F490790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1146 | 338 | 2293 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100365111|Ga0068869_1003651111 |
| Length | 242 |
| Sequence | MAKQPKQSQPTESIETNVTESTPGPPFKGRIKVCGMTLPDQVNALDEMGVDLAGFIFYPKSPRFIRNKIPAEKMKKIKGRIAKVGVFVNMPYEDLMRTVEDYRLDMVQLHGDETPRYCEQVANYITVVKAFRLSDNDPLDWIIRPFHEGSDMYMFDTLGSGYGGTGKKFDWNVLKDKQIDKLFFLSGGIEPGDEERLKNFAMEPVAKKLFAIDINSKFEISAGVKDIERIRKFVTTLRSGPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 205 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 215 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 216 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 217 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 218 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 219 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 220 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 295 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 314 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 317 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 318 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 319 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 324 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 328 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 334 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 335 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 336 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 337 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 338 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.66 |
| Nodule | 0 |
| Rhizoplane | 1.13 |
| Rhizosphere | 90.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100365111 | 3300005334 | Bacteria | 1180 |
| 2 | MBSR1b_contig_5080737 | 2162886012 | Bacteria | 1371 |
| 3 | JGI24740J21852_10005751 | 3300001979 | Bacteria | 5210 |
| 4 | JGI25154J39366_1000040 | 3300002738 | Bacteria | 147410 |
| 5 | JGI25157J39369_1003509 | 3300002741 | Bacteria | 3173 |
| 6 | JGI25406J46586_10015712 | 3300003203 | Bacteria | 3183 |
| 7 | rootH1_10042957 | 3300003316 | Unclassified | 1701 |
| 8 | rootH2_10008248 | 3300003320 | Bacteria | 5781 |
| 9 | rootH2_10008268 | 3300003320 | Bacteria | 7923 |
| 10 | rootH2_10028777 | 3300003320 | Bacteria | 10914 |
| 11 | rootH2_10030072 | 3300003320 | Bacteria | 4856 |
| 12 | rootH2_10132146 | 3300003320 | Bacteria | 1804 |
| 13 | rootH2_10141251 | 3300003320 | Bacteria | 1834 |
| 14 | rootL2_10188385 | 3300003322 | Bacteria | 1474 |
| 15 | rootH1_10002854 | 3300003316 | Bacteria | 8719 |
| 16 | rootH1_10002854 | 3300003323 | Bacteria | 1182 |
| 17 | rootH1_10015122 | 3300003323 | Bacteria | 9190 |
| 18 | JGI25160J50197_1001601 | 3300003354 | Bacteria | 11152 |
| 19 | Ga0055535_1003449 | 3300003761 | Bacteria | 4482 |
| 20 | Ga0055542_1017472 | 3300003762 | Bacteria | 1110 |
| 21 | Ga0058863_11413575 | 3300004799 | Bacteria | 3839 |
| 22 | Ga0058862_12656212 | 3300004803 | Bacteria | 1749 |
| 23 | Ga0065165_1037906 | 3300005262 | Bacteria | 1458 |
| 24 | Ga0065712_10008205 | 3300005290 | Unclassified | 2599 |
| 25 | Ga0065712_10070469 | 3300005290 | Bacteria | 5975 |
| 26 | Ga0065712_10270594 | 3300005290 | Bacteria | 909 |
| 27 | Ga0070658_10010748 | 3300005327 | Bacteria | 7336 |
| 28 | Ga0070658_10075190 | 3300005327 | Bacteria | 2771 |
| 29 | Ga0070658_10081107 | 3300005327 | Bacteria | 2665 |
| 30 | Ga0070658_10187046 | 3300005327 | Bacteria | 1745 |
| 31 | Ga0070658_10214232 | 3300005327 | Bacteria | 1628 |
| 32 | Ga0070658_10281996 | 3300005327 | Bacteria | 1414 |
| 33 | Ga0070658_10526202 | 3300005327 | Bacteria | 1022 |
| 34 | Ga0070676_10000336 | 3300005328 | Bacteria | 21357 |
| 35 | Ga0070676_10031688 | 3300005328 | Bacteria | 3024 |
| 36 | Ga0070676_10248238 | 3300005328 | Bacteria | 1186 |
| 37 | Ga0070683_100002966 | 3300005329 | Bacteria | 13606 |
| 38 | Ga0070683_100032588 | 3300005329 | Bacteria | 4746 |
| 39 | Ga0070683_100120371 | 3300005329 | Bacteria | 2479 |
| 40 | Ga0070683_100673128 | 3300005329 | Bacteria | 991 |
| 41 | Ga0070683_100841404 | 3300005329 | Bacteria | 880 |
| 42 | Ga0070690_100005983 | 3300005330 | Bacteria | 6872 |
| 43 | Ga0070690_100057685 | 3300005330 | Bacteria | 2492 |
| 44 | Ga0070690_100166719 | 3300005330 | Bacteria | 1513 |
| 45 | Ga0070690_100266160 | 3300005330 | Bacteria | 1218 |
| 46 | Ga0070690_100319086 | 3300005330 | Unclassified | 1119 |
| 47 | Ga0070670_100030756 | 3300005331 | Bacteria | 4623 |
| 48 | Ga0070670_100039056 | 3300005331 | Bacteria | 4081 |
| 49 | Ga0070670_100062154 | 3300005331 | Bacteria | 3206 |
| 50 | Ga0070670_100079810 | 3300005331 | Unclassified | 2812 |
| 51 | Ga0070670_100162784 | 3300005331 | Bacteria | 1934 |
| 52 | Ga0070670_100221339 | 3300005331 | Bacteria | 1647 |
| 53 | Ga0070670_100245642 | 3300005331 | Bacteria | 1559 |
| 54 | Ga0070670_100899099 | 3300005331 | Bacteria | 803 |
| 55 | Ga0070677_10143248 | 3300005333 | Bacteria | 1105 |
| 56 | Ga0070677_10416306 | 3300005333 | Bacteria | 712 |
| 57 | Ga0068869_100043129 | 3300005334 | Bacteria | 3238 |
| 58 | Ga0068869_100080027 | 3300005334 | Bacteria | 2436 |
| 59 | Ga0068869_100125092 | 3300005334 | Bacteria | 1971 |
| 60 | Ga0068869_100151211 | 3300005334 | Bacteria | 1801 |
| 61 | Ga0068869_100159910 | 3300005334 | Bacteria | 1753 |
| 62 | Ga0068869_100160053 | 3300005334 | Unclassified | 1752 |
| 63 | Ga0068869_100183963 | 3300005334 | Bacteria | 1639 |
| 64 | Ga0068869_100428266 | 3300005334 | Bacteria | 1093 |
| 65 | Ga0068869_100468926 | 3300005334 | Bacteria | 1047 |
| 66 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 67 | Ga0070666_10010207 | 3300005335 | Bacteria | 5868 |
| 68 | Ga0070666_10013609 | 3300005335 | Bacteria | 5165 |
| 69 | Ga0070666_10090217 | 3300005335 | Bacteria | 2105 |
| 70 | Ga0070666_10143011 | 3300005335 | Bacteria | 1667 |
| 71 | Ga0070666_10382347 | 3300005335 | Bacteria | 1011 |
| 72 | Ga0070680_100031956 | 3300005336 | Bacteria | 4233 |
| 73 | Ga0070680_100171315 | 3300005336 | Bacteria | 1827 |
| 74 | Ga0070680_100189297 | 3300005336 | Bacteria | 1734 |
| 75 | Ga0070680_100213482 | 3300005336 | Bacteria | 1628 |
| 76 | Ga0070680_100243505 | 3300005336 | Unclassified | 1520 |
| 77 | Ga0070682_100001275 | 3300005337 | Bacteria | 14290 |
| 78 | Ga0070682_100026905 | 3300005337 | Bacteria | 3446 |
| 79 | Ga0070682_100559187 | 3300005337 | Unclassified | 897 |
| 80 | Ga0068868_100005270 | 3300005338 | Bacteria | 9078 |
| 81 | Ga0068868_100010338 | 3300005338 | Bacteria | 6749 |
| 82 | Ga0068868_100078065 | 3300005338 | Bacteria | 2650 |
| 83 | Ga0068868_100205069 | 3300005338 | Viruses | 1645 |
| 84 | Ga0068868_100255371 | 3300005338 | Bacteria | 1476 |
| 85 | Ga0068868_100308965 | 3300005338 | Bacteria | 1345 |
| 86 | Ga0068868_100630897 | 3300005338 | Bacteria | 952 |
| 87 | Ga0068868_101113413 | 3300005338 | Bacteria | 727 |
| 88 | Ga0070660_100015714 | 3300005339 | Bacteria | 5473 |
| 89 | Ga0070660_101097932 | 3300005339 | Unclassified | 673 |
| 90 | Ga0070689_100001732 | 3300005340 | Bacteria | 13951 |
| 91 | Ga0070689_100013351 | 3300005340 | Bacteria | 5941 |
| 92 | Ga0070689_100014808 | 3300005340 | Bacteria | 5674 |
| 93 | Ga0070689_100278201 | 3300005340 | Bacteria | 1388 |
| 94 | Ga0070691_10016205 | 3300005341 | Bacteria | 3424 |
| 95 | Ga0070691_10049783 | 3300005341 | Bacteria | 1997 |
| 96 | Ga0070661_100002702 | 3300005344 | Bacteria | 12149 |
| 97 | Ga0070661_100003143 | 3300005344 | Bacteria | 11357 |
| 98 | Ga0070661_100022549 | 3300005344 | Bacteria | 4508 |
| 99 | Ga0070661_100242507 | 3300005344 | Bacteria | 1388 |
| 100 | Ga0070661_100286536 | 3300005344 | Bacteria | 1279 |
| 101 | Ga0070661_100467931 | 3300005344 | Bacteria | 1005 |
| 102 | Ga0070668_100002494 | 3300005347 | Bacteria | 13548 |
| 103 | Ga0070668_100022644 | 3300005347 | Bacteria | 4751 |
| 104 | Ga0070668_100395028 | 3300005347 | Bacteria | 1180 |
| 105 | Ga0070669_100004789 | 3300005353 | Bacteria | 9766 |
| 106 | Ga0070669_100036574 | 3300005353 | Bacteria | 3558 |
| 107 | Ga0070669_100165082 | 3300005353 | Unclassified | 1723 |
| 108 | Ga0070669_100301733 | 3300005353 | Bacteria | 1288 |
| 109 | Ga0070669_100582851 | 3300005353 | Bacteria | 935 |
| 110 | Ga0070669_100761213 | 3300005353 | Bacteria | 821 |
| 111 | Ga0070669_100924072 | 3300005353 | Bacteria | 746 |
| 112 | Ga0070675_100013600 | 3300005354 | Bacteria | 6399 |
| 113 | Ga0070675_100025711 | 3300005354 | Bacteria | 4720 |
| 114 | Ga0070675_100040336 | 3300005354 | Bacteria | 3811 |
| 115 | Ga0070675_100055271 | 3300005354 | Unclassified | 3268 |
| 116 | Ga0070675_100266528 | 3300005354 | Bacteria | 1502 |
| 117 | Ga0070671_100004803 | 3300005355 | Bacteria | 10743 |
| 118 | Ga0070671_100032777 | 3300005355 | Bacteria | 4293 |
| 119 | Ga0070671_100049587 | 3300005355 | Bacteria | 3493 |
| 120 | Ga0070671_100062085 | 3300005355 | Bacteria | 3112 |
| 121 | Ga0070671_100074043 | 3300005355 | Bacteria | 2845 |
| 122 | Ga0070671_100123868 | 3300005355 | Bacteria | 2176 |
| 123 | Ga0070671_100195390 | 3300005355 | Bacteria | 1715 |
| 124 | Ga0070671_100292029 | 3300005355 | Bacteria | 1387 |
| 125 | Ga0070671_100354866 | 3300005355 | Bacteria | 1252 |
| 126 | Ga0070674_100028173 | 3300005356 | Bacteria | 3688 |
| 127 | Ga0070674_100076506 | 3300005356 | Bacteria | 2379 |
| 128 | Ga0070674_100270356 | 3300005356 | Bacteria | 1343 |
| 129 | Ga0070673_100001990 | 3300005364 | Bacteria | 12324 |
| 130 | Ga0070673_100017265 | 3300005364 | Bacteria | 5126 |
| 131 | Ga0070673_100049176 | 3300005364 | Bacteria | 3292 |
| 132 | Ga0070673_100062597 | 3300005364 | Bacteria | 2957 |
| 133 | Ga0070673_100161208 | 3300005364 | Bacteria | 1908 |
| 134 | Ga0070673_100216608 | 3300005364 | Bacteria | 1655 |
| 135 | Ga0070673_100218521 | 3300005364 | Bacteria | 1648 |
| 136 | Ga0070673_100290540 | 3300005364 | Bacteria | 1436 |
| 137 | Ga0070673_100874628 | 3300005364 | Bacteria | 832 |
| 138 | Ga0070688_100019036 | 3300005365 | Bacteria | 3974 |
| 139 | Ga0070688_100039808 | 3300005365 | Bacteria | 2878 |
| 140 | Ga0070688_100051258 | 3300005365 | Bacteria | 2574 |
| 141 | Ga0070688_100082918 | 3300005365 | Unclassified | 2079 |
| 142 | Ga0070688_100345935 | 3300005365 | Bacteria | 1087 |
| 143 | Ga0070659_100117387 | 3300005366 | Bacteria | 2152 |
| 144 | Ga0070659_100120914 | 3300005366 | Bacteria | 2121 |
| 145 | Ga0070667_100000492 | 3300005367 | Bacteria | 40164 |
| 146 | Ga0070667_100020321 | 3300005367 | Bacteria | 5512 |
| 147 | Ga0070667_100054456 | 3300005367 | Bacteria | 3378 |
| 148 | Ga0070667_100075366 | 3300005367 | Bacteria | 2880 |
| 149 | Ga0070667_100088516 | 3300005367 | Bacteria | 2659 |
| 150 | Ga0070667_100157396 | 3300005367 | Bacteria | 1999 |
| 151 | Ga0070667_100161421 | 3300005367 | Bacteria | 1974 |
| 152 | Ga0070667_100307734 | 3300005367 | Unclassified | 1428 |
| 153 | Ga0070705_100351477 | 3300005440 | Bacteria | 1075 |
| 154 | Ga0070663_100690869 | 3300005455 | Bacteria | 866 |
| 155 | Ga0070678_100010791 | 3300005456 | Bacteria | 5599 |
| 156 | Ga0070678_100013945 | 3300005456 | Bacteria | 5054 |
| 157 | Ga0070678_100231962 | 3300005456 | Unclassified | 1539 |
| 158 | Ga0070662_100004086 | 3300005457 | Bacteria | 9167 |
| 159 | Ga0070662_100027166 | 3300005457 | Bacteria | 3970 |
| 160 | Ga0070662_100036135 | 3300005457 | Bacteria | 3493 |
| 161 | Ga0070662_100056097 | 3300005457 | Bacteria | 2860 |
| 162 | Ga0070662_100146200 | 3300005457 | Bacteria | 1836 |
| 163 | Ga0070662_100283207 | 3300005457 | Bacteria | 1342 |
| 164 | Ga0070681_10021777 | 3300005458 | Bacteria | 6428 |
| 165 | Ga0070681_10040812 | 3300005458 | Bacteria | 4649 |
| 166 | Ga0070681_10097972 | 3300005458 | Bacteria | 2878 |
| 167 | Ga0070681_10305631 | 3300005458 | Bacteria | 1500 |
| 168 | Ga0068867_100043311 | 3300005459 | Bacteria | 3295 |
| 169 | Ga0068867_100082241 | 3300005459 | Bacteria | 2429 |
| 170 | Ga0068867_100094622 | 3300005459 | Bacteria | 2272 |
| 171 | Ga0068867_100192882 | 3300005459 | Bacteria | 1627 |
| 172 | Ga0068867_100273011 | 3300005459 | Bacteria | 1383 |
| 173 | Ga0068867_100355786 | 3300005459 | Bacteria | 1223 |
| 174 | Ga0068867_100621339 | 3300005459 | Unclassified | 945 |
| 175 | Ga0070685_10009065 | 3300005466 | Bacteria | 5133 |
| 176 | Ga0070685_10016536 | 3300005466 | Bacteria | 3932 |
| 177 | Ga0070685_10063077 | 3300005466 | Bacteria | 2175 |
| 178 | Ga0070685_10165147 | 3300005466 | Unclassified | 1414 |
| 179 | Ga0070685_10166737 | 3300005466 | Bacteria | 1408 |
| 180 | Ga0070698_100007269 | 3300005471 | Bacteria | 11994 |
| 181 | Ga0070699_100140396 | 3300005518 | Bacteria | 2133 |
| 182 | Ga0070679_100004536 | 3300005530 | Bacteria | 12825 |
| 183 | Ga0070679_100029492 | 3300005530 | Bacteria | 5413 |
| 184 | Ga0070679_100054566 | 3300005530 | Bacteria | 3979 |
| 185 | Ga0070679_100098661 | 3300005530 | Bacteria | 2908 |
| 186 | Ga0070679_100143593 | 3300005530 | Bacteria | 2365 |
| 187 | Ga0070684_100000228 | 3300005535 | Bacteria | 38984 |
| 188 | Ga0070684_100060191 | 3300005535 | Bacteria | 3321 |
| 189 | Ga0070684_100479592 | 3300005535 | Bacteria | 1151 |
| 190 | Ga0070684_100664138 | 3300005535 | Bacteria | 971 |
| 191 | Ga0068853_100000221 | 3300005539 | Bacteria | 40294 |
| 192 | Ga0068853_100020583 | 3300005539 | Bacteria | 5487 |
| 193 | Ga0068853_100055688 | 3300005539 | Bacteria | 3409 |
| 194 | Ga0068853_100058961 | 3300005539 | Bacteria | 3315 |
| 195 | Ga0068853_100092567 | 3300005539 | Bacteria | 2660 |
| 196 | Ga0068853_100094499 | 3300005539 | Unclassified | 2634 |
| 197 | Ga0068853_100130043 | 3300005539 | Bacteria | 2253 |
| 198 | Ga0068853_100140870 | 3300005539 | Bacteria | 2165 |
| 199 | Ga0068853_100196267 | 3300005539 | Bacteria | 1836 |
| 200 | Ga0068853_100241918 | 3300005539 | Bacteria | 1654 |
| 201 | Ga0068853_100372941 | 3300005539 | Bacteria | 1332 |
| 202 | Ga0068853_100706232 | 3300005539 | Bacteria | 962 |
| 203 | Ga0070672_100001464 | 3300005543 | Bacteria | 14647 |
| 204 | Ga0070672_100052158 | 3300005543 | Bacteria | 3192 |
| 205 | Ga0070672_100179906 | 3300005543 | Unclassified | 1762 |
| 206 | Ga0070672_100199661 | 3300005543 | Bacteria | 1672 |
| 207 | Ga0070672_100786836 | 3300005543 | Bacteria | 836 |
| 208 | Ga0070686_100392522 | 3300005544 | Bacteria | 1053 |
| 209 | Ga0070686_100680528 | 3300005544 | Bacteria | 818 |
| 210 | Ga0070695_100438499 | 3300005545 | Unclassified | 998 |
| 211 | Ga0070693_100009189 | 3300005547 | Bacteria | 4910 |
| 212 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 213 | Ga0070665_100005742 | 3300005548 | Bacteria | 12739 |
| 214 | Ga0070665_100392369 | 3300005548 | Bacteria | 1396 |
| 215 | Ga0068855_100007886 | 3300005563 | Bacteria | 12858 |
| 216 | Ga0068855_100030208 | 3300005563 | Bacteria | 6482 |
| 217 | Ga0068855_100034990 | 3300005563 | Bacteria | 5986 |
| 218 | Ga0068855_100125633 | 3300005563 | Bacteria | 2933 |
| 219 | Ga0068855_100274941 | 3300005563 | Bacteria | 1872 |
| 220 | Ga0068855_100329735 | 3300005563 | Bacteria | 1685 |
| 221 | Ga0068855_100413214 | 3300005563 | Bacteria | 1477 |
| 222 | Ga0068855_100482300 | 3300005563 | Bacteria | 1349 |
| 223 | Ga0070664_100003241 | 3300005564 | Bacteria | 13152 |
| 224 | Ga0070664_100004633 | 3300005564 | Bacteria | 11040 |
| 225 | Ga0070664_100012802 | 3300005564 | Bacteria | 6824 |
| 226 | Ga0070664_100074332 | 3300005564 | Bacteria | 2917 |
| 227 | Ga0070664_100296205 | 3300005564 | Bacteria | 1461 |
| 228 | Ga0070664_100382311 | 3300005564 | Bacteria | 1285 |
| 229 | Ga0070664_100688884 | 3300005564 | Bacteria | 951 |
| 230 | Ga0068857_100001119 | 3300005577 | Bacteria | 20854 |
| 231 | Ga0068857_100007157 | 3300005577 | Bacteria | 9611 |
| 232 | Ga0068857_100019040 | 3300005577 | Bacteria | 6024 |
| 233 | Ga0068857_100090705 | 3300005577 | Bacteria | 2735 |
| 234 | Ga0068857_100118152 | 3300005577 | Bacteria | 2386 |
| 235 | Ga0068857_100238569 | 3300005577 | Bacteria | 1664 |
| 236 | Ga0068857_100289571 | 3300005577 | Unclassified | 1508 |
| 237 | Ga0068854_100071634 | 3300005578 | Bacteria | 2536 |
| 238 | Ga0068854_100073957 | 3300005578 | Bacteria | 2499 |
| 239 | Ga0068854_100086737 | 3300005578 | Bacteria | 2321 |
| 240 | Ga0068854_100176660 | 3300005578 | Bacteria | 1665 |
| 241 | Ga0068854_100373372 | 3300005578 | Bacteria | 1173 |
| 242 | Ga0068854_100587059 | 3300005578 | Unclassified | 949 |
| 243 | Ga0068854_100606295 | 3300005578 | Bacteria | 935 |
| 244 | Ga0068854_100714905 | 3300005578 | Unclassified | 866 |
| 245 | Ga0068854_101153514 | 3300005578 | Bacteria | 692 |
| 246 | Ga0068856_100011164 | 3300005614 | Bacteria | 8722 |
| 247 | Ga0068856_100063215 | 3300005614 | Bacteria | 3657 |
| 248 | Ga0068856_100074030 | 3300005614 | Bacteria | 3372 |
| 249 | Ga0068856_100139887 | 3300005614 | Bacteria | 2428 |
| 250 | Ga0068856_100567977 | 3300005614 | Bacteria | 1155 |
| 251 | Ga0070702_100122033 | 3300005615 | Bacteria | 1633 |
| 252 | Ga0068852_100002006 | 3300005616 | Bacteria | 13883 |
| 253 | Ga0068852_100018674 | 3300005616 | Bacteria | 5466 |
| 254 | Ga0068852_100023547 | 3300005616 | Bacteria | 4958 |
| 255 | Ga0068852_100066167 | 3300005616 | Bacteria | 3155 |
| 256 | Ga0068852_100136739 | 3300005616 | Bacteria | 2263 |
| 257 | Ga0068852_100230863 | 3300005616 | Bacteria | 1764 |
| 258 | Ga0068852_100241605 | 3300005616 | Bacteria | 1726 |
| 259 | Ga0068852_100292942 | 3300005616 | Bacteria | 1573 |
| 260 | Ga0068852_100595137 | 3300005616 | Bacteria | 1110 |
| 261 | Ga0068852_100704643 | 3300005616 | Unclassified | 1020 |
| 262 | Ga0068852_100732765 | 3300005616 | Bacteria | 1000 |
| 263 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 264 | Ga0068859_100008109 | 3300005617 | Bacteria | 10653 |
| 265 | Ga0068859_100033356 | 3300005617 | Bacteria | 5169 |
| 266 | Ga0068859_100054725 | 3300005617 | Bacteria | 4014 |
| 267 | Ga0068859_100069445 | 3300005617 | Bacteria | 3558 |
| 268 | Ga0068859_100085357 | 3300005617 | Bacteria | 3202 |
| 269 | Ga0068859_100135826 | 3300005617 | Unclassified | 2532 |
| 270 | Ga0068859_100805481 | 3300005617 | Bacteria | 1027 |
| 271 | Ga0068859_100986642 | 3300005617 | Bacteria | 925 |
| 272 | Ga0068859_101001856 | 3300005617 | Bacteria | 917 |
| 273 | Ga0068859_101134262 | 3300005617 | Bacteria | 860 |
| 274 | Ga0068864_100005800 | 3300005618 | Bacteria | 10131 |
| 275 | Ga0068864_100007839 | 3300005618 | Bacteria | 8801 |
| 276 | Ga0068864_100016359 | 3300005618 | Bacteria | 6174 |
| 277 | Ga0068864_100026175 | 3300005618 | Bacteria | 4918 |
| 278 | Ga0068864_100066317 | 3300005618 | Bacteria | 3133 |
| 279 | Ga0068864_100072654 | 3300005618 | Bacteria | 2999 |
| 280 | Ga0068864_100217573 | 3300005618 | Bacteria | 1761 |
| 281 | Ga0068864_100293509 | 3300005618 | Bacteria | 1520 |
| 282 | Ga0068864_100444836 | 3300005618 | Bacteria | 1238 |
| 283 | Ga0068866_10059122 | 3300005718 | Bacteria | 1982 |
| 284 | Ga0068866_10348342 | 3300005718 | Bacteria | 940 |
| 285 | Ga0068861_100009306 | 3300005719 | Bacteria | 6779 |
| 286 | Ga0068861_100094670 | 3300005719 | Bacteria | 2364 |
| 287 | Ga0068861_100122562 | 3300005719 | Bacteria | 2099 |
| 288 | Ga0068861_100129736 | 3300005719 | Bacteria | 2045 |
| 289 | Ga0068861_100158612 | 3300005719 | Bacteria | 1864 |
| 290 | Ga0068861_100205414 | 3300005719 | Bacteria | 1656 |
| 291 | Ga0068861_100362071 | 3300005719 | Bacteria | 1276 |
| 292 | Ga0068861_100791543 | 3300005719 | Unclassified | 889 |
| 293 | Ga0068851_10001340 | 3300005834 | Bacteria | 10756 |
| 294 | Ga0068870_10046335 | 3300005840 | Bacteria | 2279 |
| 295 | Ga0068870_10105701 | 3300005840 | Bacteria | 1599 |
| 296 | Ga0068863_100001812 | 3300005841 | Bacteria | 21216 |
| 297 | Ga0068863_100013140 | 3300005841 | Bacteria | 7992 |
| 298 | Ga0068863_100074948 | 3300005841 | Bacteria | 3202 |
| 299 | Ga0068863_100075228 | 3300005841 | Bacteria | 3195 |
| 300 | Ga0068863_100130519 | 3300005841 | Unclassified | 2399 |
| 301 | Ga0068858_100008485 | 3300005842 | Bacteria | 9874 |
| 302 | Ga0068858_100049204 | 3300005842 | Bacteria | 3904 |
| 303 | Ga0068858_100577331 | 3300005842 | Unclassified | 1089 |
| 304 | Ga0068858_100827928 | 3300005842 | Bacteria | 903 |
| 305 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 306 | Ga0068860_100000916 | 3300005843 | Bacteria | 32698 |
| 307 | Ga0068860_100005408 | 3300005843 | Bacteria | 12959 |
| 308 | Ga0068860_100007358 | 3300005843 | Bacteria | 11008 |
| 309 | Ga0068860_100024991 | 3300005843 | Bacteria | 5767 |
| 310 | Ga0068860_100034035 | 3300005843 | Bacteria | 4887 |
| 311 | Ga0068860_100116564 | 3300005843 | Unclassified | 2556 |
| 312 | Ga0068860_100371146 | 3300005843 | Unclassified | 1411 |
| 313 | Ga0068860_100822578 | 3300005843 | Unclassified | 943 |
| 314 | Ga0068860_101335261 | 3300005843 | Unclassified | 738 |
| 315 | Ga0068862_100003779 | 3300005844 | Bacteria | 12914 |
| 316 | Ga0068862_100022881 | 3300005844 | Bacteria | 5231 |
| 317 | Ga0068862_100166968 | 3300005844 | Bacteria | 1968 |
| 318 | Ga0068862_100449754 | 3300005844 | Bacteria | 1214 |
| 319 | Ga0068862_100723941 | 3300005844 | Unclassified | 966 |
| 320 | Ga0081539_10000531 | 3300005985 | Bacteria | 79191 |
| 321 | Ga0081539_10071796 | 3300005985 | Bacteria | 1852 |
| 322 | Ga0070715_10046164 | 3300006163 | Bacteria | 1851 |
| 323 | Ga0070715_10112710 | 3300006163 | Bacteria | 1285 |
| 324 | Ga0075366_10048373 | 3300006195 | Bacteria | 2522 |
| 325 | Ga0075366_10061180 | 3300006195 | Bacteria | 2237 |
| 326 | Ga0075366_10207913 | 3300006195 | Bacteria | 1191 |
| 327 | Ga0097621_100000847 | 3300006237 | Bacteria | 21541 |
| 328 | Ga0097621_100001572 | 3300006237 | Bacteria | 15606 |
| 329 | Ga0097621_100003432 | 3300006237 | Bacteria | 10914 |
| 330 | Ga0097621_100035876 | 3300006237 | Bacteria | 3963 |
| 331 | Ga0097621_100044146 | 3300006237 | Bacteria | 3596 |
| 332 | Ga0097621_100077970 | 3300006237 | Bacteria | 2751 |
| 333 | Ga0097621_100098064 | 3300006237 | Unclassified | 2461 |
| 334 | Ga0097621_100098913 | 3300006237 | Bacteria | 2451 |
| 335 | Ga0097621_100157282 | 3300006237 | Bacteria | 1951 |
| 336 | Ga0097621_100524427 | 3300006237 | Bacteria | 1076 |
| 337 | Ga0097621_100706038 | 3300006237 | Bacteria | 929 |
| 338 | Ga0068871_100000027 | 3300006358 | Bacteria | 78588 |
| 339 | Ga0068871_100000354 | 3300006358 | Bacteria | 31915 |
| 340 | Ga0068871_100001006 | 3300006358 | Bacteria | 18890 |
| 341 | Ga0068871_100024941 | 3300006358 | Bacteria | 4645 |
| 342 | Ga0068871_100040970 | 3300006358 | Unclassified | 3712 |
| 343 | Ga0068871_100106906 | 3300006358 | Bacteria | 2349 |
| 344 | Ga0068871_100195683 | 3300006358 | Bacteria | 1743 |
| 345 | Ga0068871_100229104 | 3300006358 | Bacteria | 1612 |
| 346 | Ga0068871_100267331 | 3300006358 | Bacteria | 1493 |
| 347 | Ga0068871_100348869 | 3300006358 | Bacteria | 1309 |
| 348 | Ga0068871_100459632 | 3300006358 | Bacteria | 1142 |
| 349 | Ga0075428_100024587 | 3300006844 | Bacteria | 6666 |
| 350 | Ga0075428_100871642 | 3300006844 | Bacteria | 956 |
| 351 | Ga0075430_100010054 | 3300006846 | Bacteria | 8005 |
| 352 | Ga0075431_100004434 | 3300006847 | Bacteria | 13760 |
| 353 | Ga0075431_100245623 | 3300006847 | Bacteria | 1820 |
| 354 | Ga0075429_100005840 | 3300006880 | Bacteria | 10619 |
| 355 | Ga0068865_100023025 | 3300006881 | Bacteria | 4073 |
| 356 | Ga0068865_100157160 | 3300006881 | Bacteria | 1731 |
| 357 | Ga0068865_100275782 | 3300006881 | Bacteria | 1337 |
| 358 | Ga0068865_100331513 | 3300006881 | Bacteria | 1227 |
| 359 | Ga0068865_100598388 | 3300006881 | Bacteria | 932 |
| 360 | Ga0068865_100767296 | 3300006881 | Bacteria | 829 |
| 361 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 362 | Ga0097620_100008109 | 3300006931 | Bacteria | 10653 |
| 363 | Ga0097620_100033356 | 3300006931 | Bacteria | 5169 |
| 364 | Ga0097620_100054730 | 3300006931 | Bacteria | 4014 |
| 365 | Ga0097620_100069445 | 3300006931 | Bacteria | 3558 |
| 366 | Ga0097620_100085355 | 3300006931 | Bacteria | 3202 |
| 367 | Ga0097620_100135820 | 3300006931 | Unclassified | 2532 |
| 368 | Ga0097620_100805394 | 3300006931 | Bacteria | 1027 |
| 369 | Ga0097620_100986659 | 3300006931 | Bacteria | 925 |
| 370 | Ga0097620_101001928 | 3300006931 | Bacteria | 917 |
| 371 | Ga0097620_101134445 | 3300006931 | Bacteria | 860 |
| 372 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 373 | Ga0105240_10000598 | 3300009093 | Bacteria | 67006 |
| 374 | Ga0105240_10000626 | 3300009093 | Bacteria | 65179 |
| 375 | Ga0105240_10001595 | 3300009093 | Bacteria | 38516 |
| 376 | Ga0105240_10002663 | 3300009093 | Bacteria | 28411 |
| 377 | Ga0105240_10007062 | 3300009093 | Bacteria | 16373 |
| 378 | Ga0105240_10095833 | 3300009093 | Bacteria | 3617 |
| 379 | Ga0105240_10157044 | 3300009093 | Bacteria | 2704 |
| 380 | Ga0105240_10192995 | 3300009093 | Bacteria | 2393 |
| 381 | Ga0105240_10233775 | 3300009093 | Bacteria | 2134 |
| 382 | Ga0105240_10346161 | 3300009093 | Bacteria | 1687 |
| 383 | Ga0105240_10394988 | 3300009093 | Bacteria | 1559 |
| 384 | Ga0105240_10469687 | 3300009093 | Bacteria | 1404 |
| 385 | Ga0105240_10504726 | 3300009093 | Bacteria | 1344 |
| 386 | Ga0105240_10604497 | 3300009093 | Bacteria | 1207 |
| 387 | Ga0111539_10015483 | 3300009094 | Bacteria | 9481 |
| 388 | Ga0111539_10072693 | 3300009094 | Bacteria | 4055 |
| 389 | Ga0111539_10150833 | 3300009094 | Bacteria | 2721 |
| 390 | Ga0111539_10203554 | 3300009094 | Bacteria | 2308 |
| 391 | Ga0111539_10248996 | 3300009094 | Bacteria | 2069 |
| 392 | Ga0111539_10519594 | 3300009094 | Unclassified | 1387 |
| 393 | Ga0111539_10638165 | 3300009094 | Bacteria | 1240 |
| 394 | Ga0111539_11318769 | 3300009094 | Bacteria | 838 |
| 395 | Ga0105245_10092150 | 3300009098 | Bacteria | 2790 |
| 396 | Ga0105245_10136710 | 3300009098 | Bacteria | 2304 |
| 397 | Ga0105245_10211933 | 3300009098 | Bacteria | 1865 |
| 398 | Ga0105247_10003751 | 3300009101 | Bacteria | 9849 |
| 399 | Ga0105247_10055552 | 3300009101 | Bacteria | 2443 |
| 400 | Ga0105247_10200350 | 3300009101 | Unclassified | 1341 |
| 401 | Ga0114129_10170363 | 3300009147 | Bacteria | 2969 |
| 402 | Ga0114129_11213107 | 3300009147 | Bacteria | 939 |
| 403 | Ga0105243_11028531 | 3300009148 | Bacteria | 828 |
| 404 | Ga0105241_10000659 | 3300009174 | Bacteria | 25872 |
| 405 | Ga0105241_10000881 | 3300009174 | Bacteria | 22671 |
| 406 | Ga0105241_10007681 | 3300009174 | Bacteria | 7928 |
| 407 | Ga0105241_10034893 | 3300009174 | Bacteria | 3782 |
| 408 | Ga0105241_10105623 | 3300009174 | Bacteria | 2246 |
| 409 | Ga0105241_10281965 | 3300009174 | Bacteria | 1419 |
| 410 | Ga0105241_10720042 | 3300009174 | Bacteria | 912 |
| 411 | Ga0105242_10012454 | 3300009176 | Bacteria | 6549 |
| 412 | Ga0105242_10029532 | 3300009176 | Bacteria | 4374 |
| 413 | Ga0105242_10046336 | 3300009176 | Bacteria | 3527 |
| 414 | Ga0105242_10047921 | 3300009176 | Bacteria | 3471 |
| 415 | Ga0105242_10057412 | 3300009176 | Unclassified | 3188 |
| 416 | Ga0105242_10066820 | 3300009176 | Bacteria | 2971 |
| 417 | Ga0105242_10245338 | 3300009176 | Bacteria | 1612 |
| 418 | Ga0105242_10262710 | 3300009176 | Bacteria | 1560 |
| 419 | Ga0105242_10907120 | 3300009176 | Bacteria | 882 |
| 420 | Ga0105242_10974798 | 3300009176 | Bacteria | 854 |
| 421 | Ga0105242_11121783 | 3300009176 | Viruses | 802 |
| 422 | Ga0105248_10129741 | 3300009177 | Bacteria | 2844 |
| 423 | Ga0105248_10148472 | 3300009177 | Bacteria | 2645 |
| 424 | Ga0105248_10801695 | 3300009177 | Bacteria | 1063 |
| 425 | Ga0105237_10000755 | 3300009545 | Bacteria | 44312 |
| 426 | Ga0105237_10004143 | 3300009545 | Bacteria | 16893 |
| 427 | Ga0105237_10007407 | 3300009545 | Bacteria | 12017 |
| 428 | Ga0105237_10020135 | 3300009545 | Bacteria | 6886 |
| 429 | Ga0105237_10042602 | 3300009545 | Bacteria | 4577 |
| 430 | Ga0105237_10100523 | 3300009545 | Bacteria | 2883 |
| 431 | Ga0105237_10111377 | 3300009545 | Bacteria | 2729 |
| 432 | Ga0105237_10213092 | 3300009545 | Bacteria | 1931 |
| 433 | Ga0105237_10231380 | 3300009545 | Bacteria | 1849 |
| 434 | Ga0105237_10349941 | 3300009545 | Bacteria | 1482 |
| 435 | Ga0105238_10001132 | 3300009551 | Bacteria | 26885 |
| 436 | Ga0105238_10035958 | 3300009551 | Bacteria | 5035 |
| 437 | Ga0105238_10104359 | 3300009551 | Bacteria | 2815 |
| 438 | Ga0105238_10208463 | 3300009551 | Bacteria | 1930 |
| 439 | Ga0105238_10995831 | 3300009551 | Bacteria | 859 |
| 440 | Ga0105249_10005641 | 3300009553 | Bacteria | 10830 |
| 441 | Ga0105249_10008464 | 3300009553 | Bacteria | 8963 |
| 442 | Ga0105249_10009356 | 3300009553 | Bacteria | 8571 |
| 443 | Ga0105249_10012834 | 3300009553 | Bacteria | 7392 |
| 444 | Ga0105249_10056487 | 3300009553 | Bacteria | 3594 |
| 445 | Ga0105249_10088386 | 3300009553 | Bacteria | 2894 |
| 446 | Ga0105249_10133429 | 3300009553 | Bacteria | 2373 |
| 447 | Ga0105249_10209741 | 3300009553 | Bacteria | 1911 |
| 448 | Ga0105249_10322304 | 3300009553 | Bacteria | 1557 |
| 449 | Ga0105249_10435755 | 3300009553 | Bacteria | 1347 |
| 450 | Ga0105249_10524346 | 3300009553 | Bacteria | 1232 |
| 451 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 452 | Ga0105239_10000785 | 3300010375 | Bacteria | 45044 |
| 453 | Ga0105239_10090248 | 3300010375 | Bacteria | 3381 |
| 454 | Ga0105239_10192023 | 3300010375 | Bacteria | 2286 |
| 455 | Ga0105239_10206574 | 3300010375 | Bacteria | 2201 |
| 456 | Ga0105239_10236788 | 3300010375 | Bacteria | 2049 |
| 457 | Ga0105239_10240773 | 3300010375 | Bacteria | 2030 |
| 458 | Ga0105239_10335860 | 3300010375 | Bacteria | 1705 |
| 459 | Ga0105239_10376028 | 3300010375 | Bacteria | 1606 |
| 460 | Ga0105239_10410117 | 3300010375 | Bacteria | 1534 |
| 461 | Ga0105239_10485819 | 3300010375 | Bacteria | 1403 |
| 462 | Ga0105246_10017603 | 3300011119 | Bacteria | 4545 |
| 463 | Ga0105246_10098219 | 3300011119 | Bacteria | 2127 |
| 464 | Ga0105246_10315264 | 3300011119 | Bacteria | 1268 |
| 465 | Ga0105246_10324771 | 3300011119 | Bacteria | 1252 |
| 466 | Ga0157373_10016186 | 3300013100 | Bacteria | 5442 |
| 467 | Ga0157373_10092062 | 3300013100 | Bacteria | 2135 |
| 468 | Ga0157373_10132512 | 3300013100 | Bacteria | 1753 |
| 469 | Ga0157371_10048769 | 3300013102 | Bacteria | 3010 |
| 470 | Ga0157371_10144490 | 3300013102 | Bacteria | 1695 |
| 471 | Ga0157371_10356050 | 3300013102 | Bacteria | 1066 |
| 472 | Ga0157370_10000839 | 3300013104 | Bacteria | 39014 |
| 473 | Ga0157370_10006823 | 3300013104 | Bacteria | 12514 |
| 474 | Ga0157370_10121472 | 3300013104 | Bacteria | 2439 |
| 475 | Ga0157370_10450449 | 3300013104 | Bacteria | 1183 |
| 476 | Ga0157370_10680122 | 3300013104 | Bacteria | 940 |
| 477 | Ga0157369_10039285 | 3300013105 | Bacteria | 5172 |
| 478 | Ga0157369_10053379 | 3300013105 | Bacteria | 4370 |
| 479 | Ga0157369_10083054 | 3300013105 | Bacteria | 3427 |
| 480 | Ga0157369_10100053 | 3300013105 | Bacteria | 3090 |
| 481 | Ga0157369_10104624 | 3300013105 | Bacteria | 3014 |
| 482 | Ga0157369_10192363 | 3300013105 | Bacteria | 2143 |
| 483 | Ga0157369_10301339 | 3300013105 | Bacteria | 1667 |
| 484 | Ga0157369_10343029 | 3300013105 | Bacteria | 1552 |
| 485 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 486 | Ga0157374_10004285 | 3300013296 | Bacteria | 11997 |
| 487 | Ga0157374_10008464 | 3300013296 | Bacteria | 8797 |
| 488 | Ga0157374_10025420 | 3300013296 | Bacteria | 5318 |
| 489 | Ga0157374_10097036 | 3300013296 | Bacteria | 2820 |
| 490 | Ga0157374_10101752 | 3300013296 | Bacteria | 2755 |
| 491 | Ga0157374_10152435 | 3300013296 | Bacteria | 2248 |
| 492 | Ga0157374_10189753 | 3300013296 | Bacteria | 2010 |
| 493 | Ga0157374_10391189 | 3300013296 | Bacteria | 1386 |
| 494 | Ga0157374_10516632 | 3300013296 | Bacteria | 1200 |
| 495 | Ga0157374_10519786 | 3300013296 | Bacteria | 1196 |
| 496 | Ga0157374_10535483 | 3300013296 | Bacteria | 1178 |
| 497 | Ga0157374_10854522 | 3300013296 | Bacteria | 927 |
| 498 | Ga0157374_11249023 | 3300013296 | Bacteria | 764 |
| 499 | Ga0157378_10011078 | 3300013297 | Bacteria | 7892 |
| 500 | Ga0157378_10011450 | 3300013297 | Bacteria | 7762 |
| 501 | Ga0157378_10017714 | 3300013297 | Bacteria | 6253 |
| 502 | Ga0157378_10021827 | 3300013297 | Bacteria | 5630 |
| 503 | Ga0157378_10048565 | 3300013297 | Bacteria | 3774 |
| 504 | Ga0157378_10118435 | 3300013297 | Unclassified | 2438 |
| 505 | Ga0157378_10322662 | 3300013297 | Bacteria | 1501 |
| 506 | Ga0157378_10512683 | 3300013297 | Unclassified | 1200 |
| 507 | Ga0157378_10534989 | 3300013297 | Bacteria | 1175 |
| 508 | Ga0157378_10965802 | 3300013297 | Bacteria | 885 |
| 509 | Ga0157378_11019935 | 3300013297 | Bacteria | 862 |
| 510 | Ga0157378_11023952 | 3300013297 | Bacteria | 861 |
| 511 | Ga0163162_10000331 | 3300013306 | Bacteria | 43319 |
| 512 | Ga0163162_10000967 | 3300013306 | Bacteria | 26666 |
| 513 | Ga0163162_10005326 | 3300013306 | Bacteria | 12412 |
| 514 | Ga0163162_10005839 | 3300013306 | Bacteria | 11903 |
| 515 | Ga0163162_10014930 | 3300013306 | Bacteria | 7585 |
| 516 | Ga0163162_10023196 | 3300013306 | Bacteria | 6122 |
| 517 | Ga0163162_10044468 | 3300013306 | Bacteria | 4448 |
| 518 | Ga0163162_10081120 | 3300013306 | Bacteria | 3314 |
| 519 | Ga0163162_10086357 | 3300013306 | Bacteria | 3215 |
| 520 | Ga0163162_10104877 | 3300013306 | Bacteria | 2921 |
| 521 | Ga0163162_10126784 | 3300013306 | Bacteria | 2659 |
| 522 | Ga0163162_10176964 | 3300013306 | Bacteria | 2259 |
| 523 | Ga0163162_10195439 | 3300013306 | Bacteria | 2151 |
| 524 | Ga0163162_10256648 | 3300013306 | Unclassified | 1880 |
| 525 | Ga0163162_10339926 | 3300013306 | Bacteria | 1633 |
| 526 | Ga0163162_11252393 | 3300013306 | Unclassified | 842 |
| 527 | Ga0157372_10000921 | 3300013307 | Bacteria | 32008 |
| 528 | Ga0157372_10002207 | 3300013307 | Bacteria | 21135 |
| 529 | Ga0157372_10015967 | 3300013307 | Bacteria | 8054 |
| 530 | Ga0157372_10125895 | 3300013307 | Bacteria | 2946 |
| 531 | Ga0157372_10229607 | 3300013307 | Bacteria | 2151 |
| 532 | Ga0157372_10480557 | 3300013307 | Bacteria | 1448 |
| 533 | Ga0157372_10834613 | 3300013307 | Unclassified | 1070 |
| 534 | Ga0157372_11452223 | 3300013307 | Unclassified | 790 |
| 535 | Ga0157375_10000229 | 3300013308 | Bacteria | 52257 |
| 536 | Ga0157375_10003117 | 3300013308 | Bacteria | 14392 |
| 537 | Ga0157375_10043753 | 3300013308 | Bacteria | 4345 |
| 538 | Ga0157375_10049275 | 3300013308 | Bacteria | 4126 |
| 539 | Ga0157375_10082027 | 3300013308 | Bacteria | 3266 |
| 540 | Ga0157375_10115476 | 3300013308 | Bacteria | 2787 |
| 541 | Ga0157375_10117019 | 3300013308 | Bacteria | 2770 |
| 542 | Ga0157375_10198617 | 3300013308 | Bacteria | 2161 |
| 543 | Ga0157375_10219068 | 3300013308 | Bacteria | 2061 |
| 544 | Ga0157375_10227378 | 3300013308 | Bacteria | 2024 |
| 545 | Ga0157375_10322576 | 3300013308 | Bacteria | 1709 |
| 546 | Ga0157375_10585055 | 3300013308 | Bacteria | 1276 |
| 547 | Ga0157375_10798047 | 3300013308 | Bacteria | 1093 |
| 548 | Ga0157375_10936927 | 3300013308 | Bacteria | 1008 |
| 549 | Ga0157375_10984019 | 3300013308 | Bacteria | 984 |
| 550 | Ga0157375_11096202 | 3300013308 | Bacteria | 932 |
| 551 | Ga0163163_10000538 | 3300014325 | Bacteria | 33542 |
| 552 | Ga0163163_10000653 | 3300014325 | Bacteria | 29691 |
| 553 | Ga0163163_10039883 | 3300014325 | Bacteria | 4584 |
| 554 | Ga0163163_10236928 | 3300014325 | Bacteria | 1874 |
| 555 | Ga0163163_10247142 | 3300014325 | Bacteria | 1834 |
| 556 | Ga0163163_10353157 | 3300014325 | Bacteria | 1526 |
| 557 | Ga0163163_11020906 | 3300014325 | Unclassified | 890 |
| 558 | Ga0163163_11687486 | 3300014325 | Unclassified | 694 |
| 559 | Ga0157380_10009363 | 3300014326 | Bacteria | 7015 |
| 560 | Ga0157380_10046212 | 3300014326 | Bacteria | 3418 |
| 561 | Ga0157380_10151308 | 3300014326 | Bacteria | 2006 |
| 562 | Ga0157380_10430802 | 3300014326 | Unclassified | 1261 |
| 563 | Ga0157380_10512078 | 3300014326 | Bacteria | 1168 |
| 564 | Ga0157380_10613153 | 3300014326 | Bacteria | 1079 |
| 565 | Ga0157380_10757211 | 3300014326 | Bacteria | 983 |
| 566 | Ga0157380_11067610 | 3300014326 | Bacteria | 845 |
| 567 | Ga0157377_10000932 | 3300014745 | Bacteria | 12243 |
| 568 | Ga0157377_10011561 | 3300014745 | Bacteria | 4412 |
| 569 | Ga0157377_10052986 | 3300014745 | Bacteria | 2292 |
| 570 | Ga0157377_10191453 | 3300014745 | Unclassified | 1293 |
| 571 | Ga0157377_10289435 | 3300014745 | Bacteria | 1077 |
| 572 | Ga0157379_10001640 | 3300014968 | Bacteria | 18479 |
| 573 | Ga0157379_10002723 | 3300014968 | Bacteria | 14918 |
| 574 | Ga0157379_10025305 | 3300014968 | Bacteria | 5273 |
| 575 | Ga0157379_10039098 | 3300014968 | Bacteria | 4233 |
| 576 | Ga0157379_10053136 | 3300014968 | Bacteria | 3619 |
| 577 | Ga0157379_10063814 | 3300014968 | Bacteria | 3292 |
| 578 | Ga0157379_10153679 | 3300014968 | Bacteria | 2076 |
| 579 | Ga0157379_10160896 | 3300014968 | Bacteria | 2026 |
| 580 | Ga0157379_10268112 | 3300014968 | Unclassified | 1552 |
| 581 | Ga0157379_10331601 | 3300014968 | Bacteria | 1390 |
| 582 | Ga0157376_10002682 | 3300014969 | Bacteria | 12095 |
| 583 | Ga0157376_10004414 | 3300014969 | Bacteria | 9794 |
| 584 | Ga0157376_10005888 | 3300014969 | Bacteria | 8604 |
| 585 | Ga0157376_10017174 | 3300014969 | Bacteria | 5512 |
| 586 | Ga0157376_10037066 | 3300014969 | Bacteria | 3954 |
| 587 | Ga0157376_10054689 | 3300014969 | Bacteria | 3329 |
| 588 | Ga0157376_10055401 | 3300014969 | Bacteria | 3308 |
| 589 | Ga0157376_10089452 | 3300014969 | Bacteria | 2662 |
| 590 | Ga0157376_10133715 | 3300014969 | Bacteria | 2217 |
| 591 | Ga0157376_10201804 | 3300014969 | Viruses | 1830 |
| 592 | Ga0157376_10369875 | 3300014969 | Unclassified | 1377 |
| 593 | Ga0163161_10023525 | 3300017792 | Bacteria | 4347 |
| 594 | Ga0163161_10027192 | 3300017792 | Bacteria | 4057 |
| 595 | Ga0163161_10041919 | 3300017792 | Bacteria | 3290 |
| 596 | Ga0163161_10129167 | 3300017792 | Bacteria | 1905 |
| 597 | Ga0163161_10210271 | 3300017792 | Bacteria | 1503 |
| 598 | Ga0163161_10244272 | 3300017792 | Bacteria | 1397 |
| 599 | Ga0213876_10022962 | 3300021384 | Bacteria | 3295 |
| 600 | Ga0209258_100151 | 3300025242 | Bacteria | 160444 |
| 601 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 602 | Ga0209646_1000823 | 3300025246 | Bacteria | 10466 |
| 603 | Ga0209026_1000434 | 3300025250 | Bacteria | 34861 |
| 604 | Ga0209148_1000154 | 3300025254 | Bacteria | 145214 |
| 605 | Ga0209758_1037890 | 3300025297 | Unclassified | 1857 |
| 606 | Ga0207426_1000030 | 3300025302 | Bacteria | 461478 |
| 607 | Ga0207426_1000497 | 3300025302 | Bacteria | 58506 |
| 608 | Ga0207697_10093949 | 3300025315 | Bacteria | 1273 |
| 609 | Ga0207656_10004204 | 3300025321 | Bacteria | 5010 |
| 610 | Ga0207710_10003162 | 3300025900 | Bacteria | 7372 |
| 611 | Ga0207710_10030055 | 3300025900 | Bacteria | 2368 |
| 612 | Ga0207688_10039173 | 3300025901 | Bacteria | 2633 |
| 613 | Ga0207688_10102142 | 3300025901 | Bacteria | 1657 |
| 614 | Ga0207680_10000162 | 3300025903 | Bacteria | 32782 |
| 615 | Ga0207680_10011575 | 3300025903 | Bacteria | 4461 |
| 616 | Ga0207647_10018104 | 3300025904 | Bacteria | 4774 |
| 617 | Ga0207647_10112441 | 3300025904 | Bacteria | 1609 |
| 618 | Ga0207647_10157173 | 3300025904 | Bacteria | 1327 |
| 619 | Ga0207685_10245320 | 3300025905 | Bacteria | 864 |
| 620 | Ga0207645_10000782 | 3300025907 | Bacteria | 26555 |
| 621 | Ga0207645_10009564 | 3300025907 | Bacteria | 6697 |
| 622 | Ga0207645_10032778 | 3300025907 | Bacteria | 3340 |
| 623 | Ga0207645_10082780 | 3300025907 | Unclassified | 2057 |
| 624 | Ga0207645_10299253 | 3300025907 | Bacteria | 1071 |
| 625 | Ga0207643_10003598 | 3300025908 | Bacteria | 8348 |
| 626 | Ga0207643_10024156 | 3300025908 | Unclassified | 3354 |
| 627 | Ga0207643_10156236 | 3300025908 | Bacteria | 1370 |
| 628 | Ga0207705_10140693 | 3300025909 | Unclassified | 1802 |
| 629 | Ga0207705_10147114 | 3300025909 | Bacteria | 1763 |
| 630 | Ga0207654_10003155 | 3300025911 | Bacteria | 8333 |
| 631 | Ga0207654_10003491 | 3300025911 | Bacteria | 7952 |
| 632 | Ga0207654_10210525 | 3300025911 | Bacteria | 1285 |
| 633 | Ga0207654_10270390 | 3300025911 | Unclassified | 1146 |
| 634 | Ga0207654_10317871 | 3300025911 | Bacteria | 1063 |
| 635 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 636 | Ga0207707_10028865 | 3300025912 | Bacteria | 4848 |
| 637 | Ga0207707_10121080 | 3300025912 | Bacteria | 2288 |
| 638 | Ga0207707_10160562 | 3300025912 | Bacteria | 1965 |
| 639 | Ga0207707_10220480 | 3300025912 | Bacteria | 1651 |
| 640 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 641 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 642 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 643 | Ga0207695_10004602 | 3300025913 | Bacteria | 18731 |
| 644 | Ga0207695_10020015 | 3300025913 | Bacteria | 7681 |
| 645 | Ga0207695_10094718 | 3300025913 | Bacteria | 2992 |
| 646 | Ga0207695_10111165 | 3300025913 | Bacteria | 2719 |
| 647 | Ga0207695_10141759 | 3300025913 | Bacteria | 2351 |
| 648 | Ga0207695_10175536 | 3300025913 | Bacteria | 2065 |
| 649 | Ga0207695_10206800 | 3300025913 | Bacteria | 1875 |
| 650 | Ga0207695_10261200 | 3300025913 | Bacteria | 1629 |
| 651 | Ga0207695_10446920 | 3300025913 | Bacteria | 1176 |
| 652 | Ga0207695_10452825 | 3300025913 | Bacteria | 1166 |
| 653 | Ga0207695_10514728 | 3300025913 | Bacteria | 1078 |
| 654 | Ga0207671_10001044 | 3300025914 | Bacteria | 33679 |
| 655 | Ga0207671_10002907 | 3300025914 | Bacteria | 17690 |
| 656 | Ga0207671_10003799 | 3300025914 | Bacteria | 14813 |
| 657 | Ga0207671_10003904 | 3300025914 | Bacteria | 14529 |
| 658 | Ga0207671_10024892 | 3300025914 | Bacteria | 4497 |
| 659 | Ga0207671_10047813 | 3300025914 | Bacteria | 3166 |
| 660 | Ga0207660_10005186 | 3300025917 | Bacteria | 8471 |
| 661 | Ga0207660_10013385 | 3300025917 | Bacteria | 5377 |
| 662 | Ga0207660_10099182 | 3300025917 | Bacteria | 2173 |
| 663 | Ga0207660_10108430 | 3300025917 | Bacteria | 2085 |
| 664 | Ga0207660_10201863 | 3300025917 | Bacteria | 1553 |
| 665 | Ga0207660_10445736 | 3300025917 | Unclassified | 1046 |
| 666 | Ga0207662_10012024 | 3300025918 | Bacteria | 4813 |
| 667 | Ga0207662_10239060 | 3300025918 | Unclassified | 1188 |
| 668 | Ga0207657_10010433 | 3300025919 | Bacteria | 9272 |
| 669 | Ga0207657_10042823 | 3300025919 | Bacteria | 3991 |
| 670 | Ga0207657_10270275 | 3300025919 | Unclassified | 1351 |
| 671 | Ga0207649_10009815 | 3300025920 | Bacteria | 5245 |
| 672 | Ga0207649_10255441 | 3300025920 | Bacteria | 1264 |
| 673 | Ga0207649_10668233 | 3300025920 | Unclassified | 804 |
| 674 | Ga0207652_10000384 | 3300025921 | Bacteria | 46082 |
| 675 | Ga0207652_10020709 | 3300025921 | Bacteria | 5421 |
| 676 | Ga0207652_10106805 | 3300025921 | Bacteria | 2478 |
| 677 | Ga0207652_10159287 | 3300025921 | Bacteria | 2023 |
| 678 | Ga0207652_10179079 | 3300025921 | Bacteria | 1904 |
| 679 | Ga0207652_10180240 | 3300025921 | Bacteria | 1898 |
| 680 | Ga0207681_10330130 | 3300025923 | Unclassified | 1215 |
| 681 | Ga0207681_10398400 | 3300025923 | Bacteria | 1111 |
| 682 | Ga0207681_10438157 | 3300025923 | Bacteria | 1061 |
| 683 | Ga0207681_10727514 | 3300025923 | Bacteria | 826 |
| 684 | Ga0207694_10007231 | 3300025924 | Bacteria | 8426 |
| 685 | Ga0207694_10024476 | 3300025924 | Bacteria | 4586 |
| 686 | Ga0207694_10189791 | 3300025924 | Bacteria | 1669 |
| 687 | Ga0207650_10029550 | 3300025925 | Bacteria | 3941 |
| 688 | Ga0207650_10069495 | 3300025925 | Unclassified | 2646 |
| 689 | Ga0207650_10084153 | 3300025925 | Unclassified | 2418 |
| 690 | Ga0207650_10086979 | 3300025925 | Bacteria | 2380 |
| 691 | Ga0207650_10112906 | 3300025925 | Unclassified | 2106 |
| 692 | Ga0207650_10143351 | 3300025925 | Unclassified | 1880 |
| 693 | Ga0207650_10227135 | 3300025925 | Bacteria | 1504 |
| 694 | Ga0207650_10350160 | 3300025925 | Bacteria | 1215 |
| 695 | Ga0207650_10612459 | 3300025925 | Bacteria | 916 |
| 696 | Ga0207650_10806457 | 3300025925 | Unclassified | 796 |
| 697 | Ga0207659_10094854 | 3300025926 | Bacteria | 2236 |
| 698 | Ga0207659_10428587 | 3300025926 | Bacteria | 1110 |
| 699 | Ga0207687_10086348 | 3300025927 | Bacteria | 2278 |
| 700 | Ga0207687_10561668 | 3300025927 | Bacteria | 958 |
| 701 | Ga0207644_10002938 | 3300025931 | Bacteria | 10975 |
| 702 | Ga0207644_10085126 | 3300025931 | Bacteria | 2345 |
| 703 | Ga0207644_10107695 | 3300025931 | Bacteria | 2103 |
| 704 | Ga0207644_10118442 | 3300025931 | Bacteria | 2012 |
| 705 | Ga0207644_10501524 | 3300025931 | Bacteria | 1001 |
| 706 | Ga0207690_10017654 | 3300025932 | Bacteria | 4363 |
| 707 | Ga0207706_10006768 | 3300025933 | Bacteria | 10596 |
| 708 | Ga0207706_10022065 | 3300025933 | Bacteria | 5714 |
| 709 | Ga0207706_10036407 | 3300025933 | Bacteria | 4371 |
| 710 | Ga0207706_10060668 | 3300025933 | Bacteria | 3331 |
| 711 | Ga0207706_10113169 | 3300025933 | Bacteria | 2387 |
| 712 | Ga0207706_10198002 | 3300025933 | Bacteria | 1762 |
| 713 | Ga0207686_10003538 | 3300025934 | Bacteria | 8377 |
| 714 | Ga0207686_10025792 | 3300025934 | Bacteria | 3424 |
| 715 | Ga0207686_10031401 | 3300025934 | Bacteria | 3153 |
| 716 | Ga0207686_10040558 | 3300025934 | Bacteria | 2831 |
| 717 | Ga0207686_10951096 | 3300025934 | Unclassified | 695 |
| 718 | Ga0207670_10013524 | 3300025936 | Bacteria | 4817 |
| 719 | Ga0207670_10455138 | 3300025936 | Bacteria | 1032 |
| 720 | Ga0207670_10718211 | 3300025936 | Bacteria | 828 |
| 721 | Ga0207669_10089885 | 3300025937 | Bacteria | 1995 |
| 722 | Ga0207704_10051601 | 3300025938 | Bacteria | 2488 |
| 723 | Ga0207704_10054704 | 3300025938 | Bacteria | 2435 |
| 724 | Ga0207704_10169619 | 3300025938 | Bacteria | 1563 |
| 725 | Ga0207704_10246745 | 3300025938 | Unclassified | 1338 |
| 726 | Ga0207704_10723475 | 3300025938 | Bacteria | 826 |
| 727 | Ga0207691_10006538 | 3300025940 | Bacteria | 11250 |
| 728 | Ga0207691_10011421 | 3300025940 | Bacteria | 8521 |
| 729 | Ga0207691_10066380 | 3300025940 | Bacteria | 3264 |
| 730 | Ga0207691_10075281 | 3300025940 | Bacteria | 3044 |
| 731 | Ga0207691_10129415 | 3300025940 | Bacteria | 2231 |
| 732 | Ga0207691_10302352 | 3300025940 | Bacteria | 1374 |
| 733 | Ga0207711_10097280 | 3300025941 | Bacteria | 2599 |
| 734 | Ga0207689_10001006 | 3300025942 | Bacteria | 27060 |
| 735 | Ga0207689_10004039 | 3300025942 | Bacteria | 13333 |
| 736 | Ga0207689_10011687 | 3300025942 | Bacteria | 7524 |
| 737 | Ga0207689_10015929 | 3300025942 | Bacteria | 6365 |
| 738 | Ga0207689_10036692 | 3300025942 | Bacteria | 4069 |
| 739 | Ga0207689_10050801 | 3300025942 | Bacteria | 3417 |
| 740 | Ga0207689_10051842 | 3300025942 | Bacteria | 3382 |
| 741 | Ga0207689_10138954 | 3300025942 | Bacteria | 2001 |
| 742 | Ga0207689_10231980 | 3300025942 | Bacteria | 1525 |
| 743 | Ga0207689_10371134 | 3300025942 | Bacteria | 1191 |
| 744 | Ga0207689_10651659 | 3300025942 | Bacteria | 887 |
| 745 | Ga0207689_10659378 | 3300025942 | Bacteria | 882 |
| 746 | Ga0207661_10006472 | 3300025944 | Bacteria | 8280 |
| 747 | Ga0207661_10006982 | 3300025944 | Bacteria | 8009 |
| 748 | Ga0207661_10009253 | 3300025944 | Bacteria | 7058 |
| 749 | Ga0207661_10076460 | 3300025944 | Bacteria | 2750 |
| 750 | Ga0207661_10310305 | 3300025944 | Bacteria | 1416 |
| 751 | Ga0207661_11061858 | 3300025944 | Unclassified | 746 |
| 752 | Ga0207679_10003010 | 3300025945 | Bacteria | 10450 |
| 753 | Ga0207679_10086960 | 3300025945 | Unclassified | 2405 |
| 754 | Ga0207679_10148809 | 3300025945 | Bacteria | 1903 |
| 755 | Ga0207679_10193919 | 3300025945 | Bacteria | 1691 |
| 756 | Ga0207679_10214210 | 3300025945 | Bacteria | 1617 |
| 757 | Ga0207679_10485240 | 3300025945 | Bacteria | 1101 |
| 758 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 759 | Ga0207667_10015290 | 3300025949 | Bacteria | 8725 |
| 760 | Ga0207667_10021496 | 3300025949 | Bacteria | 7148 |
| 761 | Ga0207667_10027988 | 3300025949 | Bacteria | 6126 |
| 762 | Ga0207667_10044124 | 3300025949 | Bacteria | 4727 |
| 763 | Ga0207667_10061072 | 3300025949 | Bacteria | 3944 |
| 764 | Ga0207667_10100565 | 3300025949 | Bacteria | 2982 |
| 765 | Ga0207667_10571436 | 3300025949 | Bacteria | 1142 |
| 766 | Ga0207651_10001099 | 3300025960 | Bacteria | 12009 |
| 767 | Ga0207651_10165244 | 3300025960 | Bacteria | 1739 |
| 768 | Ga0207651_10213080 | 3300025960 | Unclassified | 1556 |
| 769 | Ga0207651_10277221 | 3300025960 | Bacteria | 1384 |
| 770 | Ga0207651_10298807 | 3300025960 | Bacteria | 1338 |
| 771 | Ga0207651_10469620 | 3300025960 | Bacteria | 1082 |
| 772 | Ga0207651_10609985 | 3300025960 | Unclassified | 955 |
| 773 | Ga0207651_10848885 | 3300025960 | Bacteria | 811 |
| 774 | Ga0207712_10009497 | 3300025961 | Bacteria | 6153 |
| 775 | Ga0207712_10011985 | 3300025961 | Bacteria | 5532 |
| 776 | Ga0207712_10052658 | 3300025961 | Bacteria | 2852 |
| 777 | Ga0207712_10082148 | 3300025961 | Bacteria | 2348 |
| 778 | Ga0207712_10140469 | 3300025961 | Unclassified | 1853 |
| 779 | Ga0207712_10203460 | 3300025961 | Bacteria | 1571 |
| 780 | Ga0207712_10209950 | 3300025961 | Unclassified | 1550 |
| 781 | Ga0207712_10255179 | 3300025961 | Bacteria | 1419 |
| 782 | Ga0207668_10000843 | 3300025972 | Bacteria | 18537 |
| 783 | Ga0207668_10270488 | 3300025972 | Unclassified | 1389 |
| 784 | Ga0207668_10299956 | 3300025972 | Bacteria | 1326 |
| 785 | Ga0207640_10012737 | 3300025981 | Bacteria | 4799 |
| 786 | Ga0207640_10147321 | 3300025981 | Bacteria | 1724 |
| 787 | Ga0207640_10189077 | 3300025981 | Bacteria | 1550 |
| 788 | Ga0207640_10287420 | 3300025981 | Bacteria | 1295 |
| 789 | Ga0207640_10308625 | 3300025981 | Bacteria | 1255 |
| 790 | Ga0207640_10328689 | 3300025981 | Bacteria | 1220 |
| 791 | Ga0207640_10363026 | 3300025981 | Bacteria | 1168 |
| 792 | Ga0207658_10061094 | 3300025986 | Bacteria | 2814 |
| 793 | Ga0207658_10062871 | 3300025986 | Bacteria | 2780 |
| 794 | Ga0207658_10201871 | 3300025986 | Bacteria | 1660 |
| 795 | Ga0207658_10280211 | 3300025986 | Bacteria | 1429 |
| 796 | Ga0207677_10008700 | 3300026023 | Bacteria | 5684 |
| 797 | Ga0207677_10019809 | 3300026023 | Bacteria | 4072 |
| 798 | Ga0207677_10023899 | 3300026023 | Bacteria | 3785 |
| 799 | Ga0207677_10903456 | 3300026023 | Bacteria | 796 |
| 800 | Ga0207677_11044310 | 3300026023 | Bacteria | 743 |
| 801 | Ga0207703_10005016 | 3300026035 | Bacteria | 10732 |
| 802 | Ga0207703_10050477 | 3300026035 | Bacteria | 3367 |
| 803 | Ga0207703_10354175 | 3300026035 | Bacteria | 1352 |
| 804 | Ga0207703_10400092 | 3300026035 | Bacteria | 1274 |
| 805 | Ga0207639_10003645 | 3300026041 | Bacteria | 10352 |
| 806 | Ga0207639_10045139 | 3300026041 | Bacteria | 3318 |
| 807 | Ga0207639_10048724 | 3300026041 | Bacteria | 3208 |
| 808 | Ga0207639_10132582 | 3300026041 | Bacteria | 2065 |
| 809 | Ga0207639_10177426 | 3300026041 | Bacteria | 1809 |
| 810 | Ga0207639_10191922 | 3300026041 | Bacteria | 1745 |
| 811 | Ga0207639_10224058 | 3300026041 | Bacteria | 1626 |
| 812 | Ga0207639_10239208 | 3300026041 | Bacteria | 1577 |
| 813 | Ga0207639_10249979 | 3300026041 | Bacteria | 1546 |
| 814 | Ga0207639_10361966 | 3300026041 | Bacteria | 1298 |
| 815 | Ga0207639_10858552 | 3300026041 | Bacteria | 847 |
| 816 | Ga0207678_10036360 | 3300026067 | Bacteria | 4287 |
| 817 | Ga0207678_10824553 | 3300026067 | Bacteria | 819 |
| 818 | Ga0207678_10824573 | 3300026067 | Bacteria | 819 |
| 819 | Ga0207708_10033757 | 3300026075 | Bacteria | 3890 |
| 820 | Ga0207708_10236353 | 3300026075 | Bacteria | 1468 |
| 821 | Ga0207708_10260555 | 3300026075 | Bacteria | 1400 |
| 822 | Ga0207702_10079557 | 3300026078 | Bacteria | 2841 |
| 823 | Ga0207702_10193997 | 3300026078 | Bacteria | 1879 |
| 824 | Ga0207702_10500460 | 3300026078 | Bacteria | 1185 |
| 825 | Ga0207702_10531882 | 3300026078 | Bacteria | 1148 |
| 826 | Ga0207641_10000226 | 3300026088 | Bacteria | 72539 |
| 827 | Ga0207641_10001217 | 3300026088 | Bacteria | 25759 |
| 828 | Ga0207641_10004894 | 3300026088 | Bacteria | 11515 |
| 829 | Ga0207641_10064994 | 3300026088 | Bacteria | 3120 |
| 830 | Ga0207641_10089306 | 3300026088 | Bacteria | 2693 |
| 831 | Ga0207641_10091888 | 3300026088 | Bacteria | 2657 |
| 832 | Ga0207641_10272700 | 3300026088 | Bacteria | 1588 |
| 833 | Ga0207641_10365843 | 3300026088 | Bacteria | 1378 |
| 834 | Ga0207648_10002745 | 3300026089 | Bacteria | 18711 |
| 835 | Ga0207648_10003442 | 3300026089 | Bacteria | 16603 |
| 836 | Ga0207648_10012585 | 3300026089 | Bacteria | 7917 |
| 837 | Ga0207648_10075871 | 3300026089 | Bacteria | 2930 |
| 838 | Ga0207648_10075913 | 3300026089 | Bacteria | 2929 |
| 839 | Ga0207648_10078660 | 3300026089 | Bacteria | 2877 |
| 840 | Ga0207648_10082137 | 3300026089 | Unclassified | 2810 |
| 841 | Ga0207648_10495006 | 3300026089 | Bacteria | 1118 |
| 842 | Ga0207676_10009153 | 3300026095 | Bacteria | 7052 |
| 843 | Ga0207676_10009837 | 3300026095 | Bacteria | 6802 |
| 844 | Ga0207676_10022211 | 3300026095 | Bacteria | 4665 |
| 845 | Ga0207676_10034551 | 3300026095 | Bacteria | 3829 |
| 846 | Ga0207676_10130570 | 3300026095 | Bacteria | 2135 |
| 847 | Ga0207676_10133209 | 3300026095 | Bacteria | 2116 |
| 848 | Ga0207676_10208370 | 3300026095 | Bacteria | 1732 |
| 849 | Ga0207676_10304526 | 3300026095 | Bacteria | 1456 |
| 850 | Ga0207676_10600121 | 3300026095 | Unclassified | 1057 |
| 851 | Ga0207676_10804568 | 3300026095 | Bacteria | 917 |
| 852 | Ga0207674_10000672 | 3300026116 | Bacteria | 44419 |
| 853 | Ga0207674_10009363 | 3300026116 | Bacteria | 11203 |
| 854 | Ga0207674_10013131 | 3300026116 | Bacteria | 9219 |
| 855 | Ga0207674_10078260 | 3300026116 | Bacteria | 3312 |
| 856 | Ga0207674_10102221 | 3300026116 | Bacteria | 2846 |
| 857 | Ga0207674_10119089 | 3300026116 | Bacteria | 2609 |
| 858 | Ga0207674_10191290 | 3300026116 | Bacteria | 1996 |
| 859 | Ga0207674_10367721 | 3300026116 | Unclassified | 1390 |
| 860 | Ga0207674_10743548 | 3300026116 | Bacteria | 947 |
| 861 | Ga0207674_11257823 | 3300026116 | Bacteria | 710 |
| 862 | Ga0207675_100000124 | 3300026118 | Bacteria | 63805 |
| 863 | Ga0207675_100042058 | 3300026118 | Bacteria | 4265 |
| 864 | Ga0207675_100066501 | 3300026118 | Bacteria | 3369 |
| 865 | Ga0207675_100123061 | 3300026118 | Bacteria | 2456 |
| 866 | Ga0207675_100132394 | 3300026118 | Unclassified | 2364 |
| 867 | Ga0207675_100215203 | 3300026118 | Bacteria | 1850 |
| 868 | Ga0207675_100337963 | 3300026118 | Bacteria | 1474 |
| 869 | Ga0207675_100407759 | 3300026118 | Bacteria | 1340 |
| 870 | Ga0207683_10010911 | 3300026121 | Bacteria | 7748 |
| 871 | Ga0207683_10015180 | 3300026121 | Bacteria | 6554 |
| 872 | Ga0207683_10069331 | 3300026121 | Bacteria | 3114 |
| 873 | Ga0207683_10083694 | 3300026121 | Unclassified | 2835 |
| 874 | Ga0207683_10267570 | 3300026121 | Bacteria | 1561 |
| 875 | Ga0207683_10436473 | 3300026121 | Bacteria | 1207 |
| 876 | Ga0207698_10001082 | 3300026142 | Bacteria | 15843 |
| 877 | Ga0207698_10018942 | 3300026142 | Bacteria | 4701 |
| 878 | Ga0207698_10055253 | 3300026142 | Bacteria | 3059 |
| 879 | Ga0207698_10073671 | 3300026142 | Bacteria | 2720 |
| 880 | Ga0207698_10117304 | 3300026142 | Bacteria | 2245 |
| 881 | Ga0207698_10140320 | 3300026142 | Bacteria | 2081 |
| 882 | Ga0207698_10366157 | 3300026142 | Bacteria | 1367 |
| 883 | Ga0207698_10470277 | 3300026142 | Bacteria | 1217 |
| 884 | Ga0207698_10587283 | 3300026142 | Bacteria | 1097 |
| 885 | Ga0207698_10748676 | 3300026142 | Unclassified | 976 |
| 886 | Ga0207428_10196734 | 3300027907 | Bacteria | 1518 |
| 887 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 888 | Ga0268266_10085877 | 3300028379 | Bacteria | 2750 |
| 889 | Ga0268266_10416980 | 3300028379 | Bacteria | 1272 |
| 890 | Ga0268265_10127934 | 3300028380 | Bacteria | 2106 |
| 891 | Ga0268265_10211380 | 3300028380 | Bacteria | 1691 |
| 892 | Ga0268265_10520123 | 3300028380 | Bacteria | 1125 |
| 893 | Ga0268265_10551345 | 3300028380 | Bacteria | 1094 |
| 894 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 895 | Ga0268264_10003860 | 3300028381 | Bacteria | 12861 |
| 896 | Ga0268264_10008457 | 3300028381 | Bacteria | 8559 |
| 897 | Ga0268264_10015087 | 3300028381 | Bacteria | 6337 |
| 898 | Ga0268264_10018061 | 3300028381 | Bacteria | 5768 |
| 899 | Ga0268264_10066255 | 3300028381 | Bacteria | 3045 |
| 900 | Ga0268264_10092890 | 3300028381 | Bacteria | 2605 |
| 901 | Ga0268264_10354427 | 3300028381 | Bacteria | 1398 |
| 902 | Ga0268264_10459618 | 3300028381 | Bacteria | 1235 |
| 903 | Ga0268264_10472905 | 3300028381 | Bacteria | 1218 |
| 904 | Ga0307517_10079111 | 3300028786 | Bacteria | 2833 |
| 905 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 906 | Ga0307515_10009265 | 3300028794 | Bacteria | 19056 |
| 907 | Ga0307515_10201918 | 3300028794 | Unclassified | 1861 |
| 908 | Ga0307511_10000042 | 3300030521 | Bacteria | 102114 |
| 909 | Ga0316177_1100501 | 3300030731 | Unclassified | 1381 |
| 910 | Ga0265327_10000084 | 3300031251 | Bacteria | 204433 |
| 911 | Ga0265327_10000395 | 3300031251 | Bacteria | 81944 |
| 912 | Ga0265327_10011198 | 3300031251 | Bacteria | 6212 |
| 913 | Ga0265327_10023168 | 3300031251 | Bacteria | 3685 |
| 914 | Ga0265327_10168209 | 3300031251 | Bacteria | 1009 |
| 915 | Ga0265316_10169767 | 3300031344 | Bacteria | 1628 |
| 916 | Ga0307513_10151351 | 3300031456 | Bacteria | 2228 |
| 917 | Ga0307513_10285094 | 3300031456 | Bacteria | 1427 |
| 918 | Ga0307513_10625902 | 3300031456 | Bacteria | 784 |
| 919 | Ga0307509_10139082 | 3300031507 | Unclassified | 2368 |
| 920 | Ga0307509_10208553 | 3300031507 | Bacteria | 1782 |
| 921 | Ga0307509_10234366 | 3300031507 | Bacteria | 1635 |
| 922 | Ga0307509_10365330 | 3300031507 | Bacteria | 1161 |
| 923 | Ga0307508_10002100 | 3300031616 | Bacteria | 21430 |
| 924 | Ga0307516_10001558 | 3300031730 | Bacteria | 31533 |
| 925 | Ga0307516_10214020 | 3300031730 | Bacteria | 1640 |
| 926 | Ga0307414_10000003 | 3300032004 | Bacteria | 519751 |
| 927 | Ga0307414_10019125 | 3300032004 | Bacteria | 4237 |
| 928 | Ga0307507_10286948 | 3300033179 | Bacteria | 1023 |
| 929 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 930 | Ga0373934_0117388 | 3300035086 | Unclassified | 1082 |
| 931 | Ga0373934_0232580 | 3300035086 | Unclassified | 761 |
| 932 | Ga0373952_0023997 | 3300035092 | Bacteria | 1306 |
| 933 | Ga0373953_0040200 | 3300035117 | Bacteria | 1857 |
| 934 | Ga0373956_0164875 | 3300035119 | Bacteria | 1045 |
| 935 | Ga0373943_0031071 | 3300035170 | Bacteria | 2532 |
| 936 | Ga0373947_0082304 | 3300035725 | Bacteria | 1995 |
| 937 | Ga0373937_0058916 | 3300036401 | Bacteria | 3528 |
| 938 | Ga0373937_0277658 | 3300036401 | Bacteria | 1582 |
| 939 | Ga0373937_0365304 | 3300036401 | Unclassified | 1368 |
| 940 | Ga0373925_0098421 | 3300037068 | Bacteria | 2245 |
| 941 | Ga0395900_0596943 | 3300037418 | Bacteria | 1045 |
| 942 | Ga0395905_0317315 | 3300037471 | Bacteria | 1448 |
| 943 | Ga0400483_053230 | 3300039062 | Bacteria | 33079 |
| 944 | Ga0400489_34926 | 3300039093 | Bacteria | 1682 |
| 945 | Ga0436365_0175741 | 3300039437 | Bacteria | 2955 |
| 946 | Ga0436365_0203686 | 3300039437 | Bacteria | 3547 |
| 947 | Ga0436365_0881017 | 3300039437 | Bacteria | 14010 |
| 948 | Ga0436365_1079918 | 3300039437 | Bacteria | 37760 |
| 949 | Ga0436365_1735638 | 3300039437 | Bacteria | 1330 |
| 950 | Ga0436363_1382145 | 3300039450 | Bacteria | 1702 |
| 951 | Ga0439436_0001603 | 3300041404 | Bacteria | 6586 |
| 952 | Ga0439439_0014036 | 3300041406 | Bacteria | 1947 |
| 953 | Ga0439439_0041709 | 3300041406 | Bacteria | 1191 |
| 954 | Ga0451791_1161455 | 3300041451 | Bacteria | 1918 |
| 955 | Ga0451841_0473234 | 3300041498 | Bacteria | 746 |
| 956 | Ga0451849_1509768 | 3300041505 | Bacteria | 2016 |
| 957 | Ga0451853_3111860 | 3300041512 | Bacteria | 1118 |
| 958 | Ga0439442_014098 | 3300042002 | Unclassified | 1645 |
| 959 | Ga0439452_061751 | 3300042010 | Bacteria | 838 |
| 960 | Ga0439454_029769 | 3300042011 | Unclassified | 850 |
| 961 | Ga0439457_000788 | 3300042014 | Bacteria | 9461 |
| 962 | Ga0439457_010425 | 3300042014 | Bacteria | 2137 |
| 963 | Ga0439462_0007494 | 3300042015 | Bacteria | 2733 |
| 964 | Ga0450923_055175 | 3300042125 | Bacteria | 859 |
| 965 | Ga0450898_024292 | 3300042134 | Bacteria | 1082 |
| 966 | Ga0439434_0024981 | 3300042435 | Unclassified | 1803 |
| 967 | Ga0439435_0075887 | 3300042436 | Bacteria | 1002 |
| 968 | Ga0451577_0069645 | 3300042876 | Bacteria | 3137 |
| 969 | Ga0466969_0000584 | 3300044656 | Bacteria | 19813 |
| 970 | Ga0466972_0000002 | 3300044658 | Bacteria | 408005 |
| 971 | Ga0466972_0000207 | 3300044658 | Bacteria | 42277 |
| 972 | Ga0466972_0003815 | 3300044658 | Bacteria | 7496 |
| 973 | Ga0466972_0137982 | 3300044658 | Bacteria | 1148 |
| 974 | Ga0466965_0069128 | 3300044683 | Bacteria | 1774 |
| 975 | Ga0466966_0000136 | 3300044684 | Bacteria | 47038 |
| 976 | Ga0466961_0042386 | 3300044693 | Bacteria | 2917 |
| 977 | Ga0466961_0212398 | 3300044693 | Bacteria | 1194 |
| 978 | Ga0466964_0064167 | 3300044706 | Bacteria | 1536 |
| 979 | Ga0466964_0198483 | 3300044706 | Bacteria | 962 |
| 980 | Ga0453684_0182377 | 3300044712 | Bacteria | 2463 |
| 981 | Ga0466971_0085557 | 3300044719 | Bacteria | 1441 |
| 982 | Ga0466968_0024893 | 3300044735 | Bacteria | 2449 |
| 983 | Ga0466968_0074220 | 3300044735 | Bacteria | 1485 |
| 984 | Ga0466970_0032860 | 3300044765 | Bacteria | 2742 |
| 985 | Ga0466970_0083703 | 3300044765 | Bacteria | 1726 |
| 986 | Ga0466970_0183496 | 3300044765 | Bacteria | 1161 |
| 987 | Ga0466957_0007040 | 3300044842 | Bacteria | 6358 |
| 988 | Ga0466957_0014895 | 3300044842 | Bacteria | 4535 |
| 989 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 990 | Ga0466959_0004264 | 3300045049 | Bacteria | 9538 |
| 991 | Ga0466958_0067052 | 3300045836 | Bacteria | 2192 |
| 992 | Ga0495592_0092874 | 3300046454 | Bacteria | 2162 |
| 993 | Ga0495638_0044437 | 3300046460 | Bacteria | 2798 |
| 994 | Ga0495638_0133573 | 3300046460 | Bacteria | 1456 |
| 995 | Ga0495651_0491722 | 3300046462 | Unclassified | 787 |
| 996 | Ga0495651_0510201 | 3300046462 | Bacteria | 769 |
| 997 | Ga0495650_0048290 | 3300046471 | Bacteria | 1775 |
| 998 | Ga0495580_0014773 | 3300046472 | Bacteria | 5916 |
| 999 | Ga0495594_0109128 | 3300046499 | Bacteria | 1560 |
| 1000 | Ga0495606_0019321 | 3300046507 | Bacteria | 5075 |
| 1001 | Ga0495608_0321123 | 3300046511 | Bacteria | 957 |
| 1002 | Ga0495628_0034567 | 3300046516 | Bacteria | 4065 |
| 1003 | Ga0495628_0285752 | 3300046516 | Bacteria | 1224 |
| 1004 | Ga0495630_0012164 | 3300046517 | Bacteria | 6242 |
| 1005 | Ga0495648_0014811 | 3300046524 | Bacteria | 5682 |
| 1006 | Ga0495652_0080509 | 3300046529 | Bacteria | 2690 |
| 1007 | Ga0495640_0090800 | 3300046533 | Bacteria | 2016 |
| 1008 | Ga0495586_0254880 | 3300046535 | Bacteria | 1001 |
| 1009 | Ga0495598_0076542 | 3300046537 | Bacteria | 1065 |
| 1010 | Ga0495597_0142432 | 3300046542 | Bacteria | 988 |
| 1011 | Ga0495645_0092555 | 3300046543 | Bacteria | 2159 |
| 1012 | Ga0495645_0125671 | 3300046543 | Bacteria | 1802 |
| 1013 | Ga0495633_0105857 | 3300046558 | Bacteria | 1305 |
| 1014 | Ga0495668_0000751 | 3300046616 | Bacteria | 38311 |
| 1015 | Ga0495611_0001116 | 3300046648 | Bacteria | 14130 |
| 1016 | Ga0495611_0036215 | 3300046648 | Bacteria | 2189 |
| 1017 | Ga0495611_0320702 | 3300046648 | Bacteria | 713 |
| 1018 | Ga0495625_0040260 | 3300046660 | Bacteria | 3410 |
| 1019 | Ga0495658_0229419 | 3300046683 | Unclassified | 1164 |
| 1020 | Ga0495613_0185963 | 3300046689 | Unclassified | 1470 |
| 1021 | Ga0495600_0264951 | 3300046809 | Bacteria | 1091 |
| 1022 | Ga0495674_0210944 | 3300047319 | Bacteria | 1608 |
| 1023 | Ga0495672_0025973 | 3300047320 | Bacteria | 3743 |
| 1024 | Ga0495676_0070348 | 3300047321 | Bacteria | 2696 |
| 1025 | Ga0495676_0145947 | 3300047321 | Bacteria | 1690 |
| 1026 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 1027 | Ga0495675_0166435 | 3300047444 | Bacteria | 1356 |
| 1028 | Ga0495675_0240181 | 3300047444 | Bacteria | 1091 |
| 1029 | Ga0495684_0050898 | 3300047471 | Bacteria | 3162 |
| 1030 | Ga0495684_0436512 | 3300047471 | Unclassified | 913 |
| 1031 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 1032 | Ga0495686_0011430 | 3300047472 | Bacteria | 6255 |
| 1033 | Ga0495686_0071848 | 3300047472 | Bacteria | 2129 |
| 1034 | Ga0496104_0497143 | 3300048907 | Unclassified | 1131 |
| 1035 | Ga0496104_0540596 | 3300048907 | Bacteria | 1076 |
| 1036 | Ga0496105_0561363 | 3300048908 | Bacteria | 890 |
| 1037 | Ga0496107_0583247 | 3300048910 | Bacteria | 827 |
| 1038 | Ga0496108_0183554 | 3300048911 | Bacteria | 1812 |
| 1039 | Ga0496108_0481496 | 3300048911 | Bacteria | 1084 |
| 1040 | Ga0496108_0503107 | 3300048911 | Unclassified | 1058 |
| 1041 | Ga0496109_0245679 | 3300048912 | Unclassified | 1685 |
| 1042 | Ga0496109_0252417 | 3300048912 | Bacteria | 1661 |
| 1043 | Ga0496110_0267538 | 3300048913 | Bacteria | 1556 |
| 1044 | Ga0496110_0939890 | 3300048913 | Bacteria | 771 |
| 1045 | Ga0496115_0089648 | 3300048918 | Bacteria | 2512 |
| 1046 | Ga0496124_0066454 | 3300048927 | Bacteria | 3003 |
| 1047 | Ga0496126_0567079 | 3300048929 | Bacteria | 899 |
| 1048 | Ga0501031_0010841 | 3300049568 | Bacteria | 5935 |
| 1049 | Ga0501031_0485868 | 3300049568 | Unclassified | 797 |
| 1050 | Ga0501032_0154715 | 3300049569 | Bacteria | 1507 |
| 1051 | Ga0501032_0381305 | 3300049569 | Bacteria | 907 |
| 1052 | Ga0501033_0066471 | 3300049570 | Bacteria | 2651 |
| 1053 | Ga0501033_0230965 | 3300049570 | Bacteria | 1314 |
| 1054 | Ga0501034_0004012 | 3300049571 | Bacteria | 16517 |
| 1055 | Ga0501034_0053271 | 3300049571 | Bacteria | 4075 |
| 1056 | Ga0501034_0064319 | 3300049571 | Bacteria | 3682 |
| 1057 | Ga0501034_0112712 | 3300049571 | Bacteria | 2709 |
| 1058 | Ga0501034_0240918 | 3300049571 | Bacteria | 1755 |
| 1059 | Ga0501034_1151286 | 3300049571 | Unclassified | 655 |
| 1060 | Ga0501036_0306700 | 3300049572 | Bacteria | 1327 |
| 1061 | Ga0501037_0007826 | 3300049573 | Bacteria | 7827 |
| 1062 | Ga0501037_0037709 | 3300049573 | Bacteria | 3563 |
| 1063 | Ga0501038_0007220 | 3300049574 | Bacteria | 10263 |
| 1064 | Ga0501038_0033809 | 3300049574 | Bacteria | 4500 |
| 1065 | Ga0501039_0385750 | 3300049575 | Bacteria | 1100 |
| 1066 | Ga0501040_0024888 | 3300049576 | Unclassified | 4022 |
| 1067 | Ga0501043_0008215 | 3300049579 | Bacteria | 8223 |
| 1068 | Ga0501043_0015257 | 3300049579 | Bacteria | 6018 |
| 1069 | Ga0501043_0029351 | 3300049579 | Bacteria | 4320 |
| 1070 | Ga0501047_0009183 | 3300049581 | Bacteria | 9336 |
| 1071 | Ga0501047_0119920 | 3300049581 | Bacteria | 2513 |
| 1072 | Ga0501047_0128329 | 3300049581 | Bacteria | 2416 |
| 1073 | Ga0501048_0165851 | 3300049582 | Bacteria | 1564 |
| 1074 | Ga0501068_0026838 | 3300049584 | Bacteria | 3397 |
| 1075 | Ga0501069_0007664 | 3300049585 | Bacteria | 5663 |
| 1076 | Ga0501071_0062985 | 3300049587 | Bacteria | 2688 |
| 1077 | Ga0501073_0018001 | 3300049589 | Bacteria | 5108 |
| 1078 | Ga0501227_002942 | 3300049665 | Bacteria | 3723 |
| 1079 | Ga0501257_046339 | 3300049686 | Bacteria | 1077 |
| 1080 | Ga0501219_000230 | 3300049703 | Bacteria | 10699 |
| 1081 | Ga0501225_0001846 | 3300049705 | Bacteria | 6642 |
| 1082 | Ga0501079_0058140 | 3300049741 | Bacteria | 2984 |
| 1083 | Ga0501080_0140200 | 3300049742 | Bacteria | 2236 |
| 1084 | Ga0501083_0060149 | 3300049744 | Bacteria | 2538 |
| 1085 | Ga0501035_0031410 | 3300049822 | Bacteria | 4837 |
| 1086 | Ga0501035_0043415 | 3300049822 | Bacteria | 4052 |
| 1087 | Ga0501035_0210219 | 3300049822 | Bacteria | 1665 |
| 1088 | Ga0501044_0016307 | 3300049823 | Bacteria | 7981 |
| 1089 | Ga0501044_0017470 | 3300049823 | Bacteria | 7699 |
| 1090 | Ga0501044_0044831 | 3300049823 | Bacteria | 4586 |
| 1091 | Ga0501044_0100475 | 3300049823 | Bacteria | 2911 |
| 1092 | Ga0501044_0221853 | 3300049823 | Bacteria | 1841 |
| 1093 | Ga0501044_0657860 | 3300049823 | Bacteria | 936 |
| 1094 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 1095 | nmdc:mga0k408_233999_c1 | 3300050493 | Bacteria | 1097 |
| 1096 | nmdc:mga0k408_57908_c1 | 3300050493 | Bacteria | 2250 |
| 1097 | nmdc:mga05p37_720353_c1 | 3300050507 | Bacteria | 1105 |
| 1098 | nmdc:mga05p37_985444_c1 | 3300050507 | Bacteria | 897 |
| 1099 | nmdc:mga09592_173530_c1 | 3300050508 | Bacteria | 1865 |
| 1100 | nmdc:mga09592_466632_c1 | 3300050508 | Bacteria | 1089 |
| 1101 | nmdc:mga0qj67_225298_c1 | 3300050509 | Bacteria | 1522 |
| 1102 | nmdc:mga06r32_10152_c1 | 3300050510 | Bacteria | 8500 |
| 1103 | nmdc:mga08y16_168780_c1 | 3300050511 | Bacteria | 2273 |
| 1104 | nmdc:mga08y16_237955_c1 | 3300050511 | Bacteria | 1882 |
| 1105 | nmdc:mga08y16_277282_c1 | 3300050511 | Bacteria | 1730 |
| 1106 | nmdc:mga08y16_292138_c1 | 3300050511 | Bacteria | 1680 |
| 1107 | nmdc:mga08y16_646838_c1 | 3300050511 | Bacteria | 1062 |
| 1108 | nmdc:mga08y16_766199_c1 | 3300050511 | Bacteria | 960 |
| 1109 | nmdc:mga0n895_876213_c1 | 3300050512 | Bacteria | 884 |
| 1110 | Ga0500578_0000034 | 3300053086 | Bacteria | 136582 |
| 1111 | Ga0500644_0000283 | 3300053088 | Bacteria | 28078 |
| 1112 | Ga0500644_0018221 | 3300053088 | Bacteria | 2053 |
| 1113 | Ga0500644_0064791 | 3300053088 | Bacteria | 1299 |
| 1114 | Ga0500644_0246989 | 3300053088 | Bacteria | 751 |
| 1115 | Ga0500646_0017416 | 3300053090 | Bacteria | 1884 |
| 1116 | Ga0500583_0000346 | 3300053092 | Bacteria | 15437 |
| 1117 | Ga0500583_0006285 | 3300053092 | Bacteria | 4072 |
| 1118 | Ga0500640_180406 | 3300053095 | Bacteria | 766 |
| 1119 | Ga0500650_0137230 | 3300053098 | Bacteria | 1135 |
| 1120 | Ga0500562_000050 | 3300053108 | Bacteria | 60058 |
| 1121 | Ga0500569_026583 | 3300053109 | Bacteria | 1587 |
| 1122 | Ga0500652_027751 | 3300053131 | Bacteria | 2192 |
| 1123 | Ga0500658_0006675 | 3300053134 | Bacteria | 4275 |
| 1124 | Ga0500559_0134430 | 3300053136 | Bacteria | 1156 |
| 1125 | Ga0500577_0130092 | 3300053142 | Bacteria | 1054 |
| 1126 | Ga0500588_0080710 | 3300053146 | Unclassified | 1087 |
| 1127 | Ga0500589_111239 | 3300053147 | Bacteria | 1174 |
| 1128 | Ga0500590_113567 | 3300053148 | Bacteria | 1281 |
| 1129 | Ga0500604_0014034 | 3300053151 | Bacteria | 2177 |
| 1130 | Ga0500604_0162825 | 3300053151 | Bacteria | 760 |
| 1131 | Ga0500616_0005429 | 3300053153 | Bacteria | 8651 |
| 1132 | Ga0500616_0009033 | 3300053153 | Bacteria | 6104 |
| 1133 | Ga0500616_0041053 | 3300053153 | Bacteria | 2485 |
| 1134 | Ga0500616_0058660 | 3300053153 | Bacteria | 2002 |
| 1135 | Ga0500622_0001463 | 3300053156 | Bacteria | 18819 |
| 1136 | Ga0500634_0069639 | 3300053161 | Bacteria | 1844 |
| 1137 | Ga0500639_048405 | 3300053163 | Bacteria | 2219 |
| 1138 | Ga0501084_0108818 | 3300054114 | Unclassified | 2328 |
| 1139 | Ga0501082_0492410 | 3300060353 | Unclassified | 1071 |
| 1140 | Ga0466962_0082820 | 3300061719 | Bacteria | 1535 |
| 1141 | Ga0466962_0379214 | 3300061719 | Bacteria | 706 |
| 1142 | 2738727061 | 2738541278 | Bacteria | 9755573 |
| 1143 | 2819588782 | 2818991444 | Bacteria | 6968812 |
| 1144 | 2884795626 | 2884791551 | Bacteria | 8511252 |
| 1145 | 2929157418 | 2929154850 | Bacteria | 6753285 |
| 1146 | 2929923242 | 2929921140 | Bacteria | 8649150 |
| 1147 | 8003153685 | 8003151029 | Bacteria | 8187759 |
| 1148 | Ga0068869_100365111 | |||
| 1149 | MBSR1b_contig_5080737 | |||
| 1150 | JGI24740J21852_10005751 | |||
| 1151 | JGI25154J39366_1000040 | |||
| 1152 | JGI25157J39369_1003509 | |||
| 1153 | JGI25406J46586_10015712 | |||
| 1154 | rootH1_10042957 | |||
| 1155 | rootH2_10008248 | |||
| 1156 | rootH2_10008268 | |||
| 1157 | rootH2_10028777 | |||
| 1158 | rootH2_10030072 | |||
| 1159 | rootH2_10132146 | |||
| 1160 | rootH2_10141251 | |||
| 1161 | rootL2_10188385 | |||
| 1162 | rootH1_10002854 | |||
| 1163 | rootH1_10015122 | |||
| 1164 | JGI25160J50197_1001601 | |||
| 1165 | Ga0055535_1003449 | |||
| 1166 | Ga0055542_1017472 | |||
| 1167 | Ga0058863_11413575 | |||
| 1168 | Ga0058862_12656212 | |||
| 1169 | Ga0065165_1037906 | |||
| 1170 | Ga0065712_10008205 | |||
| 1171 | Ga0065712_10070469 | |||
| 1172 | Ga0065712_10270594 | |||
| 1173 | Ga0070658_10010748 | |||
| 1174 | Ga0070658_10075190 | |||
| 1175 | Ga0070658_10081107 | |||
| 1176 | Ga0070658_10187046 | |||
| 1177 | Ga0070658_10214232 | |||
| 1178 | Ga0070658_10281996 | |||
| 1179 | Ga0070658_10526202 | |||
| 1180 | Ga0070676_10000336 | |||
| 1181 | Ga0070676_10031688 | |||
| 1182 | Ga0070676_10248238 | |||
| 1183 | Ga0070683_100002966 | |||
| 1184 | Ga0070683_100032588 | |||
| 1185 | Ga0070683_100120371 | |||
| 1186 | Ga0070683_100673128 | |||
| 1187 | Ga0070683_100841404 | |||
| 1188 | Ga0070690_100005983 | |||
| 1189 | Ga0070690_100057685 | |||
| 1190 | Ga0070690_100166719 | |||
| 1191 | Ga0070690_100266160 | |||
| 1192 | Ga0070690_100319086 | |||
| 1193 | Ga0070670_100030756 | |||
| 1194 | Ga0070670_100039056 | |||
| 1195 | Ga0070670_100062154 | |||
| 1196 | Ga0070670_100079810 | |||
| 1197 | Ga0070670_100162784 | |||
| 1198 | Ga0070670_100221339 | |||
| 1199 | Ga0070670_100245642 | |||
| 1200 | Ga0070670_100899099 | |||
| 1201 | Ga0070677_10143248 | |||
| 1202 | Ga0070677_10416306 | |||
| 1203 | Ga0068869_100043129 | |||
| 1204 | Ga0068869_100080027 | |||
| 1205 | Ga0068869_100125092 | |||
| 1206 | Ga0068869_100151211 | |||
| 1207 | Ga0068869_100159910 | |||
| 1208 | Ga0068869_100160053 | |||
| 1209 | Ga0068869_100183963 | |||
| 1210 | Ga0068869_100428266 | |||
| 1211 | Ga0068869_100468926 | |||
| 1212 | Ga0070666_10000051 | |||
| 1213 | Ga0070666_10010207 | |||
| 1214 | Ga0070666_10013609 | |||
| 1215 | Ga0070666_10090217 | |||
| 1216 | Ga0070666_10143011 | |||
| 1217 | Ga0070666_10382347 | |||
| 1218 | Ga0070680_100031956 | |||
| 1219 | Ga0070680_100171315 | |||
| 1220 | Ga0070680_100189297 | |||
| 1221 | Ga0070680_100213482 | |||
| 1222 | Ga0070680_100243505 | |||
| 1223 | Ga0070682_100001275 | |||
| 1224 | Ga0070682_100026905 | |||
| 1225 | Ga0070682_100559187 | |||
| 1226 | Ga0068868_100005270 | |||
| 1227 | Ga0068868_100010338 | |||
| 1228 | Ga0068868_100078065 | |||
| 1229 | Ga0068868_100205069 | |||
| 1230 | Ga0068868_100255371 | |||
| 1231 | Ga0068868_100308965 | |||
| 1232 | Ga0068868_100630897 | |||
| 1233 | Ga0068868_101113413 | |||
| 1234 | Ga0070660_100015714 | |||
| 1235 | Ga0070660_101097932 | |||
| 1236 | Ga0070689_100001732 | |||
| 1237 | Ga0070689_100013351 | |||
| 1238 | Ga0070689_100014808 | |||
| 1239 | Ga0070689_100278201 | |||
| 1240 | Ga0070691_10016205 | |||
| 1241 | Ga0070691_10049783 | |||
| 1242 | Ga0070661_100002702 | |||
| 1243 | Ga0070661_100003143 | |||
| 1244 | Ga0070661_100022549 | |||
| 1245 | Ga0070661_100242507 | |||
| 1246 | Ga0070661_100286536 | |||
| 1247 | Ga0070661_100467931 | |||
| 1248 | Ga0070668_100002494 | |||
| 1249 | Ga0070668_100022644 | |||
| 1250 | Ga0070668_100395028 | |||
| 1251 | Ga0070669_100004789 | |||
| 1252 | Ga0070669_100036574 | |||
| 1253 | Ga0070669_100165082 | |||
| 1254 | Ga0070669_100301733 | |||
| 1255 | Ga0070669_100582851 | |||
| 1256 | Ga0070669_100761213 | |||
| 1257 | Ga0070669_100924072 | |||
| 1258 | Ga0070675_100013600 | |||
| 1259 | Ga0070675_100025711 | |||
| 1260 | Ga0070675_100040336 | |||
| 1261 | Ga0070675_100055271 | |||
| 1262 | Ga0070675_100266528 | |||
| 1263 | Ga0070671_100004803 | |||
| 1264 | Ga0070671_100032777 | |||
| 1265 | Ga0070671_100049587 | |||
| 1266 | Ga0070671_100062085 | |||
| 1267 | Ga0070671_100074043 | |||
| 1268 | Ga0070671_100123868 | |||
| 1269 | Ga0070671_100195390 | |||
| 1270 | Ga0070671_100292029 | |||
| 1271 | Ga0070671_100354866 | |||
| 1272 | Ga0070674_100028173 | |||
| 1273 | Ga0070674_100076506 | |||
| 1274 | Ga0070674_100270356 | |||
| 1275 | Ga0070673_100001990 | |||
| 1276 | Ga0070673_100017265 | |||
| 1277 | Ga0070673_100049176 | |||
| 1278 | Ga0070673_100062597 | |||
| 1279 | Ga0070673_100161208 | |||
| 1280 | Ga0070673_100216608 | |||
| 1281 | Ga0070673_100218521 | |||
| 1282 | Ga0070673_100290540 | |||
| 1283 | Ga0070673_100874628 | |||
| 1284 | Ga0070688_100019036 | |||
| 1285 | Ga0070688_100039808 | |||
| 1286 | Ga0070688_100051258 | |||
| 1287 | Ga0070688_100082918 | |||
| 1288 | Ga0070688_100345935 | |||
| 1289 | Ga0070659_100117387 | |||
| 1290 | Ga0070659_100120914 | |||
| 1291 | Ga0070667_100000492 | |||
| 1292 | Ga0070667_100020321 | |||
| 1293 | Ga0070667_100054456 | |||
| 1294 | Ga0070667_100075366 | |||
| 1295 | Ga0070667_100088516 | |||
| 1296 | Ga0070667_100157396 | |||
| 1297 | Ga0070667_100161421 | |||
| 1298 | Ga0070667_100307734 | |||
| 1299 | Ga0070705_100351477 | |||
| 1300 | Ga0070663_100690869 | |||
| 1301 | Ga0070678_100010791 | |||
| 1302 | Ga0070678_100013945 | |||
| 1303 | Ga0070678_100231962 | |||
| 1304 | Ga0070662_100004086 | |||
| 1305 | Ga0070662_100027166 | |||
| 1306 | Ga0070662_100036135 | |||
| 1307 | Ga0070662_100056097 | |||
| 1308 | Ga0070662_100146200 | |||
| 1309 | Ga0070662_100283207 | |||
| 1310 | Ga0070681_10021777 | |||
| 1311 | Ga0070681_10040812 | |||
| 1312 | Ga0070681_10097972 | |||
| 1313 | Ga0070681_10305631 | |||
| 1314 | Ga0068867_100043311 | |||
| 1315 | Ga0068867_100082241 | |||
| 1316 | Ga0068867_100094622 | |||
| 1317 | Ga0068867_100192882 | |||
| 1318 | Ga0068867_100273011 | |||
| 1319 | Ga0068867_100355786 | |||
| 1320 | Ga0068867_100621339 | |||
| 1321 | Ga0070685_10009065 | |||
| 1322 | Ga0070685_10016536 | |||
| 1323 | Ga0070685_10063077 | |||
| 1324 | Ga0070685_10165147 | |||
| 1325 | Ga0070685_10166737 | |||
| 1326 | Ga0070698_100007269 | |||
| 1327 | Ga0070699_100140396 | |||
| 1328 | Ga0070679_100004536 | |||
| 1329 | Ga0070679_100029492 | |||
| 1330 | Ga0070679_100054566 | |||
| 1331 | Ga0070679_100098661 | |||
| 1332 | Ga0070679_100143593 | |||
| 1333 | Ga0070684_100000228 | |||
| 1334 | Ga0070684_100060191 | |||
| 1335 | Ga0070684_100479592 | |||
| 1336 | Ga0070684_100664138 | |||
| 1337 | Ga0068853_100000221 | |||
| 1338 | Ga0068853_100020583 | |||
| 1339 | Ga0068853_100055688 | |||
| 1340 | Ga0068853_100058961 | |||
| 1341 | Ga0068853_100092567 | |||
| 1342 | Ga0068853_100094499 | |||
| 1343 | Ga0068853_100130043 | |||
| 1344 | Ga0068853_100140870 | |||
| 1345 | Ga0068853_100196267 | |||
| 1346 | Ga0068853_100241918 | |||
| 1347 | Ga0068853_100372941 | |||
| 1348 | Ga0068853_100706232 | |||
| 1349 | Ga0070672_100001464 | |||
| 1350 | Ga0070672_100052158 | |||
| 1351 | Ga0070672_100179906 | |||
| 1352 | Ga0070672_100199661 | |||
| 1353 | Ga0070672_100786836 | |||
| 1354 | Ga0070686_100392522 | |||
| 1355 | Ga0070686_100680528 | |||
| 1356 | Ga0070695_100438499 | |||
| 1357 | Ga0070693_100009189 | |||
| 1358 | Ga0070665_100000001 | |||
| 1359 | Ga0070665_100005742 | |||
| 1360 | Ga0070665_100392369 | |||
| 1361 | Ga0068855_100007886 | |||
| 1362 | Ga0068855_100030208 | |||
| 1363 | Ga0068855_100034990 | |||
| 1364 | Ga0068855_100125633 | |||
| 1365 | Ga0068855_100274941 | |||
| 1366 | Ga0068855_100329735 | |||
| 1367 | Ga0068855_100413214 | |||
| 1368 | Ga0068855_100482300 | |||
| 1369 | Ga0070664_100003241 | |||
| 1370 | Ga0070664_100004633 | |||
| 1371 | Ga0070664_100012802 | |||
| 1372 | Ga0070664_100074332 | |||
| 1373 | Ga0070664_100296205 | |||
| 1374 | Ga0070664_100382311 | |||
| 1375 | Ga0070664_100688884 | |||
| 1376 | Ga0068857_100001119 | |||
| 1377 | Ga0068857_100007157 | |||
| 1378 | Ga0068857_100019040 | |||
| 1379 | Ga0068857_100090705 | |||
| 1380 | Ga0068857_100118152 | |||
| 1381 | Ga0068857_100238569 | |||
| 1382 | Ga0068857_100289571 | |||
| 1383 | Ga0068854_100071634 | |||
| 1384 | Ga0068854_100073957 | |||
| 1385 | Ga0068854_100086737 | |||
| 1386 | Ga0068854_100176660 | |||
| 1387 | Ga0068854_100373372 | |||
| 1388 | Ga0068854_100587059 | |||
| 1389 | Ga0068854_100606295 | |||
| 1390 | Ga0068854_100714905 | |||
| 1391 | Ga0068854_101153514 | |||
| 1392 | Ga0068856_100011164 | |||
| 1393 | Ga0068856_100063215 | |||
| 1394 | Ga0068856_100074030 | |||
| 1395 | Ga0068856_100139887 | |||
| 1396 | Ga0068856_100567977 | |||
| 1397 | Ga0070702_100122033 | |||
| 1398 | Ga0068852_100002006 | |||
| 1399 | Ga0068852_100018674 | |||
| 1400 | Ga0068852_100023547 | |||
| 1401 | Ga0068852_100066167 | |||
| 1402 | Ga0068852_100136739 | |||
| 1403 | Ga0068852_100230863 | |||
| 1404 | Ga0068852_100241605 | |||
| 1405 | Ga0068852_100292942 | |||
| 1406 | Ga0068852_100595137 | |||
| 1407 | Ga0068852_100704643 | |||
| 1408 | Ga0068852_100732765 | |||
| 1409 | Ga0068859_100000023 | |||
| 1410 | Ga0068859_100008109 | |||
| 1411 | Ga0068859_100033356 | |||
| 1412 | Ga0068859_100054725 | |||
| 1413 | Ga0068859_100069445 | |||
| 1414 | Ga0068859_100085357 | |||
| 1415 | Ga0068859_100135826 | |||
| 1416 | Ga0068859_100805481 | |||
| 1417 | Ga0068859_100986642 | |||
| 1418 | Ga0068859_101001856 | |||
| 1419 | Ga0068859_101134262 | |||
| 1420 | Ga0068864_100005800 | |||
| 1421 | Ga0068864_100007839 | |||
| 1422 | Ga0068864_100016359 | |||
| 1423 | Ga0068864_100026175 | |||
| 1424 | Ga0068864_100066317 | |||
| 1425 | Ga0068864_100072654 | |||
| 1426 | Ga0068864_100217573 | |||
| 1427 | Ga0068864_100293509 | |||
| 1428 | Ga0068864_100444836 | |||
| 1429 | Ga0068866_10059122 | |||
| 1430 | Ga0068866_10348342 | |||
| 1431 | Ga0068861_100009306 | |||
| 1432 | Ga0068861_100094670 | |||
| 1433 | Ga0068861_100122562 | |||
| 1434 | Ga0068861_100129736 | |||
| 1435 | Ga0068861_100158612 | |||
| 1436 | Ga0068861_100205414 | |||
| 1437 | Ga0068861_100362071 | |||
| 1438 | Ga0068861_100791543 | |||
| 1439 | Ga0068851_10001340 | |||
| 1440 | Ga0068870_10046335 | |||
| 1441 | Ga0068870_10105701 | |||
| 1442 | Ga0068863_100001812 | |||
| 1443 | Ga0068863_100013140 | |||
| 1444 | Ga0068863_100074948 | |||
| 1445 | Ga0068863_100075228 | |||
| 1446 | Ga0068863_100130519 | |||
| 1447 | Ga0068858_100008485 | |||
| 1448 | Ga0068858_100049204 | |||
| 1449 | Ga0068858_100577331 | |||
| 1450 | Ga0068858_100827928 | |||
| 1451 | Ga0068860_100000046 | |||
| 1452 | Ga0068860_100000916 | |||
| 1453 | Ga0068860_100005408 | |||
| 1454 | Ga0068860_100007358 | |||
| 1455 | Ga0068860_100024991 | |||
| 1456 | Ga0068860_100034035 | |||
| 1457 | Ga0068860_100116564 | |||
| 1458 | Ga0068860_100371146 | |||
| 1459 | Ga0068860_100822578 | |||
| 1460 | Ga0068860_101335261 | |||
| 1461 | Ga0068862_100003779 | |||
| 1462 | Ga0068862_100022881 | |||
| 1463 | Ga0068862_100166968 | |||
| 1464 | Ga0068862_100449754 | |||
| 1465 | Ga0068862_100723941 | |||
| 1466 | Ga0081539_10000531 | |||
| 1467 | Ga0081539_10071796 | |||
| 1468 | Ga0070715_10046164 | |||
| 1469 | Ga0070715_10112710 | |||
| 1470 | Ga0075366_10048373 | |||
| 1471 | Ga0075366_10061180 | |||
| 1472 | Ga0075366_10207913 | |||
| 1473 | Ga0097621_100000847 | |||
| 1474 | Ga0097621_100001572 | |||
| 1475 | Ga0097621_100003432 | |||
| 1476 | Ga0097621_100035876 | |||
| 1477 | Ga0097621_100044146 | |||
| 1478 | Ga0097621_100077970 | |||
| 1479 | Ga0097621_100098064 | |||
| 1480 | Ga0097621_100098913 | |||
| 1481 | Ga0097621_100157282 | |||
| 1482 | Ga0097621_100524427 | |||
| 1483 | Ga0097621_100706038 | |||
| 1484 | Ga0068871_100000027 | |||
| 1485 | Ga0068871_100000354 | |||
| 1486 | Ga0068871_100001006 | |||
| 1487 | Ga0068871_100024941 | |||
| 1488 | Ga0068871_100040970 | |||
| 1489 | Ga0068871_100106906 | |||
| 1490 | Ga0068871_100195683 | |||
| 1491 | Ga0068871_100229104 | |||
| 1492 | Ga0068871_100267331 | |||
| 1493 | Ga0068871_100348869 | |||
| 1494 | Ga0068871_100459632 | |||
| 1495 | Ga0075428_100024587 | |||
| 1496 | Ga0075428_100871642 | |||
| 1497 | Ga0075430_100010054 | |||
| 1498 | Ga0075431_100004434 | |||
| 1499 | Ga0075431_100245623 | |||
| 1500 | Ga0075429_100005840 | |||
| 1501 | Ga0068865_100023025 | |||
| 1502 | Ga0068865_100157160 | |||
| 1503 | Ga0068865_100275782 | |||
| 1504 | Ga0068865_100331513 | |||
| 1505 | Ga0068865_100598388 | |||
| 1506 | Ga0068865_100767296 | |||
| 1507 | Ga0097620_100000023 | |||
| 1508 | Ga0097620_100008109 | |||
| 1509 | Ga0097620_100033356 | |||
| 1510 | Ga0097620_100054730 | |||
| 1511 | Ga0097620_100069445 | |||
| 1512 | Ga0097620_100085355 | |||
| 1513 | Ga0097620_100135820 | |||
| 1514 | Ga0097620_100805394 | |||
| 1515 | Ga0097620_100986659 | |||
| 1516 | Ga0097620_101001928 | |||
| 1517 | Ga0097620_101134445 | |||
| 1518 | Ga0105240_10000074 | |||
| 1519 | Ga0105240_10000598 | |||
| 1520 | Ga0105240_10000626 | |||
| 1521 | Ga0105240_10001595 | |||
| 1522 | Ga0105240_10002663 | |||
| 1523 | Ga0105240_10007062 | |||
| 1524 | Ga0105240_10095833 | |||
| 1525 | Ga0105240_10157044 | |||
| 1526 | Ga0105240_10192995 | |||
| 1527 | Ga0105240_10233775 | |||
| 1528 | Ga0105240_10346161 | |||
| 1529 | Ga0105240_10394988 | |||
| 1530 | Ga0105240_10469687 | |||
| 1531 | Ga0105240_10504726 | |||
| 1532 | Ga0105240_10604497 | |||
| 1533 | Ga0111539_10015483 | |||
| 1534 | Ga0111539_10072693 | |||
| 1535 | Ga0111539_10150833 | |||
| 1536 | Ga0111539_10203554 | |||
| 1537 | Ga0111539_10248996 | |||
| 1538 | Ga0111539_10519594 | |||
| 1539 | Ga0111539_10638165 | |||
| 1540 | Ga0111539_11318769 | |||
| 1541 | Ga0105245_10092150 | |||
| 1542 | Ga0105245_10136710 | |||
| 1543 | Ga0105245_10211933 | |||
| 1544 | Ga0105247_10003751 | |||
| 1545 | Ga0105247_10055552 | |||
| 1546 | Ga0105247_10200350 | |||
| 1547 | Ga0114129_10170363 | |||
| 1548 | Ga0114129_11213107 | |||
| 1549 | Ga0105243_11028531 | |||
| 1550 | Ga0105241_10000659 | |||
| 1551 | Ga0105241_10000881 | |||
| 1552 | Ga0105241_10007681 | |||
| 1553 | Ga0105241_10034893 | |||
| 1554 | Ga0105241_10105623 | |||
| 1555 | Ga0105241_10281965 | |||
| 1556 | Ga0105241_10720042 | |||
| 1557 | Ga0105242_10012454 | |||
| 1558 | Ga0105242_10029532 | |||
| 1559 | Ga0105242_10046336 | |||
| 1560 | Ga0105242_10047921 | |||
| 1561 | Ga0105242_10057412 | |||
| 1562 | Ga0105242_10066820 | |||
| 1563 | Ga0105242_10245338 | |||
| 1564 | Ga0105242_10262710 | |||
| 1565 | Ga0105242_10907120 | |||
| 1566 | Ga0105242_10974798 | |||
| 1567 | Ga0105242_11121783 | |||
| 1568 | Ga0105248_10129741 | |||
| 1569 | Ga0105248_10148472 | |||
| 1570 | Ga0105248_10801695 | |||
| 1571 | Ga0105237_10000755 | |||
| 1572 | Ga0105237_10004143 | |||
| 1573 | Ga0105237_10007407 | |||
| 1574 | Ga0105237_10020135 | |||
| 1575 | Ga0105237_10042602 | |||
| 1576 | Ga0105237_10100523 | |||
| 1577 | Ga0105237_10111377 | |||
| 1578 | Ga0105237_10213092 | |||
| 1579 | Ga0105237_10231380 | |||
| 1580 | Ga0105237_10349941 | |||
| 1581 | Ga0105238_10001132 | |||
| 1582 | Ga0105238_10035958 | |||
| 1583 | Ga0105238_10104359 | |||
| 1584 | Ga0105238_10208463 | |||
| 1585 | Ga0105238_10995831 | |||
| 1586 | Ga0105249_10005641 | |||
| 1587 | Ga0105249_10008464 | |||
| 1588 | Ga0105249_10009356 | |||
| 1589 | Ga0105249_10012834 | |||
| 1590 | Ga0105249_10056487 | |||
| 1591 | Ga0105249_10088386 | |||
| 1592 | Ga0105249_10133429 | |||
| 1593 | Ga0105249_10209741 | |||
| 1594 | Ga0105249_10322304 | |||
| 1595 | Ga0105249_10435755 | |||
| 1596 | Ga0105249_10524346 | |||
| 1597 | Ga0105239_10000048 | |||
| 1598 | Ga0105239_10000785 | |||
| 1599 | Ga0105239_10090248 | |||
| 1600 | Ga0105239_10192023 | |||
| 1601 | Ga0105239_10206574 | |||
| 1602 | Ga0105239_10236788 | |||
| 1603 | Ga0105239_10240773 | |||
| 1604 | Ga0105239_10335860 | |||
| 1605 | Ga0105239_10376028 | |||
| 1606 | Ga0105239_10410117 | |||
| 1607 | Ga0105239_10485819 | |||
| 1608 | Ga0105246_10017603 | |||
| 1609 | Ga0105246_10098219 | |||
| 1610 | Ga0105246_10315264 | |||
| 1611 | Ga0105246_10324771 | |||
| 1612 | Ga0157373_10016186 | |||
| 1613 | Ga0157373_10092062 | |||
| 1614 | Ga0157373_10132512 | |||
| 1615 | Ga0157371_10048769 | |||
| 1616 | Ga0157371_10144490 | |||
| 1617 | Ga0157371_10356050 | |||
| 1618 | Ga0157370_10000839 | |||
| 1619 | Ga0157370_10006823 | |||
| 1620 | Ga0157370_10121472 | |||
| 1621 | Ga0157370_10450449 | |||
| 1622 | Ga0157370_10680122 | |||
| 1623 | Ga0157369_10039285 | |||
| 1624 | Ga0157369_10053379 | |||
| 1625 | Ga0157369_10083054 | |||
| 1626 | Ga0157369_10100053 | |||
| 1627 | Ga0157369_10104624 | |||
| 1628 | Ga0157369_10192363 | |||
| 1629 | Ga0157369_10301339 | |||
| 1630 | Ga0157369_10343029 | |||
| 1631 | Ga0157374_10000001 | |||
| 1632 | Ga0157374_10004285 | |||
| 1633 | Ga0157374_10008464 | |||
| 1634 | Ga0157374_10025420 | |||
| 1635 | Ga0157374_10097036 | |||
| 1636 | Ga0157374_10101752 | |||
| 1637 | Ga0157374_10152435 | |||
| 1638 | Ga0157374_10189753 | |||
| 1639 | Ga0157374_10391189 | |||
| 1640 | Ga0157374_10516632 | |||
| 1641 | Ga0157374_10519786 | |||
| 1642 | Ga0157374_10535483 | |||
| 1643 | Ga0157374_10854522 | |||
| 1644 | Ga0157374_11249023 | |||
| 1645 | Ga0157378_10011078 | |||
| 1646 | Ga0157378_10011450 | |||
| 1647 | Ga0157378_10017714 | |||
| 1648 | Ga0157378_10021827 | |||
| 1649 | Ga0157378_10048565 | |||
| 1650 | Ga0157378_10118435 | |||
| 1651 | Ga0157378_10322662 | |||
| 1652 | Ga0157378_10512683 | |||
| 1653 | Ga0157378_10534989 | |||
| 1654 | Ga0157378_10965802 | |||
| 1655 | Ga0157378_11019935 | |||
| 1656 | Ga0157378_11023952 | |||
| 1657 | Ga0163162_10000331 | |||
| 1658 | Ga0163162_10000967 | |||
| 1659 | Ga0163162_10005326 | |||
| 1660 | Ga0163162_10005839 | |||
| 1661 | Ga0163162_10014930 | |||
| 1662 | Ga0163162_10023196 | |||
| 1663 | Ga0163162_10044468 | |||
| 1664 | Ga0163162_10081120 | |||
| 1665 | Ga0163162_10086357 | |||
| 1666 | Ga0163162_10104877 | |||
| 1667 | Ga0163162_10126784 | |||
| 1668 | Ga0163162_10176964 | |||
| 1669 | Ga0163162_10195439 | |||
| 1670 | Ga0163162_10256648 | |||
| 1671 | Ga0163162_10339926 | |||
| 1672 | Ga0163162_11252393 | |||
| 1673 | Ga0157372_10000921 | |||
| 1674 | Ga0157372_10002207 | |||
| 1675 | Ga0157372_10015967 | |||
| 1676 | Ga0157372_10125895 | |||
| 1677 | Ga0157372_10229607 | |||
| 1678 | Ga0157372_10480557 | |||
| 1679 | Ga0157372_10834613 | |||
| 1680 | Ga0157372_11452223 | |||
| 1681 | Ga0157375_10000229 | |||
| 1682 | Ga0157375_10003117 | |||
| 1683 | Ga0157375_10043753 | |||
| 1684 | Ga0157375_10049275 | |||
| 1685 | Ga0157375_10082027 | |||
| 1686 | Ga0157375_10115476 | |||
| 1687 | Ga0157375_10117019 | |||
| 1688 | Ga0157375_10198617 | |||
| 1689 | Ga0157375_10219068 | |||
| 1690 | Ga0157375_10227378 | |||
| 1691 | Ga0157375_10322576 | |||
| 1692 | Ga0157375_10585055 | |||
| 1693 | Ga0157375_10798047 | |||
| 1694 | Ga0157375_10936927 | |||
| 1695 | Ga0157375_10984019 | |||
| 1696 | Ga0157375_11096202 | |||
| 1697 | Ga0163163_10000538 | |||
| 1698 | Ga0163163_10000653 | |||
| 1699 | Ga0163163_10039883 | |||
| 1700 | Ga0163163_10236928 | |||
| 1701 | Ga0163163_10247142 | |||
| 1702 | Ga0163163_10353157 | |||
| 1703 | Ga0163163_11020906 | |||
| 1704 | Ga0163163_11687486 | |||
| 1705 | Ga0157380_10009363 | |||
| 1706 | Ga0157380_10046212 | |||
| 1707 | Ga0157380_10151308 | |||
| 1708 | Ga0157380_10430802 | |||
| 1709 | Ga0157380_10512078 | |||
| 1710 | Ga0157380_10613153 | |||
| 1711 | Ga0157380_10757211 | |||
| 1712 | Ga0157380_11067610 | |||
| 1713 | Ga0157377_10000932 | |||
| 1714 | Ga0157377_10011561 | |||
| 1715 | Ga0157377_10052986 | |||
| 1716 | Ga0157377_10191453 | |||
| 1717 | Ga0157377_10289435 | |||
| 1718 | Ga0157379_10001640 | |||
| 1719 | Ga0157379_10002723 | |||
| 1720 | Ga0157379_10025305 | |||
| 1721 | Ga0157379_10039098 | |||
| 1722 | Ga0157379_10053136 | |||
| 1723 | Ga0157379_10063814 | |||
| 1724 | Ga0157379_10153679 | |||
| 1725 | Ga0157379_10160896 | |||
| 1726 | Ga0157379_10268112 | |||
| 1727 | Ga0157379_10331601 | |||
| 1728 | Ga0157376_10002682 | |||
| 1729 | Ga0157376_10004414 | |||
| 1730 | Ga0157376_10005888 | |||
| 1731 | Ga0157376_10017174 | |||
| 1732 | Ga0157376_10037066 | |||
| 1733 | Ga0157376_10054689 | |||
| 1734 | Ga0157376_10055401 | |||
| 1735 | Ga0157376_10089452 | |||
| 1736 | Ga0157376_10133715 | |||
| 1737 | Ga0157376_10201804 | |||
| 1738 | Ga0157376_10369875 | |||
| 1739 | Ga0163161_10023525 | |||
| 1740 | Ga0163161_10027192 | |||
| 1741 | Ga0163161_10041919 | |||
| 1742 | Ga0163161_10129167 | |||
| 1743 | Ga0163161_10210271 | |||
| 1744 | Ga0163161_10244272 | |||
| 1745 | Ga0213876_10022962 | |||
| 1746 | Ga0209258_100151 | |||
| 1747 | Ga0209646_1000002 | |||
| 1748 | Ga0209646_1000823 | |||
| 1749 | Ga0209026_1000434 | |||
| 1750 | Ga0209148_1000154 | |||
| 1751 | Ga0209758_1037890 | |||
| 1752 | Ga0207426_1000030 | |||
| 1753 | Ga0207426_1000497 | |||
| 1754 | Ga0207697_10093949 | |||
| 1755 | Ga0207656_10004204 | |||
| 1756 | Ga0207710_10003162 | |||
| 1757 | Ga0207710_10030055 | |||
| 1758 | Ga0207688_10039173 | |||
| 1759 | Ga0207688_10102142 | |||
| 1760 | Ga0207680_10000162 | |||
| 1761 | Ga0207680_10011575 | |||
| 1762 | Ga0207647_10018104 | |||
| 1763 | Ga0207647_10112441 | |||
| 1764 | Ga0207647_10157173 | |||
| 1765 | Ga0207685_10245320 | |||
| 1766 | Ga0207645_10000782 | |||
| 1767 | Ga0207645_10009564 | |||
| 1768 | Ga0207645_10032778 | |||
| 1769 | Ga0207645_10082780 | |||
| 1770 | Ga0207645_10299253 | |||
| 1771 | Ga0207643_10003598 | |||
| 1772 | Ga0207643_10024156 | |||
| 1773 | Ga0207643_10156236 | |||
| 1774 | Ga0207705_10140693 | |||
| 1775 | Ga0207705_10147114 | |||
| 1776 | Ga0207654_10003155 | |||
| 1777 | Ga0207654_10003491 | |||
| 1778 | Ga0207654_10210525 | |||
| 1779 | Ga0207654_10270390 | |||
| 1780 | Ga0207654_10317871 | |||
| 1781 | Ga0207707_10000051 | |||
| 1782 | Ga0207707_10028865 | |||
| 1783 | Ga0207707_10121080 | |||
| 1784 | Ga0207707_10160562 | |||
| 1785 | Ga0207707_10220480 | |||
| 1786 | Ga0207695_10000071 | |||
| 1787 | Ga0207695_10000084 | |||
| 1788 | Ga0207695_10000323 | |||
| 1789 | Ga0207695_10004602 | |||
| 1790 | Ga0207695_10020015 | |||
| 1791 | Ga0207695_10094718 | |||
| 1792 | Ga0207695_10111165 | |||
| 1793 | Ga0207695_10141759 | |||
| 1794 | Ga0207695_10175536 | |||
| 1795 | Ga0207695_10206800 | |||
| 1796 | Ga0207695_10261200 | |||
| 1797 | Ga0207695_10446920 | |||
| 1798 | Ga0207695_10452825 | |||
| 1799 | Ga0207695_10514728 | |||
| 1800 | Ga0207671_10001044 | |||
| 1801 | Ga0207671_10002907 | |||
| 1802 | Ga0207671_10003799 | |||
| 1803 | Ga0207671_10003904 | |||
| 1804 | Ga0207671_10024892 | |||
| 1805 | Ga0207671_10047813 | |||
| 1806 | Ga0207660_10005186 | |||
| 1807 | Ga0207660_10013385 | |||
| 1808 | Ga0207660_10099182 | |||
| 1809 | Ga0207660_10108430 | |||
| 1810 | Ga0207660_10201863 | |||
| 1811 | Ga0207660_10445736 | |||
| 1812 | Ga0207662_10012024 | |||
| 1813 | Ga0207662_10239060 | |||
| 1814 | Ga0207657_10010433 | |||
| 1815 | Ga0207657_10042823 | |||
| 1816 | Ga0207657_10270275 | |||
| 1817 | Ga0207649_10009815 | |||
| 1818 | Ga0207649_10255441 | |||
| 1819 | Ga0207649_10668233 | |||
| 1820 | Ga0207652_10000384 | |||
| 1821 | Ga0207652_10020709 | |||
| 1822 | Ga0207652_10106805 | |||
| 1823 | Ga0207652_10159287 | |||
| 1824 | Ga0207652_10179079 | |||
| 1825 | Ga0207652_10180240 | |||
| 1826 | Ga0207681_10330130 | |||
| 1827 | Ga0207681_10398400 | |||
| 1828 | Ga0207681_10438157 | |||
| 1829 | Ga0207681_10727514 | |||
| 1830 | Ga0207694_10007231 | |||
| 1831 | Ga0207694_10024476 | |||
| 1832 | Ga0207694_10189791 | |||
| 1833 | Ga0207650_10029550 | |||
| 1834 | Ga0207650_10069495 | |||
| 1835 | Ga0207650_10084153 | |||
| 1836 | Ga0207650_10086979 | |||
| 1837 | Ga0207650_10112906 | |||
| 1838 | Ga0207650_10143351 | |||
| 1839 | Ga0207650_10227135 | |||
| 1840 | Ga0207650_10350160 | |||
| 1841 | Ga0207650_10612459 | |||
| 1842 | Ga0207650_10806457 | |||
| 1843 | Ga0207659_10094854 | |||
| 1844 | Ga0207659_10428587 | |||
| 1845 | Ga0207687_10086348 | |||
| 1846 | Ga0207687_10561668 | |||
| 1847 | Ga0207644_10002938 | |||
| 1848 | Ga0207644_10085126 | |||
| 1849 | Ga0207644_10107695 | |||
| 1850 | Ga0207644_10118442 | |||
| 1851 | Ga0207644_10501524 | |||
| 1852 | Ga0207690_10017654 | |||
| 1853 | Ga0207706_10006768 | |||
| 1854 | Ga0207706_10022065 | |||
| 1855 | Ga0207706_10036407 | |||
| 1856 | Ga0207706_10060668 | |||
| 1857 | Ga0207706_10113169 | |||
| 1858 | Ga0207706_10198002 | |||
| 1859 | Ga0207686_10003538 | |||
| 1860 | Ga0207686_10025792 | |||
| 1861 | Ga0207686_10031401 | |||
| 1862 | Ga0207686_10040558 | |||
| 1863 | Ga0207686_10951096 | |||
| 1864 | Ga0207670_10013524 | |||
| 1865 | Ga0207670_10455138 | |||
| 1866 | Ga0207670_10718211 | |||
| 1867 | Ga0207669_10089885 | |||
| 1868 | Ga0207704_10051601 | |||
| 1869 | Ga0207704_10054704 | |||
| 1870 | Ga0207704_10169619 | |||
| 1871 | Ga0207704_10246745 | |||
| 1872 | Ga0207704_10723475 | |||
| 1873 | Ga0207691_10006538 | |||
| 1874 | Ga0207691_10011421 | |||
| 1875 | Ga0207691_10066380 | |||
| 1876 | Ga0207691_10075281 | |||
| 1877 | Ga0207691_10129415 | |||
| 1878 | Ga0207691_10302352 | |||
| 1879 | Ga0207711_10097280 | |||
| 1880 | Ga0207689_10001006 | |||
| 1881 | Ga0207689_10004039 | |||
| 1882 | Ga0207689_10011687 | |||
| 1883 | Ga0207689_10015929 | |||
| 1884 | Ga0207689_10036692 | |||
| 1885 | Ga0207689_10050801 | |||
| 1886 | Ga0207689_10051842 | |||
| 1887 | Ga0207689_10138954 | |||
| 1888 | Ga0207689_10231980 | |||
| 1889 | Ga0207689_10371134 | |||
| 1890 | Ga0207689_10651659 | |||
| 1891 | Ga0207689_10659378 | |||
| 1892 | Ga0207661_10006472 | |||
| 1893 | Ga0207661_10006982 | |||
| 1894 | Ga0207661_10009253 | |||
| 1895 | Ga0207661_10076460 | |||
| 1896 | Ga0207661_10310305 | |||
| 1897 | Ga0207661_11061858 | |||
| 1898 | Ga0207679_10003010 | |||
| 1899 | Ga0207679_10086960 | |||
| 1900 | Ga0207679_10148809 | |||
| 1901 | Ga0207679_10193919 | |||
| 1902 | Ga0207679_10214210 | |||
| 1903 | Ga0207679_10485240 | |||
| 1904 | Ga0207667_10000177 | |||
| 1905 | Ga0207667_10015290 | |||
| 1906 | Ga0207667_10021496 | |||
| 1907 | Ga0207667_10027988 | |||
| 1908 | Ga0207667_10044124 | |||
| 1909 | Ga0207667_10061072 | |||
| 1910 | Ga0207667_10100565 | |||
| 1911 | Ga0207667_10571436 | |||
| 1912 | Ga0207651_10001099 | |||
| 1913 | Ga0207651_10165244 | |||
| 1914 | Ga0207651_10213080 | |||
| 1915 | Ga0207651_10277221 | |||
| 1916 | Ga0207651_10298807 | |||
| 1917 | Ga0207651_10469620 | |||
| 1918 | Ga0207651_10609985 | |||
| 1919 | Ga0207651_10848885 | |||
| 1920 | Ga0207712_10009497 | |||
| 1921 | Ga0207712_10011985 | |||
| 1922 | Ga0207712_10052658 | |||
| 1923 | Ga0207712_10082148 | |||
| 1924 | Ga0207712_10140469 | |||
| 1925 | Ga0207712_10203460 | |||
| 1926 | Ga0207712_10209950 | |||
| 1927 | Ga0207712_10255179 | |||
| 1928 | Ga0207668_10000843 | |||
| 1929 | Ga0207668_10270488 | |||
| 1930 | Ga0207668_10299956 | |||
| 1931 | Ga0207640_10012737 | |||
| 1932 | Ga0207640_10147321 | |||
| 1933 | Ga0207640_10189077 | |||
| 1934 | Ga0207640_10287420 | |||
| 1935 | Ga0207640_10308625 | |||
| 1936 | Ga0207640_10328689 | |||
| 1937 | Ga0207640_10363026 | |||
| 1938 | Ga0207658_10061094 | |||
| 1939 | Ga0207658_10062871 | |||
| 1940 | Ga0207658_10201871 | |||
| 1941 | Ga0207658_10280211 | |||
| 1942 | Ga0207677_10008700 | |||
| 1943 | Ga0207677_10019809 | |||
| 1944 | Ga0207677_10023899 | |||
| 1945 | Ga0207677_10903456 | |||
| 1946 | Ga0207677_11044310 | |||
| 1947 | Ga0207703_10005016 | |||
| 1948 | Ga0207703_10050477 | |||
| 1949 | Ga0207703_10354175 | |||
| 1950 | Ga0207703_10400092 | |||
| 1951 | Ga0207639_10003645 | |||
| 1952 | Ga0207639_10045139 | |||
| 1953 | Ga0207639_10048724 | |||
| 1954 | Ga0207639_10132582 | |||
| 1955 | Ga0207639_10177426 | |||
| 1956 | Ga0207639_10191922 | |||
| 1957 | Ga0207639_10224058 | |||
| 1958 | Ga0207639_10239208 | |||
| 1959 | Ga0207639_10249979 | |||
| 1960 | Ga0207639_10361966 | |||
| 1961 | Ga0207639_10858552 | |||
| 1962 | Ga0207678_10036360 | |||
| 1963 | Ga0207678_10824553 | |||
| 1964 | Ga0207678_10824573 | |||
| 1965 | Ga0207708_10033757 | |||
| 1966 | Ga0207708_10236353 | |||
| 1967 | Ga0207708_10260555 | |||
| 1968 | Ga0207702_10079557 | |||
| 1969 | Ga0207702_10193997 | |||
| 1970 | Ga0207702_10500460 | |||
| 1971 | Ga0207702_10531882 | |||
| 1972 | Ga0207641_10000226 | |||
| 1973 | Ga0207641_10001217 | |||
| 1974 | Ga0207641_10004894 | |||
| 1975 | Ga0207641_10064994 | |||
| 1976 | Ga0207641_10089306 | |||
| 1977 | Ga0207641_10091888 | |||
| 1978 | Ga0207641_10272700 | |||
| 1979 | Ga0207641_10365843 | |||
| 1980 | Ga0207648_10002745 | |||
| 1981 | Ga0207648_10003442 | |||
| 1982 | Ga0207648_10012585 | |||
| 1983 | Ga0207648_10075871 | |||
| 1984 | Ga0207648_10075913 | |||
| 1985 | Ga0207648_10078660 | |||
| 1986 | Ga0207648_10082137 | |||
| 1987 | Ga0207648_10495006 | |||
| 1988 | Ga0207676_10009153 | |||
| 1989 | Ga0207676_10009837 | |||
| 1990 | Ga0207676_10022211 | |||
| 1991 | Ga0207676_10034551 | |||
| 1992 | Ga0207676_10130570 | |||
| 1993 | Ga0207676_10133209 | |||
| 1994 | Ga0207676_10208370 | |||
| 1995 | Ga0207676_10304526 | |||
| 1996 | Ga0207676_10600121 | |||
| 1997 | Ga0207676_10804568 | |||
| 1998 | Ga0207674_10000672 | |||
| 1999 | Ga0207674_10009363 | |||
| 2000 | Ga0207674_10013131 | |||
| 2001 | Ga0207674_10078260 | |||
| 2002 | Ga0207674_10102221 | |||
| 2003 | Ga0207674_10119089 | |||
| 2004 | Ga0207674_10191290 | |||
| 2005 | Ga0207674_10367721 | |||
| 2006 | Ga0207674_10743548 | |||
| 2007 | Ga0207674_11257823 | |||
| 2008 | Ga0207675_100000124 | |||
| 2009 | Ga0207675_100042058 | |||
| 2010 | Ga0207675_100066501 | |||
| 2011 | Ga0207675_100123061 | |||
| 2012 | Ga0207675_100132394 | |||
| 2013 | Ga0207675_100215203 | |||
| 2014 | Ga0207675_100337963 | |||
| 2015 | Ga0207675_100407759 | |||
| 2016 | Ga0207683_10010911 | |||
| 2017 | Ga0207683_10015180 | |||
| 2018 | Ga0207683_10069331 | |||
| 2019 | Ga0207683_10083694 | |||
| 2020 | Ga0207683_10267570 | |||
| 2021 | Ga0207683_10436473 | |||
| 2022 | Ga0207698_10001082 | |||
| 2023 | Ga0207698_10018942 | |||
| 2024 | Ga0207698_10055253 | |||
| 2025 | Ga0207698_10073671 | |||
| 2026 | Ga0207698_10117304 | |||
| 2027 | Ga0207698_10140320 | |||
| 2028 | Ga0207698_10366157 | |||
| 2029 | Ga0207698_10470277 | |||
| 2030 | Ga0207698_10587283 | |||
| 2031 | Ga0207698_10748676 | |||
| 2032 | Ga0207428_10196734 | |||
| 2033 | Ga0268266_10000049 | |||
| 2034 | Ga0268266_10085877 | |||
| 2035 | Ga0268266_10416980 | |||
| 2036 | Ga0268265_10127934 | |||
| 2037 | Ga0268265_10211380 | |||
| 2038 | Ga0268265_10520123 | |||
| 2039 | Ga0268265_10551345 | |||
| 2040 | Ga0268264_10000041 | |||
| 2041 | Ga0268264_10003860 | |||
| 2042 | Ga0268264_10008457 | |||
| 2043 | Ga0268264_10015087 | |||
| 2044 | Ga0268264_10018061 | |||
| 2045 | Ga0268264_10066255 | |||
| 2046 | Ga0268264_10092890 | |||
| 2047 | Ga0268264_10354427 | |||
| 2048 | Ga0268264_10459618 | |||
| 2049 | Ga0268264_10472905 | |||
| 2050 | Ga0307517_10079111 | |||
| 2051 | Ga0307515_10000001 | |||
| 2052 | Ga0307515_10009265 | |||
| 2053 | Ga0307515_10201918 | |||
| 2054 | Ga0307511_10000042 | |||
| 2055 | Ga0316177_1100501 | |||
| 2056 | Ga0265327_10000084 | |||
| 2057 | Ga0265327_10000395 | |||
| 2058 | Ga0265327_10011198 | |||
| 2059 | Ga0265327_10023168 | |||
| 2060 | Ga0265327_10168209 | |||
| 2061 | Ga0265316_10169767 | |||
| 2062 | Ga0307513_10151351 | |||
| 2063 | Ga0307513_10285094 | |||
| 2064 | Ga0307513_10625902 | |||
| 2065 | Ga0307509_10139082 | |||
| 2066 | Ga0307509_10208553 | |||
| 2067 | Ga0307509_10234366 | |||
| 2068 | Ga0307509_10365330 | |||
| 2069 | Ga0307508_10002100 | |||
| 2070 | Ga0307516_10001558 | |||
| 2071 | Ga0307516_10214020 | |||
| 2072 | Ga0307414_10000003 | |||
| 2073 | Ga0307414_10019125 | |||
| 2074 | Ga0307507_10286948 | |||
| 2075 | Ga0307510_10000091 | |||
| 2076 | Ga0373934_0117388 | |||
| 2077 | Ga0373934_0232580 | |||
| 2078 | Ga0373952_0023997 | |||
| 2079 | Ga0373953_0040200 | |||
| 2080 | Ga0373956_0164875 | |||
| 2081 | Ga0373943_0031071 | |||
| 2082 | Ga0373947_0082304 | |||
| 2083 | Ga0373937_0058916 | |||
| 2084 | Ga0373937_0277658 | |||
| 2085 | Ga0373937_0365304 | |||
| 2086 | Ga0373925_0098421 | |||
| 2087 | Ga0395900_0596943 | |||
| 2088 | Ga0395905_0317315 | |||
| 2089 | Ga0400483_053230 | |||
| 2090 | Ga0400489_34926 | |||
| 2091 | Ga0436365_0175741 | |||
| 2092 | Ga0436365_0203686 | |||
| 2093 | Ga0436365_0881017 | |||
| 2094 | Ga0436365_1079918 | |||
| 2095 | Ga0436365_1735638 | |||
| 2096 | Ga0436363_1382145 | |||
| 2097 | Ga0439436_0001603 | |||
| 2098 | Ga0439439_0014036 | |||
| 2099 | Ga0439439_0041709 | |||
| 2100 | Ga0451791_1161455 | |||
| 2101 | Ga0451841_0473234 | |||
| 2102 | Ga0451849_1509768 | |||
| 2103 | Ga0451853_3111860 | |||
| 2104 | Ga0439442_014098 | |||
| 2105 | Ga0439452_061751 | |||
| 2106 | Ga0439454_029769 | |||
| 2107 | Ga0439457_000788 | |||
| 2108 | Ga0439457_010425 | |||
| 2109 | Ga0439462_0007494 | |||
| 2110 | Ga0450923_055175 | |||
| 2111 | Ga0450898_024292 | |||
| 2112 | Ga0439434_0024981 | |||
| 2113 | Ga0439435_0075887 | |||
| 2114 | Ga0451577_0069645 | |||
| 2115 | Ga0466969_0000584 | |||
| 2116 | Ga0466972_0000002 | |||
| 2117 | Ga0466972_0000207 | |||
| 2118 | Ga0466972_0003815 | |||
| 2119 | Ga0466972_0137982 | |||
| 2120 | Ga0466965_0069128 | |||
| 2121 | Ga0466966_0000136 | |||
| 2122 | Ga0466961_0042386 | |||
| 2123 | Ga0466961_0212398 | |||
| 2124 | Ga0466964_0064167 | |||
| 2125 | Ga0466964_0198483 | |||
| 2126 | Ga0453684_0182377 | |||
| 2127 | Ga0466971_0085557 | |||
| 2128 | Ga0466968_0024893 | |||
| 2129 | Ga0466968_0074220 | |||
| 2130 | Ga0466970_0032860 | |||
| 2131 | Ga0466970_0083703 | |||
| 2132 | Ga0466970_0183496 | |||
| 2133 | Ga0466957_0007040 | |||
| 2134 | Ga0466957_0014895 | |||
| 2135 | Ga0466959_0000002 | |||
| 2136 | Ga0466959_0004264 | |||
| 2137 | Ga0466958_0067052 | |||
| 2138 | Ga0495592_0092874 | |||
| 2139 | Ga0495638_0044437 | |||
| 2140 | Ga0495638_0133573 | |||
| 2141 | Ga0495651_0491722 | |||
| 2142 | Ga0495651_0510201 | |||
| 2143 | Ga0495650_0048290 | |||
| 2144 | Ga0495580_0014773 | |||
| 2145 | Ga0495594_0109128 | |||
| 2146 | Ga0495606_0019321 | |||
| 2147 | Ga0495608_0321123 | |||
| 2148 | Ga0495628_0034567 | |||
| 2149 | Ga0495628_0285752 | |||
| 2150 | Ga0495630_0012164 | |||
| 2151 | Ga0495648_0014811 | |||
| 2152 | Ga0495652_0080509 | |||
| 2153 | Ga0495640_0090800 | |||
| 2154 | Ga0495586_0254880 | |||
| 2155 | Ga0495598_0076542 | |||
| 2156 | Ga0495597_0142432 | |||
| 2157 | Ga0495645_0092555 | |||
| 2158 | Ga0495645_0125671 | |||
| 2159 | Ga0495633_0105857 | |||
| 2160 | Ga0495668_0000751 | |||
| 2161 | Ga0495611_0001116 | |||
| 2162 | Ga0495611_0036215 | |||
| 2163 | Ga0495611_0320702 | |||
| 2164 | Ga0495625_0040260 | |||
| 2165 | Ga0495658_0229419 | |||
| 2166 | Ga0495613_0185963 | |||
| 2167 | Ga0495600_0264951 | |||
| 2168 | Ga0495674_0210944 | |||
| 2169 | Ga0495672_0025973 | |||
| 2170 | Ga0495676_0070348 | |||
| 2171 | Ga0495676_0145947 | |||
| 2172 | Ga0495687_000001 | |||
| 2173 | Ga0495675_0166435 | |||
| 2174 | Ga0495675_0240181 | |||
| 2175 | Ga0495684_0050898 | |||
| 2176 | Ga0495684_0436512 | |||
| 2177 | Ga0495686_0000004 | |||
| 2178 | Ga0495686_0011430 | |||
| 2179 | Ga0495686_0071848 | |||
| 2180 | Ga0496104_0497143 | |||
| 2181 | Ga0496104_0540596 | |||
| 2182 | Ga0496105_0561363 | |||
| 2183 | Ga0496107_0583247 | |||
| 2184 | Ga0496108_0183554 | |||
| 2185 | Ga0496108_0481496 | |||
| 2186 | Ga0496108_0503107 | |||
| 2187 | Ga0496109_0245679 | |||
| 2188 | Ga0496109_0252417 | |||
| 2189 | Ga0496110_0267538 | |||
| 2190 | Ga0496110_0939890 | |||
| 2191 | Ga0496115_0089648 | |||
| 2192 | Ga0496124_0066454 | |||
| 2193 | Ga0496126_0567079 | |||
| 2194 | Ga0501031_0010841 | |||
| 2195 | Ga0501031_0485868 | |||
| 2196 | Ga0501032_0154715 | |||
| 2197 | Ga0501032_0381305 | |||
| 2198 | Ga0501033_0066471 | |||
| 2199 | Ga0501033_0230965 | |||
| 2200 | Ga0501034_0004012 | |||
| 2201 | Ga0501034_0053271 | |||
| 2202 | Ga0501034_0064319 | |||
| 2203 | Ga0501034_0112712 | |||
| 2204 | Ga0501034_0240918 | |||
| 2205 | Ga0501034_1151286 | |||
| 2206 | Ga0501036_0306700 | |||
| 2207 | Ga0501037_0007826 | |||
| 2208 | Ga0501037_0037709 | |||
| 2209 | Ga0501038_0007220 | |||
| 2210 | Ga0501038_0033809 | |||
| 2211 | Ga0501039_0385750 | |||
| 2212 | Ga0501040_0024888 | |||
| 2213 | Ga0501043_0008215 | |||
| 2214 | Ga0501043_0015257 | |||
| 2215 | Ga0501043_0029351 | |||
| 2216 | Ga0501047_0009183 | |||
| 2217 | Ga0501047_0119920 | |||
| 2218 | Ga0501047_0128329 | |||
| 2219 | Ga0501048_0165851 | |||
| 2220 | Ga0501068_0026838 | |||
| 2221 | Ga0501069_0007664 | |||
| 2222 | Ga0501071_0062985 | |||
| 2223 | Ga0501073_0018001 | |||
| 2224 | Ga0501227_002942 | |||
| 2225 | Ga0501257_046339 | |||
| 2226 | Ga0501219_000230 | |||
| 2227 | Ga0501225_0001846 | |||
| 2228 | Ga0501079_0058140 | |||
| 2229 | Ga0501080_0140200 | |||
| 2230 | Ga0501083_0060149 | |||
| 2231 | Ga0501035_0031410 | |||
| 2232 | Ga0501035_0043415 | |||
| 2233 | Ga0501035_0210219 | |||
| 2234 | Ga0501044_0016307 | |||
| 2235 | Ga0501044_0017470 | |||
| 2236 | Ga0501044_0044831 | |||
| 2237 | Ga0501044_0100475 | |||
| 2238 | Ga0501044_0221853 | |||
| 2239 | Ga0501044_0657860 | |||
| 2240 | Ga0501284_00029 | |||
| 2241 | nmdc:mga0k408_233999_c1 | |||
| 2242 | nmdc:mga0k408_57908_c1 | |||
| 2243 | nmdc:mga05p37_720353_c1 | |||
| 2244 | nmdc:mga05p37_985444_c1 | |||
| 2245 | nmdc:mga09592_173530_c1 | |||
| 2246 | nmdc:mga09592_466632_c1 | |||
| 2247 | nmdc:mga0qj67_225298_c1 | |||
| 2248 | nmdc:mga06r32_10152_c1 | |||
| 2249 | nmdc:mga08y16_168780_c1 | |||
| 2250 | nmdc:mga08y16_237955_c1 | |||
| 2251 | nmdc:mga08y16_277282_c1 | |||
| 2252 | nmdc:mga08y16_292138_c1 | |||
| 2253 | nmdc:mga08y16_646838_c1 | |||
| 2254 | nmdc:mga08y16_766199_c1 | |||
| 2255 | nmdc:mga0n895_876213_c1 | |||
| 2256 | Ga0500578_0000034 | |||
| 2257 | Ga0500644_0000283 | |||
| 2258 | Ga0500644_0018221 | |||
| 2259 | Ga0500644_0064791 | |||
| 2260 | Ga0500644_0246989 | |||
| 2261 | Ga0500646_0017416 | |||
| 2262 | Ga0500583_0000346 | |||
| 2263 | Ga0500583_0006285 | |||
| 2264 | Ga0500640_180406 | |||
| 2265 | Ga0500650_0137230 | |||
| 2266 | Ga0500562_000050 | |||
| 2267 | Ga0500569_026583 | |||
| 2268 | Ga0500652_027751 | |||
| 2269 | Ga0500658_0006675 | |||
| 2270 | Ga0500559_0134430 | |||
| 2271 | Ga0500577_0130092 | |||
| 2272 | Ga0500588_0080710 | |||
| 2273 | Ga0500589_111239 | |||
| 2274 | Ga0500590_113567 | |||
| 2275 | Ga0500604_0014034 | |||
| 2276 | Ga0500604_0162825 | |||
| 2277 | Ga0500616_0005429 | |||
| 2278 | Ga0500616_0009033 | |||
| 2279 | Ga0500616_0041053 | |||
| 2280 | Ga0500616_0058660 | |||
| 2281 | Ga0500622_0001463 | |||
| 2282 | Ga0500634_0069639 | |||
| 2283 | Ga0500639_048405 | |||
| 2284 | Ga0501084_0108818 | |||
| 2285 | Ga0501082_0492410 | |||
| 2286 | Ga0466962_0082820 | |||
| 2287 | Ga0466962_0379214 | |||
| 2288 | 2738727061 | |||
| 2289 | 2819588782 | |||
| 2290 | 2884795626 | |||
| 2291 | 2929157418 | |||
| 2292 | 2929923242 | |||
| 2293 | 8003153685 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nsj-assembly1.cif.gz_A-2 | crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima | 0.8804 | 1 | 211 |
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.8706 | 1 | 211 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.8701 | 1 | 211 |
| 1nsj-assembly1.cif.gz_A-2 | crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima | 0.8683 | 1 | 211 |
| 1v5x-assembly1.cif.gz_B | crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus | 0.8678 | 2 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8678 | 2 | 210 | 3.20.20.70 |
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8661 | 1 | 212 | 3.20.20.70 |
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8576 | 1 | 212 | 3.20.20.70 |
| af_Q2FYR5_1_206_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8554 | 2 | 211 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8473 | 2 | 210 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2XC07-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.992 | 2 | 211 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A191TPB8-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9897 | 2 | 211 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A537KKD0-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9887 | 2 | 210 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A1I5XBR7-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9867 | 1 | 210 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A537JSI5-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) | 0.9849 | 2 | 132 |
GO:0000162
GO:0004640 GO:0006568 |