
875 Ga0495584_0252618 3300046491 Bacteria 896
876 Ga0495584_0263029 3300046491 Bacteria 877
877 Ga0495594_0105565 3300046499 Bacteria 1586
878 Ga0495637_0244212 3300046520 Bacteria 648
879 Ga0495644_0085525 3300046523 Bacteria 1189
880 Ga0495644_0205021 3300046523 Unclassified 761
881 Ga0495663_0052971 3300046525 Bacteria 1260
882 Ga0495663_0162149 3300046525 Archaea 767
883 Ga0495666_0167028 3300046526 Bacteria 1019
884 Ga0495642_0151091 3300046528 Bacteria 1004
885 Ga0495652_0252243 3300046529 Bacteria 1307
886 Ga0495598_0021116 3300046537 Archaea 1728
887 Ga0495598_0051423 3300046537 Bacteria 1242
888 Ga0495598_0064086 3300046537 Bacteria 1141
889 Ga0495598_0228776 3300046537 Bacteria 681
890 Ga0495609_0078948 3300046538 Bacteria 1440
891 Ga0495609_0187020 3300046538 Unclassified 870
892 Ga0495609_0199273 3300046538 Bacteria 837
893 Ga0495621_0003683 3300046539 Bacteria 4241
894 Ga0495621_0052370 3300046539 Bacteria 1463
895 Ga0495621_0199038 3300046539 Bacteria 805
896 Ga0495621_0304421 3300046539 Bacteria 661
897 Ga0495621_0364702 3300046539 Bacteria 608
898 Ga0495645_0342825 3300046543 Bacteria 964
899 Ga0495656_0536881 3300046615 Bacteria 622
900 Ga0495611_0411343 3300046648 Bacteria 618
901 Ga0495635_0533360 3300046663 Bacteria 771
902 Ga0495659_0020386 3300046664 Bacteria 2226
903 Ga0495659_0030413 3300046664 Bacteria 1879
904 Ga0495659_0121840 3300046664 Bacteria 1027
905 Ga0495659_0151520 3300046664 Bacteria 931
906 Ga0495659_0212478 3300046664 Bacteria 796
907 Ga0495588_0008264 3300046674 Bacteria 4767
908 Ga0495657_0748330 3300046675 Bacteria 560
909 Ga0495623_0117341 3300046679 Bacteria 1607
910 Ga0495658_0232783 3300046683 Bacteria 1156
911 Ga0495658_0597804 3300046683 Bacteria 707
912 Ga0495669_0005624 3300046684 Bacteria 5232
913 Ga0495669_0046114 3300046684 Bacteria 1945
914 Ga0495669_0131328 3300046684 Unclassified 1179
915 Ga0495669_0269978 3300046684 Bacteria 818
916 Ga0495670_0291499 3300046691 Bacteria 874
917 Ga0495589_0362937 3300046794 Unclassified 667
918 Ga0495581_0482659 3300047315 Bacteria 721
919 Ga0495636_0038084 3300047318 Bacteria 1988
920 Ga0495636_0039285 3300047318 Bacteria 1959
921 Ga0495636_0353942 3300047318 Bacteria 693
922 Ga0495636_0594235 3300047318 Bacteria 541
923 Ga0495676_0115037 3300047321 Bacteria 1967
924 Ga0495685_040988 3300047447 Unclassified 1583
925 Ga0496102_0437284 3300048905 Bacteria 1228
926 Ga0496102_1963868 3300048905 Bacteria 502
927 Ga0496106_1378713 3300048909 Bacteria 545
928 Ga0496108_0375576 3300048911 Bacteria 1241
929 Ga0496109_0959963 3300048912 Unclassified 793
930 Ga0496110_1786219 3300048913 Bacteria 525
931 Ga0496112_0353005 3300048915 Bacteria 1413
932 Ga0501298_049216 3300049521 Bacteria 871
933 Ga0501298_185005 3300049521 Bacteria 523
934 Ga0501031_0595100 3300049568 Bacteria 712
935 Ga0501032_0129204 3300049569 Bacteria 1668
936 Ga0501033_0072873 3300049570 Bacteria 2522
937 Ga0501033_0341788 3300049570 Bacteria 1049
938 Ga0501033_0643509 3300049570 Bacteria 725
939 Ga0501036_0180638 3300049572 Bacteria 1776
940 Ga0501036_0314202 3300049572 Unclassified 1310
941 Ga0501036_0716116 3300049572 Unclassified 827
942 Ga0501036_1132772 3300049572 Bacteria 639
943 Ga0501037_0141437 3300049573 Bacteria 1722
944 Ga0501038_0222702 3300049574 Bacteria 1504
945 Ga0501038_0323348 3300049574 Unclassified 1206
946 Ga0501039_0185201 3300049575 Bacteria 1637
947 Ga0501040_0016751 3300049576 Bacteria 4859
948 Ga0501040_0258346 3300049576 Bacteria 1243
949 Ga0501040_0533205 3300049576 Bacteria 847
950 Ga0501040_0613235 3300049576 Bacteria 786
951 Ga0501040_0639500 3300049576 Bacteria 769
952 Ga0501040_0949882 3300049576 Bacteria 623
953 Ga0501041_0013891 3300049577 Bacteria 4775
954 Ga0501041_0081995 3300049577 Bacteria 1987
955 Ga0501041_0128864 3300049577 Bacteria 1576
956 Ga0501041_0514788 3300049577 Bacteria 762
957 Ga0501042_0018095 3300049578 Bacteria 4874
958 Ga0501042_0608006 3300049578 Bacteria 795
959 Ga0501042_0694363 3300049578 Unclassified 740
960 Ga0501042_1022494 3300049578 Bacteria 602
961 Ga0501043_0812819 3300049579 Bacteria 675
962 Ga0501043_1032799 3300049579 Bacteria 584
963 Ga0501046_0043652 3300049580 Bacteria 3569
964 Ga0501046_1049487 3300049580 Bacteria 564
965 Ga0501048_0100635 3300049582 Bacteria 2039
966 Ga0501048_0383048 3300049582 Bacteria 1004
967 Ga0501067_0013133 3300049583 Bacteria 4584
968 Ga0501068_0378009 3300049584 Bacteria 912
969 Ga0501068_0589959 3300049584 Bacteria 724
970 Ga0501071_0674889 3300049587 Bacteria 795
971 Ga0501071_0913561 3300049587 Bacteria 677
972 Ga0501071_0978048 3300049587 Unclassified 653
973 Ga0501072_0023580 3300049588 Bacteria 4780
974 Ga0501072_0205886 3300049588 Bacteria 1568
975 Ga0501072_0471767 3300049588 Bacteria 993
976 Ga0501072_0481614 3300049588 Bacteria 982
977 Ga0501072_1224456 3300049588 Bacteria 583
978 Ga0501072_1527880 3300049588 Bacteria 515
979 Ga0501073_0443041 3300049589 Bacteria 898
980 Ga0501073_0537297 3300049589 Archaea 808
981 Ga0501073_0761748 3300049589 Bacteria 667
982 Ga0501074_0149705 3300049590 Bacteria 1669
983 Ga0501074_0256259 3300049590 Bacteria 1244
984 Ga0501074_0268468 3300049590 Bacteria 1213
985 Ga0501074_0585410 3300049590 Unclassified 789
986 Ga0501075_0007121 3300049591 Bacteria 7737
987 Ga0501075_0032800 3300049591 Bacteria 3861
988 Ga0501075_0071628 3300049591 Bacteria 2620
989 Ga0501075_0174421 3300049591 Bacteria 1641
990 Ga0501075_0321000 3300049591 Bacteria 1180
991 Ga0501076_0034754 3300049592 Bacteria 3942
992 Ga0501076_0065728 3300049592 Bacteria 2893
993 Ga0501076_0082643 3300049592 Bacteria 2578
994 Ga0501076_0108317 3300049592 Bacteria 2244
995 Ga0501076_0462350 3300049592 Bacteria 1045
996 Ga0501076_0782493 3300049592 Bacteria 787
997 Ga0501077_0009200 3300049593 Bacteria 6134
998 Ga0501077_0301894 3300049593 Bacteria 1020
999 Ga0501077_0313668 3300049593 Bacteria 1000
1000 Ga0501077_0477705 3300049593 Bacteria 799
1001 Ga0501077_0739008 3300049593 Bacteria 632
1002 Ga0501198_113007 3300049649 Unclassified 564
1003 Ga0501235_024462 3300049669 Unclassified 1349
1004 Ga0501249_013544 3300049679 Bacteria 1734
1005 Ga0501255_067738 3300049684 Bacteria 579
1006 Ga0501225_0052260 3300049705 Bacteria 1139
1007 Ga0501079_0036483 3300049741 Bacteria 3787
1008 Ga0501079_0066182 3300049741 Bacteria 2788
1009 Ga0501079_0069077 3300049741 Bacteria 2727
1010 Ga0501079_0115944 3300049741 Bacteria 2082
1011 Ga0501079_0216011 3300049741 Bacteria 1498
1012 Ga0501079_0897792 3300049741 Bacteria 698
1013 Ga0501079_1346916 3300049741 Bacteria 562
1014 Ga0501080_0176285 3300049742 Bacteria 1969
1015 Ga0501080_0367445 3300049742 Bacteria 1297
1016 Ga0501080_0748723 3300049742 Unclassified 859
1017 Ga0501081_0005258 3300049743 Bacteria 8341
1018 Ga0501081_0008813 3300049743 Bacteria 6556
1019 Ga0501081_0161916 3300049743 Bacteria 1612
1020 Ga0501081_0165335 3300049743 Bacteria 1596
1021 Ga0501081_1393479 3300049743 Bacteria 532
1022 Ga0501083_0334075 3300049744 Bacteria 985
1023 Ga0501083_0663724 3300049744 Bacteria 678
1024 Ga0501265_017040 3300049762 Bacteria 948
1025 Ga0501268_117020 3300049765 Bacteria 587
1026 Ga0501283_017736 3300049779 Bacteria 1116
1027 Ga0501283_033328 3300049779 Unclassified 871
1028 Ga0501035_0460082 3300049822 Bacteria 1052
1029 Ga0501035_0718893 3300049822 Bacteria 804
1030 Ga0501045_0026152 3300049824 Bacteria 4196
1031 Ga0501045_0096486 3300049824 Bacteria 2188
1032 Ga0501045_0247397 3300049824 Bacteria 1327
1033 Ga0501045_1185506 3300049824 Bacteria 557
1034 Ga0501045_1350652 3300049824 Bacteria 518
1035 nmdc:mga00v17_139668_c1 3300050491 Bacteria 1553
1036 nmdc:mga0yw44_320343_c1 3300050492 Bacteria 1041
1037 nmdc:mga06z11_475989_c1 3300050494 Bacteria 756
1038 nmdc:mga07m45_164479_c1 3300050496 Bacteria 1289
1039 nmdc:mga05p37_11414_c1 3300050507 Bacteria 10575
1040 nmdc:mga05p37_115985_c1 3300050507 Bacteria 3292
1041 nmdc:mga05p37_123743_c1 3300050507 Bacteria 3177
1042 nmdc:mga05p37_129870_c1 3300050507 Bacteria 3092
1043 nmdc:mga05p37_13298_c1 3300050507 Bacteria 9856
1044 nmdc:mga05p37_1652420_c1 3300050507 Bacteria 628
1045 nmdc:mga05p37_1693675_c1 3300050507 Unclassified 617
1046 nmdc:mga05p37_1919791_c1 3300050507 Unclassified 564
1047 nmdc:mga05p37_310094_c1 3300050507 Archaea 1871
1048 nmdc:mga05p37_42435_c1 3300050507 Bacteria 5589
1049 nmdc:mga05p37_588858_c1 3300050507 Bacteria 1258
1050 nmdc:mga05p37_63188_c1 3300050507 Bacteria 4556
1051 nmdc:mga05p37_631990_c1 3300050507 Bacteria 1203
1052 nmdc:mga05p37_92989_c1 3300050507 Bacteria 3716
1053 nmdc:mga05p37_957640_c1 3300050507 Bacteria 915
1054 nmdc:mga09592_10924_c1 3300050508 Bacteria 7389
1055 nmdc:mga09592_112066_c1 3300050508 Bacteria 2341
1056 nmdc:mga09592_119748_c1 3300050508 Bacteria 2261
1057 nmdc:mga09592_148299_c1 3300050508 Bacteria 2023
1058 nmdc:mga09592_186536_c1 3300050508 Bacteria 1795
1059 nmdc:mga09592_243115_c1 3300050508 Bacteria 1560
1060 nmdc:mga09592_381980_c1 3300050508 Bacteria 1218
1061 nmdc:mga09592_421195_c1 3300050508 Unclassified 1153
1062 nmdc:mga09592_428433_c1 3300050508 Bacteria 1142
1063 nmdc:mga09592_5317_c1 3300050508 Bacteria 10464
1064 nmdc:mga0qj67_371396_c1 3300050509 Unclassified 1155
1065 nmdc:mga0qj67_545023_c1 3300050509 Bacteria 931
1066 nmdc:mga0qj67_629250_c1 3300050509 Bacteria 857
1067 nmdc:mga0qj67_7809_c1 3300050509 Bacteria 7907
1068 nmdc:mga0qj67_851719_c1 3300050509 Bacteria 720
1069 nmdc:mga0qj67_900244_c1 3300050509 Bacteria 697
1070 nmdc:mga0qj67_90075_c1 3300050509 Bacteria 2464
1071 nmdc:mga0qj67_9223_c1 3300050509 Bacteria 7331
1072 nmdc:mga06r32_1091200_c1 3300050510 Bacteria 748
1073 nmdc:mga06r32_1230140_c1 3300050510 Unclassified 694
1074 nmdc:mga06r32_139300_c1 3300050510 Bacteria 2402
1075 nmdc:mga06r32_1511356_c1 3300050510 Bacteria 611
1076 nmdc:mga06r32_23099_c1 3300050510 Bacteria 5754
1077 nmdc:mga06r32_2396_c1 3300050510 Bacteria 16781
1078 nmdc:mga06r32_961369_c1 3300050510 Bacteria 808
1079 nmdc:mga08y16_1006278_c1 3300050511 Bacteria 813
1080 nmdc:mga08y16_121797_c1 3300050511 Bacteria 2715
1081 nmdc:mga08y16_1306_c1 3300050511 Bacteria 24771
1082 nmdc:mga08y16_165223_c1 3300050511 Bacteria 2299
1083 nmdc:mga08y16_243886_c1 3300050511 Bacteria 1857
1084 nmdc:mga08y16_2919_c1 3300050511 Bacteria 17590
1085 nmdc:mga08y16_33506_c1 3300050511 Bacteria 5394
1086 nmdc:mga08y16_430301_c1 3300050511 Bacteria 1348
1087 nmdc:mga08y16_49615_c1 3300050511 Bacteria 4393
1088 nmdc:mga08y16_508377_c1 3300050511 Bacteria 1223
1089 nmdc:mga08y16_597_c1 3300050511 Bacteria 33660
1090 nmdc:mga08y16_689353_c1 3300050511 Bacteria 1022
1091 nmdc:mga08y16_777201_c1 3300050511 Bacteria 952
1092 nmdc:mga08y16_788480_c1 3300050511 Bacteria 944
1093 nmdc:mga08y16_8329_c1 3300050511 Bacteria 10851
1094 nmdc:mga08y16_91146_c1 3300050511 Bacteria 3177
1095 nmdc:mga0n895_1170540_c1 3300050512 Bacteria 744
1096 nmdc:mga0n895_133290_c1 3300050512 Bacteria 2510
1097 nmdc:mga0n895_20754_c1 3300050512 Bacteria 6133
1098 nmdc:mga0n895_2183_c1 3300050512 Bacteria 15126
1099 nmdc:mga0n895_263771_c1 3300050512 Bacteria 1748
1100 nmdc:mga0n895_277750_c1 3300050512 Bacteria 1699
1101 nmdc:mga0n895_290853_c1 3300050512 Bacteria 1657
1102 nmdc:mga0n895_346896_c1 3300050512 Bacteria 1504
1103 nmdc:mga0n895_477_c1 3300050512 Bacteria 26935
1104 nmdc:mga0n895_60106_c1 3300050512 Bacteria 3750
1105 nmdc:mga0n895_67211_c1 3300050512 Bacteria 3550
1106 nmdc:mga0n895_874520_c1 3300050512 Bacteria 885
1107 nmdc:mga0n895_935803_c1 3300050512 Bacteria 851
1108 nmdc:mga0rr50_10710_c1 3300050513 Bacteria 5839
1109 nmdc:mga0rr50_111232_c1 3300050513 Bacteria 2168
1110 nmdc:mga0rr50_123548_c1 3300050513 Bacteria 2064
1111 nmdc:mga0rr50_222714_c1 3300050513 Unclassified 1558
1112 nmdc:mga0rr50_31338_c1 3300050513 Bacteria 3775
1113 nmdc:mga0rr50_43159_c1 3300050513 Bacteria 3298
1114 nmdc:mga0rr50_47581_c1 3300050513 Bacteria 3165
1115 nmdc:mga0rr50_761073_c1 3300050513 Bacteria 827
1116 nmdc:mga0rr50_97406_c1 3300050513 Bacteria 2303
1117 nmdc:mga08x19_39381_c1 3300050514 Bacteria 3005
1118 nmdc:mga08x19_496283_c1 3300050514 Bacteria 862
1119 nmdc:mga08x19_895036_c1 3300050514 Unclassified 630
1120 nmdc:mga0a205_13783_c1 3300050515 Bacteria 7537
1121 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
1122 nmdc:mga0a205_1991_c1 3300050515 Bacteria 17807
1123 nmdc:mga0a205_216431_c1 3300050515 Bacteria 1802
1124 nmdc:mga0a205_26128_c1 3300050515 Bacteria 5563
1125 nmdc:mga0a205_266811_c1 3300050515 Bacteria 1589
1126 nmdc:mga0a205_29729_c1 3300050515 Bacteria 5229
1127 nmdc:mga0a205_36408_c1 3300050515 Bacteria 4728
1128 nmdc:mga0a205_472746_c1 3300050515 Bacteria 1112
1129 nmdc:mga0a205_6155_c1 3300050515 Bacteria 3270
1130 nmdc:mga0a205_646_c1 3300050515 Bacteria 27674
1131 nmdc:mga0a205_8978_c1 3300050515 Bacteria 9109
1132 nmdc:mga0a205_909785_c1 3300050515 Bacteria 727
1133 Ga0495619_0466536 3300053085 Bacteria 870
1134 Ga0501084_0040149 3300054114 Bacteria 3914
1135 Ga0501084_0089930 3300054114 Bacteria 2577
1136 Ga0501084_0575637 3300054114 Bacteria 951
1137 Ga0501082_0076295 3300060353 Bacteria 2889
1138 Ga0501082_0097568 3300060353 Bacteria 2541
1139 Ga0501082_0103281 3300060353 Bacteria 2465
1140 Ga0501082_0739990 3300060353 Unclassified 861
1141 Ga0530510_0096259 3300061734 Bacteria 2164
1142 Ga0530510_0123561 3300061734 Bacteria 1901
1143 Ga0530510_0342645 3300061734 Bacteria 1122
1144 Ga0530510_0641315 3300061734 Bacteria 808
1145 Ga0530510_1339866 3300061734 Bacteria 549

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005440 Ga0070705_100943433 Ga0070705_1009434332 79
2 3300005467 Ga0070706_100013213 Ga0070706_1000132135 79
3 3300005471 Ga0070698_100064519 Ga0070698_1000645194 79
4 3300005545 Ga0070695_100056269 Ga0070695_1000562692 79
5 3300005546 Ga0070696_100137699 Ga0070696_1001376992 79
6 3300006852 Ga0075433_10018854 Ga0075433_100188544 79
7 3300006871 Ga0075434_100140362 Ga0075434_1001403623 79
8 3300009098 Ga0105245_13159986 Ga0105245_131599862 79
9 3300009147 Ga0114129_10167321 Ga0114129_101673213 79
10 3300025910 Ga0207684_10064862 Ga0207684_100648625 79
11 3300025922 Ga0207646_10486722 Ga0207646_104867222 79
12 3300044673 Ga0453683_0351684 Ga0453683_0351684_434_745 79
13 3300045051 Ga0451576_1959513 Ga0451576_1959513_39_350 79
14 3300031691 Ga0316579_10011617 Ga0316579_100116172 80
15 3300031727 Ga0316576_10037984 Ga0316576_100379843 80
16 3300031727 Ga0316576_10135810 Ga0316576_101358102 80
17 3300031728 Ga0316578_10007788 Ga0316578_100077886 80
18 3300031728 Ga0316578_10054368 Ga0316578_100543682 80
19 3300031733 Ga0316577_10000150 Ga0316577_100001502 80
20 3300031733 Ga0316577_10413776 Ga0316577_104137762 80
21 3300032137 Ga0316585_10022784 Ga0316585_100227842 80
22 3300035398 Ga0316574_0052433 Ga0316574_0052433_1790_2098 80
23 3300035398 Ga0316574_0386549 Ga0316574_0386549_72_377 80
24 3300036647 Ga0316582_0001357 Ga0316582_0001357_3376_3681 80
25 3300036647 Ga0316582_1217702 Ga0316582_1217702_79_384 80
26 3300036712 Ga0316584_0002564 Ga0316584_0002564_6796_7101 80
27 3300036712 Ga0316584_0277436 Ga0316584_0277436_787_1095 80
28 3300037588 Ga0316581_0062722 Ga0316581_0062722_561_866 80
29 3300005467 Ga0070706_100532267 Ga0070706_1005322672 81
30 3300005471 Ga0070698_100085437 Ga0070698_1000854374 81
31 3300005518 Ga0070699_100330080 Ga0070699_1003300803 81
32 3300025910 Ga0207684_10111950 Ga0207684_101119502 81
33 3300049584 Ga0501068_0589959 Ga0501068_0589959_92_397 81
34 3300006846 Ga0075430_100473874 Ga0075430_1004738742 82
35 3300050509 nmdc:mga0qj67_851719_c1 nmdc:mga0qj67_851719_c1_143_448 82
36 3300006852 Ga0075433_10152422 Ga0075433_101524223 84
37 3300050515 nmdc:mga0a205_29729_c1 nmdc:mga0a205_29729_c1_4019_4324 84
38 3300050510 nmdc:mga06r32_1230140_c1 nmdc:mga06r32_1230140_c1_406_684 92
39 3300005295 Ga0065707_10335677 Ga0065707_103356772 93
40 3300009176 Ga0105242_10823188 Ga0105242_108231882 93
41 3300026075 Ga0207708_11085461 Ga0207708_110854611 94
42 3300006852 Ga0075433_10279678 Ga0075433_102796782 97
43 3300006871 Ga0075434_100656106 Ga0075434_1006561062 97
44 3300050515 nmdc:mga0a205_6155_c1 nmdc:mga0a205_6155_c1_1313_1636 97
45 3300005981 Ga0081538_10003260 Ga0081538_1000326011 98
46 3300049572 Ga0501036_0716116 Ga0501036_0716116_416_727 98
47 3300049578 Ga0501042_0694363 Ga0501042_0694363_59_370 98
48 2162886007 SwRhRL2b_contig_47150 SwRhRL2b_0259.00006130 99
49 3300001977 JGI24746J21847_1001951 JGI24746J21847_10019512 99
50 3300002070 JGI24750J21931_1036437 JGI24750J21931_10364372 99
51 3300002073 JGI24745J21846_1042295 JGI24745J21846_10422951 99
52 3300002077 JGI24744J21845_10110202 JGI24744J21845_101102022 99
53 3300002155 JGI24033J26618_1040659 JGI24033J26618_10406592 99
54 3300003203 JGI25406J46586_10000120 JGI25406J46586_1000012017 99
55 3300003203 JGI25406J46586_10002893 JGI25406J46586_100028939 99
56 3300003203 JGI25406J46586_10230258 JGI25406J46586_102302581 99
57 3300003911 JGI25405J52794_10007265 JGI25405J52794_100072652 99
58 3300005288 Ga0065714_10022432 Ga0065714_100224322 99
59 3300005289 Ga0065704_10555065 Ga0065704_105550651 99
60 3300005289 Ga0065704_10637319 Ga0065704_106373191 99
61 3300005289 Ga0065704_10786870 Ga0065704_107868702 99
62 3300005289 Ga0065704_10809916 Ga0065704_108099161 99
63 3300005290 Ga0065712_10002361 Ga0065712_100023615 99
64 3300005290 Ga0065712_10044208 Ga0065712_100442082 99
65 3300005290 Ga0065712_10068087 Ga0065712_100680872 99
66 3300005290 Ga0065712_10416474 Ga0065712_104164742 99
67 3300005290 Ga0065712_10495543 Ga0065712_104955431 99
68 3300005293 Ga0065715_10005733 Ga0065715_100057332 99
69 3300005293 Ga0065715_10032568 Ga0065715_100325682 99
70 3300005293 Ga0065715_10140458 Ga0065715_101404583 99
71 3300005293 Ga0065715_10307877 Ga0065715_103078772 99
72 3300005293 Ga0065715_10430131 Ga0065715_104301312 99
73 3300005293 Ga0065715_10539117 Ga0065715_105391171 99
74 3300005295 Ga0065707_10002595 Ga0065707_100025954 99
75 3300005295 Ga0065707_10059554 Ga0065707_100595542 99
76 3300005295 Ga0065707_10223056 Ga0065707_102230562 99
77 3300005295 Ga0065707_10275393 Ga0065707_102753932 99
78 3300005295 Ga0065707_10816707 Ga0065707_108167071 99
79 3300005295 Ga0065707_10887380 Ga0065707_108873802 99
80 3300005295 Ga0065707_10925811 Ga0065707_109258112 99
81 3300005295 Ga0065707_10950298 Ga0065707_109502982 99
82 3300005295 Ga0065707_11138320 Ga0065707_111383201 99
83 3300005328 Ga0070676_10032474 Ga0070676_100324744 99
84 3300005328 Ga0070676_10520244 Ga0070676_105202442 99
85 3300005329 Ga0070683_100188506 Ga0070683_1001885062 99
86 3300005329 Ga0070683_100680413 Ga0070683_1006804132 99
87 3300005329 Ga0070683_101061149 Ga0070683_1010611491 99
88 3300005329 Ga0070683_101578385 Ga0070683_1015783852 99
89 3300005330 Ga0070690_100082077 Ga0070690_1000820774 99
90 3300005330 Ga0070690_100194641 Ga0070690_1001946412 99
91 3300005330 Ga0070690_100263525 Ga0070690_1002635252 99
92 3300005331 Ga0070670_100029541 Ga0070670_1000295413 99
93 3300005331 Ga0070670_100444072 Ga0070670_1004440722 99
94 3300005331 Ga0070670_101096431 Ga0070670_1010964312 99
95 3300005333 Ga0070677_10002331 Ga0070677_100023314 99
96 3300005333 Ga0070677_10105855 Ga0070677_101058552 99
97 3300005333 Ga0070677_10635424 Ga0070677_106354242 99
98 3300005334 Ga0068869_100002011 Ga0068869_10000201112 99
99 3300005334 Ga0068869_100010384 Ga0068869_1000103842 99
100 3300005334 Ga0068869_100095270 Ga0068869_1000952704 99
101 3300005334 Ga0068869_100171937 Ga0068869_1001719372 99
102 3300005334 Ga0068869_100204359 Ga0068869_1002043592 99
103 3300005334 Ga0068869_100805168 Ga0068869_1008051682 99
104 3300005335 Ga0070666_10029185 Ga0070666_100291852 99
105 3300005335 Ga0070666_10103656 Ga0070666_101036563 99
106 3300005335 Ga0070666_10282459 Ga0070666_102824592 99
107 3300005335 Ga0070666_10384378 Ga0070666_103843782 99
108 3300005335 Ga0070666_10677981 Ga0070666_106779812 99
109 3300005336 Ga0070680_100447086 Ga0070680_1004470861 99
110 3300005336 Ga0070680_100499426 Ga0070680_1004994262 99
111 3300005336 Ga0070680_100783123 Ga0070680_1007831232 99
112 3300005338 Ga0068868_100018603 Ga0068868_1000186033 99
113 3300005338 Ga0068868_100489238 Ga0068868_1004892382 99
114 3300005338 Ga0068868_100683023 Ga0068868_1006830231 99
115 3300005339 Ga0070660_100744426 Ga0070660_1007444261 99
116 3300005339 Ga0070660_101352452 Ga0070660_1013524521 99
117 3300005340 Ga0070689_100179427 Ga0070689_1001794274 99
118 3300005340 Ga0070689_100274466 Ga0070689_1002744662 99
119 3300005340 Ga0070689_100313133 Ga0070689_1003131332 99
120 3300005340 Ga0070689_100321381 Ga0070689_1003213813 99
121 3300005340 Ga0070689_100909534 Ga0070689_1009095342 99
122 3300005341 Ga0070691_10162871 Ga0070691_101628712 99
123 3300005341 Ga0070691_10268802 Ga0070691_102688022 99
124 3300005341 Ga0070691_10436806 Ga0070691_104368062 99
125 3300005343 Ga0070687_100015745 Ga0070687_1000157452 99
126 3300005343 Ga0070687_100087406 Ga0070687_1000874062 99
127 3300005344 Ga0070661_100323592 Ga0070661_1003235921 99
128 3300005344 Ga0070661_101128696 Ga0070661_1011286962 99
129 3300005345 Ga0070692_10034824 Ga0070692_100348243 99
130 3300005345 Ga0070692_10111153 Ga0070692_101111532 99
131 3300005345 Ga0070692_10218309 Ga0070692_102183092 99
132 3300005345 Ga0070692_10567199 Ga0070692_105671992 99
133 3300005347 Ga0070668_100021604 Ga0070668_1000216043 99
134 3300005347 Ga0070668_100049143 Ga0070668_1000491434 99
135 3300005347 Ga0070668_100197353 Ga0070668_1001973531 99
136 3300005347 Ga0070668_100399699 Ga0070668_1003996992 99
137 3300005353 Ga0070669_100012365 Ga0070669_1000123655 99
138 3300005353 Ga0070669_100017022 Ga0070669_1000170222 99
139 3300005353 Ga0070669_100042163 Ga0070669_1000421632 99
140 3300005353 Ga0070669_100107685 Ga0070669_1001076854 99
141 3300005353 Ga0070669_100195573 Ga0070669_1001955732 99
142 3300005353 Ga0070669_100457497 Ga0070669_1004574972 99
143 3300005353 Ga0070669_100663674 Ga0070669_1006636741 99
144 3300005353 Ga0070669_100819323 Ga0070669_1008193232 99
145 3300005354 Ga0070675_100003563 Ga0070675_1000035637 99
146 3300005354 Ga0070675_100011263 Ga0070675_1000112634 99
147 3300005354 Ga0070675_100016428 Ga0070675_1000164287 99
148 3300005354 Ga0070675_100029346 Ga0070675_1000293462 99
149 3300005354 Ga0070675_100075745 Ga0070675_1000757453 99
150 3300005354 Ga0070675_100085167 Ga0070675_1000851674 99
151 3300005354 Ga0070675_100390813 Ga0070675_1003908132 99
152 3300005354 Ga0070675_100598389 Ga0070675_1005983892 99
153 3300005355 Ga0070671_100044691 Ga0070671_1000446915 99
154 3300005355 Ga0070671_100306964 Ga0070671_1003069642 99
155 3300005355 Ga0070671_100768316 Ga0070671_1007683162 99
156 3300005356 Ga0070674_100070035 Ga0070674_1000700351 99
157 3300005356 Ga0070674_100086628 Ga0070674_1000866282 99
158 3300005356 Ga0070674_100107787 Ga0070674_1001077872 99
159 3300005356 Ga0070674_100138352 Ga0070674_1001383522 99
160 3300005356 Ga0070674_100997044 Ga0070674_1009970442 99
161 3300005356 Ga0070674_101063989 Ga0070674_1010639892 99
162 3300005364 Ga0070673_100004953 Ga0070673_1000049532 99
163 3300005364 Ga0070673_100032242 Ga0070673_1000322424 99
164 3300005364 Ga0070673_100043953 Ga0070673_1000439534 99
165 3300005364 Ga0070673_100124601 Ga0070673_1001246012 99
166 3300005364 Ga0070673_100326327 Ga0070673_1003263273 99
167 3300005364 Ga0070673_100730355 Ga0070673_1007303552 99
168 3300005364 Ga0070673_101274949 Ga0070673_1012749492 99
169 3300005364 Ga0070673_102249565 Ga0070673_1022495652 99
170 3300005365 Ga0070688_100030594 Ga0070688_1000305943 99
171 3300005365 Ga0070688_100032093 Ga0070688_1000320932 99
172 3300005365 Ga0070688_100048283 Ga0070688_1000482832 99
173 3300005366 Ga0070659_100102975 Ga0070659_1001029752 99
174 3300005366 Ga0070659_100518934 Ga0070659_1005189342 99
175 3300005367 Ga0070667_100034478 Ga0070667_1000344786 99
176 3300005367 Ga0070667_100236304 Ga0070667_1002363042 99
177 3300005367 Ga0070667_101343353 Ga0070667_1013433531 99
178 3300005406 Ga0070703_10133781 Ga0070703_101337812 99
179 3300005406 Ga0070703_10421141 Ga0070703_104211411 99
180 3300005434 Ga0070709_10852947 Ga0070709_108529472 99
181 3300005436 Ga0070713_100750187 Ga0070713_1007501872 99
182 3300005438 Ga0070701_10008052 Ga0070701_100080522 99
183 3300005438 Ga0070701_10017782 Ga0070701_100177822 99
184 3300005438 Ga0070701_10017788 Ga0070701_100177881 99
185 3300005438 Ga0070701_10038494 Ga0070701_100384944 99
186 3300005439 Ga0070711_101099147 Ga0070711_1010991471 99
187 3300005440 Ga0070705_100001862 Ga0070705_1000018624 99
188 3300005440 Ga0070705_100111209 Ga0070705_1001112093 99
189 3300005440 Ga0070705_100344098 Ga0070705_1003440982 99
190 3300005440 Ga0070705_100405455 Ga0070705_1004054551 99
191 3300005440 Ga0070705_100448107 Ga0070705_1004481072 99
192 3300005440 Ga0070705_100665329 Ga0070705_1006653292 99
193 3300005440 Ga0070705_100726644 Ga0070705_1007266441 99
194 3300005440 Ga0070705_100961846 Ga0070705_1009618462 99
195 3300005440 Ga0070705_101120932 Ga0070705_1011209321 99
196 3300005440 Ga0070705_101604422 Ga0070705_1016044222 99
197 3300005440 Ga0070705_101940549 Ga0070705_1019405492 99
198 3300005441 Ga0070700_100183364 Ga0070700_1001833643 99
199 3300005441 Ga0070700_100295219 Ga0070700_1002952192 99
200 3300005441 Ga0070700_100391766 Ga0070700_1003917662 99
201 3300005441 Ga0070700_101093137 Ga0070700_1010931371 99
202 3300005444 Ga0070694_100006222 Ga0070694_1000062222 99
203 3300005444 Ga0070694_100023227 Ga0070694_1000232272 99
204 3300005444 Ga0070694_100035820 Ga0070694_1000358203 99
205 3300005444 Ga0070694_100049676 Ga0070694_1000496762 99
206 3300005444 Ga0070694_100181157 Ga0070694_1001811573 99
207 3300005444 Ga0070694_100345192 Ga0070694_1003451923 99
208 3300005444 Ga0070694_100356504 Ga0070694_1003565042 99
209 3300005444 Ga0070694_100747054 Ga0070694_1007470542 99
210 3300005445 Ga0070708_100087544 Ga0070708_1000875442 99
211 3300005445 Ga0070708_100333926 Ga0070708_1003339263 99
212 3300005445 Ga0070708_100437080 Ga0070708_1004370802 99
213 3300005445 Ga0070708_100828039 Ga0070708_1008280392 99
214 3300005445 Ga0070708_101608306 Ga0070708_1016083061 99
215 3300005455 Ga0070663_101015172 Ga0070663_1010151722 99
216 3300005456 Ga0070678_100016025 Ga0070678_1000160253 99
217 3300005456 Ga0070678_100058630 Ga0070678_1000586302 99
218 3300005456 Ga0070678_100290207 Ga0070678_1002902072 99
219 3300005456 Ga0070678_100399936 Ga0070678_1003999362 99
220 3300005457 Ga0070662_100057020 Ga0070662_1000570203 99
221 3300005458 Ga0070681_10118989 Ga0070681_101189892 99
222 3300005459 Ga0068867_100030066 Ga0068867_1000300662 99
223 3300005459 Ga0068867_100038646 Ga0068867_1000386465 99
224 3300005459 Ga0068867_100151872 Ga0068867_1001518723 99
225 3300005459 Ga0068867_100957619 Ga0068867_1009576192 99
226 3300005459 Ga0068867_101189515 Ga0068867_1011895152 99
227 3300005466 Ga0070685_10009166 Ga0070685_100091664 99
228 3300005466 Ga0070685_10230971 Ga0070685_102309711 99
229 3300005466 Ga0070685_10876151 Ga0070685_108761512 99
230 3300005467 Ga0070706_100116122 Ga0070706_1001161223 99
231 3300005467 Ga0070706_100277962 Ga0070706_1002779622 99
232 3300005467 Ga0070706_100334820 Ga0070706_1003348202 99
233 3300005467 Ga0070706_100615355 Ga0070706_1006153552 99
234 3300005467 Ga0070706_100798774 Ga0070706_1007987742 99
235 3300005468 Ga0070707_100138098 Ga0070707_1001380984 99
236 3300005468 Ga0070707_100369536 Ga0070707_1003695362 99
237 3300005468 Ga0070707_100424279 Ga0070707_1004242793 99
238 3300005468 Ga0070707_100444487 Ga0070707_1004444872 99
239 3300005468 Ga0070707_100493067 Ga0070707_1004930672 99
240 3300005468 Ga0070707_100535907 Ga0070707_1005359072 99
241 3300005468 Ga0070707_101123101 Ga0070707_1011231012 99
242 3300005468 Ga0070707_101562831 Ga0070707_1015628312 99
243 3300005468 Ga0070707_101751196 Ga0070707_1017511961 99
244 3300005468 Ga0070707_102084580 Ga0070707_1020845802 99
245 3300005471 Ga0070698_100007713 Ga0070698_1000077135 99
246 3300005471 Ga0070698_100010269 Ga0070698_1000102694 99
247 3300005471 Ga0070698_100016413 Ga0070698_1000164135 99
248 3300005471 Ga0070698_100108397 Ga0070698_1001083972 99
249 3300005471 Ga0070698_100111260 Ga0070698_1001112601 99
250 3300005471 Ga0070698_100134909 Ga0070698_1001349092 99
251 3300005471 Ga0070698_100209013 Ga0070698_1002090132 99
252 3300005471 Ga0070698_101934461 Ga0070698_1019344611 99
253 3300005518 Ga0070699_100000712 Ga0070699_10000071214 99
254 3300005518 Ga0070699_100008025 Ga0070699_1000080252 99
255 3300005518 Ga0070699_100020623 Ga0070699_1000206237 99
256 3300005518 Ga0070699_100023130 Ga0070699_1000231303 99
257 3300005518 Ga0070699_100103902 Ga0070699_1001039022 99
258 3300005518 Ga0070699_100150910 Ga0070699_1001509104 99
259 3300005518 Ga0070699_100186996 Ga0070699_1001869962 99
260 3300005518 Ga0070699_100279325 Ga0070699_1002793252 99
261 3300005530 Ga0070679_100481925 Ga0070679_1004819253 99
262 3300005530 Ga0070679_101541655 Ga0070679_1015416551 99
263 3300005535 Ga0070684_100048966 Ga0070684_1000489663 99
264 3300005535 Ga0070684_102241676 Ga0070684_1022416762 99
265 3300005536 Ga0070697_100029575 Ga0070697_1000295753 99
266 3300005536 Ga0070697_100063206 Ga0070697_1000632064 99
267 3300005536 Ga0070697_100322996 Ga0070697_1003229963 99
268 3300005536 Ga0070697_100407940 Ga0070697_1004079402 99
269 3300005536 Ga0070697_101093382 Ga0070697_1010933822 99
270 3300005536 Ga0070697_101603251 Ga0070697_1016032511 99
271 3300005539 Ga0068853_100936029 Ga0068853_1009360291 99
272 3300005543 Ga0070672_100014619 Ga0070672_1000146194 99
273 3300005543 Ga0070672_100035906 Ga0070672_1000359065 99
274 3300005543 Ga0070672_100069321 Ga0070672_1000693215 99
275 3300005543 Ga0070672_100276074 Ga0070672_1002760742 99
276 3300005543 Ga0070672_100370524 Ga0070672_1003705243 99
277 3300005543 Ga0070672_100636349 Ga0070672_1006363492 99
278 3300005543 Ga0070672_101466765 Ga0070672_1014667652 99
279 3300005544 Ga0070686_100049367 Ga0070686_1000493672 99
280 3300005544 Ga0070686_100064257 Ga0070686_1000642572 99
281 3300005544 Ga0070686_100070785 Ga0070686_1000707852 99
282 3300005544 Ga0070686_100174043 Ga0070686_1001740433 99
283 3300005545 Ga0070695_100000112 Ga0070695_10000011211 99
284 3300005545 Ga0070695_100010416 Ga0070695_1000104163 99
285 3300005545 Ga0070695_100109708 Ga0070695_1001097082 99
286 3300005545 Ga0070695_100161054 Ga0070695_1001610543 99
287 3300005545 Ga0070695_100217988 Ga0070695_1002179882 99
288 3300005545 Ga0070695_101290580 Ga0070695_1012905802 99
289 3300005545 Ga0070695_101512869 Ga0070695_1015128692 99
290 3300005546 Ga0070696_100027987 Ga0070696_1000279873 99
291 3300005546 Ga0070696_100049679 Ga0070696_1000496792 99
292 3300005546 Ga0070696_100281943 Ga0070696_1002819431 99
293 3300005547 Ga0070693_100275924 Ga0070693_1002759241 99
294 3300005547 Ga0070693_101499810 Ga0070693_1014998101 99
295 3300005548 Ga0070665_100044178 Ga0070665_1000441782 99
296 3300005548 Ga0070665_100567843 Ga0070665_1005678432 99
297 3300005549 Ga0070704_100031186 Ga0070704_1000311863 99
298 3300005549 Ga0070704_100034877 Ga0070704_1000348772 99
299 3300005549 Ga0070704_100088178 Ga0070704_1000881781 99
300 3300005549 Ga0070704_100218668 Ga0070704_1002186683 99
301 3300005549 Ga0070704_100241768 Ga0070704_1002417681 99
302 3300005549 Ga0070704_100563574 Ga0070704_1005635742 99
303 3300005549 Ga0070704_100934201 Ga0070704_1009342012 99
304 3300005549 Ga0070704_100951981 Ga0070704_1009519812 99
305 3300005549 Ga0070704_101168906 Ga0070704_1011689062 99
306 3300005549 Ga0070704_101252365 Ga0070704_1012523651 99
307 3300005564 Ga0070664_100024184 Ga0070664_1000241843 99
308 3300005564 Ga0070664_100091167 Ga0070664_1000911673 99
309 3300005564 Ga0070664_100418153 Ga0070664_1004181533 99
310 3300005564 Ga0070664_100569270 Ga0070664_1005692702 99
311 3300005577 Ga0068857_100008027 Ga0068857_1000080273 99
312 3300005577 Ga0068857_100441993 Ga0068857_1004419932 99
313 3300005577 Ga0068857_100512152 Ga0068857_1005121522 99
314 3300005577 Ga0068857_100858673 Ga0068857_1008586732 99
315 3300005577 Ga0068857_101149576 Ga0068857_1011495762 99
316 3300005577 Ga0068857_101662098 Ga0068857_1016620982 99
317 3300005578 Ga0068854_100115278 Ga0068854_1001152781 99
318 3300005578 Ga0068854_100139823 Ga0068854_1001398232 99
319 3300005578 Ga0068854_100313426 Ga0068854_1003134262 99
320 3300005578 Ga0068854_101622860 Ga0068854_1016228601 99
321 3300005615 Ga0070702_100031310 Ga0070702_1000313103 99
322 3300005615 Ga0070702_100195867 Ga0070702_1001958672 99
323 3300005615 Ga0070702_100263505 Ga0070702_1002635052 99
324 3300005615 Ga0070702_100303926 Ga0070702_1003039261 99
325 3300005615 Ga0070702_100966332 Ga0070702_1009663322 99
326 3300005616 Ga0068852_101953964 Ga0068852_1019539642 99
327 3300005617 Ga0068859_100046788 Ga0068859_1000467882 99
328 3300005617 Ga0068859_100074781 Ga0068859_1000747813 99
329 3300005617 Ga0068859_100102459 Ga0068859_1001024592 99
330 3300005617 Ga0068859_100436306 Ga0068859_1004363063 99
331 3300005617 Ga0068859_100491396 Ga0068859_1004913962 99
332 3300005617 Ga0068859_100691970 Ga0068859_1006919702 99
333 3300005617 Ga0068859_101528343 Ga0068859_1015283432 99
334 3300005618 Ga0068864_100061602 Ga0068864_1000616022 99
335 3300005618 Ga0068864_100587619 Ga0068864_1005876192 99
336 3300005618 Ga0068864_100705993 Ga0068864_1007059932 99
337 3300005718 Ga0068866_10023915 Ga0068866_100239152 99
338 3300005719 Ga0068861_100005274 Ga0068861_1000052749 99
339 3300005719 Ga0068861_100178774 Ga0068861_1001787742 99
340 3300005719 Ga0068861_100413867 Ga0068861_1004138672 99
341 3300005719 Ga0068861_100652124 Ga0068861_1006521243 99
342 3300005719 Ga0068861_100706069 Ga0068861_1007060692 99
343 3300005719 Ga0068861_101336355 Ga0068861_1013363552 99
344 3300005840 Ga0068870_10002979 Ga0068870_100029795 99
345 3300005840 Ga0068870_10030196 Ga0068870_100301963 99
346 3300005840 Ga0068870_10056742 Ga0068870_100567422 99
347 3300005840 Ga0068870_10308883 Ga0068870_103088832 99
348 3300005841 Ga0068863_100025327 Ga0068863_1000253274 99
349 3300005841 Ga0068863_100079921 Ga0068863_1000799213 99
350 3300005841 Ga0068863_100141547 Ga0068863_1001415472 99
351 3300005841 Ga0068863_100214672 Ga0068863_1002146722 99
352 3300005841 Ga0068863_100738601 Ga0068863_1007386012 99
353 3300005841 Ga0068863_101534619 Ga0068863_1015346192 99
354 3300005842 Ga0068858_100034467 Ga0068858_1000344673 99
355 3300005842 Ga0068858_100056039 Ga0068858_1000560394 99
356 3300005842 Ga0068858_100080652 Ga0068858_1000806522 99
357 3300005842 Ga0068858_100114085 Ga0068858_1001140853 99
358 3300005842 Ga0068858_101224818 Ga0068858_1012248182 99
359 3300005843 Ga0068860_100027366 Ga0068860_1000273665 99
360 3300005843 Ga0068860_100070854 Ga0068860_1000708543 99
361 3300005843 Ga0068860_100332345 Ga0068860_1003323452 99
362 3300005843 Ga0068860_100359758 Ga0068860_1003597582 99
363 3300005843 Ga0068860_100705271 Ga0068860_1007052712 99
364 3300005843 Ga0068860_100707885 Ga0068860_1007078852 99
365 3300005843 Ga0068860_100907846 Ga0068860_1009078462 99
366 3300005843 Ga0068860_101116897 Ga0068860_1011168972 99
367 3300005844 Ga0068862_100026860 Ga0068862_1000268605 99
368 3300005844 Ga0068862_100039181 Ga0068862_1000391812 99
369 3300005844 Ga0068862_100043004 Ga0068862_1000430043 99
370 3300005844 Ga0068862_100126478 Ga0068862_1001264783 99
371 3300005844 Ga0068862_101738228 Ga0068862_1017382282 99
372 3300005844 Ga0068862_102644755 Ga0068862_1026447552 99
373 3300005937 Ga0081455_10000868 Ga0081455_100008686 99
374 3300005937 Ga0081455_10118098 Ga0081455_101180982 99
375 3300005937 Ga0081455_10800085 Ga0081455_108000851 99
376 3300005985 Ga0081539_10000024 Ga0081539_1000002438 99
377 3300005985 Ga0081539_10000096 Ga0081539_10000096101 99
378 3300005985 Ga0081539_10002353 Ga0081539_1000235314 99
379 3300006038 Ga0075365_10817599 Ga0075365_108175992 99
380 3300006051 Ga0075364_10169992 Ga0075364_101699922 99
381 3300006058 Ga0075432_10390362 Ga0075432_103903622 99
382 3300006058 Ga0075432_10481468 Ga0075432_104814681 99
383 3300006058 Ga0075432_10497270 Ga0075432_104972702 99
384 3300006173 Ga0070716_100035251 Ga0070716_1000352515 99
385 3300006178 Ga0075367_10163763 Ga0075367_101637632 99
386 3300006237 Ga0097621_100068844 Ga0097621_1000688442 99
387 3300006237 Ga0097621_100070646 Ga0097621_1000706462 99
388 3300006237 Ga0097621_100228817 Ga0097621_1002288173 99
389 3300006237 Ga0097621_100362880 Ga0097621_1003628802 99
390 3300006237 Ga0097621_101481160 Ga0097621_1014811602 99
391 3300006353 Ga0075370_10040982 Ga0075370_100409822 99
392 3300006358 Ga0068871_100053801 Ga0068871_1000538013 99
393 3300006358 Ga0068871_100200215 Ga0068871_1002002152 99
394 3300006358 Ga0068871_101893464 Ga0068871_1018934642 99
395 3300006844 Ga0075428_100004648 Ga0075428_10000464812 99
396 3300006844 Ga0075428_100004968 Ga0075428_1000049689 99
397 3300006844 Ga0075428_100036865 Ga0075428_1000368658 99
398 3300006844 Ga0075428_100038501 Ga0075428_1000385012 99
399 3300006844 Ga0075428_100119768 Ga0075428_1001197685 99
400 3300006844 Ga0075428_100161676 Ga0075428_1001616762 99
401 3300006844 Ga0075428_100197201 Ga0075428_1001972014 99
402 3300006844 Ga0075428_100276515 Ga0075428_1002765152 99
403 3300006844 Ga0075428_100556253 Ga0075428_1005562532 99
404 3300006844 Ga0075428_100634272 Ga0075428_1006342722 99
405 3300006844 Ga0075428_100683412 Ga0075428_1006834122 99
406 3300006844 Ga0075428_101734208 Ga0075428_1017342082 99
407 3300006846 Ga0075430_100007192 Ga0075430_1000071926 99
408 3300006846 Ga0075430_100019149 Ga0075430_1000191491 99
409 3300006846 Ga0075430_100029617 Ga0075430_1000296172 99
410 3300006846 Ga0075430_100212742 Ga0075430_1002127423 99
411 3300006846 Ga0075430_100267132 Ga0075430_1002671322 99
412 3300006846 Ga0075430_101030802 Ga0075430_1010308022 99
413 3300006846 Ga0075430_101074181 Ga0075430_1010741812 99
414 3300006847 Ga0075431_100001687 Ga0075431_10000168718 99
415 3300006847 Ga0075431_100030494 Ga0075431_1000304944 99
416 3300006847 Ga0075431_100150391 Ga0075431_1001503912 99
417 3300006847 Ga0075431_100260488 Ga0075431_1002604884 99
418 3300006847 Ga0075431_101393331 Ga0075431_1013933312 99
419 3300006847 Ga0075431_101956526 Ga0075431_1019565262 99
420 3300006852 Ga0075433_10000839 Ga0075433_1000083918 99
421 3300006852 Ga0075433_10002893 Ga0075433_100028935 99
422 3300006852 Ga0075433_10005550 Ga0075433_100055506 99
423 3300006852 Ga0075433_10006319 Ga0075433_100063193 99
424 3300006852 Ga0075433_10027506 Ga0075433_100275063 99
425 3300006852 Ga0075433_10177914 Ga0075433_101779142 99
426 3300006852 Ga0075433_10281322 Ga0075433_102813222 99
427 3300006852 Ga0075433_11456901 Ga0075433_114569012 99
428 3300006871 Ga0075434_100001347 Ga0075434_10000134717 99
429 3300006871 Ga0075434_100032100 Ga0075434_1000321004 99
430 3300006871 Ga0075434_100040188 Ga0075434_1000401883 99
431 3300006871 Ga0075434_100105126 Ga0075434_1001051262 99
432 3300006871 Ga0075434_100109724 Ga0075434_1001097242 99
433 3300006871 Ga0075434_100120623 Ga0075434_1001206232 99
434 3300006871 Ga0075434_100260002 Ga0075434_1002600021 99
435 3300006871 Ga0075434_100322629 Ga0075434_1003226292 99
436 3300006871 Ga0075434_100457482 Ga0075434_1004574822 99
437 3300006871 Ga0075434_100492669 Ga0075434_1004926692 99
438 3300006871 Ga0075434_100507371 Ga0075434_1005073712 99
439 3300006871 Ga0075434_100994290 Ga0075434_1009942902 99
440 3300006871 Ga0075434_101671582 Ga0075434_1016715821 99
441 3300006880 Ga0075429_100015287 Ga0075429_1000152877 99
442 3300006880 Ga0075429_100023887 Ga0075429_1000238876 99
443 3300006880 Ga0075429_100064236 Ga0075429_1000642362 99
444 3300006880 Ga0075429_100187116 Ga0075429_1001871162 99
445 3300006880 Ga0075429_100196391 Ga0075429_1001963913 99
446 3300006880 Ga0075429_100219258 Ga0075429_1002192582 99
447 3300006880 Ga0075429_100448887 Ga0075429_1004488873 99
448 3300006880 Ga0075429_100473830 Ga0075429_1004738302 99
449 3300006880 Ga0075429_101935177 Ga0075429_1019351772 99
450 3300006881 Ga0068865_100025088 Ga0068865_1000250883 99
451 3300006881 Ga0068865_100057029 Ga0068865_1000570292 99
452 3300006881 Ga0068865_100157174 Ga0068865_1001571743 99
453 3300006881 Ga0068865_100480235 Ga0068865_1004802352 99
454 3300006881 Ga0068865_100507095 Ga0068865_1005070952 99
455 3300006914 Ga0075436_100319187 Ga0075436_1003191871 99
456 3300006914 Ga0075436_100441716 Ga0075436_1004417162 99
457 3300006931 Ga0097620_100046795 Ga0097620_1000467952 99
458 3300006931 Ga0097620_100074773 Ga0097620_1000747733 99
459 3300006931 Ga0097620_100102452 Ga0097620_1001024522 99
460 3300006931 Ga0097620_100436300 Ga0097620_1004363003 99
461 3300006931 Ga0097620_100491395 Ga0097620_1004913953 99
462 3300006931 Ga0097620_100692012 Ga0097620_1006920122 99
463 3300006931 Ga0097620_101528071 Ga0097620_1015280712 99
464 3300007076 Ga0075435_100008503 Ga0075435_1000085033 99
465 3300007076 Ga0075435_100039285 Ga0075435_1000392853 99
466 3300007076 Ga0075435_100055028 Ga0075435_1000550282 99
467 3300007076 Ga0075435_100063505 Ga0075435_1000635055 99
468 3300007076 Ga0075435_100103053 Ga0075435_1001030532 99
469 3300007076 Ga0075435_100139166 Ga0075435_1001391662 99
470 3300007076 Ga0075435_100177631 Ga0075435_1001776312 99
471 3300007076 Ga0075435_100464211 Ga0075435_1004642112 99
472 3300007076 Ga0075435_100593283 Ga0075435_1005932831 99
473 3300007076 Ga0075435_101886846 Ga0075435_1018868461 99
474 3300007265 Ga0099794_10004256 Ga0099794_100042565 99
475 3300007265 Ga0099794_10097975 Ga0099794_100979752 99
476 3300009093 Ga0105240_12187269 Ga0105240_121872691 99
477 3300009094 Ga0111539_10000463 Ga0111539_1000046354 99
478 3300009094 Ga0111539_10001789 Ga0111539_1000178916 99
479 3300009094 Ga0111539_10002439 Ga0111539_1000243916 99
480 3300009094 Ga0111539_10006594 Ga0111539_100065948 99
481 3300009094 Ga0111539_10012644 Ga0111539_1001264412 99
482 3300009094 Ga0111539_10099987 Ga0111539_100999873 99
483 3300009094 Ga0111539_10114103 Ga0111539_101141032 99
484 3300009094 Ga0111539_10152507 Ga0111539_101525073 99
485 3300009094 Ga0111539_10203254 Ga0111539_102032542 99
486 3300009094 Ga0111539_10300301 Ga0111539_103003012 99
487 3300009094 Ga0111539_10302283 Ga0111539_103022832 99
488 3300009094 Ga0111539_10480399 Ga0111539_104803992 99
489 3300009094 Ga0111539_10519714 Ga0111539_105197142 99
490 3300009094 Ga0111539_10784627 Ga0111539_107846272 99
491 3300009094 Ga0111539_11232907 Ga0111539_112329072 99
492 3300009094 Ga0111539_11254841 Ga0111539_112548411 99
493 3300009094 Ga0111539_11580791 Ga0111539_115807912 99
494 3300009094 Ga0111539_12675332 Ga0111539_126753322 99
495 3300009098 Ga0105245_10146503 Ga0105245_101465032 99
496 3300009098 Ga0105245_10180236 Ga0105245_101802363 99
497 3300009098 Ga0105245_10483565 Ga0105245_104835652 99
498 3300009098 Ga0105245_10529811 Ga0105245_105298112 99
499 3300009098 Ga0105245_11954895 Ga0105245_119548952 99
500 3300009101 Ga0105247_10816183 Ga0105247_108161832 99
501 3300009147 Ga0114129_10001511 Ga0114129_100015119 99
502 3300009147 Ga0114129_10003221 Ga0114129_1000322121 99
503 3300009147 Ga0114129_10025730 Ga0114129_100257304 99
504 3300009147 Ga0114129_10031560 Ga0114129_100315604 99
505 3300009147 Ga0114129_10054988 Ga0114129_100549883 99
506 3300009147 Ga0114129_10129219 Ga0114129_101292192 99
507 3300009147 Ga0114129_10211158 Ga0114129_102111584 99
508 3300009147 Ga0114129_10244796 Ga0114129_102447963 99
509 3300009147 Ga0114129_10271552 Ga0114129_102715522 99
510 3300009147 Ga0114129_10373446 Ga0114129_103734463 99
511 3300009147 Ga0114129_10382845 Ga0114129_103828452 99
512 3300009147 Ga0114129_10413676 Ga0114129_104136761 99
513 3300009147 Ga0114129_10610916 Ga0114129_106109162 99
514 3300009147 Ga0114129_11288975 Ga0114129_112889752 99
515 3300009147 Ga0114129_11884284 Ga0114129_118842842 99
516 3300009147 Ga0114129_12332620 Ga0114129_123326201 99
517 3300009147 Ga0114129_12471794 Ga0114129_124717942 99
518 3300009148 Ga0105243_10189089 Ga0105243_101890892 99
519 3300009148 Ga0105243_10218214 Ga0105243_102182143 99
520 3300009148 Ga0105243_10226498 Ga0105243_102264982 99
521 3300009148 Ga0105243_11068623 Ga0105243_110686232 99
522 3300009176 Ga0105242_10432658 Ga0105242_104326582 99
523 3300009177 Ga0105248_10090515 Ga0105248_100905155 99
524 3300009177 Ga0105248_10128201 Ga0105248_101282012 99
525 3300009177 Ga0105248_10133601 Ga0105248_101336013 99
526 3300009177 Ga0105248_12810120 Ga0105248_128101202 99
527 3300009551 Ga0105238_10384021 Ga0105238_103840212 99
528 3300009553 Ga0105249_10008153 Ga0105249_100081537 99
529 3300009553 Ga0105249_10018474 Ga0105249_100184744 99
530 3300009553 Ga0105249_10170834 Ga0105249_101708343 99
531 3300009553 Ga0105249_10171281 Ga0105249_101712812 99
532 3300009553 Ga0105249_11473945 Ga0105249_114739452 99
533 3300010375 Ga0105239_10387526 Ga0105239_103875262 99
534 3300010375 Ga0105239_13260376 Ga0105239_132603761 99
535 3300011119 Ga0105246_10038109 Ga0105246_100381093 99
536 3300011119 Ga0105246_10982167 Ga0105246_109821672 99
537 3300012505 Ga0157339_1042486 Ga0157339_10424861 99
538 3300012506 Ga0157324_1049104 Ga0157324_10491042 99
539 3300013102 Ga0157371_10173274 Ga0157371_101732741 99
540 3300013102 Ga0157371_10263672 Ga0157371_102636722 99
541 3300013296 Ga0157374_10284132 Ga0157374_102841322 99
542 3300013297 Ga0157378_10137339 Ga0157378_101373391 99
543 3300013297 Ga0157378_10222809 Ga0157378_102228092 99
544 3300013297 Ga0157378_11459389 Ga0157378_114593891 99
545 3300013306 Ga0163162_10055861 Ga0163162_100558616 99
546 3300013306 Ga0163162_10148124 Ga0163162_101481242 99
547 3300013306 Ga0163162_10219016 Ga0163162_102190163 99
548 3300013306 Ga0163162_10327365 Ga0163162_103273652 99
549 3300013306 Ga0163162_10557886 Ga0163162_105578861 99
550 3300013306 Ga0163162_10905775 Ga0163162_109057752 99
551 3300013306 Ga0163162_12073617 Ga0163162_120736172 99
552 3300013308 Ga0157375_10090064 Ga0157375_100900642 99
553 3300013308 Ga0157375_10255663 Ga0157375_102556632 99
554 3300013308 Ga0157375_10646215 Ga0157375_106462152 99
555 3300013308 Ga0157375_10736668 Ga0157375_107366682 99
556 3300013308 Ga0157375_10938618 Ga0157375_109386182 99
557 3300013308 Ga0157375_11184520 Ga0157375_111845202 99
558 3300014325 Ga0163163_10025725 Ga0163163_100257252 99
559 3300014325 Ga0163163_10710865 Ga0163163_107108652 99
560 3300014325 Ga0163163_11617471 Ga0163163_116174711 99
561 3300014326 Ga0157380_10003226 Ga0157380_100032265 99
562 3300014326 Ga0157380_10124967 Ga0157380_101249673 99
563 3300014326 Ga0157380_10152244 Ga0157380_101522441 99
564 3300014326 Ga0157380_10236682 Ga0157380_102366822 99
565 3300014326 Ga0157380_10251829 Ga0157380_102518292 99
566 3300014326 Ga0157380_10311765 Ga0157380_103117652 99
567 3300014326 Ga0157380_10450940 Ga0157380_104509402 99
568 3300014326 Ga0157380_13233172 Ga0157380_132331721 99
569 3300014745 Ga0157377_10005724 Ga0157377_100057244 99
570 3300014745 Ga0157377_10055331 Ga0157377_100553312 99
571 3300014745 Ga0157377_10191641 Ga0157377_101916412 99
572 3300014745 Ga0157377_10501305 Ga0157377_105013052 99
573 3300014745 Ga0157377_11187905 Ga0157377_111879052 99
574 3300014968 Ga0157379_10422569 Ga0157379_104225692 99
575 3300014968 Ga0157379_12464871 Ga0157379_124648711 99
576 3300014969 Ga0157376_10453181 Ga0157376_104531812 99
577 3300014969 Ga0157376_10485717 Ga0157376_104857172 99
578 3300014969 Ga0157376_10511408 Ga0157376_105114082 99
579 3300017792 Ga0163161_10058861 Ga0163161_100588612 99
580 3300017792 Ga0163161_10484093 Ga0163161_104840932 99
581 3300017792 Ga0163161_11704090 Ga0163161_117040902 99
582 3300025315 Ga0207697_10001435 Ga0207697_100014357 99
583 3300025315 Ga0207697_10031538 Ga0207697_100315382 99
584 3300025885 Ga0207653_10067691 Ga0207653_100676911 99
585 3300025885 Ga0207653_10088143 Ga0207653_100881433 99
586 3300025885 Ga0207653_10094861 Ga0207653_100948612 99
587 3300025893 Ga0207682_10015059 Ga0207682_100150592 99
588 3300025893 Ga0207682_10130382 Ga0207682_101303822 99
589 3300025899 Ga0207642_10048892 Ga0207642_100488922 99
590 3300025901 Ga0207688_10001607 Ga0207688_100016074 99
591 3300025901 Ga0207688_10025562 Ga0207688_100255624 99
592 3300025903 Ga0207680_10023261 Ga0207680_100232615 99
593 3300025903 Ga0207680_10054725 Ga0207680_100547253 99
594 3300025903 Ga0207680_10091937 Ga0207680_100919372 99
595 3300025904 Ga0207647_10547238 Ga0207647_105472382 99
596 3300025905 Ga0207685_10226730 Ga0207685_102267301 99
597 3300025907 Ga0207645_10008679 Ga0207645_100086794 99
598 3300025907 Ga0207645_10032645 Ga0207645_100326454 99
599 3300025907 Ga0207645_10172604 Ga0207645_101726043 99
600 3300025908 Ga0207643_10000732 Ga0207643_100007324 99
601 3300025908 Ga0207643_10016610 Ga0207643_100166103 99
602 3300025908 Ga0207643_10052943 Ga0207643_100529432 99
603 3300025908 Ga0207643_10094574 Ga0207643_100945741 99
604 3300025908 Ga0207643_10218456 Ga0207643_102184562 99
605 3300025910 Ga0207684_10030947 Ga0207684_100309473 99
606 3300025910 Ga0207684_10084506 Ga0207684_100845062 99
607 3300025910 Ga0207684_10471456 Ga0207684_104714562 99
608 3300025910 Ga0207684_10638079 Ga0207684_106380792 99
609 3300025912 Ga0207707_10184798 Ga0207707_101847982 99
610 3300025912 Ga0207707_10760510 Ga0207707_107605102 99
611 3300025915 Ga0207693_10407794 Ga0207693_104077942 99
612 3300025916 Ga0207663_11084288 Ga0207663_110842881 99
613 3300025917 Ga0207660_10432334 Ga0207660_104323342 99
614 3300025917 Ga0207660_10614139 Ga0207660_106141392 99
615 3300025918 Ga0207662_10000891 Ga0207662_1000089111 99
616 3300025918 Ga0207662_10039826 Ga0207662_100398264 99
617 3300025918 Ga0207662_10155036 Ga0207662_101550363 99
618 3300025919 Ga0207657_10454193 Ga0207657_104541932 99
619 3300025920 Ga0207649_10111059 Ga0207649_101110592 99
620 3300025920 Ga0207649_10158827 Ga0207649_101588273 99
621 3300025921 Ga0207652_10614889 Ga0207652_106148892 99
622 3300025921 Ga0207652_11472205 Ga0207652_114722052 99
623 3300025922 Ga0207646_10161550 Ga0207646_101615502 99
624 3300025922 Ga0207646_10163787 Ga0207646_101637872 99
625 3300025922 Ga0207646_10360712 Ga0207646_103607122 99
626 3300025922 Ga0207646_10385565 Ga0207646_103855652 99
627 3300025922 Ga0207646_10483532 Ga0207646_104835323 99
628 3300025922 Ga0207646_10524185 Ga0207646_105241852 99
629 3300025922 Ga0207646_10754954 Ga0207646_107549542 99
630 3300025922 Ga0207646_10808486 Ga0207646_108084862 99
631 3300025922 Ga0207646_11249739 Ga0207646_112497392 99
632 3300025923 Ga0207681_10004865 Ga0207681_100048652 99
633 3300025923 Ga0207681_10008334 Ga0207681_100083345 99
634 3300025923 Ga0207681_10066116 Ga0207681_100661164 99
635 3300025923 Ga0207681_10131785 Ga0207681_101317853 99
636 3300025923 Ga0207681_10376233 Ga0207681_103762332 99
637 3300025923 Ga0207681_10412966 Ga0207681_104129662 99
638 3300025923 Ga0207681_10674185 Ga0207681_106741852 99
639 3300025923 Ga0207681_10914367 Ga0207681_109143671 99
640 3300025925 Ga0207650_10017271 Ga0207650_100172712 99
641 3300025925 Ga0207650_10372758 Ga0207650_103727582 99
642 3300025925 Ga0207650_10457803 Ga0207650_104578032 99
643 3300025925 Ga0207650_11282048 Ga0207650_112820481 99
644 3300025926 Ga0207659_10002998 Ga0207659_100029982 99
645 3300025926 Ga0207659_10003928 Ga0207659_100039284 99
646 3300025926 Ga0207659_10010902 Ga0207659_100109027 99
647 3300025926 Ga0207659_10051272 Ga0207659_100512725 99
648 3300025926 Ga0207659_10057795 Ga0207659_100577952 99
649 3300025926 Ga0207659_10157104 Ga0207659_101571042 99
650 3300025926 Ga0207659_10291501 Ga0207659_102915012 99
651 3300025926 Ga0207659_10678745 Ga0207659_106787452 99
652 3300025927 Ga0207687_10268549 Ga0207687_102685492 99
653 3300025927 Ga0207687_10441460 Ga0207687_104414601 99
654 3300025927 Ga0207687_10514328 Ga0207687_105143281 99
655 3300025931 Ga0207644_10040212 Ga0207644_100402124 99
656 3300025931 Ga0207644_10380470 Ga0207644_103804702 99
657 3300025931 Ga0207644_10590966 Ga0207644_105909662 99
658 3300025931 Ga0207644_11133080 Ga0207644_111330802 99
659 3300025933 Ga0207706_10058439 Ga0207706_100584393 99
660 3300025933 Ga0207706_10068582 Ga0207706_100685823 99
661 3300025933 Ga0207706_10160764 Ga0207706_101607642 99
662 3300025933 Ga0207706_10196924 Ga0207706_101969244 99
663 3300025933 Ga0207706_10693258 Ga0207706_106932582 99
664 3300025934 Ga0207686_10169311 Ga0207686_101693113 99
665 3300025934 Ga0207686_10596343 Ga0207686_105963431 99
666 3300025935 Ga0207709_10141615 Ga0207709_101416153 99
667 3300025935 Ga0207709_10160309 Ga0207709_101603092 99
668 3300025935 Ga0207709_10171488 Ga0207709_101714882 99
669 3300025936 Ga0207670_10181069 Ga0207670_101810694 99
670 3300025936 Ga0207670_10184352 Ga0207670_101843522 99
671 3300025936 Ga0207670_10337921 Ga0207670_103379212 99
672 3300025937 Ga0207669_10103922 Ga0207669_101039223 99
673 3300025937 Ga0207669_10179197 Ga0207669_101791971 99
674 3300025937 Ga0207669_10339106 Ga0207669_103391062 99
675 3300025937 Ga0207669_10564216 Ga0207669_105642162 99
676 3300025937 Ga0207669_11505596 Ga0207669_115055962 99
677 3300025938 Ga0207704_10109826 Ga0207704_101098262 99
678 3300025938 Ga0207704_10182352 Ga0207704_101823522 99
679 3300025939 Ga0207665_10007130 Ga0207665_100071304 99
680 3300025940 Ga0207691_10010524 Ga0207691_100105245 99
681 3300025940 Ga0207691_10106017 Ga0207691_101060173 99
682 3300025940 Ga0207691_10114519 Ga0207691_101145193 99
683 3300025940 Ga0207691_10230449 Ga0207691_102304492 99
684 3300025940 Ga0207691_10819835 Ga0207691_108198351 99
685 3300025941 Ga0207711_10082589 Ga0207711_100825892 99
686 3300025941 Ga0207711_10105501 Ga0207711_101055012 99
687 3300025941 Ga0207711_10578188 Ga0207711_105781882 99
688 3300025942 Ga0207689_10006142 Ga0207689_100061429 99
689 3300025942 Ga0207689_10044373 Ga0207689_100443735 99
690 3300025942 Ga0207689_10046149 Ga0207689_100461495 99
691 3300025942 Ga0207689_10183265 Ga0207689_101832652 99
692 3300025942 Ga0207689_10208497 Ga0207689_102084972 99
693 3300025942 Ga0207689_10906838 Ga0207689_109068381 99
694 3300025942 Ga0207689_10907973 Ga0207689_109079732 99
695 3300025944 Ga0207661_10082731 Ga0207661_100827313 99
696 3300025944 Ga0207661_11002771 Ga0207661_110027712 99
697 3300025945 Ga0207679_10010677 Ga0207679_100106779 99
698 3300025945 Ga0207679_10123508 Ga0207679_101235082 99
699 3300025945 Ga0207679_10329701 Ga0207679_103297012 99
700 3300025945 Ga0207679_10354593 Ga0207679_103545932 99
701 3300025945 Ga0207679_11243163 Ga0207679_112431632 99
702 3300025960 Ga0207651_10030607 Ga0207651_100306075 99
703 3300025960 Ga0207651_10072361 Ga0207651_100723613 99
704 3300025960 Ga0207651_10121224 Ga0207651_101212244 99
705 3300025960 Ga0207651_10356488 Ga0207651_103564883 99
706 3300025960 Ga0207651_10534526 Ga0207651_105345262 99
707 3300025960 Ga0207651_10696310 Ga0207651_106963102 99
708 3300025960 Ga0207651_10719901 Ga0207651_107199012 99
709 3300025961 Ga0207712_10135770 Ga0207712_101357704 99
710 3300025961 Ga0207712_10194380 Ga0207712_101943803 99
711 3300025961 Ga0207712_10584556 Ga0207712_105845563 99
712 3300025972 Ga0207668_10016771 Ga0207668_100167714 99
713 3300025972 Ga0207668_10211429 Ga0207668_102114292 99
714 3300025981 Ga0207640_10020989 Ga0207640_100209893 99
715 3300025981 Ga0207640_10058881 Ga0207640_100588812 99
716 3300025986 Ga0207658_10078126 Ga0207658_100781263 99
717 3300025986 Ga0207658_10167120 Ga0207658_101671201 99
718 3300025986 Ga0207658_10308506 Ga0207658_103085062 99
719 3300025986 Ga0207658_11276202 Ga0207658_112762022 99
720 3300026035 Ga0207703_10029241 Ga0207703_100292412 99
721 3300026035 Ga0207703_10113861 Ga0207703_101138611 99
722 3300026035 Ga0207703_10338812 Ga0207703_103388123 99
723 3300026035 Ga0207703_10519059 Ga0207703_105190592 99
724 3300026041 Ga0207639_10927307 Ga0207639_109273072 99
725 3300026041 Ga0207639_10929610 Ga0207639_109296102 99
726 3300026067 Ga0207678_11632290 Ga0207678_116322902 99
727 3300026075 Ga0207708_10012722 Ga0207708_100127228 99
728 3300026075 Ga0207708_10093271 Ga0207708_100932711 99
729 3300026075 Ga0207708_10181902 Ga0207708_101819022 99
730 3300026075 Ga0207708_10183062 Ga0207708_101830622 99
731 3300026075 Ga0207708_10234878 Ga0207708_102348782 99
732 3300026075 Ga0207708_10292117 Ga0207708_102921173 99
733 3300026075 Ga0207708_10293292 Ga0207708_102932922 99
734 3300026088 Ga0207641_10058835 Ga0207641_100588352 99
735 3300026088 Ga0207641_10110548 Ga0207641_101105482 99
736 3300026088 Ga0207641_10215059 Ga0207641_102150592 99
737 3300026088 Ga0207641_10391301 Ga0207641_103913013 99
738 3300026088 Ga0207641_10604914 Ga0207641_106049143 99
739 3300026088 Ga0207641_12329168 Ga0207641_123291682 99
740 3300026088 Ga0207641_12601614 Ga0207641_126016142 99
741 3300026089 Ga0207648_10033849 Ga0207648_100338494 99
742 3300026089 Ga0207648_10087451 Ga0207648_100874512 99
743 3300026089 Ga0207648_10150282 Ga0207648_101502822 99
744 3300026095 Ga0207676_10048586 Ga0207676_100485865 99
745 3300026095 Ga0207676_10062298 Ga0207676_100622984 99
746 3300026095 Ga0207676_10523081 Ga0207676_105230812 99
747 3300026116 Ga0207674_10073397 Ga0207674_100733973 99
748 3300026116 Ga0207674_10244843 Ga0207674_102448432 99
749 3300026116 Ga0207674_10276266 Ga0207674_102762662 99
750 3300026116 Ga0207674_10369070 Ga0207674_103690702 99
751 3300026116 Ga0207674_10395006 Ga0207674_103950062 99
752 3300026118 Ga0207675_100000947 Ga0207675_10000094724 99
753 3300026118 Ga0207675_100012281 Ga0207675_10001228111 99
754 3300026118 Ga0207675_100093252 Ga0207675_1000932523 99
755 3300026118 Ga0207675_100173853 Ga0207675_1001738532 99
756 3300026118 Ga0207675_100211179 Ga0207675_1002111794 99
757 3300026118 Ga0207675_101912130 Ga0207675_1019121301 99
758 3300026121 Ga0207683_10007833 Ga0207683_100078334 99
759 3300026121 Ga0207683_10050501 Ga0207683_100505012 99
760 3300026121 Ga0207683_10141601 Ga0207683_101416012 99
761 3300026121 Ga0207683_10430262 Ga0207683_104302623 99
762 3300026142 Ga0207698_11649866 Ga0207698_116498662 99
763 3300027471 Ga0209995_1081825 Ga0209995_10818252 99
764 3300027671 Ga0209588_1005595 Ga0209588_10055953 99
765 3300027671 Ga0209588_1048902 Ga0209588_10489022 99
766 3300027717 Ga0209998_10129991 Ga0209998_101299912 99
767 3300027717 Ga0209998_10150856 Ga0209998_101508562 99
768 3300027907 Ga0207428_10000245 Ga0207428_1000024539 99
769 3300027907 Ga0207428_10000849 Ga0207428_1000084919 99
770 3300027907 Ga0207428_10005064 Ga0207428_1000506413 99
771 3300027907 Ga0207428_10007874 Ga0207428_1000787411 99
772 3300027907 Ga0207428_10008043 Ga0207428_100080435 99
773 3300027907 Ga0207428_10020343 Ga0207428_100203432 99
774 3300027907 Ga0207428_10092168 Ga0207428_100921682 99
775 3300027907 Ga0207428_10914374 Ga0207428_109143742 99
776 3300028379 Ga0268266_10437784 Ga0268266_104377843 99
777 3300028379 Ga0268266_11723356 Ga0268266_117233562 99
778 3300028380 Ga0268265_10007675 Ga0268265_100076757 99
779 3300028380 Ga0268265_10018708 Ga0268265_100187084 99
780 3300028380 Ga0268265_10031665 Ga0268265_100316652 99
781 3300028380 Ga0268265_10161847 Ga0268265_101618472 99
782 3300028380 Ga0268265_11777409 Ga0268265_117774091 99
783 3300028381 Ga0268264_10075993 Ga0268264_100759933 99
784 3300028381 Ga0268264_10113298 Ga0268264_101132982 99
785 3300028381 Ga0268264_10127853 Ga0268264_101278534 99
786 3300028381 Ga0268264_10254504 Ga0268264_102545042 99
787 3300028381 Ga0268264_10561589 Ga0268264_105615892 99
788 3300028381 Ga0268264_10824501 Ga0268264_108245012 99
789 3300028381 Ga0268264_10946128 Ga0268264_109461282 99
790 3300028381 Ga0268264_11183455 Ga0268264_111834552 99
791 3300031548 Ga0307408_100205223 Ga0307408_1002052232 99
792 3300031548 Ga0307408_100945535 Ga0307408_1009455352 99
793 3300031731 Ga0307405_10123246 Ga0307405_101232462 99
794 3300031731 Ga0307405_10915101 Ga0307405_109151012 99
795 3300031731 Ga0307405_11949433 Ga0307405_119494332 99
796 3300031824 Ga0307413_10391913 Ga0307413_103919132 99
797 3300031901 Ga0307406_10485606 Ga0307406_104856062 99
798 3300031911 Ga0307412_10288160 Ga0307412_102881603 99
799 3300031911 Ga0307412_10715555 Ga0307412_107155552 99
800 3300031911 Ga0307412_11693710 Ga0307412_116937102 99
801 3300031995 Ga0307409_100445183 Ga0307409_1004451833 99
802 3300031995 Ga0307409_102783271 Ga0307409_1027832712 99
803 3300032002 Ga0307416_100251533 Ga0307416_1002515332 99
804 3300032002 Ga0307416_100745093 Ga0307416_1007450932 99
805 3300032004 Ga0307414_11400291 Ga0307414_114002912 99
806 3300032005 Ga0307411_11132852 Ga0307411_111328522 99
807 3300032005 Ga0307411_12238295 Ga0307411_122382951 99
808 3300032126 Ga0307415_100221167 Ga0307415_1002211672 99
809 3300032126 Ga0307415_101115443 Ga0307415_1011154432 99
810 3300034816 Ga0373930_0209875 Ga0373930_0209875_153_452 99
811 3300034818 Ga0373950_0027984 Ga0373950_0027984_335_637 99
812 3300034819 Ga0373958_0048755 Ga0373958_0048755_131_430 99
813 3300034820 Ga0373959_0175564 Ga0373959_0175564_228_527 99
814 3300034957 Ga0373938_0170143 Ga0373938_0170143_113_412 99
815 3300035083 Ga0373926_0294007 Ga0373926_0294007_193_492 99
816 3300035084 Ga0373928_0113764 Ga0373928_0113764_353_652 99
817 3300035085 Ga0373929_0055139 Ga0373929_0055139_551_850 99
818 3300035088 Ga0373940_0014879 Ga0373940_0014879_365_664 99
819 3300035088 Ga0373940_0060180 Ga0373940_0060180_261_560 99
820 3300035090 Ga0373949_0265966 Ga0373949_0265966_224_523 99
821 3300035092 Ga0373952_0052533 Ga0373952_0052533_261_560 99
822 3300035092 Ga0373952_0117428 Ga0373952_0117428_326_625 99
823 3300035112 Ga0373932_0052326 Ga0373932_0052326_10_309 99
824 3300035114 Ga0373939_0025212 Ga0373939_0025212_463_762 99
825 3300035114 Ga0373939_0532840 Ga0373939_0532840_51_350 99
826 3300035117 Ga0373953_0245737 Ga0373953_0245737_81_386 99
827 3300035121 Ga0373960_0099627 Ga0373960_0099627_115_414 99
828 3300035207 Ga0373942_0180712 Ga0373942_0180712_227_526 99
829 3300035242 Ga0373962_0067457 Ga0373962_0067457_188_487 99
830 3300035691 Ga0373931_0081609 Ga0373931_0081609_1297_1596 99
831 3300035691 Ga0373931_0133132 Ga0373931_0133132_678_977 99
832 3300035692 Ga0373935_0256656 Ga0373935_0256656_780_1085 99
833 3300035725 Ga0373947_0955651 Ga0373947_0955651_17_322 99
834 3300036401 Ga0373937_0025681 Ga0373937_0025681_4021_4326 99
835 3300037068 Ga0373925_0560631 Ga0373925_0560631_178_483 99
836 3300041404 Ga0439436_0076849 Ga0439436_0076849_173_472 99
837 3300041406 Ga0439439_0189547 Ga0439439_0189547_44_343 99
838 3300041408 Ga0439453_0011997 Ga0439453_0011997_1135_1434 99
839 3300041997 Ga0439431_0270420 Ga0439431_0270420_28_327 99
840 3300042008 Ga0439450_062070 Ga0439450_062070_318_617 99
841 3300042012 Ga0439455_0112882 Ga0439455_0112882_302_601 99
842 3300042012 Ga0439455_0173809 Ga0439455_0173809_191_490 99
843 3300042014 Ga0439457_023617 Ga0439457_023617_266_565 99
844 3300042130 Ga0450892_015169 Ga0450892_015169_152_451 99
845 3300042133 Ga0450896_072453 Ga0450896_072453_89_388 99
846 3300042435 Ga0439434_0318086 Ga0439434_0318086_223_522 99
847 3300042435 Ga0439434_0365699 Ga0439434_0365699_63_362 99
848 3300042436 Ga0439435_0041885 Ga0439435_0041885_265_564 99
849 3300042436 Ga0439435_0080982 Ga0439435_0080982_456_755 99
850 3300042436 Ga0439435_0244752 Ga0439435_0244752_217_516 99
851 3300042437 Ga0439444_0046250 Ga0439444_0046250_453_752 99
852 3300042438 Ga0439459_0028451 Ga0439459_0028451_357_656 99
853 3300042461 Ga0439460_0284332 Ga0439460_0284332_180_479 99
854 3300042461 Ga0439460_0329560 Ga0439460_0329560_218_517 99
855 3300042461 Ga0439460_0378904 Ga0439460_0378904_152_451 99
856 3300042876 Ga0451577_0014387 Ga0451577_0014387_6675_6998 99
857 3300042876 Ga0451577_0335791 Ga0451577_0335791_944_1243 99
858 3300042876 Ga0451577_0435081 Ga0451577_0435081_573_872 99
859 3300042993 Ga0439440_0013716 Ga0439440_0013716_704_1003 99
860 3300042993 Ga0439440_0150235 Ga0439440_0150235_259_558 99
861 3300042993 Ga0439440_0197963 Ga0439440_0197963_53_352 99
862 3300044673 Ga0453683_0034615 Ga0453683_0034615_814_1113 99
863 3300044673 Ga0453683_0921676 Ga0453683_0921676_32_331 99
864 3300044712 Ga0453684_0023625 Ga0453684_0023625_2128_2451 99
865 3300045051 Ga0451576_0004364 Ga0451576_0004364_7727_8050 99
866 3300045051 Ga0451576_0012148 Ga0451576_0012148_4671_4970 99
867 3300045051 Ga0451576_0030406 Ga0451576_0030406_2554_2853 99
868 3300045051 Ga0451576_0031179 Ga0451576_0031179_4405_4704 99
869 3300045051 Ga0451576_0104360 Ga0451576_0104360_1517_1840 99
870 3300045051 Ga0451576_0117028 Ga0451576_0117028_1624_1923 99
871 3300045051 Ga0451576_0172853 Ga0451576_0172853_1902_2201 99
872 3300045051 Ga0451576_0638681 Ga0451576_0638681_758_1057 99
873 3300045051 Ga0451576_2225671 Ga0451576_2225671_208_507 99
874 3300046455 Ga0495603_0159384 Ga0495603_0159384_89_388 99
875 3300046455 Ga0495603_0200936 Ga0495603_0200936_18_317 99
876 3300046459 Ga0495629_0038310 Ga0495629_0038310_1224_1523 99
877 3300046472 Ga0495580_0303417 Ga0495580_0303417_261_560 99
878 3300046472 Ga0495580_0908600 Ga0495580_0908600_42_341 99
879 3300046473 Ga0495582_0097077 Ga0495582_0097077_520_825 99
880 3300046491 Ga0495584_0042121 Ga0495584_0042121_988_1287 99
881 3300046491 Ga0495584_0074113 Ga0495584_0074113_232_531 99
882 3300046491 Ga0495584_0252618 Ga0495584_0252618_100_399 99
883 3300046491 Ga0495584_0263029 Ga0495584_0263029_355_654 99
884 3300046499 Ga0495594_0105565 Ga0495594_0105565_917_1216 99
885 3300046520 Ga0495637_0244212 Ga0495637_0244212_207_506 99
886 3300046523 Ga0495644_0085525 Ga0495644_0085525_634_933 99
887 3300046523 Ga0495644_0205021 Ga0495644_0205021_29_328 99
888 3300046525 Ga0495663_0052971 Ga0495663_0052971_714_1013 99
889 3300046525 Ga0495663_0162149 Ga0495663_0162149_429_728 99
890 3300046526 Ga0495666_0167028 Ga0495666_0167028_104_403 99
891 3300046528 Ga0495642_0151091 Ga0495642_0151091_219_518 99
892 3300046529 Ga0495652_0252243 Ga0495652_0252243_202_507 99
893 3300046537 Ga0495598_0021116 Ga0495598_0021116_354_653 99
894 3300046537 Ga0495598_0051423 Ga0495598_0051423_184_483 99
895 3300046537 Ga0495598_0064086 Ga0495598_0064086_824_1123 99
896 3300046537 Ga0495598_0228776 Ga0495598_0228776_284_583 99
897 3300046538 Ga0495609_0078948 Ga0495609_0078948_290_589 99
898 3300046538 Ga0495609_0187020 Ga0495609_0187020_141_440 99
899 3300046538 Ga0495609_0199273 Ga0495609_0199273_508_807 99
900 3300046539 Ga0495621_0003683 Ga0495621_0003683_1187_1486 99
901 3300046539 Ga0495621_0052370 Ga0495621_0052370_885_1184 99
902 3300046539 Ga0495621_0199038 Ga0495621_0199038_363_662 99
903 3300046539 Ga0495621_0304421 Ga0495621_0304421_23_322 99
904 3300046539 Ga0495621_0364702 Ga0495621_0364702_160_459 99
905 3300046543 Ga0495645_0342825 Ga0495645_0342825_136_441 99
906 3300046615 Ga0495656_0536881 Ga0495656_0536881_218_517 99
907 3300046648 Ga0495611_0411343 Ga0495611_0411343_259_558 99
908 3300046663 Ga0495635_0533360 Ga0495635_0533360_388_693 99
909 3300046664 Ga0495659_0020386 Ga0495659_0020386_1347_1646 99
910 3300046664 Ga0495659_0030413 Ga0495659_0030413_77_376 99
911 3300046664 Ga0495659_0121840 Ga0495659_0121840_59_358 99
912 3300046664 Ga0495659_0151520 Ga0495659_0151520_46_345 99
913 3300046664 Ga0495659_0212478 Ga0495659_0212478_158_457 99
914 3300046674 Ga0495588_0008264 Ga0495588_0008264_1387_1734 99
915 3300046675 Ga0495657_0748330 Ga0495657_0748330_72_377 99
916 3300046679 Ga0495623_0117341 Ga0495623_0117341_419_724 99
917 3300046683 Ga0495658_0232783 Ga0495658_0232783_62_361 99
918 3300046683 Ga0495658_0597804 Ga0495658_0597804_240_545 99
919 3300046684 Ga0495669_0005624 Ga0495669_0005624_4820_5119 99
920 3300046684 Ga0495669_0046114 Ga0495669_0046114_400_699 99
921 3300046684 Ga0495669_0131328 Ga0495669_0131328_629_928 99
922 3300046684 Ga0495669_0269978 Ga0495669_0269978_238_537 99
923 3300046691 Ga0495670_0291499 Ga0495670_0291499_54_353 99
924 3300046794 Ga0495589_0362937 Ga0495589_0362937_199_498 99
925 3300047315 Ga0495581_0482659 Ga0495581_0482659_83_382 99
926 3300047318 Ga0495636_0038084 Ga0495636_0038084_929_1228 99
927 3300047318 Ga0495636_0039285 Ga0495636_0039285_199_498 99
928 3300047318 Ga0495636_0353942 Ga0495636_0353942_227_529 99
929 3300047318 Ga0495636_0594235 Ga0495636_0594235_139_438 99
930 3300047321 Ga0495676_0115037 Ga0495676_0115037_864_1163 99
931 3300047447 Ga0495685_040988 Ga0495685_040988_1145_1444 99
932 3300048905 Ga0496102_0437284 Ga0496102_0437284_204_503 99
933 3300048905 Ga0496102_1963868 Ga0496102_1963868_112_411 99
934 3300048909 Ga0496106_1378713 Ga0496106_1378713_221_520 99
935 3300048911 Ga0496108_0375576 Ga0496108_0375576_471_770 99
936 3300048912 Ga0496109_0959963 Ga0496109_0959963_160_459 99
937 3300048913 Ga0496110_1786219 Ga0496110_1786219_104_403 99
938 3300048915 Ga0496112_0353005 Ga0496112_0353005_10_309 99
939 3300049521 Ga0501298_049216 Ga0501298_049216_350_649 99
940 3300049521 Ga0501298_185005 Ga0501298_185005_34_333 99
941 3300049568 Ga0501031_0595100 Ga0501031_0595100_131_430 99
942 3300049569 Ga0501032_0129204 Ga0501032_0129204_686_985 99
943 3300049570 Ga0501033_0072873 Ga0501033_0072873_1566_1865 99
944 3300049570 Ga0501033_0341788 Ga0501033_0341788_459_758 99
945 3300049570 Ga0501033_0643509 Ga0501033_0643509_309_608 99
946 3300049572 Ga0501036_0180638 Ga0501036_0180638_44_343 99
947 3300049572 Ga0501036_0314202 Ga0501036_0314202_568_867 99
948 3300049572 Ga0501036_1132772 Ga0501036_1132772_263_568 99
949 3300049573 Ga0501037_0141437 Ga0501037_0141437_1097_1396 99
950 3300049574 Ga0501038_0222702 Ga0501038_0222702_550_849 99
951 3300049574 Ga0501038_0323348 Ga0501038_0323348_485_784 99
952 3300049575 Ga0501039_0185201 Ga0501039_0185201_267_566 99
953 3300049576 Ga0501040_0016751 Ga0501040_0016751_549_848 99
954 3300049576 Ga0501040_0258346 Ga0501040_0258346_70_369 99
955 3300049576 Ga0501040_0533205 Ga0501040_0533205_533_832 99
956 3300049576 Ga0501040_0613235 Ga0501040_0613235_139_438 99
957 3300049576 Ga0501040_0639500 Ga0501040_0639500_224_523 99
958 3300049576 Ga0501040_0949882 Ga0501040_0949882_64_363 99
959 3300049577 Ga0501041_0013891 Ga0501041_0013891_4460_4759 99
960 3300049577 Ga0501041_0081995 Ga0501041_0081995_1592_1891 99
961 3300049577 Ga0501041_0128864 Ga0501041_0128864_1174_1473 99
962 3300049577 Ga0501041_0514788 Ga0501041_0514788_282_587 99
963 3300049578 Ga0501042_0018095 Ga0501042_0018095_964_1263 99
964 3300049578 Ga0501042_0608006 Ga0501042_0608006_60_359 99
965 3300049578 Ga0501042_1022494 Ga0501042_1022494_291_590 99
966 3300049579 Ga0501043_0812819 Ga0501043_0812819_324_623 99
967 3300049579 Ga0501043_1032799 Ga0501043_1032799_202_501 99
968 3300049580 Ga0501046_0043652 Ga0501046_0043652_1278_1577 99
969 3300049580 Ga0501046_1049487 Ga0501046_1049487_171_470 99
970 3300049582 Ga0501048_0100635 Ga0501048_0100635_732_1031 99
971 3300049582 Ga0501048_0383048 Ga0501048_0383048_57_356 99
972 3300049583 Ga0501067_0013133 Ga0501067_0013133_2524_2823 99
973 3300049584 Ga0501068_0378009 Ga0501068_0378009_527_826 99
974 3300049587 Ga0501071_0674889 Ga0501071_0674889_423_722 99
975 3300049587 Ga0501071_0913561 Ga0501071_0913561_309_608 99
976 3300049587 Ga0501071_0978048 Ga0501071_0978048_311_610 99
977 3300049588 Ga0501072_0023580 Ga0501072_0023580_3783_4082 99
978 3300049588 Ga0501072_0205886 Ga0501072_0205886_911_1210 99
979 3300049588 Ga0501072_0471767 Ga0501072_0471767_415_714 99
980 3300049588 Ga0501072_0481614 Ga0501072_0481614_404_703 99
981 3300049588 Ga0501072_1224456 Ga0501072_1224456_77_376 99
982 3300049588 Ga0501072_1527880 Ga0501072_1527880_152_451 99
983 3300049589 Ga0501073_0443041 Ga0501073_0443041_52_351 99
984 3300049589 Ga0501073_0537297 Ga0501073_0537297_443_742 99
985 3300049589 Ga0501073_0761748 Ga0501073_0761748_145_444 99
986 3300049590 Ga0501074_0149705 Ga0501074_0149705_748_1047 99
987 3300049590 Ga0501074_0256259 Ga0501074_0256259_467_766 99
988 3300049590 Ga0501074_0268468 Ga0501074_0268468_516_815 99
989 3300049590 Ga0501074_0585410 Ga0501074_0585410_290_589 99
990 3300049591 Ga0501075_0007121 Ga0501075_0007121_1742_2041 99
991 3300049591 Ga0501075_0032800 Ga0501075_0032800_839_1138 99
992 3300049591 Ga0501075_0071628 Ga0501075_0071628_474_773 99
993 3300049591 Ga0501075_0174421 Ga0501075_0174421_1330_1629 99
994 3300049591 Ga0501075_0321000 Ga0501075_0321000_418_720 99
995 3300049592 Ga0501076_0034754 Ga0501076_0034754_1796_2095 99
996 3300049592 Ga0501076_0065728 Ga0501076_0065728_1228_1527 99
997 3300049592 Ga0501076_0082643 Ga0501076_0082643_1871_2170 99
998 3300049592 Ga0501076_0108317 Ga0501076_0108317_657_956 99
999 3300049592 Ga0501076_0462350 Ga0501076_0462350_610_909 99
1000 3300049592 Ga0501076_0782493 Ga0501076_0782493_112_411 99
1001 3300049593 Ga0501077_0009200 Ga0501077_0009200_43_342 99
1002 3300049593 Ga0501077_0301894 Ga0501077_0301894_530_829 99
1003 3300049593 Ga0501077_0313668 Ga0501077_0313668_11_316 99
1004 3300049593 Ga0501077_0477705 Ga0501077_0477705_195_494 99
1005 3300049593 Ga0501077_0739008 Ga0501077_0739008_36_335 99
1006 3300049649 Ga0501198_113007 Ga0501198_113007_33_332 99
1007 3300049669 Ga0501235_024462 Ga0501235_024462_11_310 99
1008 3300049679 Ga0501249_013544 Ga0501249_013544_993_1292 99
1009 3300049684 Ga0501255_067738 Ga0501255_067738_163_462 99
1010 3300049705 Ga0501225_0052260 Ga0501225_0052260_494_793 99
1011 3300049741 Ga0501079_0036483 Ga0501079_0036483_2254_2553 99
1012 3300049741 Ga0501079_0066182 Ga0501079_0066182_2140_2439 99
1013 3300049741 Ga0501079_0069077 Ga0501079_0069077_1545_1844 99
1014 3300049741 Ga0501079_0115944 Ga0501079_0115944_609_908 99
1015 3300049741 Ga0501079_0216011 Ga0501079_0216011_52_351 99
1016 3300049741 Ga0501079_0897792 Ga0501079_0897792_175_474 99
1017 3300049741 Ga0501079_1346916 Ga0501079_1346916_167_466 99
1018 3300049742 Ga0501080_0176285 Ga0501080_0176285_1176_1475 99
1019 3300049742 Ga0501080_0367445 Ga0501080_0367445_537_836 99
1020 3300049742 Ga0501080_0748723 Ga0501080_0748723_480_779 99
1021 3300049743 Ga0501081_0005258 Ga0501081_0005258_5864_6163 99
1022 3300049743 Ga0501081_0008813 Ga0501081_0008813_4858_5157 99
1023 3300049743 Ga0501081_0161916 Ga0501081_0161916_431_730 99
1024 3300049743 Ga0501081_0165335 Ga0501081_0165335_547_846 99
1025 3300049743 Ga0501081_1393479 Ga0501081_1393479_158_463 99
1026 3300049744 Ga0501083_0334075 Ga0501083_0334075_390_689 99
1027 3300049744 Ga0501083_0663724 Ga0501083_0663724_260_559 99
1028 3300049762 Ga0501265_017040 Ga0501265_017040_380_679 99
1029 3300049765 Ga0501268_117020 Ga0501268_117020_176_475 99
1030 3300049779 Ga0501283_017736 Ga0501283_017736_768_1067 99
1031 3300049779 Ga0501283_033328 Ga0501283_033328_381_680 99
1032 3300049822 Ga0501035_0460082 Ga0501035_0460082_709_1008 99
1033 3300049822 Ga0501035_0718893 Ga0501035_0718893_407_706 99
1034 3300049824 Ga0501045_0026152 Ga0501045_0026152_192_491 99
1035 3300049824 Ga0501045_0096486 Ga0501045_0096486_626_925 99
1036 3300049824 Ga0501045_0247397 Ga0501045_0247397_613_912 99
1037 3300049824 Ga0501045_1185506 Ga0501045_1185506_53_361 99
1038 3300049824 Ga0501045_1350652 Ga0501045_1350652_168_467 99
1039 3300050491 nmdc:mga00v17_139668_c1 nmdc:mga00v17_139668_c1_688_987 99
1040 3300050492 nmdc:mga0yw44_320343_c1 nmdc:mga0yw44_320343_c1_414_713 99
1041 3300050494 nmdc:mga06z11_475989_c1 nmdc:mga06z11_475989_c1_186_485 99
1042 3300050496 nmdc:mga07m45_164479_c1 nmdc:mga07m45_164479_c1_871_1170 99
1043 3300050507 nmdc:mga05p37_11414_c1 nmdc:mga05p37_11414_c1_3713_4012 99
1044 3300050507 nmdc:mga05p37_115985_c1 nmdc:mga05p37_115985_c1_2430_2732 99
1045 3300050507 nmdc:mga05p37_123743_c1 nmdc:mga05p37_123743_c1_712_1011 99
1046 3300050507 nmdc:mga05p37_129870_c1 nmdc:mga05p37_129870_c1_929_1228 99
1047 3300050507 nmdc:mga05p37_13298_c1 nmdc:mga05p37_13298_c1_2285_2584 99
1048 3300050507 nmdc:mga05p37_1652420_c1 nmdc:mga05p37_1652420_c1_22_321 99
1049 3300050507 nmdc:mga05p37_1693675_c1 nmdc:mga05p37_1693675_c1_140_475 99
1050 3300050507 nmdc:mga05p37_1919791_c1 nmdc:mga05p37_1919791_c1_53_379 99
1051 3300050507 nmdc:mga05p37_310094_c1 nmdc:mga05p37_310094_c1_1229_1528 99
1052 3300050507 nmdc:mga05p37_42435_c1 nmdc:mga05p37_42435_c1_2836_3138 99
1053 3300050507 nmdc:mga05p37_588858_c1 nmdc:mga05p37_588858_c1_164_463 99
1054 3300050507 nmdc:mga05p37_63188_c1 nmdc:mga05p37_63188_c1_759_1058 99
1055 3300050507 nmdc:mga05p37_631990_c1 nmdc:mga05p37_631990_c1_476_775 99
1056 3300050507 nmdc:mga05p37_92989_c1 nmdc:mga05p37_92989_c1_1672_1971 99
1057 3300050507 nmdc:mga05p37_957640_c1 nmdc:mga05p37_957640_c1_18_317 99
1058 3300050508 nmdc:mga09592_10924_c1 nmdc:mga09592_10924_c1_3448_3747 99
1059 3300050508 nmdc:mga09592_112066_c1 nmdc:mga09592_112066_c1_127_426 99
1060 3300050508 nmdc:mga09592_119748_c1 nmdc:mga09592_119748_c1_498_797 99
1061 3300050508 nmdc:mga09592_148299_c1 nmdc:mga09592_148299_c1_1441_1740 99
1062 3300050508 nmdc:mga09592_186536_c1 nmdc:mga09592_186536_c1_1068_1367 99
1063 3300050508 nmdc:mga09592_243115_c1 nmdc:mga09592_243115_c1_168_467 99
1064 3300050508 nmdc:mga09592_381980_c1 nmdc:mga09592_381980_c1_313_612 99
1065 3300050508 nmdc:mga09592_421195_c1 nmdc:mga09592_421195_c1_658_981 99
1066 3300050508 nmdc:mga09592_428433_c1 nmdc:mga09592_428433_c1_579_878 99
1067 3300050508 nmdc:mga09592_5317_c1 nmdc:mga09592_5317_c1_6739_7041 99
1068 3300050509 nmdc:mga0qj67_371396_c1 nmdc:mga0qj67_371396_c1_674_1000 99
1069 3300050509 nmdc:mga0qj67_545023_c1 nmdc:mga0qj67_545023_c1_509_808 99
1070 3300050509 nmdc:mga0qj67_629250_c1 nmdc:mga0qj67_629250_c1_47_346 99
1071 3300050509 nmdc:mga0qj67_7809_c1 nmdc:mga0qj67_7809_c1_2491_2790 99
1072 3300050509 nmdc:mga0qj67_900244_c1 nmdc:mga0qj67_900244_c1_37_336 99
1073 3300050509 nmdc:mga0qj67_90075_c1 nmdc:mga0qj67_90075_c1_1568_1867 99
1074 3300050509 nmdc:mga0qj67_9223_c1 nmdc:mga0qj67_9223_c1_2772_3071 99
1075 3300050510 nmdc:mga06r32_1091200_c1 nmdc:mga06r32_1091200_c1_70_369 99
1076 3300050510 nmdc:mga06r32_139300_c1 nmdc:mga06r32_139300_c1_1106_1405 99
1077 3300050510 nmdc:mga06r32_1511356_c1 nmdc:mga06r32_1511356_c1_154_453 99
1078 3300050510 nmdc:mga06r32_23099_c1 nmdc:mga06r32_23099_c1_1566_1865 99
1079 3300050510 nmdc:mga06r32_2396_c1 nmdc:mga06r32_2396_c1_616_915 99
1080 3300050510 nmdc:mga06r32_961369_c1 nmdc:mga06r32_961369_c1_298_597 99
1081 3300050511 nmdc:mga08y16_1006278_c1 nmdc:mga08y16_1006278_c1_498_797 99
1082 3300050511 nmdc:mga08y16_121797_c1 nmdc:mga08y16_121797_c1_950_1249 99
1083 3300050511 nmdc:mga08y16_1306_c1 nmdc:mga08y16_1306_c1_12894_13193 99
1084 3300050511 nmdc:mga08y16_165223_c1 nmdc:mga08y16_165223_c1_1770_2069 99
1085 3300050511 nmdc:mga08y16_243886_c1 nmdc:mga08y16_243886_c1_1039_1338 99
1086 3300050511 nmdc:mga08y16_2919_c1 nmdc:mga08y16_2919_c1_5366_5665 99
1087 3300050511 nmdc:mga08y16_33506_c1 nmdc:mga08y16_33506_c1_2960_3259 99
1088 3300050511 nmdc:mga08y16_430301_c1 nmdc:mga08y16_430301_c1_877_1176 99
1089 3300050511 nmdc:mga08y16_49615_c1 nmdc:mga08y16_49615_c1_2812_3114 99
1090 3300050511 nmdc:mga08y16_508377_c1 nmdc:mga08y16_508377_c1_801_1100 99
1091 3300050511 nmdc:mga08y16_597_c1 nmdc:mga08y16_597_c1_13842_14165 99
1092 3300050511 nmdc:mga08y16_689353_c1 nmdc:mga08y16_689353_c1_191_490 99
1093 3300050511 nmdc:mga08y16_777201_c1 nmdc:mga08y16_777201_c1_161_460 99
1094 3300050511 nmdc:mga08y16_788480_c1 nmdc:mga08y16_788480_c1_538_837 99
1095 3300050511 nmdc:mga08y16_8329_c1 nmdc:mga08y16_8329_c1_2251_2550 99
1096 3300050511 nmdc:mga08y16_91146_c1 nmdc:mga08y16_91146_c1_211_510 99
1097 3300050512 nmdc:mga0n895_1170540_c1 nmdc:mga0n895_1170540_c1_97_396 99
1098 3300050512 nmdc:mga0n895_133290_c1 nmdc:mga0n895_133290_c1_1082_1381 99
1099 3300050512 nmdc:mga0n895_20754_c1 nmdc:mga0n895_20754_c1_1601_1900 99
1100 3300050512 nmdc:mga0n895_2183_c1 nmdc:mga0n895_2183_c1_13044_13343 99
1101 3300050512 nmdc:mga0n895_263771_c1 nmdc:mga0n895_263771_c1_442_777 99
1102 3300050512 nmdc:mga0n895_277750_c1 nmdc:mga0n895_277750_c1_1014_1337 99
1103 3300050512 nmdc:mga0n895_290853_c1 nmdc:mga0n895_290853_c1_893_1192 99
1104 3300050512 nmdc:mga0n895_346896_c1 nmdc:mga0n895_346896_c1_670_969 99
1105 3300050512 nmdc:mga0n895_477_c1 nmdc:mga0n895_477_c1_9434_9733 99
1106 3300050512 nmdc:mga0n895_60106_c1 nmdc:mga0n895_60106_c1_442_744 99
1107 3300050512 nmdc:mga0n895_67211_c1 nmdc:mga0n895_67211_c1_881_1180 99
1108 3300050512 nmdc:mga0n895_874520_c1 nmdc:mga0n895_874520_c1_259_558 99
1109 3300050512 nmdc:mga0n895_935803_c1 nmdc:mga0n895_935803_c1_203_502 99
1110 3300050513 nmdc:mga0rr50_10710_c1 nmdc:mga0rr50_10710_c1_3678_3977 99
1111 3300050513 nmdc:mga0rr50_111232_c1 nmdc:mga0rr50_111232_c1_10_309 99
1112 3300050513 nmdc:mga0rr50_123548_c1 nmdc:mga0rr50_123548_c1_488_790 99
1113 3300050513 nmdc:mga0rr50_222714_c1 nmdc:mga0rr50_222714_c1_916_1251 99
1114 3300050513 nmdc:mga0rr50_31338_c1 nmdc:mga0rr50_31338_c1_1180_1479 99
1115 3300050513 nmdc:mga0rr50_43159_c1 nmdc:mga0rr50_43159_c1_1647_1946 99
1116 3300050513 nmdc:mga0rr50_47581_c1 nmdc:mga0rr50_47581_c1_979_1278 99
1117 3300050513 nmdc:mga0rr50_761073_c1 nmdc:mga0rr50_761073_c1_153_452 99
1118 3300050513 nmdc:mga0rr50_97406_c1 nmdc:mga0rr50_97406_c1_1026_1325 99
1119 3300050514 nmdc:mga08x19_39381_c1 nmdc:mga08x19_39381_c1_2051_2350 99
1120 3300050514 nmdc:mga08x19_496283_c1 nmdc:mga08x19_496283_c1_525_824 99
1121 3300050514 nmdc:mga08x19_895036_c1 nmdc:mga08x19_895036_c1_217_516 99
1122 3300050515 nmdc:mga0a205_13783_c1 nmdc:mga0a205_13783_c1_1337_1636 99
1123 3300050515 nmdc:mga0a205_1627_c1 nmdc:mga0a205_1627_c1_1912_2211 99
1124 3300050515 nmdc:mga0a205_1991_c1 nmdc:mga0a205_1991_c1_2164_2487 99
1125 3300050515 nmdc:mga0a205_216431_c1 nmdc:mga0a205_216431_c1_552_851 99
1126 3300050515 nmdc:mga0a205_26128_c1 nmdc:mga0a205_26128_c1_1684_1983 99
1127 3300050515 nmdc:mga0a205_266811_c1 nmdc:mga0a205_266811_c1_180_479 99
1128 3300050515 nmdc:mga0a205_36408_c1 nmdc:mga0a205_36408_c1_805_1140 99
1129 3300050515 nmdc:mga0a205_472746_c1 nmdc:mga0a205_472746_c1_314_613 99
1130 3300050515 nmdc:mga0a205_646_c1 nmdc:mga0a205_646_c1_17650_17949 99
1131 3300050515 nmdc:mga0a205_8978_c1 nmdc:mga0a205_8978_c1_4093_4395 99
1132 3300050515 nmdc:mga0a205_909785_c1 nmdc:mga0a205_909785_c1_252_551 99
1133 3300053085 Ga0495619_0466536 Ga0495619_0466536_396_695 99
1134 3300054114 Ga0501084_0040149 Ga0501084_0040149_3100_3399 99
1135 3300054114 Ga0501084_0089930 Ga0501084_0089930_2081_2380 99
1136 3300054114 Ga0501084_0575637 Ga0501084_0575637_600_899 99
1137 3300060353 Ga0501082_0076295 Ga0501082_0076295_620_919 99
1138 3300060353 Ga0501082_0097568 Ga0501082_0097568_974_1273 99
1139 3300060353 Ga0501082_0103281 Ga0501082_0103281_114_413 99
1140 3300060353 Ga0501082_0739990 Ga0501082_0739990_169_468 99
1141 3300061734 Ga0530510_0096259 Ga0530510_0096259_1672_1971 99
1142 3300061734 Ga0530510_0123561 Ga0530510_0123561_833_1132 99
1143 3300061734 Ga0530510_0342645 Ga0530510_0342645_459_764 99
1144 3300061734 Ga0530510_0641315 Ga0530510_0641315_485_784 99
1145 3300061734 Ga0530510_1339866 Ga0530510_1339866_16_315 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

7

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rwx-assembly1.cif.gz_A-2 crystal structure of a zn-bound ridc1 variant in the presence of reductant 0.9236 7 45
3m4c-assembly1.cif.gz_D a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase 0.9227 7 45
3hni-assembly1.cif.gz_A crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-1 0.9218 7 45
7rwx-assembly1.cif.gz_B-2 crystal structure of a zn-bound ridc1 variant in the presence of reductant 0.9201 7 45
6ot8-assembly1.cif.gz_A bimetallic hexameric cage design 4 (bmc4) from cytochrome cb562 0.9184 7 45
ID Description Score Start End Superfamily
3u8pA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9149 5 45 1.20.120.10
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9002 7 49 1.20.5.1930
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8827 5 86 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8543 5 86 1.10.287.3510
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8443 5 86 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A6B1A7X9-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9329 1 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A2V1K4Z5-F1-model_v4 pH regulation protein F 0.9293 3 77 GO:0005886
GO:0015385
AF-A0A497N4B1-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9252 4 84 GO:0016651
GO:0030964
GO:0042773
AF-A0A7C4MWT7-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9236 3 78 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A4P5XYL7-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9173 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136

Feature Viewer

pLDDT pTM Quality
88.81 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map