F490790

General Info

Members Datasets Scaffolds Average Seq Length
1146 338 2293 214

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100365111|Ga0068869_1003651111
Length 242
Sequence MAKQPKQSQPTESIETNVTESTPGPPFKGRIKVCGMTLPDQVNALDEMGVDLAGFIFYPKSPRFIRNKIPAEKMKKIKGRIAKVGVFVNMPYEDLMRTVEDYRLDMVQLHGDETPRYCEQVANYITVVKAFRLSDNDPLDWIIRPFHEGSDMYMFDTLGSGYGGTGKKFDWNVLKDKQIDKLFFLSGGIEPGDEERLKNFAMEPVAKKLFAIDINSKFEISAGVKDIERIRKFVTTLRSGPQ

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
184 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
205 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
219 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
220 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
294 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
295 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
314 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
315 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
316 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
317 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
318 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
322 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
323 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
329 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 2738541278 Niastella sp. CF465 Isolate Unclassified
334 2818991444 Filimonas endophytica 3197 Isolate Unclassified
335 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
336 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
337 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
338 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.17
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 1.13
Rhizosphere 90.66
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100365111 3300005334 Bacteria 1180
2 MBSR1b_contig_5080737 2162886012 Bacteria 1371
3 JGI24740J21852_10005751 3300001979 Bacteria 5210
4 JGI25154J39366_1000040 3300002738 Bacteria 147410
5 JGI25157J39369_1003509 3300002741 Bacteria 3173
6 JGI25406J46586_10015712 3300003203 Bacteria 3183
7 rootH1_10042957 3300003316 Unclassified 1701
8 rootH2_10008248 3300003320 Bacteria 5781
9 rootH2_10008268 3300003320 Bacteria 7923
10 rootH2_10028777 3300003320 Bacteria 10914
11 rootH2_10030072 3300003320 Bacteria 4856
12 rootH2_10132146 3300003320 Bacteria 1804
13 rootH2_10141251 3300003320 Bacteria 1834
14 rootL2_10188385 3300003322 Bacteria 1474
15 rootH1_10002854 3300003316 Bacteria 8719
16 rootH1_10002854 3300003323 Bacteria 1182
17 rootH1_10015122 3300003323 Bacteria 9190
18 JGI25160J50197_1001601 3300003354 Bacteria 11152
19 Ga0055535_1003449 3300003761 Bacteria 4482
20 Ga0055542_1017472 3300003762 Bacteria 1110
21 Ga0058863_11413575 3300004799 Bacteria 3839
22 Ga0058862_12656212 3300004803 Bacteria 1749
23 Ga0065165_1037906 3300005262 Bacteria 1458
24 Ga0065712_10008205 3300005290 Unclassified 2599
25 Ga0065712_10070469 3300005290 Bacteria 5975
26 Ga0065712_10270594 3300005290 Bacteria 909
27 Ga0070658_10010748 3300005327 Bacteria 7336
28 Ga0070658_10075190 3300005327 Bacteria 2771
29 Ga0070658_10081107 3300005327 Bacteria 2665
30 Ga0070658_10187046 3300005327 Bacteria 1745
31 Ga0070658_10214232 3300005327 Bacteria 1628
32 Ga0070658_10281996 3300005327 Bacteria 1414
33 Ga0070658_10526202 3300005327 Bacteria 1022
34 Ga0070676_10000336 3300005328 Bacteria 21357
35 Ga0070676_10031688 3300005328 Bacteria 3024
36 Ga0070676_10248238 3300005328 Bacteria 1186
37 Ga0070683_100002966 3300005329 Bacteria 13606
38 Ga0070683_100032588 3300005329 Bacteria 4746
39 Ga0070683_100120371 3300005329 Bacteria 2479
40 Ga0070683_100673128 3300005329 Bacteria 991
41 Ga0070683_100841404 3300005329 Bacteria 880
42 Ga0070690_100005983 3300005330 Bacteria 6872
43 Ga0070690_100057685 3300005330 Bacteria 2492
44 Ga0070690_100166719 3300005330 Bacteria 1513
45 Ga0070690_100266160 3300005330 Bacteria 1218
46 Ga0070690_100319086 3300005330 Unclassified 1119
47 Ga0070670_100030756 3300005331 Bacteria 4623
48 Ga0070670_100039056 3300005331 Bacteria 4081
49 Ga0070670_100062154 3300005331 Bacteria 3206
50 Ga0070670_100079810 3300005331 Unclassified 2812
51 Ga0070670_100162784 3300005331 Bacteria 1934
52 Ga0070670_100221339 3300005331 Bacteria 1647
53 Ga0070670_100245642 3300005331 Bacteria 1559
54 Ga0070670_100899099 3300005331 Bacteria 803
55 Ga0070677_10143248 3300005333 Bacteria 1105
56 Ga0070677_10416306 3300005333 Bacteria 712
57 Ga0068869_100043129 3300005334 Bacteria 3238
58 Ga0068869_100080027 3300005334 Bacteria 2436
59 Ga0068869_100125092 3300005334 Bacteria 1971
60 Ga0068869_100151211 3300005334 Bacteria 1801
61 Ga0068869_100159910 3300005334 Bacteria 1753
62 Ga0068869_100160053 3300005334 Unclassified 1752
63 Ga0068869_100183963 3300005334 Bacteria 1639
64 Ga0068869_100428266 3300005334 Bacteria 1093
65 Ga0068869_100468926 3300005334 Bacteria 1047
66 Ga0070666_10000051 3300005335 Bacteria 99740
67 Ga0070666_10010207 3300005335 Bacteria 5868
68 Ga0070666_10013609 3300005335 Bacteria 5165
69 Ga0070666_10090217 3300005335 Bacteria 2105
70 Ga0070666_10143011 3300005335 Bacteria 1667
71 Ga0070666_10382347 3300005335 Bacteria 1011
72 Ga0070680_100031956 3300005336 Bacteria 4233
73 Ga0070680_100171315 3300005336 Bacteria 1827
74 Ga0070680_100189297 3300005336 Bacteria 1734
75 Ga0070680_100213482 3300005336 Bacteria 1628
76 Ga0070680_100243505 3300005336 Unclassified 1520
77 Ga0070682_100001275 3300005337 Bacteria 14290
78 Ga0070682_100026905 3300005337 Bacteria 3446
79 Ga0070682_100559187 3300005337 Unclassified 897
80 Ga0068868_100005270 3300005338 Bacteria 9078
81 Ga0068868_100010338 3300005338 Bacteria 6749
82 Ga0068868_100078065 3300005338 Bacteria 2650
83 Ga0068868_100205069 3300005338 Viruses 1645
84 Ga0068868_100255371 3300005338 Bacteria 1476
85 Ga0068868_100308965 3300005338 Bacteria 1345
86 Ga0068868_100630897 3300005338 Bacteria 952
87 Ga0068868_101113413 3300005338 Bacteria 727
88 Ga0070660_100015714 3300005339 Bacteria 5473
89 Ga0070660_101097932 3300005339 Unclassified 673
90 Ga0070689_100001732 3300005340 Bacteria 13951
91 Ga0070689_100013351 3300005340 Bacteria 5941
92 Ga0070689_100014808 3300005340 Bacteria 5674
93 Ga0070689_100278201 3300005340 Bacteria 1388
94 Ga0070691_10016205 3300005341 Bacteria 3424
95 Ga0070691_10049783 3300005341 Bacteria 1997
96 Ga0070661_100002702 3300005344 Bacteria 12149
97 Ga0070661_100003143 3300005344 Bacteria 11357
98 Ga0070661_100022549 3300005344 Bacteria 4508
99 Ga0070661_100242507 3300005344 Bacteria 1388
100 Ga0070661_100286536 3300005344 Bacteria 1279
101 Ga0070661_100467931 3300005344 Bacteria 1005
102 Ga0070668_100002494 3300005347 Bacteria 13548
103 Ga0070668_100022644 3300005347 Bacteria 4751
104 Ga0070668_100395028 3300005347 Bacteria 1180
105 Ga0070669_100004789 3300005353 Bacteria 9766
106 Ga0070669_100036574 3300005353 Bacteria 3558
107 Ga0070669_100165082 3300005353 Unclassified 1723
108 Ga0070669_100301733 3300005353 Bacteria 1288
109 Ga0070669_100582851 3300005353 Bacteria 935
110 Ga0070669_100761213 3300005353 Bacteria 821
111 Ga0070669_100924072 3300005353 Bacteria 746
112 Ga0070675_100013600 3300005354 Bacteria 6399
113 Ga0070675_100025711 3300005354 Bacteria 4720
114 Ga0070675_100040336 3300005354 Bacteria 3811
115 Ga0070675_100055271 3300005354 Unclassified 3268
116 Ga0070675_100266528 3300005354 Bacteria 1502
117 Ga0070671_100004803 3300005355 Bacteria 10743
118 Ga0070671_100032777 3300005355 Bacteria 4293
119 Ga0070671_100049587 3300005355 Bacteria 3493
120 Ga0070671_100062085 3300005355 Bacteria 3112
121 Ga0070671_100074043 3300005355 Bacteria 2845
122 Ga0070671_100123868 3300005355 Bacteria 2176
123 Ga0070671_100195390 3300005355 Bacteria 1715
124 Ga0070671_100292029 3300005355 Bacteria 1387
125 Ga0070671_100354866 3300005355 Bacteria 1252
126 Ga0070674_100028173 3300005356 Bacteria 3688
127 Ga0070674_100076506 3300005356 Bacteria 2379
128 Ga0070674_100270356 3300005356 Bacteria 1343
129 Ga0070673_100001990 3300005364 Bacteria 12324
130 Ga0070673_100017265 3300005364 Bacteria 5126
131 Ga0070673_100049176 3300005364 Bacteria 3292
132 Ga0070673_100062597 3300005364 Bacteria 2957
133 Ga0070673_100161208 3300005364 Bacteria 1908
134 Ga0070673_100216608 3300005364 Bacteria 1655
135 Ga0070673_100218521 3300005364 Bacteria 1648
136 Ga0070673_100290540 3300005364 Bacteria 1436
137 Ga0070673_100874628 3300005364 Bacteria 832
138 Ga0070688_100019036 3300005365 Bacteria 3974
139 Ga0070688_100039808 3300005365 Bacteria 2878
140 Ga0070688_100051258 3300005365 Bacteria 2574
141 Ga0070688_100082918 3300005365 Unclassified 2079
142 Ga0070688_100345935 3300005365 Bacteria 1087
143 Ga0070659_100117387 3300005366 Bacteria 2152
144 Ga0070659_100120914 3300005366 Bacteria 2121
145 Ga0070667_100000492 3300005367 Bacteria 40164
146 Ga0070667_100020321 3300005367 Bacteria 5512
147 Ga0070667_100054456 3300005367 Bacteria 3378
148 Ga0070667_100075366 3300005367 Bacteria 2880
149 Ga0070667_100088516 3300005367 Bacteria 2659
150 Ga0070667_100157396 3300005367 Bacteria 1999
151 Ga0070667_100161421 3300005367 Bacteria 1974
152 Ga0070667_100307734 3300005367 Unclassified 1428
153 Ga0070705_100351477 3300005440 Bacteria 1075
154 Ga0070663_100690869 3300005455 Bacteria 866
155 Ga0070678_100010791 3300005456 Bacteria 5599
156 Ga0070678_100013945 3300005456 Bacteria 5054
157 Ga0070678_100231962 3300005456 Unclassified 1539
158 Ga0070662_100004086 3300005457 Bacteria 9167
159 Ga0070662_100027166 3300005457 Bacteria 3970
160 Ga0070662_100036135 3300005457 Bacteria 3493
161 Ga0070662_100056097 3300005457 Bacteria 2860
162 Ga0070662_100146200 3300005457 Bacteria 1836
163 Ga0070662_100283207 3300005457 Bacteria 1342
164 Ga0070681_10021777 3300005458 Bacteria 6428
165 Ga0070681_10040812 3300005458 Bacteria 4649
166 Ga0070681_10097972 3300005458 Bacteria 2878
167 Ga0070681_10305631 3300005458 Bacteria 1500
168 Ga0068867_100043311 3300005459 Bacteria 3295
169 Ga0068867_100082241 3300005459 Bacteria 2429
170 Ga0068867_100094622 3300005459 Bacteria 2272
171 Ga0068867_100192882 3300005459 Bacteria 1627
172 Ga0068867_100273011 3300005459 Bacteria 1383
173 Ga0068867_100355786 3300005459 Bacteria 1223
174 Ga0068867_100621339 3300005459 Unclassified 945
175 Ga0070685_10009065 3300005466 Bacteria 5133
176 Ga0070685_10016536 3300005466 Bacteria 3932
177 Ga0070685_10063077 3300005466 Bacteria 2175
178 Ga0070685_10165147 3300005466 Unclassified 1414
179 Ga0070685_10166737 3300005466 Bacteria 1408
180 Ga0070698_100007269 3300005471 Bacteria 11994
181 Ga0070699_100140396 3300005518 Bacteria 2133
182 Ga0070679_100004536 3300005530 Bacteria 12825
183 Ga0070679_100029492 3300005530 Bacteria 5413
184 Ga0070679_100054566 3300005530 Bacteria 3979
185 Ga0070679_100098661 3300005530 Bacteria 2908
186 Ga0070679_100143593 3300005530 Bacteria 2365
187 Ga0070684_100000228 3300005535 Bacteria 38984
188 Ga0070684_100060191 3300005535 Bacteria 3321
189 Ga0070684_100479592 3300005535 Bacteria 1151
190 Ga0070684_100664138 3300005535 Bacteria 971
191 Ga0068853_100000221 3300005539 Bacteria 40294
192 Ga0068853_100020583 3300005539 Bacteria 5487
193 Ga0068853_100055688 3300005539 Bacteria 3409
194 Ga0068853_100058961 3300005539 Bacteria 3315
195 Ga0068853_100092567 3300005539 Bacteria 2660
196 Ga0068853_100094499 3300005539 Unclassified 2634
197 Ga0068853_100130043 3300005539 Bacteria 2253
198 Ga0068853_100140870 3300005539 Bacteria 2165
199 Ga0068853_100196267 3300005539 Bacteria 1836
200 Ga0068853_100241918 3300005539 Bacteria 1654
201 Ga0068853_100372941 3300005539 Bacteria 1332
202 Ga0068853_100706232 3300005539 Bacteria 962
203 Ga0070672_100001464 3300005543 Bacteria 14647
204 Ga0070672_100052158 3300005543 Bacteria 3192
205 Ga0070672_100179906 3300005543 Unclassified 1762
206 Ga0070672_100199661 3300005543 Bacteria 1672
207 Ga0070672_100786836 3300005543 Bacteria 836
208 Ga0070686_100392522 3300005544 Bacteria 1053
209 Ga0070686_100680528 3300005544 Bacteria 818
210 Ga0070695_100438499 3300005545 Unclassified 998
211 Ga0070693_100009189 3300005547 Bacteria 4910
212 Ga0070665_100000001 3300005548 Bacteria 1083363
213 Ga0070665_100005742 3300005548 Bacteria 12739
214 Ga0070665_100392369 3300005548 Bacteria 1396
215 Ga0068855_100007886 3300005563 Bacteria 12858
216 Ga0068855_100030208 3300005563 Bacteria 6482
217 Ga0068855_100034990 3300005563 Bacteria 5986
218 Ga0068855_100125633 3300005563 Bacteria 2933
219 Ga0068855_100274941 3300005563 Bacteria 1872
220 Ga0068855_100329735 3300005563 Bacteria 1685
221 Ga0068855_100413214 3300005563 Bacteria 1477
222 Ga0068855_100482300 3300005563 Bacteria 1349
223 Ga0070664_100003241 3300005564 Bacteria 13152
224 Ga0070664_100004633 3300005564 Bacteria 11040
225 Ga0070664_100012802 3300005564 Bacteria 6824
226 Ga0070664_100074332 3300005564 Bacteria 2917
227 Ga0070664_100296205 3300005564 Bacteria 1461
228 Ga0070664_100382311 3300005564 Bacteria 1285
229 Ga0070664_100688884 3300005564 Bacteria 951
230 Ga0068857_100001119 3300005577 Bacteria 20854
231 Ga0068857_100007157 3300005577 Bacteria 9611
232 Ga0068857_100019040 3300005577 Bacteria 6024
233 Ga0068857_100090705 3300005577 Bacteria 2735
234 Ga0068857_100118152 3300005577 Bacteria 2386
235 Ga0068857_100238569 3300005577 Bacteria 1664
236 Ga0068857_100289571 3300005577 Unclassified 1508
237 Ga0068854_100071634 3300005578 Bacteria 2536
238 Ga0068854_100073957 3300005578 Bacteria 2499
239 Ga0068854_100086737 3300005578 Bacteria 2321
240 Ga0068854_100176660 3300005578 Bacteria 1665
241 Ga0068854_100373372 3300005578 Bacteria 1173
242 Ga0068854_100587059 3300005578 Unclassified 949
243 Ga0068854_100606295 3300005578 Bacteria 935
244 Ga0068854_100714905 3300005578 Unclassified 866
245 Ga0068854_101153514 3300005578 Bacteria 692
246 Ga0068856_100011164 3300005614 Bacteria 8722
247 Ga0068856_100063215 3300005614 Bacteria 3657
248 Ga0068856_100074030 3300005614 Bacteria 3372
249 Ga0068856_100139887 3300005614 Bacteria 2428
250 Ga0068856_100567977 3300005614 Bacteria 1155
251 Ga0070702_100122033 3300005615 Bacteria 1633
252 Ga0068852_100002006 3300005616 Bacteria 13883
253 Ga0068852_100018674 3300005616 Bacteria 5466
254 Ga0068852_100023547 3300005616 Bacteria 4958
255 Ga0068852_100066167 3300005616 Bacteria 3155
256 Ga0068852_100136739 3300005616 Bacteria 2263
257 Ga0068852_100230863 3300005616 Bacteria 1764
258 Ga0068852_100241605 3300005616 Bacteria 1726
259 Ga0068852_100292942 3300005616 Bacteria 1573
260 Ga0068852_100595137 3300005616 Bacteria 1110
261 Ga0068852_100704643 3300005616 Unclassified 1020
262 Ga0068852_100732765 3300005616 Bacteria 1000
263 Ga0068859_100000023 3300005617 Bacteria 221914
264 Ga0068859_100008109 3300005617 Bacteria 10653
265 Ga0068859_100033356 3300005617 Bacteria 5169
266 Ga0068859_100054725 3300005617 Bacteria 4014
267 Ga0068859_100069445 3300005617 Bacteria 3558
268 Ga0068859_100085357 3300005617 Bacteria 3202
269 Ga0068859_100135826 3300005617 Unclassified 2532
270 Ga0068859_100805481 3300005617 Bacteria 1027
271 Ga0068859_100986642 3300005617 Bacteria 925
272 Ga0068859_101001856 3300005617 Bacteria 917
273 Ga0068859_101134262 3300005617 Bacteria 860
274 Ga0068864_100005800 3300005618 Bacteria 10131
275 Ga0068864_100007839 3300005618 Bacteria 8801
276 Ga0068864_100016359 3300005618 Bacteria 6174
277 Ga0068864_100026175 3300005618 Bacteria 4918
278 Ga0068864_100066317 3300005618 Bacteria 3133
279 Ga0068864_100072654 3300005618 Bacteria 2999
280 Ga0068864_100217573 3300005618 Bacteria 1761
281 Ga0068864_100293509 3300005618 Bacteria 1520
282 Ga0068864_100444836 3300005618 Bacteria 1238
283 Ga0068866_10059122 3300005718 Bacteria 1982
284 Ga0068866_10348342 3300005718 Bacteria 940
285 Ga0068861_100009306 3300005719 Bacteria 6779
286 Ga0068861_100094670 3300005719 Bacteria 2364
287 Ga0068861_100122562 3300005719 Bacteria 2099
288 Ga0068861_100129736 3300005719 Bacteria 2045
289 Ga0068861_100158612 3300005719 Bacteria 1864
290 Ga0068861_100205414 3300005719 Bacteria 1656
291 Ga0068861_100362071 3300005719 Bacteria 1276
292 Ga0068861_100791543 3300005719 Unclassified 889
293 Ga0068851_10001340 3300005834 Bacteria 10756
294 Ga0068870_10046335 3300005840 Bacteria 2279
295 Ga0068870_10105701 3300005840 Bacteria 1599
296 Ga0068863_100001812 3300005841 Bacteria 21216
297 Ga0068863_100013140 3300005841 Bacteria 7992
298 Ga0068863_100074948 3300005841 Bacteria 3202
299 Ga0068863_100075228 3300005841 Bacteria 3195
300 Ga0068863_100130519 3300005841 Unclassified 2399
301 Ga0068858_100008485 3300005842 Bacteria 9874
302 Ga0068858_100049204 3300005842 Bacteria 3904
303 Ga0068858_100577331 3300005842 Unclassified 1089
304 Ga0068858_100827928 3300005842 Bacteria 903
305 Ga0068860_100000046 3300005843 Bacteria 214800
306 Ga0068860_100000916 3300005843 Bacteria 32698
307 Ga0068860_100005408 3300005843 Bacteria 12959
308 Ga0068860_100007358 3300005843 Bacteria 11008
309 Ga0068860_100024991 3300005843 Bacteria 5767
310 Ga0068860_100034035 3300005843 Bacteria 4887
311 Ga0068860_100116564 3300005843 Unclassified 2556
312 Ga0068860_100371146 3300005843 Unclassified 1411
313 Ga0068860_100822578 3300005843 Unclassified 943
314 Ga0068860_101335261 3300005843 Unclassified 738
315 Ga0068862_100003779 3300005844 Bacteria 12914
316 Ga0068862_100022881 3300005844 Bacteria 5231
317 Ga0068862_100166968 3300005844 Bacteria 1968
318 Ga0068862_100449754 3300005844 Bacteria 1214
319 Ga0068862_100723941 3300005844 Unclassified 966
320 Ga0081539_10000531 3300005985 Bacteria 79191
321 Ga0081539_10071796 3300005985 Bacteria 1852
322 Ga0070715_10046164 3300006163 Bacteria 1851
323 Ga0070715_10112710 3300006163 Bacteria 1285
324 Ga0075366_10048373 3300006195 Bacteria 2522
325 Ga0075366_10061180 3300006195 Bacteria 2237
326 Ga0075366_10207913 3300006195 Bacteria 1191
327 Ga0097621_100000847 3300006237 Bacteria 21541
328 Ga0097621_100001572 3300006237 Bacteria 15606
329 Ga0097621_100003432 3300006237 Bacteria 10914
330 Ga0097621_100035876 3300006237 Bacteria 3963
331 Ga0097621_100044146 3300006237 Bacteria 3596
332 Ga0097621_100077970 3300006237 Bacteria 2751
333 Ga0097621_100098064 3300006237 Unclassified 2461
334 Ga0097621_100098913 3300006237 Bacteria 2451
335 Ga0097621_100157282 3300006237 Bacteria 1951
336 Ga0097621_100524427 3300006237 Bacteria 1076
337 Ga0097621_100706038 3300006237 Bacteria 929
338 Ga0068871_100000027 3300006358 Bacteria 78588
339 Ga0068871_100000354 3300006358 Bacteria 31915
340 Ga0068871_100001006 3300006358 Bacteria 18890
341 Ga0068871_100024941 3300006358 Bacteria 4645
342 Ga0068871_100040970 3300006358 Unclassified 3712
343 Ga0068871_100106906 3300006358 Bacteria 2349
344 Ga0068871_100195683 3300006358 Bacteria 1743
345 Ga0068871_100229104 3300006358 Bacteria 1612
346 Ga0068871_100267331 3300006358 Bacteria 1493
347 Ga0068871_100348869 3300006358 Bacteria 1309
348 Ga0068871_100459632 3300006358 Bacteria 1142
349 Ga0075428_100024587 3300006844 Bacteria 6666
350 Ga0075428_100871642 3300006844 Bacteria 956
351 Ga0075430_100010054 3300006846 Bacteria 8005
352 Ga0075431_100004434 3300006847 Bacteria 13760
353 Ga0075431_100245623 3300006847 Bacteria 1820
354 Ga0075429_100005840 3300006880 Bacteria 10619
355 Ga0068865_100023025 3300006881 Bacteria 4073
356 Ga0068865_100157160 3300006881 Bacteria 1731
357 Ga0068865_100275782 3300006881 Bacteria 1337
358 Ga0068865_100331513 3300006881 Bacteria 1227
359 Ga0068865_100598388 3300006881 Bacteria 932
360 Ga0068865_100767296 3300006881 Bacteria 829
361 Ga0097620_100000023 3300006931 Bacteria 221914
362 Ga0097620_100008109 3300006931 Bacteria 10653
363 Ga0097620_100033356 3300006931 Bacteria 5169
364 Ga0097620_100054730 3300006931 Bacteria 4014
365 Ga0097620_100069445 3300006931 Bacteria 3558
366 Ga0097620_100085355 3300006931 Bacteria 3202
367 Ga0097620_100135820 3300006931 Unclassified 2532
368 Ga0097620_100805394 3300006931 Bacteria 1027
369 Ga0097620_100986659 3300006931 Bacteria 925
370 Ga0097620_101001928 3300006931 Bacteria 917
371 Ga0097620_101134445 3300006931 Bacteria 860
372 Ga0105240_10000074 3300009093 Bacteria 199611
373 Ga0105240_10000598 3300009093 Bacteria 67006
374 Ga0105240_10000626 3300009093 Bacteria 65179
375 Ga0105240_10001595 3300009093 Bacteria 38516
376 Ga0105240_10002663 3300009093 Bacteria 28411
377 Ga0105240_10007062 3300009093 Bacteria 16373
378 Ga0105240_10095833 3300009093 Bacteria 3617
379 Ga0105240_10157044 3300009093 Bacteria 2704
380 Ga0105240_10192995 3300009093 Bacteria 2393
381 Ga0105240_10233775 3300009093 Bacteria 2134
382 Ga0105240_10346161 3300009093 Bacteria 1687
383 Ga0105240_10394988 3300009093 Bacteria 1559
384 Ga0105240_10469687 3300009093 Bacteria 1404
385 Ga0105240_10504726 3300009093 Bacteria 1344
386 Ga0105240_10604497 3300009093 Bacteria 1207
387 Ga0111539_10015483 3300009094 Bacteria 9481
388 Ga0111539_10072693 3300009094 Bacteria 4055
389 Ga0111539_10150833 3300009094 Bacteria 2721
390 Ga0111539_10203554 3300009094 Bacteria 2308
391 Ga0111539_10248996 3300009094 Bacteria 2069
392 Ga0111539_10519594 3300009094 Unclassified 1387
393 Ga0111539_10638165 3300009094 Bacteria 1240
394 Ga0111539_11318769 3300009094 Bacteria 838
395 Ga0105245_10092150 3300009098 Bacteria 2790
396 Ga0105245_10136710 3300009098 Bacteria 2304
397 Ga0105245_10211933 3300009098 Bacteria 1865
398 Ga0105247_10003751 3300009101 Bacteria 9849
399 Ga0105247_10055552 3300009101 Bacteria 2443
400 Ga0105247_10200350 3300009101 Unclassified 1341
401 Ga0114129_10170363 3300009147 Bacteria 2969
402 Ga0114129_11213107 3300009147 Bacteria 939
403 Ga0105243_11028531 3300009148 Bacteria 828
404 Ga0105241_10000659 3300009174 Bacteria 25872
405 Ga0105241_10000881 3300009174 Bacteria 22671
406 Ga0105241_10007681 3300009174 Bacteria 7928
407 Ga0105241_10034893 3300009174 Bacteria 3782
408 Ga0105241_10105623 3300009174 Bacteria 2246
409 Ga0105241_10281965 3300009174 Bacteria 1419
410 Ga0105241_10720042 3300009174 Bacteria 912
411 Ga0105242_10012454 3300009176 Bacteria 6549
412 Ga0105242_10029532 3300009176 Bacteria 4374
413 Ga0105242_10046336 3300009176 Bacteria 3527
414 Ga0105242_10047921 3300009176 Bacteria 3471
415 Ga0105242_10057412 3300009176 Unclassified 3188
416 Ga0105242_10066820 3300009176 Bacteria 2971
417 Ga0105242_10245338 3300009176 Bacteria 1612
418 Ga0105242_10262710 3300009176 Bacteria 1560
419 Ga0105242_10907120 3300009176 Bacteria 882
420 Ga0105242_10974798 3300009176 Bacteria 854
421 Ga0105242_11121783 3300009176 Viruses 802
422 Ga0105248_10129741 3300009177 Bacteria 2844
423 Ga0105248_10148472 3300009177 Bacteria 2645
424 Ga0105248_10801695 3300009177 Bacteria 1063
425 Ga0105237_10000755 3300009545 Bacteria 44312
426 Ga0105237_10004143 3300009545 Bacteria 16893
427 Ga0105237_10007407 3300009545 Bacteria 12017
428 Ga0105237_10020135 3300009545 Bacteria 6886
429 Ga0105237_10042602 3300009545 Bacteria 4577
430 Ga0105237_10100523 3300009545 Bacteria 2883
431 Ga0105237_10111377 3300009545 Bacteria 2729
432 Ga0105237_10213092 3300009545 Bacteria 1931
433 Ga0105237_10231380 3300009545 Bacteria 1849
434 Ga0105237_10349941 3300009545 Bacteria 1482
435 Ga0105238_10001132 3300009551 Bacteria 26885
436 Ga0105238_10035958 3300009551 Bacteria 5035
437 Ga0105238_10104359 3300009551 Bacteria 2815
438 Ga0105238_10208463 3300009551 Bacteria 1930
439 Ga0105238_10995831 3300009551 Bacteria 859
440 Ga0105249_10005641 3300009553 Bacteria 10830
441 Ga0105249_10008464 3300009553 Bacteria 8963
442 Ga0105249_10009356 3300009553 Bacteria 8571
443 Ga0105249_10012834 3300009553 Bacteria 7392
444 Ga0105249_10056487 3300009553 Bacteria 3594
445 Ga0105249_10088386 3300009553 Bacteria 2894
446 Ga0105249_10133429 3300009553 Bacteria 2373
447 Ga0105249_10209741 3300009553 Bacteria 1911
448 Ga0105249_10322304 3300009553 Bacteria 1557
449 Ga0105249_10435755 3300009553 Bacteria 1347
450 Ga0105249_10524346 3300009553 Bacteria 1232
451 Ga0105239_10000048 3300010375 Bacteria 177855
452 Ga0105239_10000785 3300010375 Bacteria 45044
453 Ga0105239_10090248 3300010375 Bacteria 3381
454 Ga0105239_10192023 3300010375 Bacteria 2286
455 Ga0105239_10206574 3300010375 Bacteria 2201
456 Ga0105239_10236788 3300010375 Bacteria 2049
457 Ga0105239_10240773 3300010375 Bacteria 2030
458 Ga0105239_10335860 3300010375 Bacteria 1705
459 Ga0105239_10376028 3300010375 Bacteria 1606
460 Ga0105239_10410117 3300010375 Bacteria 1534
461 Ga0105239_10485819 3300010375 Bacteria 1403
462 Ga0105246_10017603 3300011119 Bacteria 4545
463 Ga0105246_10098219 3300011119 Bacteria 2127
464 Ga0105246_10315264 3300011119 Bacteria 1268
465 Ga0105246_10324771 3300011119 Bacteria 1252
466 Ga0157373_10016186 3300013100 Bacteria 5442
467 Ga0157373_10092062 3300013100 Bacteria 2135
468 Ga0157373_10132512 3300013100 Bacteria 1753
469 Ga0157371_10048769 3300013102 Bacteria 3010
470 Ga0157371_10144490 3300013102 Bacteria 1695
471 Ga0157371_10356050 3300013102 Bacteria 1066
472 Ga0157370_10000839 3300013104 Bacteria 39014
473 Ga0157370_10006823 3300013104 Bacteria 12514
474 Ga0157370_10121472 3300013104 Bacteria 2439
475 Ga0157370_10450449 3300013104 Bacteria 1183
476 Ga0157370_10680122 3300013104 Bacteria 940
477 Ga0157369_10039285 3300013105 Bacteria 5172
478 Ga0157369_10053379 3300013105 Bacteria 4370
479 Ga0157369_10083054 3300013105 Bacteria 3427
480 Ga0157369_10100053 3300013105 Bacteria 3090
481 Ga0157369_10104624 3300013105 Bacteria 3014
482 Ga0157369_10192363 3300013105 Bacteria 2143
483 Ga0157369_10301339 3300013105 Bacteria 1667
484 Ga0157369_10343029 3300013105 Bacteria 1552
485 Ga0157374_10000001 3300013296 Bacteria 1077351
486 Ga0157374_10004285 3300013296 Bacteria 11997
487 Ga0157374_10008464 3300013296 Bacteria 8797
488 Ga0157374_10025420 3300013296 Bacteria 5318
489 Ga0157374_10097036 3300013296 Bacteria 2820
490 Ga0157374_10101752 3300013296 Bacteria 2755
491 Ga0157374_10152435 3300013296 Bacteria 2248
492 Ga0157374_10189753 3300013296 Bacteria 2010
493 Ga0157374_10391189 3300013296 Bacteria 1386
494 Ga0157374_10516632 3300013296 Bacteria 1200
495 Ga0157374_10519786 3300013296 Bacteria 1196
496 Ga0157374_10535483 3300013296 Bacteria 1178
497 Ga0157374_10854522 3300013296 Bacteria 927
498 Ga0157374_11249023 3300013296 Bacteria 764
499 Ga0157378_10011078 3300013297 Bacteria 7892
500 Ga0157378_10011450 3300013297 Bacteria 7762
501 Ga0157378_10017714 3300013297 Bacteria 6253
502 Ga0157378_10021827 3300013297 Bacteria 5630
503 Ga0157378_10048565 3300013297 Bacteria 3774
504 Ga0157378_10118435 3300013297 Unclassified 2438
505 Ga0157378_10322662 3300013297 Bacteria 1501
506 Ga0157378_10512683 3300013297 Unclassified 1200
507 Ga0157378_10534989 3300013297 Bacteria 1175
508 Ga0157378_10965802 3300013297 Bacteria 885
509 Ga0157378_11019935 3300013297 Bacteria 862
510 Ga0157378_11023952 3300013297 Bacteria 861
511 Ga0163162_10000331 3300013306 Bacteria 43319
512 Ga0163162_10000967 3300013306 Bacteria 26666
513 Ga0163162_10005326 3300013306 Bacteria 12412
514 Ga0163162_10005839 3300013306 Bacteria 11903
515 Ga0163162_10014930 3300013306 Bacteria 7585
516 Ga0163162_10023196 3300013306 Bacteria 6122
517 Ga0163162_10044468 3300013306 Bacteria 4448
518 Ga0163162_10081120 3300013306 Bacteria 3314
519 Ga0163162_10086357 3300013306 Bacteria 3215
520 Ga0163162_10104877 3300013306 Bacteria 2921
521 Ga0163162_10126784 3300013306 Bacteria 2659
522 Ga0163162_10176964 3300013306 Bacteria 2259
523 Ga0163162_10195439 3300013306 Bacteria 2151
524 Ga0163162_10256648 3300013306 Unclassified 1880
525 Ga0163162_10339926 3300013306 Bacteria 1633
526 Ga0163162_11252393 3300013306 Unclassified 842
527 Ga0157372_10000921 3300013307 Bacteria 32008
528 Ga0157372_10002207 3300013307 Bacteria 21135
529 Ga0157372_10015967 3300013307 Bacteria 8054
530 Ga0157372_10125895 3300013307 Bacteria 2946
531 Ga0157372_10229607 3300013307 Bacteria 2151
532 Ga0157372_10480557 3300013307 Bacteria 1448
533 Ga0157372_10834613 3300013307 Unclassified 1070
534 Ga0157372_11452223 3300013307 Unclassified 790
535 Ga0157375_10000229 3300013308 Bacteria 52257
536 Ga0157375_10003117 3300013308 Bacteria 14392
537 Ga0157375_10043753 3300013308 Bacteria 4345
538 Ga0157375_10049275 3300013308 Bacteria 4126
539 Ga0157375_10082027 3300013308 Bacteria 3266
540 Ga0157375_10115476 3300013308 Bacteria 2787
541 Ga0157375_10117019 3300013308 Bacteria 2770
542 Ga0157375_10198617 3300013308 Bacteria 2161
543 Ga0157375_10219068 3300013308 Bacteria 2061
544 Ga0157375_10227378 3300013308 Bacteria 2024
545 Ga0157375_10322576 3300013308 Bacteria 1709
546 Ga0157375_10585055 3300013308 Bacteria 1276
547 Ga0157375_10798047 3300013308 Bacteria 1093
548 Ga0157375_10936927 3300013308 Bacteria 1008
549 Ga0157375_10984019 3300013308 Bacteria 984
550 Ga0157375_11096202 3300013308 Bacteria 932
551 Ga0163163_10000538 3300014325 Bacteria 33542
552 Ga0163163_10000653 3300014325 Bacteria 29691
553 Ga0163163_10039883 3300014325 Bacteria 4584
554 Ga0163163_10236928 3300014325 Bacteria 1874
555 Ga0163163_10247142 3300014325 Bacteria 1834
556 Ga0163163_10353157 3300014325 Bacteria 1526
557 Ga0163163_11020906 3300014325 Unclassified 890
558 Ga0163163_11687486 3300014325 Unclassified 694
559 Ga0157380_10009363 3300014326 Bacteria 7015
560 Ga0157380_10046212 3300014326 Bacteria 3418
561 Ga0157380_10151308 3300014326 Bacteria 2006
562 Ga0157380_10430802 3300014326 Unclassified 1261
563 Ga0157380_10512078 3300014326 Bacteria 1168
564 Ga0157380_10613153 3300014326 Bacteria 1079
565 Ga0157380_10757211 3300014326 Bacteria 983
566 Ga0157380_11067610 3300014326 Bacteria 845
567 Ga0157377_10000932 3300014745 Bacteria 12243
568 Ga0157377_10011561 3300014745 Bacteria 4412
569 Ga0157377_10052986 3300014745 Bacteria 2292
570 Ga0157377_10191453 3300014745 Unclassified 1293
571 Ga0157377_10289435 3300014745 Bacteria 1077
572 Ga0157379_10001640 3300014968 Bacteria 18479
573 Ga0157379_10002723 3300014968 Bacteria 14918
574 Ga0157379_10025305 3300014968 Bacteria 5273
575 Ga0157379_10039098 3300014968 Bacteria 4233
576 Ga0157379_10053136 3300014968 Bacteria 3619
577 Ga0157379_10063814 3300014968 Bacteria 3292
578 Ga0157379_10153679 3300014968 Bacteria 2076
579 Ga0157379_10160896 3300014968 Bacteria 2026
580 Ga0157379_10268112 3300014968 Unclassified 1552
581 Ga0157379_10331601 3300014968 Bacteria 1390
582 Ga0157376_10002682 3300014969 Bacteria 12095
583 Ga0157376_10004414 3300014969 Bacteria 9794
584 Ga0157376_10005888 3300014969 Bacteria 8604
585 Ga0157376_10017174 3300014969 Bacteria 5512
586 Ga0157376_10037066 3300014969 Bacteria 3954
587 Ga0157376_10054689 3300014969 Bacteria 3329
588 Ga0157376_10055401 3300014969 Bacteria 3308
589 Ga0157376_10089452 3300014969 Bacteria 2662
590 Ga0157376_10133715 3300014969 Bacteria 2217
591 Ga0157376_10201804 3300014969 Viruses 1830
592 Ga0157376_10369875 3300014969 Unclassified 1377
593 Ga0163161_10023525 3300017792 Bacteria 4347
594 Ga0163161_10027192 3300017792 Bacteria 4057
595 Ga0163161_10041919 3300017792 Bacteria 3290
596 Ga0163161_10129167 3300017792 Bacteria 1905
597 Ga0163161_10210271 3300017792 Bacteria 1503
598 Ga0163161_10244272 3300017792 Bacteria 1397
599 Ga0213876_10022962 3300021384 Bacteria 3295
600 Ga0209258_100151 3300025242 Bacteria 160444
601 Ga0209646_1000002 3300025246 Bacteria 1425781
602 Ga0209646_1000823 3300025246 Bacteria 10466
603 Ga0209026_1000434 3300025250 Bacteria 34861
604 Ga0209148_1000154 3300025254 Bacteria 145214
605 Ga0209758_1037890 3300025297 Unclassified 1857
606 Ga0207426_1000030 3300025302 Bacteria 461478
607 Ga0207426_1000497 3300025302 Bacteria 58506
608 Ga0207697_10093949 3300025315 Bacteria 1273
609 Ga0207656_10004204 3300025321 Bacteria 5010
610 Ga0207710_10003162 3300025900 Bacteria 7372
611 Ga0207710_10030055 3300025900 Bacteria 2368
612 Ga0207688_10039173 3300025901 Bacteria 2633
613 Ga0207688_10102142 3300025901 Bacteria 1657
614 Ga0207680_10000162 3300025903 Bacteria 32782
615 Ga0207680_10011575 3300025903 Bacteria 4461
616 Ga0207647_10018104 3300025904 Bacteria 4774
617 Ga0207647_10112441 3300025904 Bacteria 1609
618 Ga0207647_10157173 3300025904 Bacteria 1327
619 Ga0207685_10245320 3300025905 Bacteria 864
620 Ga0207645_10000782 3300025907 Bacteria 26555
621 Ga0207645_10009564 3300025907 Bacteria 6697
622 Ga0207645_10032778 3300025907 Bacteria 3340
623 Ga0207645_10082780 3300025907 Unclassified 2057
624 Ga0207645_10299253 3300025907 Bacteria 1071
625 Ga0207643_10003598 3300025908 Bacteria 8348
626 Ga0207643_10024156 3300025908 Unclassified 3354
627 Ga0207643_10156236 3300025908 Bacteria 1370
628 Ga0207705_10140693 3300025909 Unclassified 1802
629 Ga0207705_10147114 3300025909 Bacteria 1763
630 Ga0207654_10003155 3300025911 Bacteria 8333
631 Ga0207654_10003491 3300025911 Bacteria 7952
632 Ga0207654_10210525 3300025911 Bacteria 1285
633 Ga0207654_10270390 3300025911 Unclassified 1146
634 Ga0207654_10317871 3300025911 Bacteria 1063
635 Ga0207707_10000051 3300025912 Bacteria 117204
636 Ga0207707_10028865 3300025912 Bacteria 4848
637 Ga0207707_10121080 3300025912 Bacteria 2288
638 Ga0207707_10160562 3300025912 Bacteria 1965
639 Ga0207707_10220480 3300025912 Bacteria 1651
640 Ga0207695_10000071 3300025913 Bacteria 315568
641 Ga0207695_10000084 3300025913 Bacteria 282392
642 Ga0207695_10000323 3300025913 Bacteria 114265
643 Ga0207695_10004602 3300025913 Bacteria 18731
644 Ga0207695_10020015 3300025913 Bacteria 7681
645 Ga0207695_10094718 3300025913 Bacteria 2992
646 Ga0207695_10111165 3300025913 Bacteria 2719
647 Ga0207695_10141759 3300025913 Bacteria 2351
648 Ga0207695_10175536 3300025913 Bacteria 2065
649 Ga0207695_10206800 3300025913 Bacteria 1875
650 Ga0207695_10261200 3300025913 Bacteria 1629
651 Ga0207695_10446920 3300025913 Bacteria 1176
652 Ga0207695_10452825 3300025913 Bacteria 1166
653 Ga0207695_10514728 3300025913 Bacteria 1078
654 Ga0207671_10001044 3300025914 Bacteria 33679
655 Ga0207671_10002907 3300025914 Bacteria 17690
656 Ga0207671_10003799 3300025914 Bacteria 14813
657 Ga0207671_10003904 3300025914 Bacteria 14529
658 Ga0207671_10024892 3300025914 Bacteria 4497
659 Ga0207671_10047813 3300025914 Bacteria 3166
660 Ga0207660_10005186 3300025917 Bacteria 8471
661 Ga0207660_10013385 3300025917 Bacteria 5377
662 Ga0207660_10099182 3300025917 Bacteria 2173
663 Ga0207660_10108430 3300025917 Bacteria 2085
664 Ga0207660_10201863 3300025917 Bacteria 1553
665 Ga0207660_10445736 3300025917 Unclassified 1046
666 Ga0207662_10012024 3300025918 Bacteria 4813
667 Ga0207662_10239060 3300025918 Unclassified 1188
668 Ga0207657_10010433 3300025919 Bacteria 9272
669 Ga0207657_10042823 3300025919 Bacteria 3991
670 Ga0207657_10270275 3300025919 Unclassified 1351
671 Ga0207649_10009815 3300025920 Bacteria 5245
672 Ga0207649_10255441 3300025920 Bacteria 1264
673 Ga0207649_10668233 3300025920 Unclassified 804
674 Ga0207652_10000384 3300025921 Bacteria 46082
675 Ga0207652_10020709 3300025921 Bacteria 5421
676 Ga0207652_10106805 3300025921 Bacteria 2478
677 Ga0207652_10159287 3300025921 Bacteria 2023
678 Ga0207652_10179079 3300025921 Bacteria 1904
679 Ga0207652_10180240 3300025921 Bacteria 1898
680 Ga0207681_10330130 3300025923 Unclassified 1215
681 Ga0207681_10398400 3300025923 Bacteria 1111
682 Ga0207681_10438157 3300025923 Bacteria 1061
683 Ga0207681_10727514 3300025923 Bacteria 826
684 Ga0207694_10007231 3300025924 Bacteria 8426
685 Ga0207694_10024476 3300025924 Bacteria 4586
686 Ga0207694_10189791 3300025924 Bacteria 1669
687 Ga0207650_10029550 3300025925 Bacteria 3941
688 Ga0207650_10069495 3300025925 Unclassified 2646
689 Ga0207650_10084153 3300025925 Unclassified 2418
690 Ga0207650_10086979 3300025925 Bacteria 2380
691 Ga0207650_10112906 3300025925 Unclassified 2106
692 Ga0207650_10143351 3300025925 Unclassified 1880
693 Ga0207650_10227135 3300025925 Bacteria 1504
694 Ga0207650_10350160 3300025925 Bacteria 1215
695 Ga0207650_10612459 3300025925 Bacteria 916
696 Ga0207650_10806457 3300025925 Unclassified 796
697 Ga0207659_10094854 3300025926 Bacteria 2236
698 Ga0207659_10428587 3300025926 Bacteria 1110
699 Ga0207687_10086348 3300025927 Bacteria 2278
700 Ga0207687_10561668 3300025927 Bacteria 958
701 Ga0207644_10002938 3300025931 Bacteria 10975
702 Ga0207644_10085126 3300025931 Bacteria 2345
703 Ga0207644_10107695 3300025931 Bacteria 2103
704 Ga0207644_10118442 3300025931 Bacteria 2012
705 Ga0207644_10501524 3300025931 Bacteria 1001
706 Ga0207690_10017654 3300025932 Bacteria 4363
707 Ga0207706_10006768 3300025933 Bacteria 10596
708 Ga0207706_10022065 3300025933 Bacteria 5714
709 Ga0207706_10036407 3300025933 Bacteria 4371
710 Ga0207706_10060668 3300025933 Bacteria 3331
711 Ga0207706_10113169 3300025933 Bacteria 2387
712 Ga0207706_10198002 3300025933 Bacteria 1762
713 Ga0207686_10003538 3300025934 Bacteria 8377
714 Ga0207686_10025792 3300025934 Bacteria 3424
715 Ga0207686_10031401 3300025934 Bacteria 3153
716 Ga0207686_10040558 3300025934 Bacteria 2831
717 Ga0207686_10951096 3300025934 Unclassified 695
718 Ga0207670_10013524 3300025936 Bacteria 4817
719 Ga0207670_10455138 3300025936 Bacteria 1032
720 Ga0207670_10718211 3300025936 Bacteria 828
721 Ga0207669_10089885 3300025937 Bacteria 1995
722 Ga0207704_10051601 3300025938 Bacteria 2488
723 Ga0207704_10054704 3300025938 Bacteria 2435
724 Ga0207704_10169619 3300025938 Bacteria 1563
725 Ga0207704_10246745 3300025938 Unclassified 1338
726 Ga0207704_10723475 3300025938 Bacteria 826
727 Ga0207691_10006538 3300025940 Bacteria 11250
728 Ga0207691_10011421 3300025940 Bacteria 8521
729 Ga0207691_10066380 3300025940 Bacteria 3264
730 Ga0207691_10075281 3300025940 Bacteria 3044
731 Ga0207691_10129415 3300025940 Bacteria 2231
732 Ga0207691_10302352 3300025940 Bacteria 1374
733 Ga0207711_10097280 3300025941 Bacteria 2599
734 Ga0207689_10001006 3300025942 Bacteria 27060
735 Ga0207689_10004039 3300025942 Bacteria 13333
736 Ga0207689_10011687 3300025942 Bacteria 7524
737 Ga0207689_10015929 3300025942 Bacteria 6365
738 Ga0207689_10036692 3300025942 Bacteria 4069
739 Ga0207689_10050801 3300025942 Bacteria 3417
740 Ga0207689_10051842 3300025942 Bacteria 3382
741 Ga0207689_10138954 3300025942 Bacteria 2001
742 Ga0207689_10231980 3300025942 Bacteria 1525
743 Ga0207689_10371134 3300025942 Bacteria 1191
744 Ga0207689_10651659 3300025942 Bacteria 887
745 Ga0207689_10659378 3300025942 Bacteria 882
746 Ga0207661_10006472 3300025944 Bacteria 8280
747 Ga0207661_10006982 3300025944 Bacteria 8009
748 Ga0207661_10009253 3300025944 Bacteria 7058
749 Ga0207661_10076460 3300025944 Bacteria 2750
750 Ga0207661_10310305 3300025944 Bacteria 1416
751 Ga0207661_11061858 3300025944 Unclassified 746
752 Ga0207679_10003010 3300025945 Bacteria 10450
753 Ga0207679_10086960 3300025945 Unclassified 2405
754 Ga0207679_10148809 3300025945 Bacteria 1903
755 Ga0207679_10193919 3300025945 Bacteria 1691
756 Ga0207679_10214210 3300025945 Bacteria 1617
757 Ga0207679_10485240 3300025945 Bacteria 1101
758 Ga0207667_10000177 3300025949 Bacteria 92852
759 Ga0207667_10015290 3300025949 Bacteria 8725
760 Ga0207667_10021496 3300025949 Bacteria 7148
761 Ga0207667_10027988 3300025949 Bacteria 6126
762 Ga0207667_10044124 3300025949 Bacteria 4727
763 Ga0207667_10061072 3300025949 Bacteria 3944
764 Ga0207667_10100565 3300025949 Bacteria 2982
765 Ga0207667_10571436 3300025949 Bacteria 1142
766 Ga0207651_10001099 3300025960 Bacteria 12009
767 Ga0207651_10165244 3300025960 Bacteria 1739
768 Ga0207651_10213080 3300025960 Unclassified 1556
769 Ga0207651_10277221 3300025960 Bacteria 1384
770 Ga0207651_10298807 3300025960 Bacteria 1338
771 Ga0207651_10469620 3300025960 Bacteria 1082
772 Ga0207651_10609985 3300025960 Unclassified 955
773 Ga0207651_10848885 3300025960 Bacteria 811
774 Ga0207712_10009497 3300025961 Bacteria 6153
775 Ga0207712_10011985 3300025961 Bacteria 5532
776 Ga0207712_10052658 3300025961 Bacteria 2852
777 Ga0207712_10082148 3300025961 Bacteria 2348
778 Ga0207712_10140469 3300025961 Unclassified 1853
779 Ga0207712_10203460 3300025961 Bacteria 1571
780 Ga0207712_10209950 3300025961 Unclassified 1550
781 Ga0207712_10255179 3300025961 Bacteria 1419
782 Ga0207668_10000843 3300025972 Bacteria 18537
783 Ga0207668_10270488 3300025972 Unclassified 1389
784 Ga0207668_10299956 3300025972 Bacteria 1326
785 Ga0207640_10012737 3300025981 Bacteria 4799
786 Ga0207640_10147321 3300025981 Bacteria 1724
787 Ga0207640_10189077 3300025981 Bacteria 1550
788 Ga0207640_10287420 3300025981 Bacteria 1295
789 Ga0207640_10308625 3300025981 Bacteria 1255
790 Ga0207640_10328689 3300025981 Bacteria 1220
791 Ga0207640_10363026 3300025981 Bacteria 1168
792 Ga0207658_10061094 3300025986 Bacteria 2814
793 Ga0207658_10062871 3300025986 Bacteria 2780
794 Ga0207658_10201871 3300025986 Bacteria 1660
795 Ga0207658_10280211 3300025986 Bacteria 1429
796 Ga0207677_10008700 3300026023 Bacteria 5684
797 Ga0207677_10019809 3300026023 Bacteria 4072
798 Ga0207677_10023899 3300026023 Bacteria 3785
799 Ga0207677_10903456 3300026023 Bacteria 796
800 Ga0207677_11044310 3300026023 Bacteria 743
801 Ga0207703_10005016 3300026035 Bacteria 10732
802 Ga0207703_10050477 3300026035 Bacteria 3367
803 Ga0207703_10354175 3300026035 Bacteria 1352
804 Ga0207703_10400092 3300026035 Bacteria 1274
805 Ga0207639_10003645 3300026041 Bacteria 10352
806 Ga0207639_10045139 3300026041 Bacteria 3318
807 Ga0207639_10048724 3300026041 Bacteria 3208
808 Ga0207639_10132582 3300026041 Bacteria 2065
809 Ga0207639_10177426 3300026041 Bacteria 1809
810 Ga0207639_10191922 3300026041 Bacteria 1745
811 Ga0207639_10224058 3300026041 Bacteria 1626
812 Ga0207639_10239208 3300026041 Bacteria 1577
813 Ga0207639_10249979 3300026041 Bacteria 1546
814 Ga0207639_10361966 3300026041 Bacteria 1298
815 Ga0207639_10858552 3300026041 Bacteria 847
816 Ga0207678_10036360 3300026067 Bacteria 4287
817 Ga0207678_10824553 3300026067 Bacteria 819
818 Ga0207678_10824573 3300026067 Bacteria 819
819 Ga0207708_10033757 3300026075 Bacteria 3890
820 Ga0207708_10236353 3300026075 Bacteria 1468
821 Ga0207708_10260555 3300026075 Bacteria 1400
822 Ga0207702_10079557 3300026078 Bacteria 2841
823 Ga0207702_10193997 3300026078 Bacteria 1879
824 Ga0207702_10500460 3300026078 Bacteria 1185
825 Ga0207702_10531882 3300026078 Bacteria 1148
826 Ga0207641_10000226 3300026088 Bacteria 72539
827 Ga0207641_10001217 3300026088 Bacteria 25759
828 Ga0207641_10004894 3300026088 Bacteria 11515
829 Ga0207641_10064994 3300026088 Bacteria 3120
830 Ga0207641_10089306 3300026088 Bacteria 2693
831 Ga0207641_10091888 3300026088 Bacteria 2657
832 Ga0207641_10272700 3300026088 Bacteria 1588
833 Ga0207641_10365843 3300026088 Bacteria 1378
834 Ga0207648_10002745 3300026089 Bacteria 18711
835 Ga0207648_10003442 3300026089 Bacteria 16603
836 Ga0207648_10012585 3300026089 Bacteria 7917
837 Ga0207648_10075871 3300026089 Bacteria 2930
838 Ga0207648_10075913 3300026089 Bacteria 2929
839 Ga0207648_10078660 3300026089 Bacteria 2877
840 Ga0207648_10082137 3300026089 Unclassified 2810
841 Ga0207648_10495006 3300026089 Bacteria 1118
842 Ga0207676_10009153 3300026095 Bacteria 7052
843 Ga0207676_10009837 3300026095 Bacteria 6802
844 Ga0207676_10022211 3300026095 Bacteria 4665
845 Ga0207676_10034551 3300026095 Bacteria 3829
846 Ga0207676_10130570 3300026095 Bacteria 2135
847 Ga0207676_10133209 3300026095 Bacteria 2116
848 Ga0207676_10208370 3300026095 Bacteria 1732
849 Ga0207676_10304526 3300026095 Bacteria 1456
850 Ga0207676_10600121 3300026095 Unclassified 1057
851 Ga0207676_10804568 3300026095 Bacteria 917
852 Ga0207674_10000672 3300026116 Bacteria 44419
853 Ga0207674_10009363 3300026116 Bacteria 11203
854 Ga0207674_10013131 3300026116 Bacteria 9219
855 Ga0207674_10078260 3300026116 Bacteria 3312
856 Ga0207674_10102221 3300026116 Bacteria 2846
857 Ga0207674_10119089 3300026116 Bacteria 2609
858 Ga0207674_10191290 3300026116 Bacteria 1996
859 Ga0207674_10367721 3300026116 Unclassified 1390
860 Ga0207674_10743548 3300026116 Bacteria 947
861 Ga0207674_11257823 3300026116 Bacteria 710
862 Ga0207675_100000124 3300026118 Bacteria 63805
863 Ga0207675_100042058 3300026118 Bacteria 4265
864 Ga0207675_100066501 3300026118 Bacteria 3369
865 Ga0207675_100123061 3300026118 Bacteria 2456
866 Ga0207675_100132394 3300026118 Unclassified 2364
867 Ga0207675_100215203 3300026118 Bacteria 1850
868 Ga0207675_100337963 3300026118 Bacteria 1474
869 Ga0207675_100407759 3300026118 Bacteria 1340
870 Ga0207683_10010911 3300026121 Bacteria 7748
871 Ga0207683_10015180 3300026121 Bacteria 6554
872 Ga0207683_10069331 3300026121 Bacteria 3114
873 Ga0207683_10083694 3300026121 Unclassified 2835
874 Ga0207683_10267570 3300026121 Bacteria 1561
875 Ga0207683_10436473 3300026121 Bacteria 1207
876 Ga0207698_10001082 3300026142 Bacteria 15843
877 Ga0207698_10018942 3300026142 Bacteria 4701
878 Ga0207698_10055253 3300026142 Bacteria 3059
879 Ga0207698_10073671 3300026142 Bacteria 2720
880 Ga0207698_10117304 3300026142 Bacteria 2245
881 Ga0207698_10140320 3300026142 Bacteria 2081
882 Ga0207698_10366157 3300026142 Bacteria 1367
883 Ga0207698_10470277 3300026142 Bacteria 1217
884 Ga0207698_10587283 3300026142 Bacteria 1097
885 Ga0207698_10748676 3300026142 Unclassified 976
886 Ga0207428_10196734 3300027907 Bacteria 1518
887 Ga0268266_10000049 3300028379 Bacteria 307763
888 Ga0268266_10085877 3300028379 Bacteria 2750
889 Ga0268266_10416980 3300028379 Bacteria 1272
890 Ga0268265_10127934 3300028380 Bacteria 2106
891 Ga0268265_10211380 3300028380 Bacteria 1691
892 Ga0268265_10520123 3300028380 Bacteria 1125
893 Ga0268265_10551345 3300028380 Bacteria 1094
894 Ga0268264_10000041 3300028381 Bacteria 372501
895 Ga0268264_10003860 3300028381 Bacteria 12861
896 Ga0268264_10008457 3300028381 Bacteria 8559
897 Ga0268264_10015087 3300028381 Bacteria 6337
898 Ga0268264_10018061 3300028381 Bacteria 5768
899 Ga0268264_10066255 3300028381 Bacteria 3045
900 Ga0268264_10092890 3300028381 Bacteria 2605
901 Ga0268264_10354427 3300028381 Bacteria 1398
902 Ga0268264_10459618 3300028381 Bacteria 1235
903 Ga0268264_10472905 3300028381 Bacteria 1218
904 Ga0307517_10079111 3300028786 Bacteria 2833
905 Ga0307515_10000001 3300028794 Bacteria 4259510
906 Ga0307515_10009265 3300028794 Bacteria 19056
907 Ga0307515_10201918 3300028794 Unclassified 1861
908 Ga0307511_10000042 3300030521 Bacteria 102114
909 Ga0316177_1100501 3300030731 Unclassified 1381
910 Ga0265327_10000084 3300031251 Bacteria 204433
911 Ga0265327_10000395 3300031251 Bacteria 81944
912 Ga0265327_10011198 3300031251 Bacteria 6212
913 Ga0265327_10023168 3300031251 Bacteria 3685
914 Ga0265327_10168209 3300031251 Bacteria 1009
915 Ga0265316_10169767 3300031344 Bacteria 1628
916 Ga0307513_10151351 3300031456 Bacteria 2228
917 Ga0307513_10285094 3300031456 Bacteria 1427
918 Ga0307513_10625902 3300031456 Bacteria 784
919 Ga0307509_10139082 3300031507 Unclassified 2368
920 Ga0307509_10208553 3300031507 Bacteria 1782
921 Ga0307509_10234366 3300031507 Bacteria 1635
922 Ga0307509_10365330 3300031507 Bacteria 1161
923 Ga0307508_10002100 3300031616 Bacteria 21430
924 Ga0307516_10001558 3300031730 Bacteria 31533
925 Ga0307516_10214020 3300031730 Bacteria 1640
926 Ga0307414_10000003 3300032004 Bacteria 519751
927 Ga0307414_10019125 3300032004 Bacteria 4237
928 Ga0307507_10286948 3300033179 Bacteria 1023
929 Ga0307510_10000091 3300033180 Bacteria 68694
930 Ga0373934_0117388 3300035086 Unclassified 1082
931 Ga0373934_0232580 3300035086 Unclassified 761
932 Ga0373952_0023997 3300035092 Bacteria 1306
933 Ga0373953_0040200 3300035117 Bacteria 1857
934 Ga0373956_0164875 3300035119 Bacteria 1045
935 Ga0373943_0031071 3300035170 Bacteria 2532
936 Ga0373947_0082304 3300035725 Bacteria 1995
937 Ga0373937_0058916 3300036401 Bacteria 3528
938 Ga0373937_0277658 3300036401 Bacteria 1582
939 Ga0373937_0365304 3300036401 Unclassified 1368
940 Ga0373925_0098421 3300037068 Bacteria 2245
941 Ga0395900_0596943 3300037418 Bacteria 1045
942 Ga0395905_0317315 3300037471 Bacteria 1448
943 Ga0400483_053230 3300039062 Bacteria 33079
944 Ga0400489_34926 3300039093 Bacteria 1682
945 Ga0436365_0175741 3300039437 Bacteria 2955
946 Ga0436365_0203686 3300039437 Bacteria 3547
947 Ga0436365_0881017 3300039437 Bacteria 14010
948 Ga0436365_1079918 3300039437 Bacteria 37760
949 Ga0436365_1735638 3300039437 Bacteria 1330
950 Ga0436363_1382145 3300039450 Bacteria 1702
951 Ga0439436_0001603 3300041404 Bacteria 6586
952 Ga0439439_0014036 3300041406 Bacteria 1947
953 Ga0439439_0041709 3300041406 Bacteria 1191
954 Ga0451791_1161455 3300041451 Bacteria 1918
955 Ga0451841_0473234 3300041498 Bacteria 746
956 Ga0451849_1509768 3300041505 Bacteria 2016
957 Ga0451853_3111860 3300041512 Bacteria 1118
958 Ga0439442_014098 3300042002 Unclassified 1645
959 Ga0439452_061751 3300042010 Bacteria 838
960 Ga0439454_029769 3300042011 Unclassified 850
961 Ga0439457_000788 3300042014 Bacteria 9461
962 Ga0439457_010425 3300042014 Bacteria 2137
963 Ga0439462_0007494 3300042015 Bacteria 2733
964 Ga0450923_055175 3300042125 Bacteria 859
965 Ga0450898_024292 3300042134 Bacteria 1082
966 Ga0439434_0024981 3300042435 Unclassified 1803
967 Ga0439435_0075887 3300042436 Bacteria 1002
968 Ga0451577_0069645 3300042876 Bacteria 3137
969 Ga0466969_0000584 3300044656 Bacteria 19813
970 Ga0466972_0000002 3300044658 Bacteria 408005
971 Ga0466972_0000207 3300044658 Bacteria 42277
972 Ga0466972_0003815 3300044658 Bacteria 7496
973 Ga0466972_0137982 3300044658 Bacteria 1148
974 Ga0466965_0069128 3300044683 Bacteria 1774
975 Ga0466966_0000136 3300044684 Bacteria 47038
976 Ga0466961_0042386 3300044693 Bacteria 2917
977 Ga0466961_0212398 3300044693 Bacteria 1194
978 Ga0466964_0064167 3300044706 Bacteria 1536
979 Ga0466964_0198483 3300044706 Bacteria 962
980 Ga0453684_0182377 3300044712 Bacteria 2463
981 Ga0466971_0085557 3300044719 Bacteria 1441
982 Ga0466968_0024893 3300044735 Bacteria 2449
983 Ga0466968_0074220 3300044735 Bacteria 1485
984 Ga0466970_0032860 3300044765 Bacteria 2742
985 Ga0466970_0083703 3300044765 Bacteria 1726
986 Ga0466970_0183496 3300044765 Bacteria 1161
987 Ga0466957_0007040 3300044842 Bacteria 6358
988 Ga0466957_0014895 3300044842 Bacteria 4535
989 Ga0466959_0000002 3300045049 Bacteria 362671
990 Ga0466959_0004264 3300045049 Bacteria 9538
991 Ga0466958_0067052 3300045836 Bacteria 2192
992 Ga0495592_0092874 3300046454 Bacteria 2162
993 Ga0495638_0044437 3300046460 Bacteria 2798
994 Ga0495638_0133573 3300046460 Bacteria 1456
995 Ga0495651_0491722 3300046462 Unclassified 787
996 Ga0495651_0510201 3300046462 Bacteria 769
997 Ga0495650_0048290 3300046471 Bacteria 1775
998 Ga0495580_0014773 3300046472 Bacteria 5916
999 Ga0495594_0109128 3300046499 Bacteria 1560
1000 Ga0495606_0019321 3300046507 Bacteria 5075
1001 Ga0495608_0321123 3300046511 Bacteria 957
1002 Ga0495628_0034567 3300046516 Bacteria 4065
1003 Ga0495628_0285752 3300046516 Bacteria 1224
1004 Ga0495630_0012164 3300046517 Bacteria 6242
1005 Ga0495648_0014811 3300046524 Bacteria 5682
1006 Ga0495652_0080509 3300046529 Bacteria 2690
1007 Ga0495640_0090800 3300046533 Bacteria 2016
1008 Ga0495586_0254880 3300046535 Bacteria 1001
1009 Ga0495598_0076542 3300046537 Bacteria 1065
1010 Ga0495597_0142432 3300046542 Bacteria 988
1011 Ga0495645_0092555 3300046543 Bacteria 2159
1012 Ga0495645_0125671 3300046543 Bacteria 1802
1013 Ga0495633_0105857 3300046558 Bacteria 1305
1014 Ga0495668_0000751 3300046616 Bacteria 38311
1015 Ga0495611_0001116 3300046648 Bacteria 14130
1016 Ga0495611_0036215 3300046648 Bacteria 2189
1017 Ga0495611_0320702 3300046648 Bacteria 713
1018 Ga0495625_0040260 3300046660 Bacteria 3410
1019 Ga0495658_0229419 3300046683 Unclassified 1164
1020 Ga0495613_0185963 3300046689 Unclassified 1470
1021 Ga0495600_0264951 3300046809 Bacteria 1091
1022 Ga0495674_0210944 3300047319 Bacteria 1608
1023 Ga0495672_0025973 3300047320 Bacteria 3743
1024 Ga0495676_0070348 3300047321 Bacteria 2696
1025 Ga0495676_0145947 3300047321 Bacteria 1690
1026 Ga0495687_000001 3300047443 Bacteria 1215582
1027 Ga0495675_0166435 3300047444 Bacteria 1356
1028 Ga0495675_0240181 3300047444 Bacteria 1091
1029 Ga0495684_0050898 3300047471 Bacteria 3162
1030 Ga0495684_0436512 3300047471 Unclassified 913
1031 Ga0495686_0000004 3300047472 Bacteria 869019
1032 Ga0495686_0011430 3300047472 Bacteria 6255
1033 Ga0495686_0071848 3300047472 Bacteria 2129
1034 Ga0496104_0497143 3300048907 Unclassified 1131
1035 Ga0496104_0540596 3300048907 Bacteria 1076
1036 Ga0496105_0561363 3300048908 Bacteria 890
1037 Ga0496107_0583247 3300048910 Bacteria 827
1038 Ga0496108_0183554 3300048911 Bacteria 1812
1039 Ga0496108_0481496 3300048911 Bacteria 1084
1040 Ga0496108_0503107 3300048911 Unclassified 1058
1041 Ga0496109_0245679 3300048912 Unclassified 1685
1042 Ga0496109_0252417 3300048912 Bacteria 1661
1043 Ga0496110_0267538 3300048913 Bacteria 1556
1044 Ga0496110_0939890 3300048913 Bacteria 771
1045 Ga0496115_0089648 3300048918 Bacteria 2512
1046 Ga0496124_0066454 3300048927 Bacteria 3003
1047 Ga0496126_0567079 3300048929 Bacteria 899
1048 Ga0501031_0010841 3300049568 Bacteria 5935
1049 Ga0501031_0485868 3300049568 Unclassified 797
1050 Ga0501032_0154715 3300049569 Bacteria 1507
1051 Ga0501032_0381305 3300049569 Bacteria 907
1052 Ga0501033_0066471 3300049570 Bacteria 2651
1053 Ga0501033_0230965 3300049570 Bacteria 1314
1054 Ga0501034_0004012 3300049571 Bacteria 16517
1055 Ga0501034_0053271 3300049571 Bacteria 4075
1056 Ga0501034_0064319 3300049571 Bacteria 3682
1057 Ga0501034_0112712 3300049571 Bacteria 2709
1058 Ga0501034_0240918 3300049571 Bacteria 1755
1059 Ga0501034_1151286 3300049571 Unclassified 655
1060 Ga0501036_0306700 3300049572 Bacteria 1327
1061 Ga0501037_0007826 3300049573 Bacteria 7827
1062 Ga0501037_0037709 3300049573 Bacteria 3563
1063 Ga0501038_0007220 3300049574 Bacteria 10263
1064 Ga0501038_0033809 3300049574 Bacteria 4500
1065 Ga0501039_0385750 3300049575 Bacteria 1100
1066 Ga0501040_0024888 3300049576 Unclassified 4022
1067 Ga0501043_0008215 3300049579 Bacteria 8223
1068 Ga0501043_0015257 3300049579 Bacteria 6018
1069 Ga0501043_0029351 3300049579 Bacteria 4320
1070 Ga0501047_0009183 3300049581 Bacteria 9336
1071 Ga0501047_0119920 3300049581 Bacteria 2513
1072 Ga0501047_0128329 3300049581 Bacteria 2416
1073 Ga0501048_0165851 3300049582 Bacteria 1564
1074 Ga0501068_0026838 3300049584 Bacteria 3397
1075 Ga0501069_0007664 3300049585 Bacteria 5663
1076 Ga0501071_0062985 3300049587 Bacteria 2688
1077 Ga0501073_0018001 3300049589 Bacteria 5108
1078 Ga0501227_002942 3300049665 Bacteria 3723
1079 Ga0501257_046339 3300049686 Bacteria 1077
1080 Ga0501219_000230 3300049703 Bacteria 10699
1081 Ga0501225_0001846 3300049705 Bacteria 6642
1082 Ga0501079_0058140 3300049741 Bacteria 2984
1083 Ga0501080_0140200 3300049742 Bacteria 2236
1084 Ga0501083_0060149 3300049744 Bacteria 2538
1085 Ga0501035_0031410 3300049822 Bacteria 4837
1086 Ga0501035_0043415 3300049822 Bacteria 4052
1087 Ga0501035_0210219 3300049822 Bacteria 1665
1088 Ga0501044_0016307 3300049823 Bacteria 7981
1089 Ga0501044_0017470 3300049823 Bacteria 7699
1090 Ga0501044_0044831 3300049823 Bacteria 4586
1091 Ga0501044_0100475 3300049823 Bacteria 2911
1092 Ga0501044_0221853 3300049823 Bacteria 1841
1093 Ga0501044_0657860 3300049823 Bacteria 936
1094 Ga0501284_00029 3300050005 Bacteria 74818
1095 nmdc:mga0k408_233999_c1 3300050493 Bacteria 1097
1096 nmdc:mga0k408_57908_c1 3300050493 Bacteria 2250
1097 nmdc:mga05p37_720353_c1 3300050507 Bacteria 1105
1098 nmdc:mga05p37_985444_c1 3300050507 Bacteria 897
1099 nmdc:mga09592_173530_c1 3300050508 Bacteria 1865
1100 nmdc:mga09592_466632_c1 3300050508 Bacteria 1089
1101 nmdc:mga0qj67_225298_c1 3300050509 Bacteria 1522
1102 nmdc:mga06r32_10152_c1 3300050510 Bacteria 8500
1103 nmdc:mga08y16_168780_c1 3300050511 Bacteria 2273
1104 nmdc:mga08y16_237955_c1 3300050511 Bacteria 1882
1105 nmdc:mga08y16_277282_c1 3300050511 Bacteria 1730
1106 nmdc:mga08y16_292138_c1 3300050511 Bacteria 1680
1107 nmdc:mga08y16_646838_c1 3300050511 Bacteria 1062
1108 nmdc:mga08y16_766199_c1 3300050511 Bacteria 960
1109 nmdc:mga0n895_876213_c1 3300050512 Bacteria 884
1110 Ga0500578_0000034 3300053086 Bacteria 136582
1111 Ga0500644_0000283 3300053088 Bacteria 28078
1112 Ga0500644_0018221 3300053088 Bacteria 2053
1113 Ga0500644_0064791 3300053088 Bacteria 1299
1114 Ga0500644_0246989 3300053088 Bacteria 751
1115 Ga0500646_0017416 3300053090 Bacteria 1884
1116 Ga0500583_0000346 3300053092 Bacteria 15437
1117 Ga0500583_0006285 3300053092 Bacteria 4072
1118 Ga0500640_180406 3300053095 Bacteria 766
1119 Ga0500650_0137230 3300053098 Bacteria 1135
1120 Ga0500562_000050 3300053108 Bacteria 60058
1121 Ga0500569_026583 3300053109 Bacteria 1587
1122 Ga0500652_027751 3300053131 Bacteria 2192
1123 Ga0500658_0006675 3300053134 Bacteria 4275
1124 Ga0500559_0134430 3300053136 Bacteria 1156
1125 Ga0500577_0130092 3300053142 Bacteria 1054
1126 Ga0500588_0080710 3300053146 Unclassified 1087
1127 Ga0500589_111239 3300053147 Bacteria 1174
1128 Ga0500590_113567 3300053148 Bacteria 1281
1129 Ga0500604_0014034 3300053151 Bacteria 2177
1130 Ga0500604_0162825 3300053151 Bacteria 760
1131 Ga0500616_0005429 3300053153 Bacteria 8651
1132 Ga0500616_0009033 3300053153 Bacteria 6104
1133 Ga0500616_0041053 3300053153 Bacteria 2485
1134 Ga0500616_0058660 3300053153 Bacteria 2002
1135 Ga0500622_0001463 3300053156 Bacteria 18819
1136 Ga0500634_0069639 3300053161 Bacteria 1844
1137 Ga0500639_048405 3300053163 Bacteria 2219
1138 Ga0501084_0108818 3300054114 Unclassified 2328
1139 Ga0501082_0492410 3300060353 Unclassified 1071
1140 Ga0466962_0082820 3300061719 Bacteria 1535
1141 Ga0466962_0379214 3300061719 Bacteria 706
1142 2738727061 2738541278 Bacteria 9755573
1143 2819588782 2818991444 Bacteria 6968812
1144 2884795626 2884791551 Bacteria 8511252
1145 2929157418 2929154850 Bacteria 6753285
1146 2929923242 2929921140 Bacteria 8649150
1147 8003153685 8003151029 Bacteria 8187759
1148 Ga0068869_100365111
1149 MBSR1b_contig_5080737
1150 JGI24740J21852_10005751
1151 JGI25154J39366_1000040
1152 JGI25157J39369_1003509
1153 JGI25406J46586_10015712
1154 rootH1_10042957
1155 rootH2_10008248
1156 rootH2_10008268
1157 rootH2_10028777
1158 rootH2_10030072
1159 rootH2_10132146
1160 rootH2_10141251
1161 rootL2_10188385
1162 rootH1_10002854
1163 rootH1_10015122
1164 JGI25160J50197_1001601
1165 Ga0055535_1003449
1166 Ga0055542_1017472
1167 Ga0058863_11413575
1168 Ga0058862_12656212
1169 Ga0065165_1037906
1170 Ga0065712_10008205
1171 Ga0065712_10070469
1172 Ga0065712_10270594
1173 Ga0070658_10010748
1174 Ga0070658_10075190
1175 Ga0070658_10081107
1176 Ga0070658_10187046
1177 Ga0070658_10214232
1178 Ga0070658_10281996
1179 Ga0070658_10526202
1180 Ga0070676_10000336
1181 Ga0070676_10031688
1182 Ga0070676_10248238
1183 Ga0070683_100002966
1184 Ga0070683_100032588
1185 Ga0070683_100120371
1186 Ga0070683_100673128
1187 Ga0070683_100841404
1188 Ga0070690_100005983
1189 Ga0070690_100057685
1190 Ga0070690_100166719
1191 Ga0070690_100266160
1192 Ga0070690_100319086
1193 Ga0070670_100030756
1194 Ga0070670_100039056
1195 Ga0070670_100062154
1196 Ga0070670_100079810
1197 Ga0070670_100162784
1198 Ga0070670_100221339
1199 Ga0070670_100245642
1200 Ga0070670_100899099
1201 Ga0070677_10143248
1202 Ga0070677_10416306
1203 Ga0068869_100043129
1204 Ga0068869_100080027
1205 Ga0068869_100125092
1206 Ga0068869_100151211
1207 Ga0068869_100159910
1208 Ga0068869_100160053
1209 Ga0068869_100183963
1210 Ga0068869_100428266
1211 Ga0068869_100468926
1212 Ga0070666_10000051
1213 Ga0070666_10010207
1214 Ga0070666_10013609
1215 Ga0070666_10090217
1216 Ga0070666_10143011
1217 Ga0070666_10382347
1218 Ga0070680_100031956
1219 Ga0070680_100171315
1220 Ga0070680_100189297
1221 Ga0070680_100213482
1222 Ga0070680_100243505
1223 Ga0070682_100001275
1224 Ga0070682_100026905
1225 Ga0070682_100559187
1226 Ga0068868_100005270
1227 Ga0068868_100010338
1228 Ga0068868_100078065
1229 Ga0068868_100205069
1230 Ga0068868_100255371
1231 Ga0068868_100308965
1232 Ga0068868_100630897
1233 Ga0068868_101113413
1234 Ga0070660_100015714
1235 Ga0070660_101097932
1236 Ga0070689_100001732
1237 Ga0070689_100013351
1238 Ga0070689_100014808
1239 Ga0070689_100278201
1240 Ga0070691_10016205
1241 Ga0070691_10049783
1242 Ga0070661_100002702
1243 Ga0070661_100003143
1244 Ga0070661_100022549
1245 Ga0070661_100242507
1246 Ga0070661_100286536
1247 Ga0070661_100467931
1248 Ga0070668_100002494
1249 Ga0070668_100022644
1250 Ga0070668_100395028
1251 Ga0070669_100004789
1252 Ga0070669_100036574
1253 Ga0070669_100165082
1254 Ga0070669_100301733
1255 Ga0070669_100582851
1256 Ga0070669_100761213
1257 Ga0070669_100924072
1258 Ga0070675_100013600
1259 Ga0070675_100025711
1260 Ga0070675_100040336
1261 Ga0070675_100055271
1262 Ga0070675_100266528
1263 Ga0070671_100004803
1264 Ga0070671_100032777
1265 Ga0070671_100049587
1266 Ga0070671_100062085
1267 Ga0070671_100074043
1268 Ga0070671_100123868
1269 Ga0070671_100195390
1270 Ga0070671_100292029
1271 Ga0070671_100354866
1272 Ga0070674_100028173
1273 Ga0070674_100076506
1274 Ga0070674_100270356
1275 Ga0070673_100001990
1276 Ga0070673_100017265
1277 Ga0070673_100049176
1278 Ga0070673_100062597
1279 Ga0070673_100161208
1280 Ga0070673_100216608
1281 Ga0070673_100218521
1282 Ga0070673_100290540
1283 Ga0070673_100874628
1284 Ga0070688_100019036
1285 Ga0070688_100039808
1286 Ga0070688_100051258
1287 Ga0070688_100082918
1288 Ga0070688_100345935
1289 Ga0070659_100117387
1290 Ga0070659_100120914
1291 Ga0070667_100000492
1292 Ga0070667_100020321
1293 Ga0070667_100054456
1294 Ga0070667_100075366
1295 Ga0070667_100088516
1296 Ga0070667_100157396
1297 Ga0070667_100161421
1298 Ga0070667_100307734
1299 Ga0070705_100351477
1300 Ga0070663_100690869
1301 Ga0070678_100010791
1302 Ga0070678_100013945
1303 Ga0070678_100231962
1304 Ga0070662_100004086
1305 Ga0070662_100027166
1306 Ga0070662_100036135
1307 Ga0070662_100056097
1308 Ga0070662_100146200
1309 Ga0070662_100283207
1310 Ga0070681_10021777
1311 Ga0070681_10040812
1312 Ga0070681_10097972
1313 Ga0070681_10305631
1314 Ga0068867_100043311
1315 Ga0068867_100082241
1316 Ga0068867_100094622
1317 Ga0068867_100192882
1318 Ga0068867_100273011
1319 Ga0068867_100355786
1320 Ga0068867_100621339
1321 Ga0070685_10009065
1322 Ga0070685_10016536
1323 Ga0070685_10063077
1324 Ga0070685_10165147
1325 Ga0070685_10166737
1326 Ga0070698_100007269
1327 Ga0070699_100140396
1328 Ga0070679_100004536
1329 Ga0070679_100029492
1330 Ga0070679_100054566
1331 Ga0070679_100098661
1332 Ga0070679_100143593
1333 Ga0070684_100000228
1334 Ga0070684_100060191
1335 Ga0070684_100479592
1336 Ga0070684_100664138
1337 Ga0068853_100000221
1338 Ga0068853_100020583
1339 Ga0068853_100055688
1340 Ga0068853_100058961
1341 Ga0068853_100092567
1342 Ga0068853_100094499
1343 Ga0068853_100130043
1344 Ga0068853_100140870
1345 Ga0068853_100196267
1346 Ga0068853_100241918
1347 Ga0068853_100372941
1348 Ga0068853_100706232
1349 Ga0070672_100001464
1350 Ga0070672_100052158
1351 Ga0070672_100179906
1352 Ga0070672_100199661
1353 Ga0070672_100786836
1354 Ga0070686_100392522
1355 Ga0070686_100680528
1356 Ga0070695_100438499
1357 Ga0070693_100009189
1358 Ga0070665_100000001
1359 Ga0070665_100005742
1360 Ga0070665_100392369
1361 Ga0068855_100007886
1362 Ga0068855_100030208
1363 Ga0068855_100034990
1364 Ga0068855_100125633
1365 Ga0068855_100274941
1366 Ga0068855_100329735
1367 Ga0068855_100413214
1368 Ga0068855_100482300
1369 Ga0070664_100003241
1370 Ga0070664_100004633
1371 Ga0070664_100012802
1372 Ga0070664_100074332
1373 Ga0070664_100296205
1374 Ga0070664_100382311
1375 Ga0070664_100688884
1376 Ga0068857_100001119
1377 Ga0068857_100007157
1378 Ga0068857_100019040
1379 Ga0068857_100090705
1380 Ga0068857_100118152
1381 Ga0068857_100238569
1382 Ga0068857_100289571
1383 Ga0068854_100071634
1384 Ga0068854_100073957
1385 Ga0068854_100086737
1386 Ga0068854_100176660
1387 Ga0068854_100373372
1388 Ga0068854_100587059
1389 Ga0068854_100606295
1390 Ga0068854_100714905
1391 Ga0068854_101153514
1392 Ga0068856_100011164
1393 Ga0068856_100063215
1394 Ga0068856_100074030
1395 Ga0068856_100139887
1396 Ga0068856_100567977
1397 Ga0070702_100122033
1398 Ga0068852_100002006
1399 Ga0068852_100018674
1400 Ga0068852_100023547
1401 Ga0068852_100066167
1402 Ga0068852_100136739
1403 Ga0068852_100230863
1404 Ga0068852_100241605
1405 Ga0068852_100292942
1406 Ga0068852_100595137
1407 Ga0068852_100704643
1408 Ga0068852_100732765
1409 Ga0068859_100000023
1410 Ga0068859_100008109
1411 Ga0068859_100033356
1412 Ga0068859_100054725
1413 Ga0068859_100069445
1414 Ga0068859_100085357
1415 Ga0068859_100135826
1416 Ga0068859_100805481
1417 Ga0068859_100986642
1418 Ga0068859_101001856
1419 Ga0068859_101134262
1420 Ga0068864_100005800
1421 Ga0068864_100007839
1422 Ga0068864_100016359
1423 Ga0068864_100026175
1424 Ga0068864_100066317
1425 Ga0068864_100072654
1426 Ga0068864_100217573
1427 Ga0068864_100293509
1428 Ga0068864_100444836
1429 Ga0068866_10059122
1430 Ga0068866_10348342
1431 Ga0068861_100009306
1432 Ga0068861_100094670
1433 Ga0068861_100122562
1434 Ga0068861_100129736
1435 Ga0068861_100158612
1436 Ga0068861_100205414
1437 Ga0068861_100362071
1438 Ga0068861_100791543
1439 Ga0068851_10001340
1440 Ga0068870_10046335
1441 Ga0068870_10105701
1442 Ga0068863_100001812
1443 Ga0068863_100013140
1444 Ga0068863_100074948
1445 Ga0068863_100075228
1446 Ga0068863_100130519
1447 Ga0068858_100008485
1448 Ga0068858_100049204
1449 Ga0068858_100577331
1450 Ga0068858_100827928
1451 Ga0068860_100000046
1452 Ga0068860_100000916
1453 Ga0068860_100005408
1454 Ga0068860_100007358
1455 Ga0068860_100024991
1456 Ga0068860_100034035
1457 Ga0068860_100116564
1458 Ga0068860_100371146
1459 Ga0068860_100822578
1460 Ga0068860_101335261
1461 Ga0068862_100003779
1462 Ga0068862_100022881
1463 Ga0068862_100166968
1464 Ga0068862_100449754
1465 Ga0068862_100723941
1466 Ga0081539_10000531
1467 Ga0081539_10071796
1468 Ga0070715_10046164
1469 Ga0070715_10112710
1470 Ga0075366_10048373
1471 Ga0075366_10061180
1472 Ga0075366_10207913
1473 Ga0097621_100000847
1474 Ga0097621_100001572
1475 Ga0097621_100003432
1476 Ga0097621_100035876
1477 Ga0097621_100044146
1478 Ga0097621_100077970
1479 Ga0097621_100098064
1480 Ga0097621_100098913
1481 Ga0097621_100157282
1482 Ga0097621_100524427
1483 Ga0097621_100706038
1484 Ga0068871_100000027
1485 Ga0068871_100000354
1486 Ga0068871_100001006
1487 Ga0068871_100024941
1488 Ga0068871_100040970
1489 Ga0068871_100106906
1490 Ga0068871_100195683
1491 Ga0068871_100229104
1492 Ga0068871_100267331
1493 Ga0068871_100348869
1494 Ga0068871_100459632
1495 Ga0075428_100024587
1496 Ga0075428_100871642
1497 Ga0075430_100010054
1498 Ga0075431_100004434
1499 Ga0075431_100245623
1500 Ga0075429_100005840
1501 Ga0068865_100023025
1502 Ga0068865_100157160
1503 Ga0068865_100275782
1504 Ga0068865_100331513
1505 Ga0068865_100598388
1506 Ga0068865_100767296
1507 Ga0097620_100000023
1508 Ga0097620_100008109
1509 Ga0097620_100033356
1510 Ga0097620_100054730
1511 Ga0097620_100069445
1512 Ga0097620_100085355
1513 Ga0097620_100135820
1514 Ga0097620_100805394
1515 Ga0097620_100986659
1516 Ga0097620_101001928
1517 Ga0097620_101134445
1518 Ga0105240_10000074
1519 Ga0105240_10000598
1520 Ga0105240_10000626
1521 Ga0105240_10001595
1522 Ga0105240_10002663
1523 Ga0105240_10007062
1524 Ga0105240_10095833
1525 Ga0105240_10157044
1526 Ga0105240_10192995
1527 Ga0105240_10233775
1528 Ga0105240_10346161
1529 Ga0105240_10394988
1530 Ga0105240_10469687
1531 Ga0105240_10504726
1532 Ga0105240_10604497
1533 Ga0111539_10015483
1534 Ga0111539_10072693
1535 Ga0111539_10150833
1536 Ga0111539_10203554
1537 Ga0111539_10248996
1538 Ga0111539_10519594
1539 Ga0111539_10638165
1540 Ga0111539_11318769
1541 Ga0105245_10092150
1542 Ga0105245_10136710
1543 Ga0105245_10211933
1544 Ga0105247_10003751
1545 Ga0105247_10055552
1546 Ga0105247_10200350
1547 Ga0114129_10170363
1548 Ga0114129_11213107
1549 Ga0105243_11028531
1550 Ga0105241_10000659
1551 Ga0105241_10000881
1552 Ga0105241_10007681
1553 Ga0105241_10034893
1554 Ga0105241_10105623
1555 Ga0105241_10281965
1556 Ga0105241_10720042
1557 Ga0105242_10012454
1558 Ga0105242_10029532
1559 Ga0105242_10046336
1560 Ga0105242_10047921
1561 Ga0105242_10057412
1562 Ga0105242_10066820
1563 Ga0105242_10245338
1564 Ga0105242_10262710
1565 Ga0105242_10907120
1566 Ga0105242_10974798
1567 Ga0105242_11121783
1568 Ga0105248_10129741
1569 Ga0105248_10148472
1570 Ga0105248_10801695
1571 Ga0105237_10000755
1572 Ga0105237_10004143
1573 Ga0105237_10007407
1574 Ga0105237_10020135
1575 Ga0105237_10042602
1576 Ga0105237_10100523
1577 Ga0105237_10111377
1578 Ga0105237_10213092
1579 Ga0105237_10231380
1580 Ga0105237_10349941
1581 Ga0105238_10001132
1582 Ga0105238_10035958
1583 Ga0105238_10104359
1584 Ga0105238_10208463
1585 Ga0105238_10995831
1586 Ga0105249_10005641
1587 Ga0105249_10008464
1588 Ga0105249_10009356
1589 Ga0105249_10012834
1590 Ga0105249_10056487
1591 Ga0105249_10088386
1592 Ga0105249_10133429
1593 Ga0105249_10209741
1594 Ga0105249_10322304
1595 Ga0105249_10435755
1596 Ga0105249_10524346
1597 Ga0105239_10000048
1598 Ga0105239_10000785
1599 Ga0105239_10090248
1600 Ga0105239_10192023
1601 Ga0105239_10206574
1602 Ga0105239_10236788
1603 Ga0105239_10240773
1604 Ga0105239_10335860
1605 Ga0105239_10376028
1606 Ga0105239_10410117
1607 Ga0105239_10485819
1608 Ga0105246_10017603
1609 Ga0105246_10098219
1610 Ga0105246_10315264
1611 Ga0105246_10324771
1612 Ga0157373_10016186
1613 Ga0157373_10092062
1614 Ga0157373_10132512
1615 Ga0157371_10048769
1616 Ga0157371_10144490
1617 Ga0157371_10356050
1618 Ga0157370_10000839
1619 Ga0157370_10006823
1620 Ga0157370_10121472
1621 Ga0157370_10450449
1622 Ga0157370_10680122
1623 Ga0157369_10039285
1624 Ga0157369_10053379
1625 Ga0157369_10083054
1626 Ga0157369_10100053
1627 Ga0157369_10104624
1628 Ga0157369_10192363
1629 Ga0157369_10301339
1630 Ga0157369_10343029
1631 Ga0157374_10000001
1632 Ga0157374_10004285
1633 Ga0157374_10008464
1634 Ga0157374_10025420
1635 Ga0157374_10097036
1636 Ga0157374_10101752
1637 Ga0157374_10152435
1638 Ga0157374_10189753
1639 Ga0157374_10391189
1640 Ga0157374_10516632
1641 Ga0157374_10519786
1642 Ga0157374_10535483
1643 Ga0157374_10854522
1644 Ga0157374_11249023
1645 Ga0157378_10011078
1646 Ga0157378_10011450
1647 Ga0157378_10017714
1648 Ga0157378_10021827
1649 Ga0157378_10048565
1650 Ga0157378_10118435
1651 Ga0157378_10322662
1652 Ga0157378_10512683
1653 Ga0157378_10534989
1654 Ga0157378_10965802
1655 Ga0157378_11019935
1656 Ga0157378_11023952
1657 Ga0163162_10000331
1658 Ga0163162_10000967
1659 Ga0163162_10005326
1660 Ga0163162_10005839
1661 Ga0163162_10014930
1662 Ga0163162_10023196
1663 Ga0163162_10044468
1664 Ga0163162_10081120
1665 Ga0163162_10086357
1666 Ga0163162_10104877
1667 Ga0163162_10126784
1668 Ga0163162_10176964
1669 Ga0163162_10195439
1670 Ga0163162_10256648
1671 Ga0163162_10339926
1672 Ga0163162_11252393
1673 Ga0157372_10000921
1674 Ga0157372_10002207
1675 Ga0157372_10015967
1676 Ga0157372_10125895
1677 Ga0157372_10229607
1678 Ga0157372_10480557
1679 Ga0157372_10834613
1680 Ga0157372_11452223
1681 Ga0157375_10000229
1682 Ga0157375_10003117
1683 Ga0157375_10043753
1684 Ga0157375_10049275
1685 Ga0157375_10082027
1686 Ga0157375_10115476
1687 Ga0157375_10117019
1688 Ga0157375_10198617
1689 Ga0157375_10219068
1690 Ga0157375_10227378
1691 Ga0157375_10322576
1692 Ga0157375_10585055
1693 Ga0157375_10798047
1694 Ga0157375_10936927
1695 Ga0157375_10984019
1696 Ga0157375_11096202
1697 Ga0163163_10000538
1698 Ga0163163_10000653
1699 Ga0163163_10039883
1700 Ga0163163_10236928
1701 Ga0163163_10247142
1702 Ga0163163_10353157
1703 Ga0163163_11020906
1704 Ga0163163_11687486
1705 Ga0157380_10009363
1706 Ga0157380_10046212
1707 Ga0157380_10151308
1708 Ga0157380_10430802
1709 Ga0157380_10512078
1710 Ga0157380_10613153
1711 Ga0157380_10757211
1712 Ga0157380_11067610
1713 Ga0157377_10000932
1714 Ga0157377_10011561
1715 Ga0157377_10052986
1716 Ga0157377_10191453
1717 Ga0157377_10289435
1718 Ga0157379_10001640
1719 Ga0157379_10002723
1720 Ga0157379_10025305
1721 Ga0157379_10039098
1722 Ga0157379_10053136
1723 Ga0157379_10063814
1724 Ga0157379_10153679
1725 Ga0157379_10160896
1726 Ga0157379_10268112
1727 Ga0157379_10331601
1728 Ga0157376_10002682
1729 Ga0157376_10004414
1730 Ga0157376_10005888
1731 Ga0157376_10017174
1732 Ga0157376_10037066
1733 Ga0157376_10054689
1734 Ga0157376_10055401
1735 Ga0157376_10089452
1736 Ga0157376_10133715
1737 Ga0157376_10201804
1738 Ga0157376_10369875
1739 Ga0163161_10023525
1740 Ga0163161_10027192
1741 Ga0163161_10041919
1742 Ga0163161_10129167
1743 Ga0163161_10210271
1744 Ga0163161_10244272
1745 Ga0213876_10022962
1746 Ga0209258_100151
1747 Ga0209646_1000002
1748 Ga0209646_1000823
1749 Ga0209026_1000434
1750 Ga0209148_1000154
1751 Ga0209758_1037890
1752 Ga0207426_1000030
1753 Ga0207426_1000497
1754 Ga0207697_10093949
1755 Ga0207656_10004204
1756 Ga0207710_10003162
1757 Ga0207710_10030055
1758 Ga0207688_10039173
1759 Ga0207688_10102142
1760 Ga0207680_10000162
1761 Ga0207680_10011575
1762 Ga0207647_10018104
1763 Ga0207647_10112441
1764 Ga0207647_10157173
1765 Ga0207685_10245320
1766 Ga0207645_10000782
1767 Ga0207645_10009564
1768 Ga0207645_10032778
1769 Ga0207645_10082780
1770 Ga0207645_10299253
1771 Ga0207643_10003598
1772 Ga0207643_10024156
1773 Ga0207643_10156236
1774 Ga0207705_10140693
1775 Ga0207705_10147114
1776 Ga0207654_10003155
1777 Ga0207654_10003491
1778 Ga0207654_10210525
1779 Ga0207654_10270390
1780 Ga0207654_10317871
1781 Ga0207707_10000051
1782 Ga0207707_10028865
1783 Ga0207707_10121080
1784 Ga0207707_10160562
1785 Ga0207707_10220480
1786 Ga0207695_10000071
1787 Ga0207695_10000084
1788 Ga0207695_10000323
1789 Ga0207695_10004602
1790 Ga0207695_10020015
1791 Ga0207695_10094718
1792 Ga0207695_10111165
1793 Ga0207695_10141759
1794 Ga0207695_10175536
1795 Ga0207695_10206800
1796 Ga0207695_10261200
1797 Ga0207695_10446920
1798 Ga0207695_10452825
1799 Ga0207695_10514728
1800 Ga0207671_10001044
1801 Ga0207671_10002907
1802 Ga0207671_10003799
1803 Ga0207671_10003904
1804 Ga0207671_10024892
1805 Ga0207671_10047813
1806 Ga0207660_10005186
1807 Ga0207660_10013385
1808 Ga0207660_10099182
1809 Ga0207660_10108430
1810 Ga0207660_10201863
1811 Ga0207660_10445736
1812 Ga0207662_10012024
1813 Ga0207662_10239060
1814 Ga0207657_10010433
1815 Ga0207657_10042823
1816 Ga0207657_10270275
1817 Ga0207649_10009815
1818 Ga0207649_10255441
1819 Ga0207649_10668233
1820 Ga0207652_10000384
1821 Ga0207652_10020709
1822 Ga0207652_10106805
1823 Ga0207652_10159287
1824 Ga0207652_10179079
1825 Ga0207652_10180240
1826 Ga0207681_10330130
1827 Ga0207681_10398400
1828 Ga0207681_10438157
1829 Ga0207681_10727514
1830 Ga0207694_10007231
1831 Ga0207694_10024476
1832 Ga0207694_10189791
1833 Ga0207650_10029550
1834 Ga0207650_10069495
1835 Ga0207650_10084153
1836 Ga0207650_10086979
1837 Ga0207650_10112906
1838 Ga0207650_10143351
1839 Ga0207650_10227135
1840 Ga0207650_10350160
1841 Ga0207650_10612459
1842 Ga0207650_10806457
1843 Ga0207659_10094854
1844 Ga0207659_10428587
1845 Ga0207687_10086348
1846 Ga0207687_10561668
1847 Ga0207644_10002938
1848 Ga0207644_10085126
1849 Ga0207644_10107695
1850 Ga0207644_10118442
1851 Ga0207644_10501524
1852 Ga0207690_10017654
1853 Ga0207706_10006768
1854 Ga0207706_10022065
1855 Ga0207706_10036407
1856 Ga0207706_10060668
1857 Ga0207706_10113169
1858 Ga0207706_10198002
1859 Ga0207686_10003538
1860 Ga0207686_10025792
1861 Ga0207686_10031401
1862 Ga0207686_10040558
1863 Ga0207686_10951096
1864 Ga0207670_10013524
1865 Ga0207670_10455138
1866 Ga0207670_10718211
1867 Ga0207669_10089885
1868 Ga0207704_10051601
1869 Ga0207704_10054704
1870 Ga0207704_10169619
1871 Ga0207704_10246745
1872 Ga0207704_10723475
1873 Ga0207691_10006538
1874 Ga0207691_10011421
1875 Ga0207691_10066380
1876 Ga0207691_10075281
1877 Ga0207691_10129415
1878 Ga0207691_10302352
1879 Ga0207711_10097280
1880 Ga0207689_10001006
1881 Ga0207689_10004039
1882 Ga0207689_10011687
1883 Ga0207689_10015929
1884 Ga0207689_10036692
1885 Ga0207689_10050801
1886 Ga0207689_10051842
1887 Ga0207689_10138954
1888 Ga0207689_10231980
1889 Ga0207689_10371134
1890 Ga0207689_10651659
1891 Ga0207689_10659378
1892 Ga0207661_10006472
1893 Ga0207661_10006982
1894 Ga0207661_10009253
1895 Ga0207661_10076460
1896 Ga0207661_10310305
1897 Ga0207661_11061858
1898 Ga0207679_10003010
1899 Ga0207679_10086960
1900 Ga0207679_10148809
1901 Ga0207679_10193919
1902 Ga0207679_10214210
1903 Ga0207679_10485240
1904 Ga0207667_10000177
1905 Ga0207667_10015290
1906 Ga0207667_10021496
1907 Ga0207667_10027988
1908 Ga0207667_10044124
1909 Ga0207667_10061072
1910 Ga0207667_10100565
1911 Ga0207667_10571436
1912 Ga0207651_10001099
1913 Ga0207651_10165244
1914 Ga0207651_10213080
1915 Ga0207651_10277221
1916 Ga0207651_10298807
1917 Ga0207651_10469620
1918 Ga0207651_10609985
1919 Ga0207651_10848885
1920 Ga0207712_10009497
1921 Ga0207712_10011985
1922 Ga0207712_10052658
1923 Ga0207712_10082148
1924 Ga0207712_10140469
1925 Ga0207712_10203460
1926 Ga0207712_10209950
1927 Ga0207712_10255179
1928 Ga0207668_10000843
1929 Ga0207668_10270488
1930 Ga0207668_10299956
1931 Ga0207640_10012737
1932 Ga0207640_10147321
1933 Ga0207640_10189077
1934 Ga0207640_10287420
1935 Ga0207640_10308625
1936 Ga0207640_10328689
1937 Ga0207640_10363026
1938 Ga0207658_10061094
1939 Ga0207658_10062871
1940 Ga0207658_10201871
1941 Ga0207658_10280211
1942 Ga0207677_10008700
1943 Ga0207677_10019809
1944 Ga0207677_10023899
1945 Ga0207677_10903456
1946 Ga0207677_11044310
1947 Ga0207703_10005016
1948 Ga0207703_10050477
1949 Ga0207703_10354175
1950 Ga0207703_10400092
1951 Ga0207639_10003645
1952 Ga0207639_10045139
1953 Ga0207639_10048724
1954 Ga0207639_10132582
1955 Ga0207639_10177426
1956 Ga0207639_10191922
1957 Ga0207639_10224058
1958 Ga0207639_10239208
1959 Ga0207639_10249979
1960 Ga0207639_10361966
1961 Ga0207639_10858552
1962 Ga0207678_10036360
1963 Ga0207678_10824553
1964 Ga0207678_10824573
1965 Ga0207708_10033757
1966 Ga0207708_10236353
1967 Ga0207708_10260555
1968 Ga0207702_10079557
1969 Ga0207702_10193997
1970 Ga0207702_10500460
1971 Ga0207702_10531882
1972 Ga0207641_10000226
1973 Ga0207641_10001217
1974 Ga0207641_10004894
1975 Ga0207641_10064994
1976 Ga0207641_10089306
1977 Ga0207641_10091888
1978 Ga0207641_10272700
1979 Ga0207641_10365843
1980 Ga0207648_10002745
1981 Ga0207648_10003442
1982 Ga0207648_10012585
1983 Ga0207648_10075871
1984 Ga0207648_10075913
1985 Ga0207648_10078660
1986 Ga0207648_10082137
1987 Ga0207648_10495006
1988 Ga0207676_10009153
1989 Ga0207676_10009837
1990 Ga0207676_10022211
1991 Ga0207676_10034551
1992 Ga0207676_10130570
1993 Ga0207676_10133209
1994 Ga0207676_10208370
1995 Ga0207676_10304526
1996 Ga0207676_10600121
1997 Ga0207676_10804568
1998 Ga0207674_10000672
1999 Ga0207674_10009363
2000 Ga0207674_10013131
2001 Ga0207674_10078260
2002 Ga0207674_10102221
2003 Ga0207674_10119089
2004 Ga0207674_10191290
2005 Ga0207674_10367721
2006 Ga0207674_10743548
2007 Ga0207674_11257823
2008 Ga0207675_100000124
2009 Ga0207675_100042058
2010 Ga0207675_100066501
2011 Ga0207675_100123061
2012 Ga0207675_100132394
2013 Ga0207675_100215203
2014 Ga0207675_100337963
2015 Ga0207675_100407759
2016 Ga0207683_10010911
2017 Ga0207683_10015180
2018 Ga0207683_10069331
2019 Ga0207683_10083694
2020 Ga0207683_10267570
2021 Ga0207683_10436473
2022 Ga0207698_10001082
2023 Ga0207698_10018942
2024 Ga0207698_10055253
2025 Ga0207698_10073671
2026 Ga0207698_10117304
2027 Ga0207698_10140320
2028 Ga0207698_10366157
2029 Ga0207698_10470277
2030 Ga0207698_10587283
2031 Ga0207698_10748676
2032 Ga0207428_10196734
2033 Ga0268266_10000049
2034 Ga0268266_10085877
2035 Ga0268266_10416980
2036 Ga0268265_10127934
2037 Ga0268265_10211380
2038 Ga0268265_10520123
2039 Ga0268265_10551345
2040 Ga0268264_10000041
2041 Ga0268264_10003860
2042 Ga0268264_10008457
2043 Ga0268264_10015087
2044 Ga0268264_10018061
2045 Ga0268264_10066255
2046 Ga0268264_10092890
2047 Ga0268264_10354427
2048 Ga0268264_10459618
2049 Ga0268264_10472905
2050 Ga0307517_10079111
2051 Ga0307515_10000001
2052 Ga0307515_10009265
2053 Ga0307515_10201918
2054 Ga0307511_10000042
2055 Ga0316177_1100501
2056 Ga0265327_10000084
2057 Ga0265327_10000395
2058 Ga0265327_10011198
2059 Ga0265327_10023168
2060 Ga0265327_10168209
2061 Ga0265316_10169767
2062 Ga0307513_10151351
2063 Ga0307513_10285094
2064 Ga0307513_10625902
2065 Ga0307509_10139082
2066 Ga0307509_10208553
2067 Ga0307509_10234366
2068 Ga0307509_10365330
2069 Ga0307508_10002100
2070 Ga0307516_10001558
2071 Ga0307516_10214020
2072 Ga0307414_10000003
2073 Ga0307414_10019125
2074 Ga0307507_10286948
2075 Ga0307510_10000091
2076 Ga0373934_0117388
2077 Ga0373934_0232580
2078 Ga0373952_0023997
2079 Ga0373953_0040200
2080 Ga0373956_0164875
2081 Ga0373943_0031071
2082 Ga0373947_0082304
2083 Ga0373937_0058916
2084 Ga0373937_0277658
2085 Ga0373937_0365304
2086 Ga0373925_0098421
2087 Ga0395900_0596943
2088 Ga0395905_0317315
2089 Ga0400483_053230
2090 Ga0400489_34926
2091 Ga0436365_0175741
2092 Ga0436365_0203686
2093 Ga0436365_0881017
2094 Ga0436365_1079918
2095 Ga0436365_1735638
2096 Ga0436363_1382145
2097 Ga0439436_0001603
2098 Ga0439439_0014036
2099 Ga0439439_0041709
2100 Ga0451791_1161455
2101 Ga0451841_0473234
2102 Ga0451849_1509768
2103 Ga0451853_3111860
2104 Ga0439442_014098
2105 Ga0439452_061751
2106 Ga0439454_029769
2107 Ga0439457_000788
2108 Ga0439457_010425
2109 Ga0439462_0007494
2110 Ga0450923_055175
2111 Ga0450898_024292
2112 Ga0439434_0024981
2113 Ga0439435_0075887
2114 Ga0451577_0069645
2115 Ga0466969_0000584
2116 Ga0466972_0000002
2117 Ga0466972_0000207
2118 Ga0466972_0003815
2119 Ga0466972_0137982
2120 Ga0466965_0069128
2121 Ga0466966_0000136
2122 Ga0466961_0042386
2123 Ga0466961_0212398
2124 Ga0466964_0064167
2125 Ga0466964_0198483
2126 Ga0453684_0182377
2127 Ga0466971_0085557
2128 Ga0466968_0024893
2129 Ga0466968_0074220
2130 Ga0466970_0032860
2131 Ga0466970_0083703
2132 Ga0466970_0183496
2133 Ga0466957_0007040
2134 Ga0466957_0014895
2135 Ga0466959_0000002
2136 Ga0466959_0004264
2137 Ga0466958_0067052
2138 Ga0495592_0092874
2139 Ga0495638_0044437
2140 Ga0495638_0133573
2141 Ga0495651_0491722
2142 Ga0495651_0510201
2143 Ga0495650_0048290
2144 Ga0495580_0014773
2145 Ga0495594_0109128
2146 Ga0495606_0019321
2147 Ga0495608_0321123
2148 Ga0495628_0034567
2149 Ga0495628_0285752
2150 Ga0495630_0012164
2151 Ga0495648_0014811
2152 Ga0495652_0080509
2153 Ga0495640_0090800
2154 Ga0495586_0254880
2155 Ga0495598_0076542
2156 Ga0495597_0142432
2157 Ga0495645_0092555
2158 Ga0495645_0125671
2159 Ga0495633_0105857
2160 Ga0495668_0000751
2161 Ga0495611_0001116
2162 Ga0495611_0036215
2163 Ga0495611_0320702
2164 Ga0495625_0040260
2165 Ga0495658_0229419
2166 Ga0495613_0185963
2167 Ga0495600_0264951
2168 Ga0495674_0210944
2169 Ga0495672_0025973
2170 Ga0495676_0070348
2171 Ga0495676_0145947
2172 Ga0495687_000001
2173 Ga0495675_0166435
2174 Ga0495675_0240181
2175 Ga0495684_0050898
2176 Ga0495684_0436512
2177 Ga0495686_0000004
2178 Ga0495686_0011430
2179 Ga0495686_0071848
2180 Ga0496104_0497143
2181 Ga0496104_0540596
2182 Ga0496105_0561363
2183 Ga0496107_0583247
2184 Ga0496108_0183554
2185 Ga0496108_0481496
2186 Ga0496108_0503107
2187 Ga0496109_0245679
2188 Ga0496109_0252417
2189 Ga0496110_0267538
2190 Ga0496110_0939890
2191 Ga0496115_0089648
2192 Ga0496124_0066454
2193 Ga0496126_0567079
2194 Ga0501031_0010841
2195 Ga0501031_0485868
2196 Ga0501032_0154715
2197 Ga0501032_0381305
2198 Ga0501033_0066471
2199 Ga0501033_0230965
2200 Ga0501034_0004012
2201 Ga0501034_0053271
2202 Ga0501034_0064319
2203 Ga0501034_0112712
2204 Ga0501034_0240918
2205 Ga0501034_1151286
2206 Ga0501036_0306700
2207 Ga0501037_0007826
2208 Ga0501037_0037709
2209 Ga0501038_0007220
2210 Ga0501038_0033809
2211 Ga0501039_0385750
2212 Ga0501040_0024888
2213 Ga0501043_0008215
2214 Ga0501043_0015257
2215 Ga0501043_0029351
2216 Ga0501047_0009183
2217 Ga0501047_0119920
2218 Ga0501047_0128329
2219 Ga0501048_0165851
2220 Ga0501068_0026838
2221 Ga0501069_0007664
2222 Ga0501071_0062985
2223 Ga0501073_0018001
2224 Ga0501227_002942
2225 Ga0501257_046339
2226 Ga0501219_000230
2227 Ga0501225_0001846
2228 Ga0501079_0058140
2229 Ga0501080_0140200
2230 Ga0501083_0060149
2231 Ga0501035_0031410
2232 Ga0501035_0043415
2233 Ga0501035_0210219
2234 Ga0501044_0016307
2235 Ga0501044_0017470
2236 Ga0501044_0044831
2237 Ga0501044_0100475
2238 Ga0501044_0221853
2239 Ga0501044_0657860
2240 Ga0501284_00029
2241 nmdc:mga0k408_233999_c1
2242 nmdc:mga0k408_57908_c1
2243 nmdc:mga05p37_720353_c1
2244 nmdc:mga05p37_985444_c1
2245 nmdc:mga09592_173530_c1
2246 nmdc:mga09592_466632_c1
2247 nmdc:mga0qj67_225298_c1
2248 nmdc:mga06r32_10152_c1
2249 nmdc:mga08y16_168780_c1
2250 nmdc:mga08y16_237955_c1
2251 nmdc:mga08y16_277282_c1
2252 nmdc:mga08y16_292138_c1
2253 nmdc:mga08y16_646838_c1
2254 nmdc:mga08y16_766199_c1
2255 nmdc:mga0n895_876213_c1
2256 Ga0500578_0000034
2257 Ga0500644_0000283
2258 Ga0500644_0018221
2259 Ga0500644_0064791
2260 Ga0500644_0246989
2261 Ga0500646_0017416
2262 Ga0500583_0000346
2263 Ga0500583_0006285
2264 Ga0500640_180406
2265 Ga0500650_0137230
2266 Ga0500562_000050
2267 Ga0500569_026583
2268 Ga0500652_027751
2269 Ga0500658_0006675
2270 Ga0500559_0134430
2271 Ga0500577_0130092
2272 Ga0500588_0080710
2273 Ga0500589_111239
2274 Ga0500590_113567
2275 Ga0500604_0014034
2276 Ga0500604_0162825
2277 Ga0500616_0005429
2278 Ga0500616_0009033
2279 Ga0500616_0041053
2280 Ga0500616_0058660
2281 Ga0500622_0001463
2282 Ga0500634_0069639
2283 Ga0500639_048405
2284 Ga0501084_0108818
2285 Ga0501082_0492410
2286 Ga0466962_0082820
2287 Ga0466962_0379214
2288 2738727061
2289 2819588782
2290 2884795626
2291 2929157418
2292 2929923242
2293 8003153685

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

31

236

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.8804 1 211
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.8706 1 211
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.8701 1 211
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.8683 1 211
1v5x-assembly1.cif.gz_B crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus 0.8678 2 210
ID Description Score Start End Superfamily
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8678 2 210 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8661 1 212 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8576 1 212 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8554 2 211 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8473 2 210 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3D2XC07-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.992 2 211 GO:0000162
GO:0004640
GO:0006568
AF-A0A191TPB8-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9897 2 211 GO:0000162
GO:0004640
GO:0006568
AF-A0A537KKD0-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9887 2 210 GO:0000162
GO:0004640
GO:0006568
AF-A0A1I5XBR7-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9867 1 210 GO:0000162
GO:0004640
GO:0006568
AF-A0A537JSI5-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9849 2 132 GO:0000162
GO:0004640
GO:0006568

Map