F490792

General Info

Members Datasets Scaffolds Average Seq Length
1146 548 2292 297

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10077766|Ga0075432_100777662
Length 352
Sequence MISAGRRPASAGQELNDAIRCLPATTKRKACKPSSKSVRRISCTADPHSQKVVIMHIGFLGLGNMGGPMARNLLKAGHSLTVFDPFPQAVAALVEAGASAADSPAAVAKAKVEVIITMLPTADHVMQVYRGKDGLLANIGQGVLLIDSSTIDPLSAREVAKFALAQGNPMLDAPVSGGTGGAAAGTLTFMVGGPVSVFDQALPILSAMGRNIVHCGGAGNGQVAKIANNMLLGISMVGVAEAIALGVALGMDAKVLAGVIGTSTGRCWSSEINNPFPGVLENAPASRGYSGGFGTDLMLKDLGLATEAAKHARQPVVLGAAAQQLYQTFSLQGNGGLDFSAIIKLFRGEAKA

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
111 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
187 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
188 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
189 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
190 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
191 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
222 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
232 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
235 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
238 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
239 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
240 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
241 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
242 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
265 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
274 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
331 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
332 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
344 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
345 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
346 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
347 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
353 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
377 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
378 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
386 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
390 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
391 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
392 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
393 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
394 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
395 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
396 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
397 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
398 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
399 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
400 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
401 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
402 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
403 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
404 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
406 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
407 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
408 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
409 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
410 2511231008 Pseudomonas sp. GM21 Isolate Nodule
411 2511231012 Pseudomonas sp. GM33 Isolate Nodule
412 2511231020 Pseudomonas sp. GM74 Isolate Nodule
413 2511231021 Pseudomonas sp. GM78 Isolate Nodule
414 2511231022 Pseudomonas sp. GM79 Isolate Nodule
415 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
416 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
417 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
418 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
419 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
420 2547132374 Acidovorax radicis N35 Isolate Unclassified
421 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
422 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
423 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
424 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
425 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
426 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
427 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
428 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
429 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
430 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
431 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
432 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
433 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
434 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
435 2643221570 Acidovorax sp. Root568 Isolate Unclassified
436 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
437 2643221596 Acidovorax sp. Root70 Isolate Unclassified
438 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
439 2643221609 Acidovorax sp. Root217 Isolate Unclassified
440 2643221611 Acidovorax sp. Root219 Isolate Unclassified
441 2643221652 Acidovorax sp. Root402 Isolate Unclassified
442 2643221658 Variovorax sp. Root411 Isolate Unclassified
443 2643221672 Variovorax sp. Root434 Isolate Unclassified
444 2643221717 Acidovorax sp. Root267 Isolate Unclassified
445 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
446 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
447 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
448 2738541277 Variovorax sp. GV051 Isolate Unclassified
449 2738541307 Variovorax sp. GV008 Isolate Unclassified
450 2738543012 Acidovorax sp. CF301 Isolate Unclassified
451 2738543013 Variovorax sp. BT01 Isolate Unclassified
452 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
453 2738543019 Variovorax sp. GV040 Isolate Unclassified
454 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
455 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
456 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
457 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
458 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
459 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
460 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
461 2773857670 Pseudomonas sp. 478 Isolate Unclassified
462 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
463 2784132072 Pseudomonas sp. 460 Isolate Unclassified
464 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
465 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
466 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
467 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
468 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
469 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
470 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
471 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
472 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
473 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
474 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
475 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
476 2816332133 Acidovorax radicis 2721A Isolate Unclassified
477 2818991436 Collimonas arenae 515 Isolate Unclassified
478 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
479 2818991446 Variovorax sp. 1180 Isolate Unclassified
480 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
481 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
482 2831864461 Roseateles noduli HZ7 Isolate Nodule
483 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
484 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
485 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
486 2842677519 Variovorax sp. R-72495 Isolate Unclassified
487 2842733646 Variovorax sp. R-72446 Isolate Unclassified
488 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
489 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
490 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
491 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
492 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
493 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
494 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
495 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
496 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
497 2885266251 Ralstonia sp. SET104 Isolate Nodule
498 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
499 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
500 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
501 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
502 2899924645 Variovorax sp. 369 Isolate Unclassified
503 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
504 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
505 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
506 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
507 2904456579 Variovorax sp. 2002 Isolate Unclassified
508 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
509 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
510 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
511 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
512 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
513 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
514 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
515 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
516 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
517 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
518 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
519 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
520 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
521 2928037797 Variovorax sp. 1126 Isolate Unclassified
522 2928044640 Variovorax sp. 1128 Isolate Unclassified
523 2928051484 Variovorax sp. 1133 Isolate Unclassified
524 2928058823 Ralstonia sp. 1138 Isolate Unclassified
525 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
526 2928070936 Variovorax gossypii 1167 Isolate Unclassified
527 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
528 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
529 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
530 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
531 2929520902 Variovorax beijingensis 502 Isolate Unclassified
532 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
533 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
534 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
535 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
536 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
537 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
538 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
539 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
540 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
541 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
542 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
543 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
544 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
545 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
546 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
547 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
548 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.65
Metatranscriptomes 0.79
Isolates 12.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 16.84
Nodule 1.92
Rhizoplane 2.79
Rhizosphere 63.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10077766 3300006058 Bacteria 1199
2 MRS2a_Contig_6410 2124908027 Bacteria 6723
3 JGI24740J21852_10000275 3300001979 Bacteria 21803
4 JGI24740J21852_10024395 3300001979 Bacteria 2052
5 JGI25155J39150_1000740 3300002704 Bacteria 5618
6 JGI25155J39150_1000889 3300002704 Bacteria 4225
7 JGI25156J39149_1001996 3300002705 Bacteria 7822
8 JGI25156J39149_1003358 3300002705 Bacteria 5280
9 JGI25156J39149_1009248 3300002705 Bacteria 2409
10 JGI25162J39368_1000369 3300002737 Bacteria 38411
11 JGI25162J39368_1000370 3300002737 Bacteria 38244
12 JGI25154J39366_1000522 3300002738 Bacteria 19339
13 JGI25154J39366_1002282 3300002738 Bacteria 5183
14 JGI25157J39369_1000336 3300002741 Bacteria 33359
15 JGI25152J39213_1002215 3300002773 Bacteria 7563
16 JGI25152J39213_1005545 3300002773 Bacteria 3640
17 JGI25150J39212_1001247 3300002774 Bacteria 7366
18 JGI25150J39212_1001590 3300002774 Bacteria 6195
19 JGI25159J45721_1002135 3300002987 Bacteria 7731
20 JGI25159J45721_1006297 3300002987 Bacteria 3574
21 JGI25151J46595_10004105 3300003187 Bacteria 7794
22 JGI25151J46595_10004592 3300003187 Bacteria 7274
23 JGI25151J46595_10016037 3300003187 Bacteria 3284
24 JGI25165J46597_1000022 3300003214 Bacteria 357959
25 JGI25153J46596_10004442 3300003215 Bacteria 7563
26 JGI25153J46596_10006559 3300003215 Bacteria 5866
27 rootH2_10045628 3300003320 Bacteria 2640
28 rootH2_10085097 3300003320 Bacteria 3806
29 rootL2_10022424 3300003322 Bacteria 13530
30 rootL2_10234216 3300003322 Bacteria 1207
31 rootH1_10106878 3300003323 Bacteria 1338
32 JGI25160J50197_1002977 3300003354 Bacteria 7731
33 JGI25160J50197_1009553 3300003354 Bacteria 3585
34 JGI25161J50226_1001358 3300003374 Bacteria 7527
35 JGI25161J50226_1004239 3300003374 Bacteria 3045
36 Ga0006562J51391_1033784 3300003578 Bacteria 7163
37 Ga0006562J51391_1033786 3300003578 Bacteria 3270
38 Ga0006562J51391_1036841 3300003578 Bacteria 2530
39 Ga0055538_1000011 3300003751 Bacteria 357959
40 Ga0055538_1000255 3300003751 Bacteria 28208
41 Ga0055539_1000016 3300003752 Bacteria 358248
42 Ga0055539_1000059 3300003752 Bacteria 146394
43 Ga0055539_1000288 3300003752 Bacteria 28208
44 Ga0055533_1000019 3300003756 Bacteria 357959
45 Ga0055533_1000273 3300003756 Bacteria 28208
46 Ga0055532_1000016 3300003758 Bacteria 327509
47 Ga0055532_1000025 3300003758 Bacteria 240145
48 Ga0055525_1000042 3300003759 Bacteria 279804
49 Ga0055525_1000372 3300003759 Bacteria 29628
50 Ga0055525_1000389 3300003759 Bacteria 28208
51 Ga0055535_1000019 3300003761 Bacteria 240145
52 Ga0055535_1000215 3300003761 Bacteria 61211
53 Ga0055535_1009321 3300003761 Bacteria 1701
54 Ga0055542_1000004 3300003762 Bacteria 553532
55 Ga0055542_1001074 3300003762 Bacteria 16816
56 Ga0055529_1000035 3300003763 Bacteria 240145
57 Ga0055526_1003413 3300003771 Bacteria 10097
58 Ga0055526_1005028 3300003771 Bacteria 7731
59 Ga0055537_1001816 3300003773 Bacteria 7731
60 Ga0055524_1000109 3300003775 Bacteria 100308
61 Ga0055524_1003044 3300003775 Bacteria 8295
62 Ga0055524_1003404 3300003775 Bacteria 7731
63 Ga0055536_1001609 3300003781 Bacteria 13474
64 Ga0055536_1003572 3300003781 Bacteria 8312
65 Ga0055536_1006289 3300003781 Bacteria 5587
66 Ga0055536_1023079 3300003781 Bacteria 1838
67 Ga0055534_1001943 3300003784 Bacteria 7587
68 Ga0055528_1003588 3300003790 Bacteria 7731
69 Ga0055530_10001847 3300003791 Bacteria 14560
70 Ga0055530_10004499 3300003791 Bacteria 7145
71 Ga0055530_10028296 3300003791 Bacteria 1515
72 Ga0055540_1000408 3300003792 Bacteria 34822
73 Ga0055540_1001457 3300003792 Bacteria 14106
74 Ga0055540_1003628 3300003792 Bacteria 7363
75 Ga0055540_1005917 3300003792 Bacteria 4990
76 Ga0055540_1045228 3300003792 Bacteria 931
77 Ga0055531_10001899 3300003794 Bacteria 14631
78 Ga0055531_10003404 3300003794 Bacteria 10163
79 Ga0055531_10009281 3300003794 Bacteria 5050
80 Ga0055541_1000017 3300003841 Bacteria 286811
81 Ga0055541_1000187 3300003841 Bacteria 28208
82 Ga0055541_1007448 3300003841 Bacteria 1795
83 Ga0055543_1001655 3300004625 Bacteria 8481
84 Ga0055543_1001835 3300004625 Bacteria 7773
85 Ga0065165_1005005 3300005262 Bacteria 7769
86 Ga0065165_1006473 3300005262 Bacteria 6126
87 Ga0065714_10000250 3300005288 Bacteria 6675
88 Ga0065714_10004039 3300005288 Bacteria 10143
89 Ga0065714_10064584 3300005288 Bacteria 32069
90 Ga0065704_10085551 3300005289 Bacteria 3211
91 Ga0065704_10120439 3300005289 Bacteria 1783
92 Ga0065712_10001860 3300005290 Bacteria 5886
93 Ga0065715_10009160 3300005293 Bacteria 2734
94 Ga0070658_10002173 3300005327 Bacteria 16454
95 Ga0070690_100326244 3300005330 Bacteria 1108
96 Ga0068869_100300229 3300005334 Bacteria 1296
97 Ga0070682_100000175 3300005337 Bacteria 47814
98 Ga0070682_100358758 3300005337 Bacteria 1089
99 Ga0070660_100184238 3300005339 Bacteria 1690
100 Ga0070691_10077359 3300005341 Bacteria 1624
101 Ga0070661_100000767 3300005344 Bacteria 23151
102 Ga0070661_100000769 3300005344 Bacteria 23131
103 Ga0070668_100562095 3300005347 Bacteria 994
104 Ga0070669_100020846 3300005353 Bacteria 4682
105 Ga0070675_100059478 3300005354 Bacteria 3152
106 Ga0070674_100086439 3300005356 Bacteria 2253
107 Ga0070659_100003572 3300005366 Bacteria 11070
108 Ga0070659_100231782 3300005366 Bacteria 1526
109 Ga0070667_100020167 3300005367 Bacteria 5534
110 Ga0070667_100474452 3300005367 Bacteria 1145
111 Ga0070701_10234224 3300005438 Bacteria 1101
112 Ga0070663_100000009 3300005455 Bacteria 187718
113 Ga0070678_100054293 3300005456 Bacteria 2919
114 Ga0070678_100300932 3300005456 Bacteria 1363
115 Ga0070662_100002684 3300005457 Bacteria 10977
116 Ga0070662_100089639 3300005457 Bacteria 2307
117 Ga0070672_100351298 3300005543 Bacteria 1257
118 Ga0070672_100489457 3300005543 Bacteria 1063
119 Ga0070665_100241195 3300005548 Bacteria 1808
120 Ga0068855_100000526 3300005563 Bacteria 46919
121 Ga0068855_100009723 3300005563 Bacteria 11605
122 Ga0068855_100245073 3300005563 Bacteria 2000
123 Ga0070664_100000010 3300005564 Bacteria 165664
124 Ga0070664_100050800 3300005564 Bacteria 3510
125 Ga0070664_100051488 3300005564 Bacteria 3487
126 Ga0068857_100036269 3300005577 Bacteria 4369
127 Ga0068854_100000017 3300005578 Bacteria 142796
128 Ga0068854_100002811 3300005578 Bacteria 10820
129 Ga0068856_100000069 3300005614 Bacteria 95628
130 Ga0068852_100034306 3300005616 Bacteria 4220
131 Ga0068852_100200450 3300005616 Bacteria 1888
132 Ga0068852_100385353 3300005616 Bacteria 1376
133 Ga0068851_10064492 3300005834 Bacteria 1883
134 Ga0075363_100119461 3300006048 Bacteria 1471
135 Ga0075364_10001331 3300006051 Bacteria 13297
136 Ga0075364_10001778 3300006051 Bacteria 11926
137 Ga0075432_10000580 3300006058 Bacteria 11042
138 Ga0075432_10000757 3300006058 Bacteria 10035
139 Ga0075432_10015678 3300006058 Bacteria 2585
140 Ga0075432_10063717 3300006058 Bacteria 1316
141 Ga0070712_100003321 3300006175 Bacteria 9891
142 Ga0075362_10001714 3300006177 Bacteria 7108
143 Ga0075369_10044618 3300006186 Bacteria 1905
144 Ga0075370_10001452 3300006353 Bacteria 10291
145 Ga0075370_10017786 3300006353 Bacteria 3845
146 Ga0075370_10028586 3300006353 Bacteria 3100
147 Ga0075370_10061894 3300006353 Bacteria 2132
148 Ga0068865_100388775 3300006881 Bacteria 1140
149 Ga0079104_1000001 3300006946 Bacteria 521847
150 Ga0079104_1000276 3300006946 Bacteria 66810
151 Ga0105251_10002438 3300009011 Bacteria 14633
152 Ga0105251_10024172 3300009011 Bacteria 3123
153 Ga0105251_10040737 3300009011 Bacteria 2264
154 Ga0105251_10115783 3300009011 Bacteria 1219
155 Ga0105244_10000775 3300009036 Bacteria 27296
156 Ga0105244_10001886 3300009036 Bacteria 16292
157 Ga0105244_10041540 3300009036 Bacteria 2382
158 Ga0105244_10056822 3300009036 Bacteria 1979
159 Ga0105244_10178129 3300009036 Bacteria 1009
160 Ga0105250_10002637 3300009092 Bacteria 8909
161 Ga0105250_10014086 3300009092 Bacteria 3291
162 Ga0105240_10000497 3300009093 Bacteria 72381
163 Ga0105240_10031065 3300009093 Bacteria 6931
164 Ga0105240_10129678 3300009093 Bacteria 3026
165 Ga0105240_10653354 3300009093 Bacteria 1152
166 Ga0105243_10000588 3300009148 Bacteria 36466
167 Ga0105243_10012543 3300009148 Bacteria 6409
168 Ga0105243_10063016 3300009148 Bacteria 2970
169 Ga0105243_10131262 3300009148 Bacteria 2125
170 Ga0105243_10337434 3300009148 Bacteria 1379
171 Ga0105237_10003695 3300009545 Bacteria 18037
172 Ga0105237_10417715 3300009545 Bacteria 1347
173 Ga0105238_10000117 3300009551 Bacteria 89001
174 Ga0105238_10049693 3300009551 Bacteria 4223
175 Ga0105238_10244084 3300009551 Bacteria 1774
176 Ga0105249_10138083 3300009553 Bacteria 2335
177 Ga0105249_10453187 3300009553 Bacteria 1322
178 Ga0105239_10091600 3300010375 Bacteria 3355
179 Ga0105246_10118211 3300011119 Bacteria 1960
180 Ga0157339_1003179 3300012505 Bacteria 1169
181 Ga0157373_10014005 3300013100 Bacteria 5879
182 Ga0157373_10022728 3300013100 Bacteria 4548
183 Ga0157373_10033887 3300013100 Bacteria 3669
184 Ga0157373_10050217 3300013100 Bacteria 2971
185 Ga0157371_10000033 3300013102 Bacteria 225328
186 Ga0157371_10002234 3300013102 Bacteria 18717
187 Ga0157371_10003692 3300013102 Bacteria 13743
188 Ga0157371_10006955 3300013102 Bacteria 9215
189 Ga0157371_10020177 3300013102 Bacteria 4905
190 Ga0157370_10000010 3300013104 Bacteria 218199
191 Ga0157370_10000055 3300013104 Bacteria 118355
192 Ga0157370_10000372 3300013104 Bacteria 56499
193 Ga0157370_10015682 3300013104 Bacteria 7696
194 Ga0157370_10015692 3300013104 Bacteria 7694
195 Ga0157370_10270775 3300013104 Bacteria 1569
196 Ga0157369_10000093 3300013105 Bacteria 122566
197 Ga0157369_10000665 3300013105 Bacteria 44336
198 Ga0157369_10015219 3300013105 Bacteria 8683
199 Ga0157369_10061241 3300013105 Bacteria 4058
200 Ga0157369_10238705 3300013105 Bacteria 1899
201 Ga0157378_10441404 3300013297 Bacteria 1290
202 Ga0163162_10002312 3300013306 Bacteria 17879
203 Ga0163162_10108037 3300013306 Bacteria 2878
204 Ga0157372_10001138 3300013307 Bacteria 28923
205 Ga0157372_10639833 3300013307 Bacteria 1239
206 Ga0182008_10000494 3300014497 Bacteria 29731
207 Ga0182008_10004710 3300014497 Bacteria 7912
208 Ga0182008_10007370 3300014497 Bacteria 6080
209 Ga0182008_10024459 3300014497 Bacteria 3075
210 Ga0182008_10025372 3300014497 Bacteria 3010
211 Ga0182008_10097064 3300014497 Bacteria 1455
212 Ga0157379_10345012 3300014968 Bacteria 1362
213 Ga0182006_1001948 3300015261 Bacteria 11716
214 Ga0182006_1005485 3300015261 Bacteria 6041
215 Ga0182006_1006078 3300015261 Bacteria 5646
216 Ga0182006_1007977 3300015261 Bacteria 4812
217 Ga0182006_1015536 3300015261 Bacteria 3263
218 Ga0182006_1015571 3300015261 Bacteria 3258
219 Ga0182006_1019964 3300015261 Bacteria 2813
220 Ga0182006_1029274 3300015261 Bacteria 2232
221 Ga0182006_1075071 3300015261 Bacteria 1245
222 Ga0182007_10001204 3300015262 Bacteria 14045
223 Ga0182007_10003889 3300015262 Bacteria 6925
224 Ga0182007_10011950 3300015262 Bacteria 3355
225 Ga0182005_1000351 3300015265 Bacteria 26159
226 Ga0183362_10001 3300015683 Bacteria 2046624
227 Ga0163161_10000060 3300017792 Bacteria 112916
228 Ga0163161_10041431 3300017792 Bacteria 3309
229 Ga0163161_10053743 3300017792 Bacteria 2921
230 Ga0163161_10059503 3300017792 Bacteria 2778
231 Ga0163161_10293593 3300017792 Bacteria 1278
232 Ga0206351_10970006 3300020077 Bacteria 8596
233 Ga0206350_11606970 3300020080 Bacteria 1085
234 Ga0206353_10422469 3300020082 Bacteria 5620
235 Ga0154015_1175498 3300020610 Bacteria 9266
236 Ga0213872_10002036 3300021361 Bacteria 12286
237 Ga0213872_10009541 3300021361 Bacteria 4653
238 Ga0213872_10013428 3300021361 Bacteria 3837
239 Ga0213872_10028339 3300021361 Bacteria 2568
240 Ga0224712_10000006 3300022467 Bacteria 30817
241 Ga0209435_100016 3300025206 Bacteria 305566
242 Ga0209435_104520 3300025206 Bacteria 1572
243 Ga0209760_101527 3300025207 Bacteria 2400
244 Ga0209436_101334 3300025208 Bacteria 8739
245 Ga0209436_103436 3300025208 Bacteria 4216
246 Ga0209784_100008 3300025224 Bacteria 740293
247 Ga0209784_100019 3300025224 Bacteria 453558
248 Ga0209784_100281 3300025224 Bacteria 28775
249 Ga0209784_100461 3300025224 Bacteria 17042
250 Ga0209784_100809 3300025224 Bacteria 7208
251 Ga0209566_100006 3300025225 Bacteria 789272
252 Ga0209566_100017 3300025225 Bacteria 453558
253 Ga0209566_100473 3300025225 Bacteria 28775
254 Ga0209566_100805 3300025225 Bacteria 16357
255 Ga0209566_100952 3300025225 Bacteria 13060
256 Ga0209674_100031 3300025226 Bacteria 453558
257 Ga0209674_100045 3300025226 Bacteria 362387
258 Ga0209674_100114 3300025226 Bacteria 139197
259 Ga0209674_100330 3300025226 Bacteria 28775
260 Ga0209672_102145 3300025228 Bacteria 5230
261 Ga0209147_100005 3300025229 Bacteria 1036530
262 Ga0209147_100023 3300025229 Bacteria 437803
263 Ga0209147_100769 3300025229 Bacteria 15688
264 Ga0209563_100016 3300025230 Bacteria 802091
265 Ga0209563_100035 3300025230 Bacteria 453558
266 Ga0209563_100218 3300025230 Bacteria 28775
267 Ga0209563_105701 3300025230 Bacteria 2224
268 Ga0207427_100639 3300025231 Bacteria 16992
269 Ga0209437_100038 3300025233 Bacteria 453558
270 Ga0209437_100080 3300025233 Bacteria 275402
271 Ga0209258_100007 3300025242 Bacteria 1036530
272 Ga0209258_100022 3300025242 Bacteria 553584
273 Ga0209258_100210 3300025242 Bacteria 117131
274 Ga0207425_1000180 3300025245 Bacteria 52117
275 Ga0207425_1032436 3300025245 Bacteria 1034
276 Ga0209646_1000027 3300025246 Bacteria 395141
277 Ga0209646_1000033 3300025246 Bacteria 369507
278 Ga0209646_1000200 3300025246 Bacteria 71297
279 Ga0209026_1000031 3300025250 Bacteria 325747
280 Ga0209026_1002370 3300025250 Bacteria 7128
281 Ga0209026_1009929 3300025250 Bacteria 1819
282 Ga0209677_100008 3300025253 Bacteria 802091
283 Ga0209677_100020 3300025253 Bacteria 453558
284 Ga0209677_100350 3300025253 Bacteria 28775
285 Ga0209677_107624 3300025253 Bacteria 2258
286 Ga0209148_1000019 3300025254 Bacteria 748518
287 Ga0209148_1000034 3300025254 Bacteria 553584
288 Ga0209759_1000045 3300025256 Bacteria 235654
289 Ga0209759_1002029 3300025256 Bacteria 9571
290 Ga0209759_1007962 3300025256 Bacteria 3350
291 Ga0209129_1000111 3300025258 Bacteria 148853
292 Ga0209129_1001197 3300025258 Bacteria 14948
293 Ga0209233_1000049 3300025261 Bacteria 453558
294 Ga0209565_1000110 3300025263 Bacteria 119879
295 Ga0209565_1001804 3300025263 Bacteria 8626
296 Ga0209455_1000011 3300025272 Bacteria 947242
297 Ga0209455_1007159 3300025272 Bacteria 3186
298 Ga0209673_1000175 3300025273 Bacteria 131239
299 Ga0209673_1000944 3300025273 Bacteria 36333
300 Ga0209673_1000992 3300025273 Bacteria 34667
301 Ga0209673_1001347 3300025273 Bacteria 24544
302 Ga0209130_1000205 3300025284 Bacteria 79260
303 Ga0209130_1000332 3300025284 Bacteria 54263
304 Ga0209675_1000192 3300025291 Bacteria 66905
305 Ga0209675_1003468 3300025291 Bacteria 7476
306 Ga0209675_1009747 3300025291 Bacteria 3358
307 Ga0209675_1017748 3300025291 Bacteria 2021
308 Ga0209676_1000005 3300025292 Bacteria 1076001
309 Ga0209676_1000356 3300025292 Bacteria 86657
310 Ga0209676_1003888 3300025292 Bacteria 8709
311 Ga0209676_1044656 3300025292 Bacteria 1213
312 Ga0209025_1000096 3300025294 Bacteria 239153
313 Ga0209025_1000116 3300025294 Bacteria 218293
314 Ga0209025_1027245 3300025294 Bacteria 2839
315 Ga0209564_1000155 3300025295 Bacteria 165859
316 Ga0209564_1000298 3300025295 Bacteria 99805
317 Ga0209758_1000107 3300025297 Bacteria 218293
318 Ga0209758_1009267 3300025297 Bacteria 6160
319 Ga0209050_1000007 3300025298 Bacteria 1187891
320 Ga0209050_1000155 3300025298 Bacteria 159095
321 Ga0209050_1000575 3300025298 Bacteria 59696
322 Ga0209050_1003630 3300025298 Bacteria 11172
323 Ga0209050_1022292 3300025298 Bacteria 2272
324 Ga0209256_1000015 3300025299 Bacteria 622953
325 Ga0209256_1000038 3300025299 Bacteria 375225
326 Ga0209256_1000087 3300025299 Bacteria 218290
327 Ga0207426_1000090 3300025302 Bacteria 280662
328 Ga0207426_1000123 3300025302 Bacteria 218290
329 Ga0207426_1001768 3300025302 Bacteria 16308
330 Ga0207426_1032945 3300025302 Bacteria 1675
331 Ga0209051_1000009 3300025303 Bacteria 706778
332 Ga0209051_1000073 3300025303 Bacteria 208874
333 Ga0209051_1000092 3300025303 Bacteria 170056
334 Ga0209051_1000598 3300025303 Bacteria 42554
335 Ga0209051_1001817 3300025303 Bacteria 16890
336 Ga0209051_1005786 3300025303 Bacteria 7118
337 Ga0209257_1000011 3300025304 Bacteria 1112630
338 Ga0209257_1000139 3300025304 Bacteria 202285
339 Ga0209257_1000576 3300025304 Bacteria 61751
340 Ga0209257_1000870 3300025304 Bacteria 42856
341 Ga0207656_10010379 3300025321 Bacteria 3488
342 Ga0207696_1008369 3300025711 Bacteria 3967
343 Ga0207696_1024868 3300025711 Bacteria 1873
344 Ga0207655_1002169 3300025728 Bacteria 16356
345 Ga0207655_1002182 3300025728 Bacteria 16254
346 Ga0207655_1033787 3300025728 Bacteria 2312
347 Ga0207713_1006007 3300025735 Bacteria 7485
348 Ga0207713_1009327 3300025735 Bacteria 5542
349 Ga0207713_1024270 3300025735 Bacteria 2831
350 Ga0207645_10163938 3300025907 Bacteria 1455
351 Ga0207705_10002977 3300025909 Bacteria 12937
352 Ga0207695_10001142 3300025913 Bacteria 46029
353 Ga0207695_10012413 3300025913 Bacteria 10229
354 Ga0207671_10007218 3300025914 Bacteria 9678
355 Ga0207693_10012704 3300025915 Bacteria 6801
356 Ga0207657_10177300 3300025919 Bacteria 1724
357 Ga0207649_10000463 3300025920 Bacteria 29184
358 Ga0207649_10001113 3300025920 Bacteria 16303
359 Ga0207649_10124093 3300025920 Bacteria 1745
360 Ga0207681_10014629 3300025923 Bacteria 4883
361 Ga0207694_10000103 3300025924 Bacteria 92553
362 Ga0207694_10169094 3300025924 Bacteria 1769
363 Ga0207694_10256178 3300025924 Bacteria 1433
364 Ga0207659_10250138 3300025926 Bacteria 1438
365 Ga0207690_10004528 3300025932 Bacteria 8209
366 Ga0207690_10036454 3300025932 Bacteria 3185
367 Ga0207690_10358862 3300025932 Bacteria 1154
368 Ga0207706_10019491 3300025933 Bacteria 6103
369 Ga0207706_10078135 3300025933 Bacteria 2911
370 Ga0207709_10000353 3300025935 Bacteria 46902
371 Ga0207709_10001645 3300025935 Bacteria 15124
372 Ga0207709_10036454 3300025935 Bacteria 2914
373 Ga0207709_10060254 3300025935 Bacteria 2366
374 Ga0207709_10121767 3300025935 Bacteria 1762
375 Ga0207704_10548860 3300025938 Bacteria 939
376 Ga0207691_10199935 3300025940 Bacteria 1740
377 Ga0207711_10014842 3300025941 Bacteria 6472
378 Ga0207689_10246475 3300025942 Bacteria 1477
379 Ga0207679_10000002 3300025945 Bacteria 634491
380 Ga0207679_10000533 3300025945 Bacteria 25744
381 Ga0207679_10180827 3300025945 Bacteria 1744
382 Ga0207667_10000073 3300025949 Bacteria 174391
383 Ga0207667_10000076 3300025949 Bacteria 166704
384 Ga0207667_10000147 3300025949 Bacteria 106918
385 Ga0207667_10000166 3300025949 Bacteria 97376
386 Ga0207667_10001488 3300025949 Bacteria 29411
387 Ga0207667_10126447 3300025949 Bacteria 2633
388 Ga0207667_10582762 3300025949 Bacteria 1129
389 Ga0207712_10082844 3300025961 Bacteria 2339
390 Ga0207640_10003888 3300025981 Bacteria 8063
391 Ga0207658_10082854 3300025986 Bacteria 2464
392 Ga0207658_10330294 3300025986 Bacteria 1322
393 Ga0207677_10143188 3300026023 Bacteria 1833
394 Ga0207703_10046150 3300026035 Bacteria 3508
395 Ga0207639_10205885 3300026041 Bacteria 1690
396 Ga0207639_10655920 3300026041 Bacteria 971
397 Ga0207678_10000015 3300026067 Bacteria 138937
398 Ga0207702_10000053 3300026078 Bacteria 137538
399 Ga0207648_10083787 3300026089 Bacteria 2781
400 Ga0207648_10169854 3300026089 Bacteria 1927
401 Ga0207683_10031804 3300026121 Bacteria 4581
402 Ga0207683_10074997 3300026121 Bacteria 2994
403 Ga0207683_10472411 3300026121 Bacteria 1157
404 Ga0207698_10090797 3300026142 Bacteria 2499
405 Ga0209281_1000055 3300027111 Bacteria 308297
406 Ga0209281_1000057 3300027111 Bacteria 307145
407 Ga0209983_1001261 3300027665 Bacteria 5626
408 Ga0209971_1001963 3300027682 Bacteria 5014
409 Ga0209971_1032372 3300027682 Bacteria 1255
410 Ga0207428_10005518 3300027907 Bacteria 11784
411 Ga0207428_10056681 3300027907 Bacteria 3112
412 Ga0207428_10081256 3300027907 Bacteria 2531
413 Ga0268266_10282896 3300028379 Bacteria 1543
414 Ga0265334_10035702 3300028573 Bacteria 1966
415 Ga0307515_10000028 3300028794 Bacteria 368467
416 Ga0307515_10000109 3300028794 Bacteria 195895
417 Ga0307515_10010767 3300028794 Bacteria 17455
418 Ga0307515_10018244 3300028794 Bacteria 12726
419 Ga0307515_10030494 3300028794 Bacteria 9051
420 Ga0307515_10133994 3300028794 Bacteria 2707
421 Ga0307515_10229916 3300028794 Bacteria 1650
422 Ga0307512_10013840 3300030522 Bacteria 7539
423 Ga0316177_1124424 3300030731 Bacteria 4941
424 Ga0316176_1202515 3300030732 Bacteria 3104
425 Ga0314311_1048379 3300030733 Bacteria 2959
426 Ga0316180_1154980 3300030736 Bacteria 1450
427 Ga0316183_1077578 3300030742 Bacteria 7591
428 Ga0316181_1010717 3300030744 Bacteria 1638
429 Ga0265330_10000059 3300031235 Bacteria 97975
430 Ga0265332_10000002 3300031238 Bacteria 709510
431 Ga0265325_10009004 3300031241 Bacteria 5860
432 Ga0265327_10000842 3300031251 Bacteria 45767
433 Ga0265327_10003824 3300031251 Bacteria 13916
434 Ga0307513_10000990 3300031456 Bacteria 41065
435 Ga0307513_10021840 3300031456 Bacteria 7544
436 Ga0307513_10039886 3300031456 Bacteria 5199
437 Ga0307513_10064222 3300031456 Bacteria 3870
438 Ga0307513_10175158 3300031456 Bacteria 2017
439 Ga0307513_10259306 3300031456 Bacteria 1529
440 Ga0307509_10085885 3300031507 Bacteria 3237
441 Ga0307408_100030750 3300031548 Bacteria 3731
442 Ga0307408_100193231 3300031548 Bacteria 1641
443 Ga0307508_10000101 3300031616 Bacteria 100858
444 Ga0307514_10000225 3300031649 Bacteria 151002
445 Ga0307514_10006401 3300031649 Bacteria 10269
446 Ga0307514_10008985 3300031649 Bacteria 8442
447 Ga0265314_10000012 3300031711 Bacteria 415184
448 Ga0316576_10208691 3300031727 Bacteria 1470
449 Ga0316576_10337668 3300031727 Bacteria 1122
450 Ga0316578_10177242 3300031728 Bacteria 1285
451 Ga0316578_10209631 3300031728 Bacteria 1172
452 Ga0307516_10011288 3300031730 Bacteria 9730
453 Ga0307405_10191829 3300031731 Bacteria 1476
454 Ga0307406_10001953 3300031901 Bacteria 11263
455 Ga0307407_10282677 3300031903 Bacteria 1150
456 Ga0307412_10031599 3300031911 Bacteria 3345
457 Ga0307416_100025521 3300032002 Bacteria 4333
458 Ga0307416_100088997 3300032002 Bacteria 2642
459 Ga0307414_10022867 3300032004 Bacteria 3952
460 Ga0316574_0011223 3300035398 Bacteria 5087
461 Ga0316584_0043873 3300036712 Bacteria 3335
462 Ga0395899_0000023 3300037312 Bacteria 367159
463 Ga0395899_0033546 3300037312 Bacteria 3855
464 Ga0395900_0000019 3300037418 Bacteria 357240
465 Ga0395900_0000146 3300037418 Bacteria 118779
466 Ga0395900_0008274 3300037418 Bacteria 10704
467 Ga0395900_0044793 3300037418 Bacteria 4558
468 Ga0395900_0046317 3300037418 Bacteria 4477
469 Ga0395898_0000016 3300037466 Bacteria 435585
470 Ga0395898_0000617 3300037466 Bacteria 65254
471 Ga0395898_0070883 3300037466 Bacteria 3368
472 Ga0395901_0000004 3300038443 Bacteria 657361
473 Ga0395901_0000326 3300038443 Bacteria 58686
474 Ga0395901_0002868 3300038443 Bacteria 17405
475 Ga0436361_0106476 3300039447 Bacteria 19218
476 Ga0436361_0272349 3300039447 Bacteria 22942
477 Ga0436361_0325069 3300039447 Bacteria 7873
478 Ga0436361_1051926 3300039447 Bacteria 23370
479 Ga0436361_1073848 3300039447 Bacteria 2843
480 Ga0436361_1080802 3300039447 Bacteria 4291
481 Ga0439436_0000305 3300041404 Bacteria 11948
482 Ga0439436_0000469 3300041404 Bacteria 10388
483 Ga0439438_004004 3300041405 Bacteria 5786
484 Ga0439438_018382 3300041405 Bacteria 1992
485 Ga0439439_0030749 3300041406 Bacteria 1366
486 Ga0439447_000006 3300041407 Bacteria 101894
487 Ga0439447_000080 3300041407 Bacteria 34054
488 Ga0439447_000235 3300041407 Bacteria 19642
489 Ga0439447_000632 3300041407 Bacteria 13107
490 Ga0439447_000765 3300041407 Bacteria 11888
491 Ga0439466_0001045 3300041411 Bacteria 10692
492 Ga0439466_0003209 3300041411 Bacteria 6369
493 Ga0439466_0004351 3300041411 Bacteria 5462
494 Ga0439466_0006387 3300041411 Bacteria 4483
495 Ga0439465_0004405 3300041413 Bacteria 4554
496 Ga0439465_0055628 3300041413 Bacteria 1303
497 Ga0451800_1156584 3300041459 Bacteria 1381
498 Ga0451853_2167458 3300041512 Bacteria 1427
499 Ga0439433_0000296 3300041999 Bacteria 8605
500 Ga0439445_0000826 3300042004 Bacteria 6542
501 Ga0439445_0008083 3300042004 Bacteria 2455
502 Ga0439432_002294 3300042006 Bacteria 7213
503 Ga0439432_002407 3300042006 Bacteria 7059
504 Ga0439432_014129 3300042006 Bacteria 2704
505 Ga0439432_035764 3300042006 Bacteria 1591
506 Ga0439449_0000061 3300042007 Bacteria 33240
507 Ga0439452_000408 3300042010 Bacteria 25266
508 Ga0439452_000448 3300042010 Bacteria 23342
509 Ga0439452_000685 3300042010 Bacteria 16684
510 Ga0439452_002094 3300042010 Bacteria 7561
511 Ga0439452_035096 3300042010 Bacteria 1208
512 Ga0439456_000828 3300042013 Bacteria 6271
513 Ga0439457_002853 3300042014 Bacteria 4825
514 Ga0439462_0001960 3300042015 Bacteria 4707
515 Ga0450911_000368 3300042115 Bacteria 15027
516 Ga0450911_006679 3300042115 Bacteria 1706
517 Ga0450919_002935 3300042121 Bacteria 2180
518 Ga0450919_006455 3300042121 Bacteria 1387
519 Ga0450920_000143 3300042122 Bacteria 9984
520 Ga0450922_000379 3300042124 Bacteria 4780
521 Ga0450902_001332 3300042137 Bacteria 3336
522 Ga0450902_016417 3300042137 Bacteria 1207
523 Ga0450903_002119 3300042138 Bacteria 3562
524 Ga0450903_003370 3300042138 Bacteria 2770
525 Ga0450903_004901 3300042138 Bacteria 2258
526 Ga0450906_005913 3300042145 Bacteria 2492
527 Ga0450907_000703 3300042146 Bacteria 8615
528 Ga0450907_001150 3300042146 Bacteria 5984
529 Ga0450910_002081 3300042147 Bacteria 2603
530 Ga0450910_010942 3300042147 Bacteria 1298
531 Ga0439446_0000601 3300042156 Bacteria 7388
532 Ga0439446_0011883 3300042156 Bacteria 2371
533 Ga0450908_002647 3300042184 Bacteria 3511
534 Ga0439434_0000957 3300042435 Bacteria 8317
535 Ga0439434_0001034 3300042435 Bacteria 8059
536 Ga0439434_0007289 3300042435 Bacteria 3241
537 Ga0439460_0000208 3300042461 Bacteria 11639
538 Ga0451577_0060171 3300042876 Bacteria 3386
539 Ga0466986_0107857 3300044650 Bacteria 1915
540 Ga0466969_0039905 3300044656 Bacteria 2355
541 Ga0466972_0040999 3300044658 Bacteria 2254
542 Ga0466965_0014038 3300044683 Bacteria 3787
543 Ga0466966_0000009 3300044684 Bacteria 150954
544 Ga0466966_0003478 3300044684 Bacteria 10377
545 Ga0466961_0000077 3300044693 Bacteria 60661
546 Ga0466961_0000143 3300044693 Bacteria 48172
547 Ga0466961_0026460 3300044693 Bacteria 3729
548 Ga0466963_0005514 3300044694 Bacteria 7407
549 Ga0466964_0025728 3300044706 Bacteria 2300
550 Ga0466971_0014751 3300044719 Bacteria 3439
551 Ga0466971_0018637 3300044719 Bacteria 3076
552 Ga0466968_0028543 3300044735 Bacteria 2301
553 Ga0466968_0076108 3300044735 Bacteria 1468
554 Ga0466970_0004578 3300044765 Bacteria 6824
555 Ga0466957_0017713 3300044842 Bacteria 4177
556 Ga0466959_0009963 3300045049 Bacteria 6773
557 Ga0466959_0014577 3300045049 Bacteria 5718
558 Ga0495617_000188 3300046452 Bacteria 39074
559 Ga0495617_049911 3300046452 Bacteria 1392
560 Ga0495627_000426 3300046453 Bacteria 36618
561 Ga0495603_0002299 3300046455 Bacteria 11218
562 Ga0495603_0011470 3300046455 Bacteria 5364
563 Ga0495603_0015411 3300046455 Bacteria 4624
564 Ga0495603_0028632 3300046455 Bacteria 3361
565 Ga0495590_0000074 3300046457 Bacteria 69286
566 Ga0495590_0002718 3300046457 Bacteria 7308
567 Ga0495590_0021643 3300046457 Bacteria 2277
568 Ga0495590_0057690 3300046457 Bacteria 1357
569 Ga0495591_000951 3300046458 Bacteria 19801
570 Ga0495591_001372 3300046458 Bacteria 15253
571 Ga0495591_001663 3300046458 Bacteria 13391
572 Ga0495591_003339 3300046458 Bacteria 8341
573 Ga0495591_008688 3300046458 Bacteria 4132
574 Ga0495591_031829 3300046458 Bacteria 1578
575 Ga0495629_0000837 3300046459 Bacteria 24977
576 Ga0495629_0002001 3300046459 Bacteria 15835
577 Ga0495629_0003794 3300046459 Bacteria 11387
578 Ga0495629_0046455 3300046459 Bacteria 3045
579 Ga0495638_0002170 3300046460 Bacteria 16458
580 Ga0495638_0003829 3300046460 Bacteria 11677
581 Ga0495638_0019240 3300046460 Bacteria 4519
582 Ga0495638_0070278 3300046460 Bacteria 2143
583 Ga0495638_0108574 3300046460 Bacteria 1650
584 Ga0495638_0164490 3300046460 Bacteria 1277
585 Ga0495638_0208018 3300046460 Bacteria 1100
586 Ga0495641_0015039 3300046461 Bacteria 4158
587 Ga0495651_0023682 3300046462 Bacteria 4774
588 Ga0495651_0031030 3300046462 Bacteria 4169
589 Ga0495651_0130342 3300046462 Bacteria 1836
590 Ga0495653_0005124 3300046463 Bacteria 10636
591 Ga0495653_0012630 3300046463 Bacteria 6898
592 Ga0495653_0040848 3300046463 Bacteria 3623
593 Ga0495653_0103603 3300046463 Bacteria 2057
594 Ga0495653_0110361 3300046463 Bacteria 1977
595 Ga0495653_0111753 3300046463 Bacteria 1962
596 Ga0495653_0138584 3300046463 Bacteria 1714
597 Ga0495650_0001121 3300046471 Bacteria 29246
598 Ga0495650_0024249 3300046471 Bacteria 2867
599 Ga0495650_0060269 3300046471 Bacteria 1525
600 Ga0495650_0072990 3300046471 Bacteria 1341
601 Ga0495580_0000062 3300046472 Bacteria 63605
602 Ga0495580_0000269 3300046472 Bacteria 41829
603 Ga0495580_0007455 3300046472 Bacteria 8793
604 Ga0495582_0310259 3300046473 Bacteria 907
605 Ga0495605_0001196 3300046474 Bacteria 17290
606 Ga0495605_0002710 3300046474 Bacteria 10822
607 Ga0495605_0008024 3300046474 Bacteria 5977
608 Ga0495605_0014664 3300046474 Bacteria 4283
609 Ga0495605_0156509 3300046474 Bacteria 1013
610 Ga0495639_0019038 3300046475 Bacteria 2994
611 Ga0495639_0086531 3300046475 Bacteria 1466
612 Ga0495662_0072192 3300046476 Bacteria 1673
613 Ga0495664_0036492 3300046477 Bacteria 2897
614 Ga0495584_0000928 3300046491 Bacteria 18571
615 Ga0495584_0011136 3300046491 Bacteria 4610
616 Ga0495584_0021779 3300046491 Bacteria 3254
617 Ga0495584_0035830 3300046491 Bacteria 2507
618 Ga0495585_0000626 3300046492 Bacteria 32752
619 Ga0495585_0003853 3300046492 Bacteria 9967
620 Ga0495585_0028645 3300046492 Bacteria 3175
621 Ga0495594_0007964 3300046499 Bacteria 5447
622 Ga0495596_0001577 3300046500 Bacteria 13001
623 Ga0495596_0016914 3300046500 Bacteria 3026
624 Ga0495596_0070562 3300046500 Bacteria 1357
625 Ga0495607_0006252 3300046501 Bacteria 8400
626 Ga0495607_0019474 3300046501 Bacteria 4311
627 Ga0495607_0020158 3300046501 Bacteria 4219
628 Ga0495607_0035206 3300046501 Bacteria 3030
629 Ga0495583_0000172 3300046506 Bacteria 109791
630 Ga0495606_0000859 3300046507 Bacteria 45541
631 Ga0495606_0001889 3300046507 Bacteria 26207
632 Ga0495606_0002982 3300046507 Bacteria 18610
633 Ga0495606_0006443 3300046507 Bacteria 10823
634 Ga0495608_0002271 3300046511 Bacteria 13872
635 Ga0495608_0002682 3300046511 Bacteria 12786
636 Ga0495610_0003096 3300046512 Bacteria 13267
637 Ga0495610_0015345 3300046512 Bacteria 4456
638 Ga0495610_0036339 3300046512 Bacteria 2518
639 Ga0495610_0041273 3300046512 Bacteria 2318
640 Ga0495616_0000323 3300046513 Bacteria 38118
641 Ga0495616_0001007 3300046513 Bacteria 20154
642 Ga0495616_0060631 3300046513 Bacteria 1857
643 Ga0495618_0003996 3300046514 Bacteria 9094
644 Ga0495618_0125635 3300046514 Bacteria 1643
645 Ga0495628_0024205 3300046516 Bacteria 4971
646 Ga0495628_0024253 3300046516 Bacteria 4967
647 Ga0495628_0065924 3300046516 Bacteria 2831
648 Ga0495628_0148574 3300046516 Bacteria 1785
649 Ga0495628_0149659 3300046516 Bacteria 1779
650 Ga0495630_0014914 3300046517 Bacteria 5666
651 Ga0495630_0034549 3300046517 Bacteria 3776
652 Ga0495630_0042479 3300046517 Bacteria 3395
653 Ga0495630_0049412 3300046517 Bacteria 3148
654 Ga0495630_0195895 3300046517 Bacteria 1541
655 Ga0495631_0000196 3300046518 Bacteria 41587
656 Ga0495631_0000455 3300046518 Bacteria 27845
657 Ga0495631_0002595 3300046518 Bacteria 10109
658 Ga0495632_0000617 3300046519 Bacteria 32894
659 Ga0495632_0032129 3300046519 Bacteria 2707
660 Ga0495632_0032293 3300046519 Bacteria 2698
661 Ga0495632_0040974 3300046519 Bacteria 2329
662 Ga0495637_0084932 3300046520 Bacteria 1256
663 Ga0495643_0000095 3300046522 Bacteria 148901
664 Ga0495643_0000532 3300046522 Bacteria 47478
665 Ga0495643_0002524 3300046522 Bacteria 14366
666 Ga0495643_0008892 3300046522 Bacteria 6312
667 Ga0495643_0023529 3300046522 Bacteria 3502
668 Ga0495643_0027714 3300046522 Bacteria 3181
669 Ga0495643_0058840 3300046522 Bacteria 2044
670 Ga0495644_0000008 3300046523 Bacteria 109929
671 Ga0495644_0000032 3300046523 Bacteria 65821
672 Ga0495644_0001957 3300046523 Bacteria 8273
673 Ga0495648_0000678 3300046524 Bacteria 36351
674 Ga0495648_0000886 3300046524 Bacteria 31443
675 Ga0495648_0001712 3300046524 Bacteria 21190
676 Ga0495648_0012148 3300046524 Bacteria 6442
677 Ga0495648_0018328 3300046524 Bacteria 4961
678 Ga0495648_0034287 3300046524 Bacteria 3305
679 Ga0495648_0047210 3300046524 Bacteria 2663
680 Ga0495648_0112967 3300046524 Bacteria 1474
681 Ga0495663_0014116 3300046525 Bacteria 2237
682 Ga0495666_0000497 3300046526 Bacteria 17494
683 Ga0495666_0003130 3300046526 Bacteria 8317
684 Ga0495666_0008007 3300046526 Bacteria 5293
685 Ga0495666_0038876 3300046526 Bacteria 2312
686 Ga0495642_0000008 3300046528 Bacteria 162190
687 Ga0495642_0000059 3300046528 Bacteria 66129
688 Ga0495652_0005080 3300046529 Bacteria 12452
689 Ga0495652_0008766 3300046529 Bacteria 9205
690 Ga0495652_0028025 3300046529 Bacteria 4960
691 Ga0495652_0159642 3300046529 Bacteria 1752
692 Ga0495652_0175814 3300046529 Bacteria 1648
693 Ga0495652_0226906 3300046529 Bacteria 1399
694 Ga0495654_0028655 3300046530 Bacteria 2845
695 Ga0495654_0032458 3300046530 Bacteria 2647
696 Ga0495654_0033073 3300046530 Bacteria 2618
697 Ga0495654_0042135 3300046530 Bacteria 2268
698 Ga0495665_0001953 3300046531 Bacteria 11125
699 Ga0495665_0002510 3300046531 Bacteria 9908
700 Ga0495665_0037769 3300046531 Bacteria 2576
701 Ga0495665_0166156 3300046531 Bacteria 1149
702 Ga0495640_0002419 3300046533 Bacteria 14983
703 Ga0495640_0121404 3300046533 Bacteria 1698
704 Ga0495586_0036587 3300046535 Bacteria 2635
705 Ga0495586_0119469 3300046535 Bacteria 1471
706 Ga0495587_0000102 3300046536 Bacteria 64693
707 Ga0495587_0081019 3300046536 Bacteria 1881
708 Ga0495609_0000677 3300046538 Bacteria 26312
709 Ga0495609_0063042 3300046538 Bacteria 1636
710 Ga0495621_0034517 3300046539 Bacteria 1748
711 Ga0495597_0000562 3300046542 Bacteria 30814
712 Ga0495597_0030975 3300046542 Bacteria 2435
713 Ga0495597_0101001 3300046542 Bacteria 1216
714 Ga0495645_0003620 3300046543 Bacteria 10489
715 Ga0495645_0058981 3300046543 Bacteria 2784
716 Ga0495645_0082041 3300046543 Bacteria 2313
717 Ga0495622_0000005 3300046557 Bacteria 254434
718 Ga0495622_0000205 3300046557 Bacteria 46745
719 Ga0495622_0004376 3300046557 Bacteria 6578
720 Ga0495633_0018257 3300046558 Bacteria 3566
721 Ga0495667_0013764 3300046559 Bacteria 5465
722 Ga0495656_0000060 3300046615 Bacteria 52471
723 Ga0495656_0019583 3300046615 Bacteria 2613
724 Ga0495656_0128322 3300046615 Bacteria 1204
725 Ga0495634_0000380 3300046642 Bacteria 43395
726 Ga0495634_0001826 3300046642 Bacteria 18400
727 Ga0495611_0004432 3300046648 Bacteria 6074
728 Ga0495611_0043444 3300046648 Bacteria 2009
729 Ga0495625_0000888 3300046660 Bacteria 40400
730 Ga0495625_0009629 3300046660 Bacteria 8059
731 Ga0495625_0150876 3300046660 Bacteria 1562
732 Ga0495635_0000921 3300046663 Bacteria 19357
733 Ga0495635_0018816 3300046663 Bacteria 4820
734 Ga0495635_0063054 3300046663 Bacteria 2545
735 Ga0495659_0002830 3300046664 Bacteria 5575
736 Ga0495661_0006996 3300046665 Bacteria 7887
737 Ga0495661_0009949 3300046665 Bacteria 6504
738 Ga0495661_0020583 3300046665 Bacteria 4305
739 Ga0495661_0047008 3300046665 Bacteria 2630
740 Ga0495661_0052194 3300046665 Bacteria 2464
741 Ga0495661_0070500 3300046665 Bacteria 2045
742 Ga0495588_0000485 3300046674 Bacteria 19722
743 Ga0495657_0013688 3300046675 Bacteria 5975
744 Ga0495657_0100308 3300046675 Bacteria 1846
745 Ga0495599_0004627 3300046678 Bacteria 8152
746 Ga0495599_0012745 3300046678 Bacteria 5186
747 Ga0495599_0024043 3300046678 Bacteria 3810
748 Ga0495599_0035407 3300046678 Bacteria 3134
749 Ga0495599_0162296 3300046678 Bacteria 1381
750 Ga0495623_0002336 3300046679 Bacteria 12643
751 Ga0495623_0022340 3300046679 Bacteria 4087
752 Ga0495646_0009968 3300046680 Bacteria 6040
753 Ga0495646_0013242 3300046680 Bacteria 5241
754 Ga0495646_0033595 3300046680 Bacteria 3189
755 Ga0495646_0034680 3300046680 Bacteria 3133
756 Ga0495646_0053677 3300046680 Bacteria 2428
757 Ga0495646_0062053 3300046680 Bacteria 2223
758 Ga0495646_0083312 3300046680 Bacteria 1859
759 Ga0495669_0000278 3300046684 Bacteria 29293
760 Ga0495669_0090314 3300046684 Bacteria 1413
761 Ga0495613_0007730 3300046689 Bacteria 7997
762 Ga0495613_0039429 3300046689 Bacteria 3502
763 Ga0495613_0050772 3300046689 Bacteria 3058
764 Ga0495624_0000817 3300046690 Bacteria 24613
765 Ga0495624_0015267 3300046690 Bacteria 5193
766 Ga0495624_0040718 3300046690 Bacteria 2975
767 Ga0495624_0129079 3300046690 Bacteria 1550
768 Ga0495624_0143416 3300046690 Bacteria 1462
769 Ga0495624_0221730 3300046690 Bacteria 1146
770 Ga0495670_0000519 3300046691 Bacteria 18194
771 Ga0495670_0004175 3300046691 Bacteria 7076
772 Ga0495670_0031554 3300046691 Bacteria 2633
773 Ga0495670_0141382 3300046691 Bacteria 1258
774 Ga0495671_0000536 3300046692 Bacteria 28671
775 Ga0495671_0003200 3300046692 Bacteria 10173
776 Ga0495671_0021990 3300046692 Bacteria 3344
777 Ga0495671_0037450 3300046692 Bacteria 2452
778 Ga0495671_0152346 3300046692 Bacteria 1125
779 Ga0495649_0001299 3300046694 Bacteria 19087
780 Ga0495649_0001695 3300046694 Bacteria 16312
781 Ga0495649_0002422 3300046694 Bacteria 13154
782 Ga0495649_0028016 3300046694 Bacteria 3123
783 Ga0495649_0056176 3300046694 Bacteria 2126
784 Ga0495589_0000214 3300046794 Bacteria 49214
785 Ga0495589_0002921 3300046794 Bacteria 9433
786 Ga0495589_0017112 3300046794 Bacteria 3723
787 Ga0495589_0036788 3300046794 Bacteria 2453
788 Ga0495589_0113425 3300046794 Bacteria 1307
789 Ga0495600_0000303 3300046809 Bacteria 26375
790 Ga0495600_0014053 3300046809 Bacteria 5041
791 Ga0495600_0050463 3300046809 Bacteria 2715
792 Ga0495660_0019398 3300046810 Bacteria 3903
793 Ga0495660_0046228 3300046810 Bacteria 2387
794 Ga0495660_0050087 3300046810 Bacteria 2277
795 Ga0495660_0107487 3300046810 Bacteria 1427
796 Ga0495581_0000974 3300047315 Bacteria 15397
797 Ga0495604_0023319 3300047317 Bacteria 4937
798 Ga0495604_0186498 3300047317 Bacteria 1448
799 Ga0495636_0034219 3300047318 Bacteria 2090
800 Ga0495674_0005269 3300047319 Bacteria 12396
801 Ga0495674_0006339 3300047319 Bacteria 11336
802 Ga0495674_0017847 3300047319 Bacteria 6608
803 Ga0495674_0036874 3300047319 Bacteria 4396
804 Ga0495674_0058724 3300047319 Bacteria 3361
805 Ga0495674_0070895 3300047319 Bacteria 3010
806 Ga0495674_0385602 3300047319 Bacteria 1133
807 Ga0495672_0000143 3300047320 Bacteria 105045
808 Ga0495672_0000496 3300047320 Bacteria 45517
809 Ga0495672_0000737 3300047320 Bacteria 35956
810 Ga0495672_0001053 3300047320 Bacteria 28162
811 Ga0495672_0003747 3300047320 Bacteria 12818
812 Ga0495672_0009789 3300047320 Bacteria 6901
813 Ga0495672_0012589 3300047320 Bacteria 5893
814 Ga0495672_0026526 3300047320 Bacteria 3696
815 Ga0495672_0059186 3300047320 Bacteria 2217
816 Ga0495676_0032555 3300047321 Bacteria 4399
817 Ga0495676_0261183 3300047321 Bacteria 1178
818 Ga0495680_0011162 3300047322 Bacteria 7977
819 Ga0495680_0016439 3300047322 Bacteria 6354
820 Ga0495680_0017483 3300047322 Bacteria 6122
821 Ga0495680_0053085 3300047322 Bacteria 3156
822 Ga0495680_0104301 3300047322 Bacteria 2109
823 Ga0495680_0341064 3300047322 Bacteria 1045
824 Ga0495683_0000146 3300047323 Bacteria 69465
825 Ga0495683_0000882 3300047323 Bacteria 21171
826 Ga0495683_0001972 3300047323 Bacteria 12815
827 Ga0495683_0002296 3300047323 Bacteria 11659
828 Ga0495683_0015769 3300047323 Bacteria 3923
829 Ga0495683_0024109 3300047323 Bacteria 3124
830 Ga0495683_0098081 3300047323 Bacteria 1412
831 Ga0495687_000091 3300047443 Bacteria 140319
832 Ga0495687_001312 3300047443 Bacteria 23262
833 Ga0495687_001359 3300047443 Bacteria 22671
834 Ga0495677_0000236 3300047445 Bacteria 24957
835 Ga0495679_000272 3300047446 Bacteria 43249
836 Ga0495679_001867 3300047446 Bacteria 11342
837 Ga0495679_004456 3300047446 Bacteria 6453
838 Ga0495685_010247 3300047447 Bacteria 3141
839 Ga0495673_0001717 3300047469 Bacteria 16748
840 Ga0495673_0038734 3300047469 Bacteria 2166
841 Ga0495673_0047539 3300047469 Bacteria 1895
842 Ga0495681_0000069 3300047470 Bacteria 96229
843 Ga0495681_0000128 3300047470 Bacteria 66467
844 Ga0495681_0000220 3300047470 Bacteria 47456
845 Ga0495681_0001304 3300047470 Bacteria 18879
846 Ga0495681_0003028 3300047470 Bacteria 11810
847 Ga0495681_0019482 3300047470 Bacteria 3704
848 Ga0495681_0019915 3300047470 Bacteria 3649
849 Ga0495684_0314937 3300047471 Bacteria 1120
850 Ga0495686_0012185 3300047472 Bacteria 6026
851 Ga0495686_0033912 3300047472 Bacteria 3291
852 Ga0495593_0000227 3300047673 Bacteria 30157
853 Ga0495593_0000308 3300047673 Bacteria 26776
854 Ga0495593_0007850 3300047673 Bacteria 6215
855 Ga0495593_0007932 3300047673 Bacteria 6186
856 Ga0495593_0026545 3300047673 Bacteria 3196
857 Ga0495593_0032454 3300047673 Bacteria 2846
858 Ga0495602_0018173 3300048088 Bacteria 7031
859 Ga0495602_0025932 3300048088 Bacteria 5664
860 Ga0495602_0038822 3300048088 Bacteria 4395
861 Ga0495602_0048671 3300048088 Bacteria 3806
862 Ga0495602_0327338 3300048088 Bacteria 1112
863 Ga0495614_0000338 3300048089 Bacteria 18550
864 Ga0495614_0011292 3300048089 Bacteria 3930
865 Ga0495614_0029155 3300048089 Bacteria 2375
866 Ga0495614_0068977 3300048089 Bacteria 1523
867 Ga0495626_0000083 3300048091 Bacteria 127169
868 Ga0495626_0002410 3300048091 Bacteria 13026
869 Ga0495626_0038755 3300048091 Bacteria 2258
870 Ga0495626_0051292 3300048091 Bacteria 1903
871 Ga0495626_0087181 3300048091 Bacteria 1378
872 Ga0496100_0007557 3300048903 Bacteria 6004
873 Ga0496100_0098859 3300048903 Bacteria 2006
874 Ga0496100_0404620 3300048903 Bacteria 1040
875 Ga0496101_0025631 3300048904 Bacteria 4092
876 Ga0496102_0000272 3300048905 Bacteria 65744
877 Ga0496102_0010230 3300048905 Bacteria 8065
878 Ga0496102_0019842 3300048905 Bacteria 5926
879 Ga0496102_0367730 3300048905 Bacteria 1354
880 Ga0496103_0000330 3300048906 Bacteria 43422
881 Ga0496103_0001182 3300048906 Bacteria 17920
882 Ga0496103_0002633 3300048906 Bacteria 11243
883 Ga0496103_0075449 3300048906 Bacteria 2115
884 Ga0496104_0001821 3300048907 Bacteria 18471
885 Ga0496104_0178957 3300048907 Bacteria 2031
886 Ga0496105_0000437 3300048908 Bacteria 27324
887 Ga0496105_0028200 3300048908 Bacteria 4591
888 Ga0496107_0028423 3300048910 Bacteria 3974
889 Ga0496107_0222254 3300048910 Bacteria 1405
890 Ga0496110_0022865 3300048913 Bacteria 5312
891 Ga0496110_0029512 3300048913 Bacteria 4721
892 Ga0496110_0330281 3300048913 Bacteria 1389
893 Ga0496111_0003072 3300048914 Bacteria 10254
894 Ga0496113_0010518 3300048916 Bacteria 6119
895 Ga0496113_0076826 3300048916 Bacteria 2552
896 Ga0496114_0004992 3300048917 Bacteria 10352
897 Ga0496114_0067196 3300048917 Bacteria 3007
898 Ga0496115_0094831 3300048918 Bacteria 2442
899 Ga0496116_0006783 3300048919 Bacteria 10306
900 Ga0496116_0019420 3300048919 Bacteria 5204
901 Ga0496116_0020388 3300048919 Bacteria 5036
902 Ga0496116_0078039 3300048919 Bacteria 2067
903 Ga0496116_0116889 3300048919 Bacteria 1553
904 Ga0496117_0004341 3300048920 Bacteria 15738
905 Ga0496117_0007626 3300048920 Bacteria 10502
906 Ga0496117_0021528 3300048920 Bacteria 5212
907 Ga0496117_0046142 3300048920 Bacteria 3137
908 Ga0496117_0114647 3300048920 Bacteria 1670
909 Ga0496117_0188848 3300048920 Bacteria 1176
910 Ga0496118_0001543 3300048921 Bacteria 34234
911 Ga0496118_0006740 3300048921 Bacteria 12509
912 Ga0496118_0010168 3300048921 Bacteria 9347
913 Ga0496118_0012208 3300048921 Bacteria 8275
914 Ga0496118_0029641 3300048921 Bacteria 4585
915 Ga0496118_0034928 3300048921 Bacteria 4093
916 Ga0496118_0036603 3300048921 Bacteria 3964
917 Ga0496118_0061015 3300048921 Bacteria 2795
918 Ga0496118_0113644 3300048921 Bacteria 1788
919 Ga0496120_0038047 3300048923 Bacteria 2850
920 Ga0496121_0006320 3300048924 Bacteria 14783
921 Ga0496121_0006891 3300048924 Bacteria 13884
922 Ga0496121_0055336 3300048924 Bacteria 3306
923 Ga0496121_0177926 3300048924 Bacteria 1538
924 Ga0496121_0182657 3300048924 Bacteria 1512
925 Ga0496121_0201458 3300048924 Bacteria 1418
926 Ga0496122_0000217 3300048925 Bacteria 128502
927 Ga0496122_0000375 3300048925 Bacteria 95681
928 Ga0496122_0001599 3300048925 Bacteria 35428
929 Ga0496122_0002181 3300048925 Bacteria 28671
930 Ga0496122_0011301 3300048925 Bacteria 9065
931 Ga0496122_0028435 3300048925 Bacteria 4743
932 Ga0496123_0000057 3300048926 Bacteria 228608
933 Ga0496123_0000267 3300048926 Bacteria 104282
934 Ga0496123_0003201 3300048926 Bacteria 18672
935 Ga0496123_0024780 3300048926 Bacteria 4546
936 Ga0496123_0031385 3300048926 Bacteria 3867
937 Ga0496123_0095092 3300048926 Bacteria 1754
938 Ga0496123_0105389 3300048926 Bacteria 1627
939 Ga0496124_0011374 3300048927 Bacteria 8900
940 Ga0496124_0020902 3300048927 Bacteria 6039
941 Ga0496124_0027362 3300048927 Bacteria 5119
942 Ga0496124_0043328 3300048927 Bacteria 3869
943 Ga0496124_0188384 3300048927 Bacteria 1581
944 Ga0496124_0288894 3300048927 Bacteria 1191
945 Ga0496125_0000710 3300048928 Bacteria 55020
946 Ga0496125_0003337 3300048928 Bacteria 19564
947 Ga0496125_0006710 3300048928 Bacteria 12375
948 Ga0496125_0007526 3300048928 Bacteria 11575
949 Ga0496125_0010218 3300048928 Bacteria 9516
950 Ga0496125_0011820 3300048928 Bacteria 8700
951 Ga0496125_0012669 3300048928 Bacteria 8346
952 Ga0496125_0025084 3300048928 Bacteria 5469
953 Ga0496125_0045550 3300048928 Bacteria 3689
954 Ga0496125_0127760 3300048928 Bacteria 1797
955 Ga0496126_0000114 3300048929 Bacteria 188605
956 Ga0496126_0000475 3300048929 Bacteria 79715
957 Ga0496126_0001848 3300048929 Bacteria 30899
958 Ga0496126_0004098 3300048929 Bacteria 17650
959 Ga0496126_0226179 3300048929 Bacteria 1569
960 Ga0495678_000837 3300049459 Bacteria 27507
961 Ga0495678_002725 3300049459 Bacteria 11624
962 Ga0495678_025713 3300049459 Bacteria 2523
963 Ga0495678_039529 3300049459 Bacteria 1902
964 Ga0495682_0001415 3300049460 Bacteria 13027
965 Ga0495682_0010663 3300049460 Bacteria 3550
966 Ga0495682_0066119 3300049460 Bacteria 1303
967 Ga0501031_0004220 3300049568 Bacteria 9287
968 Ga0501034_0157053 3300049571 Bacteria 2248
969 Ga0501034_0496662 3300049571 Bacteria 1134
970 Ga0501037_0143571 3300049573 Bacteria 1708
971 Ga0501080_0526996 3300049742 Bacteria 1054
972 Ga0501044_0156297 3300049823 Bacteria 2260
973 nmdc:mga0k408_26139_c1 3300050493 Bacteria 3309
974 nmdc:mga07m45_1219_c1 3300050496 Bacteria 11658
975 nmdc:mga07m45_1806_c2 3300050496 Bacteria 8273
976 nmdc:mga07m45_25541_c1 3300050496 Bacteria 3240
977 nmdc:mga07m45_51387_c1 3300050496 Bacteria 2324
978 Ga0495601_0283984 3300053077 Bacteria 1079
979 Ga0500610_0027281 3300053079 Bacteria 2866
980 Ga0500610_0028356 3300053079 Bacteria 2820
981 Ga0500643_001890 3300053087 Bacteria 11384
982 Ga0500651_0000052 3300053093 Bacteria 76301
983 Ga0500571_000036 3300053110 Bacteria 42725
984 Ga0500594_0001934 3300053118 Bacteria 4484
985 Ga0500595_002080 3300053119 Bacteria 10237
986 Ga0500608_021702 3300053122 Bacteria 2969
987 Ga0500618_000385 3300053125 Bacteria 30497
988 Ga0500658_0000033 3300053134 Bacteria 89738
989 Ga0500658_0000040 3300053134 Bacteria 79293
990 Ga0500658_0016242 3300053134 Bacteria 2772
991 Ga0500559_0001604 3300053136 Bacteria 12590
992 Ga0500559_0001672 3300053136 Bacteria 12246
993 Ga0500564_011334 3300053138 Bacteria 3930
994 Ga0500568_0003399 3300053139 Bacteria 8894
995 Ga0500574_026443 3300053141 Bacteria 1522
996 Ga0500616_0083773 3300053153 Bacteria 1596
997 Ga0500619_000329 3300053154 Bacteria 9224
998 Ga0500622_0015326 3300053156 Bacteria 4105
999 Ga0500634_0024021 3300053161 Bacteria 3315
1000 Ga0500634_0066608 3300053161 Bacteria 1897
1001 Ga0500587_000979 3300053739 Bacteria 3846
1002 Ga0587072_000102 3300059643 Bacteria 6796
1003 2510249185 2510065045 Bacteria 7761063
1004 2510285086 2510065053 Bacteria 5005518
1005 2510294077 2510065055 Bacteria 5037935
1006 2510313111 2510065058 Bacteria 5005894
1007 2511247648 2511231003 Bacteria 5606035
1008 2511279989 2511231008 Bacteria 6624100
1009 2511303728 2511231012 Bacteria 6738011
1010 2511351024 2511231020 Bacteria 6115223
1011 2511353879 2511231021 Bacteria 7302637
1012 2511360242 2511231022 Bacteria 6719296
1013 2511384179 2511231026 Bacteria 5225445
1014 2513229736 2513020051 Bacteria 6053213
1015 2514047695 2513237166 Bacteria 10373764
1016 2515680544 2515154122 Bacteria 8609520
1017 2521558944 2521172590 Bacteria 5047645
1018 2548497577 2547132374 Bacteria 5530232
1019 2550697194 2548876994 Bacteria 4904866
1020 2553003752 2551306416 Bacteria 6152985
1021 2585145215 2582581278 Bacteria 5296881
1022 2587680961 2585428045 Bacteria 5203023
1023 2587759882 2585428062 Bacteria 6842168
1024 2588212911 2585428183 Bacteria 5166119
1025 2588224186 2585428185 Bacteria 4969476
1026 2590600643 2588254255 Bacteria 5014294
1027 2597030359 2596583598 Bacteria 5251611
1028 2599446361 2599185178 Bacteria 5365746
1029 2599625945 2599185214 Bacteria 8209958
1030 2599674973 2599185226 Bacteria 8233575
1031 2599683867 2599185227 Bacteria 8246414
1032 2599695530 2599185229 Bacteria 8216126
1033 2643866493 2643221570 Bacteria 5103772
1034 2643953290 2643221589 Bacteria 6250934
1035 2643993261 2643221596 Bacteria 5006805
1036 2644021030 2643221602 Bacteria 6249926
1037 2644061306 2643221609 Bacteria 6756331
1038 2644076653 2643221611 Bacteria 6820941
1039 2644294150 2643221652 Bacteria 5140275
1040 2644329567 2643221658 Bacteria 6064537
1041 2644398346 2643221672 Bacteria 6322190
1042 2644646147 2643221717 Bacteria 5676132
1043 2719642406 2718217991 Bacteria 7829542
1044 2729145426 2728369097 Bacteria 4333476
1045 2738701891 2738541273 Bacteria 4048577
1046 2738722423 2738541277 Bacteria 7458140
1047 2738883897 2738541307 Bacteria 8606193
1048 2739243632 2738543012 Bacteria 7115078
1049 2739249127 2738543013 Bacteria 5618633
1050 2739256189 2738543014 Bacteria 4048139
1051 2739282787 2738543019 Bacteria 7459457
1052 2739289826 2738543020 Bacteria 5718238
1053 2739295138 2738543021 Bacteria 5718241
1054 2740061186 2739367874 Bacteria 4872888
1055 2746090610 2744054900 Bacteria 8399525
1056 2746099092 2744054901 Bacteria 8397047
1057 2765568815 2765235838 Bacteria 5445269
1058 2765576359 2765235839 Bacteria 5314748
1059 2774119857 2773857670 Bacteria 6407454
1060 2774128181 2773857672 Bacteria 4993178
1061 2784312213 2784132072 Bacteria 6596533
1062 2808857949 2808606361 Bacteria 6136259
1063 2808926471 2808606376 Bacteria 6248667
1064 2808938209 2808606378 Bacteria 6177535
1065 2808948605 2808606380 Bacteria 6248705
1066 2808966461 2808606383 Bacteria 6138645
1067 2808970323 2808606384 Bacteria 8474373
1068 2808984322 2808606386 Bacteria 4471946
1069 2809001291 2808606389 Bacteria 6138126
1070 2809004830 2808606390 Bacteria 8476311
1071 2809012029 2808606391 Bacteria 8308166
1072 2809130675 2808606415 Bacteria 4576710
1073 2809149847 2808606419 Bacteria 4576925
1074 2816474153 2816332133 Bacteria 7249298
1075 2819542404 2818991436 Bacteria 5376622
1076 2819591352 2818991445 Bacteria 4955017
1077 2819596204 2818991446 Bacteria 7757362
1078 2819615466 2818991449 Bacteria 5518009
1079 2831270454 2831265667 Bacteria 7184833
1080 2831867738 2831864461 Bacteria 6502356
1081 2838056682 2838054893 Bacteria 7451788
1082 2839096301 2839094727 Bacteria 5534556
1083 2842456442 2842454564 Bacteria 8730687
1084 2842681506 2842677519 Bacteria 5615038
1085 2842738414 2842733646 Bacteria 5716726
1086 2842808697 2842805378 Bacteria 5385175
1087 2852620011 2852618963 Bacteria 4577824
1088 2856294497 2856287931 Bacteria 7223934
1089 2857367870 2857357740 Bacteria 9937880
1090 2860339206 2860339153 Bacteria 6846989
1091 2884812340 2884811622 Bacteria 5552861
1092 2884837146 2884836552 Bacteria 5219991
1093 2884853438 2884852848 Bacteria 5221161
1094 2885194082 2885192300 Bacteria 5882526
1095 2885266637 2885266251 Bacteria 4796748
1096 2889293133 2889290771 Bacteria 5530962
1097 2891636911 2891633521 Bacteria 4602265
1098 2894025678 2894023352 Bacteria 5167372
1099 2896155445 2896154374 Bacteria 5221518
1100 2899925585 2899924645 Bacteria 7487985
1101 2900581299 2900577576 Bacteria 5438534
1102 2902687723 2902682994 Bacteria 8951596
1103 2904444615 2904439833 Bacteria 5931679
1104 2904454667 2904449895 Bacteria 6927402
1105 2904460410 2904456579 Bacteria 6819253
1106 2904480370 2904479285 Bacteria 5073931
1107 2904486438 2904483920 Bacteria 7545285
1108 2904534730 2904530477 Bacteria 5876334
1109 2904584619 2904584206 Bacteria 6028872
1110 2904591086 2904589729 Bacteria 6113573
1111 2904605286 2904601388 Bacteria 5884906
1112 2904622351 2904615490 Bacteria 10047340
1113 2917835468 2917832318 Bacteria 5346010
1114 2919048453 2919046199 Bacteria 5567169
1115 2919081025 2919079590 Bacteria 5946433
1116 2919129191 2919125081 Bacteria 5385106
1117 2919464219 2919462493 Bacteria 5817112
1118 2923512605 2923510766 Bacteria 5926163
1119 2928038320 2928037797 Bacteria 7273642
1120 2928046075 2928044640 Bacteria 7271509
1121 2928053774 2928051484 Bacteria 7773759
1122 2928059503 2928058823 Bacteria 5520022
1123 2928067317 2928064002 Bacteria 7419480
1124 2928076284 2928070936 Bacteria 8062541
1125 2928088919 2928084124 Bacteria 7159212
1126 2928119690 2928115317 Bacteria 6477646
1127 2928132636 2928130867 Bacteria 5467269
1128 2928504251 2928503688 Bacteria 7268108
1129 2929524614 2929520902 Bacteria 6765052
1130 2931400839 2931396565 Bacteria 7251677
1131 2932426627 2932422444 Bacteria 4678430
1132 2939589090 2939582691 Bacteria 7088898
1133 2939639890 2939636861 Bacteria 6297853
1134 2945912828 2945909444 Bacteria 7065066
1135 2945947036 2945945610 Bacteria 5951079
1136 2945976722 2945972063 Bacteria 6086495
1137 2945984905 2945984333 Bacteria 7358892
1138 2974299663 2974298342 Bacteria 4840922
1139 2984504482 2984504281 Bacteria 5262371
1140 2990712304 2990710928 Bacteria 5002431
1141 2998347672 2998344455 Bacteria 4222996
1142 8011354140 8011350971 Bacteria 6158957
1143 8019781232 8019775933 Bacteria 6858656
1144 8040172932 8040167225 Bacteria 6542727
1145 8055304436 8055301274 Bacteria 8587385
1146 8056128409 8056125926 Bacteria 6228218
1147 Ga0075432_10077766
1148 MRS2a_Contig_6410
1149 JGI24740J21852_10000275
1150 JGI24740J21852_10024395
1151 JGI25155J39150_1000740
1152 JGI25155J39150_1000889
1153 JGI25156J39149_1001996
1154 JGI25156J39149_1003358
1155 JGI25156J39149_1009248
1156 JGI25162J39368_1000369
1157 JGI25162J39368_1000370
1158 JGI25154J39366_1000522
1159 JGI25154J39366_1002282
1160 JGI25157J39369_1000336
1161 JGI25152J39213_1002215
1162 JGI25152J39213_1005545
1163 JGI25150J39212_1001247
1164 JGI25150J39212_1001590
1165 JGI25159J45721_1002135
1166 JGI25159J45721_1006297
1167 JGI25151J46595_10004105
1168 JGI25151J46595_10004592
1169 JGI25151J46595_10016037
1170 JGI25165J46597_1000022
1171 JGI25153J46596_10004442
1172 JGI25153J46596_10006559
1173 rootH2_10045628
1174 rootH2_10085097
1175 rootL2_10022424
1176 rootL2_10234216
1177 rootH1_10106878
1178 JGI25160J50197_1002977
1179 JGI25160J50197_1009553
1180 JGI25161J50226_1001358
1181 JGI25161J50226_1004239
1182 Ga0006562J51391_1033784
1183 Ga0006562J51391_1033786
1184 Ga0006562J51391_1036841
1185 Ga0055538_1000011
1186 Ga0055538_1000255
1187 Ga0055539_1000016
1188 Ga0055539_1000059
1189 Ga0055539_1000288
1190 Ga0055533_1000019
1191 Ga0055533_1000273
1192 Ga0055532_1000016
1193 Ga0055532_1000025
1194 Ga0055525_1000042
1195 Ga0055525_1000372
1196 Ga0055525_1000389
1197 Ga0055535_1000019
1198 Ga0055535_1000215
1199 Ga0055535_1009321
1200 Ga0055542_1000004
1201 Ga0055542_1001074
1202 Ga0055529_1000035
1203 Ga0055526_1003413
1204 Ga0055526_1005028
1205 Ga0055537_1001816
1206 Ga0055524_1000109
1207 Ga0055524_1003044
1208 Ga0055524_1003404
1209 Ga0055536_1001609
1210 Ga0055536_1003572
1211 Ga0055536_1006289
1212 Ga0055536_1023079
1213 Ga0055534_1001943
1214 Ga0055528_1003588
1215 Ga0055530_10001847
1216 Ga0055530_10004499
1217 Ga0055530_10028296
1218 Ga0055540_1000408
1219 Ga0055540_1001457
1220 Ga0055540_1003628
1221 Ga0055540_1005917
1222 Ga0055540_1045228
1223 Ga0055531_10001899
1224 Ga0055531_10003404
1225 Ga0055531_10009281
1226 Ga0055541_1000017
1227 Ga0055541_1000187
1228 Ga0055541_1007448
1229 Ga0055543_1001655
1230 Ga0055543_1001835
1231 Ga0065165_1005005
1232 Ga0065165_1006473
1233 Ga0065714_10000250
1234 Ga0065714_10004039
1235 Ga0065714_10064584
1236 Ga0065704_10085551
1237 Ga0065704_10120439
1238 Ga0065712_10001860
1239 Ga0065715_10009160
1240 Ga0070658_10002173
1241 Ga0070690_100326244
1242 Ga0068869_100300229
1243 Ga0070682_100000175
1244 Ga0070682_100358758
1245 Ga0070660_100184238
1246 Ga0070691_10077359
1247 Ga0070661_100000767
1248 Ga0070661_100000769
1249 Ga0070668_100562095
1250 Ga0070669_100020846
1251 Ga0070675_100059478
1252 Ga0070674_100086439
1253 Ga0070659_100003572
1254 Ga0070659_100231782
1255 Ga0070667_100020167
1256 Ga0070667_100474452
1257 Ga0070701_10234224
1258 Ga0070663_100000009
1259 Ga0070678_100054293
1260 Ga0070678_100300932
1261 Ga0070662_100002684
1262 Ga0070662_100089639
1263 Ga0070672_100351298
1264 Ga0070672_100489457
1265 Ga0070665_100241195
1266 Ga0068855_100000526
1267 Ga0068855_100009723
1268 Ga0068855_100245073
1269 Ga0070664_100000010
1270 Ga0070664_100050800
1271 Ga0070664_100051488
1272 Ga0068857_100036269
1273 Ga0068854_100000017
1274 Ga0068854_100002811
1275 Ga0068856_100000069
1276 Ga0068852_100034306
1277 Ga0068852_100200450
1278 Ga0068852_100385353
1279 Ga0068851_10064492
1280 Ga0075363_100119461
1281 Ga0075364_10001331
1282 Ga0075364_10001778
1283 Ga0075432_10000580
1284 Ga0075432_10000757
1285 Ga0075432_10015678
1286 Ga0075432_10063717
1287 Ga0070712_100003321
1288 Ga0075362_10001714
1289 Ga0075369_10044618
1290 Ga0075370_10001452
1291 Ga0075370_10017786
1292 Ga0075370_10028586
1293 Ga0075370_10061894
1294 Ga0068865_100388775
1295 Ga0079104_1000001
1296 Ga0079104_1000276
1297 Ga0105251_10002438
1298 Ga0105251_10024172
1299 Ga0105251_10040737
1300 Ga0105251_10115783
1301 Ga0105244_10000775
1302 Ga0105244_10001886
1303 Ga0105244_10041540
1304 Ga0105244_10056822
1305 Ga0105244_10178129
1306 Ga0105250_10002637
1307 Ga0105250_10014086
1308 Ga0105240_10000497
1309 Ga0105240_10031065
1310 Ga0105240_10129678
1311 Ga0105240_10653354
1312 Ga0105243_10000588
1313 Ga0105243_10012543
1314 Ga0105243_10063016
1315 Ga0105243_10131262
1316 Ga0105243_10337434
1317 Ga0105237_10003695
1318 Ga0105237_10417715
1319 Ga0105238_10000117
1320 Ga0105238_10049693
1321 Ga0105238_10244084
1322 Ga0105249_10138083
1323 Ga0105249_10453187
1324 Ga0105239_10091600
1325 Ga0105246_10118211
1326 Ga0157339_1003179
1327 Ga0157373_10014005
1328 Ga0157373_10022728
1329 Ga0157373_10033887
1330 Ga0157373_10050217
1331 Ga0157371_10000033
1332 Ga0157371_10002234
1333 Ga0157371_10003692
1334 Ga0157371_10006955
1335 Ga0157371_10020177
1336 Ga0157370_10000010
1337 Ga0157370_10000055
1338 Ga0157370_10000372
1339 Ga0157370_10015682
1340 Ga0157370_10015692
1341 Ga0157370_10270775
1342 Ga0157369_10000093
1343 Ga0157369_10000665
1344 Ga0157369_10015219
1345 Ga0157369_10061241
1346 Ga0157369_10238705
1347 Ga0157378_10441404
1348 Ga0163162_10002312
1349 Ga0163162_10108037
1350 Ga0157372_10001138
1351 Ga0157372_10639833
1352 Ga0182008_10000494
1353 Ga0182008_10004710
1354 Ga0182008_10007370
1355 Ga0182008_10024459
1356 Ga0182008_10025372
1357 Ga0182008_10097064
1358 Ga0157379_10345012
1359 Ga0182006_1001948
1360 Ga0182006_1005485
1361 Ga0182006_1006078
1362 Ga0182006_1007977
1363 Ga0182006_1015536
1364 Ga0182006_1015571
1365 Ga0182006_1019964
1366 Ga0182006_1029274
1367 Ga0182006_1075071
1368 Ga0182007_10001204
1369 Ga0182007_10003889
1370 Ga0182007_10011950
1371 Ga0182005_1000351
1372 Ga0183362_10001
1373 Ga0163161_10000060
1374 Ga0163161_10041431
1375 Ga0163161_10053743
1376 Ga0163161_10059503
1377 Ga0163161_10293593
1378 Ga0206351_10970006
1379 Ga0206350_11606970
1380 Ga0206353_10422469
1381 Ga0154015_1175498
1382 Ga0213872_10002036
1383 Ga0213872_10009541
1384 Ga0213872_10013428
1385 Ga0213872_10028339
1386 Ga0224712_10000006
1387 Ga0209435_100016
1388 Ga0209435_104520
1389 Ga0209760_101527
1390 Ga0209436_101334
1391 Ga0209436_103436
1392 Ga0209784_100008
1393 Ga0209784_100019
1394 Ga0209784_100281
1395 Ga0209784_100461
1396 Ga0209784_100809
1397 Ga0209566_100006
1398 Ga0209566_100017
1399 Ga0209566_100473
1400 Ga0209566_100805
1401 Ga0209566_100952
1402 Ga0209674_100031
1403 Ga0209674_100045
1404 Ga0209674_100114
1405 Ga0209674_100330
1406 Ga0209672_102145
1407 Ga0209147_100005
1408 Ga0209147_100023
1409 Ga0209147_100769
1410 Ga0209563_100016
1411 Ga0209563_100035
1412 Ga0209563_100218
1413 Ga0209563_105701
1414 Ga0207427_100639
1415 Ga0209437_100038
1416 Ga0209437_100080
1417 Ga0209258_100007
1418 Ga0209258_100022
1419 Ga0209258_100210
1420 Ga0207425_1000180
1421 Ga0207425_1032436
1422 Ga0209646_1000027
1423 Ga0209646_1000033
1424 Ga0209646_1000200
1425 Ga0209026_1000031
1426 Ga0209026_1002370
1427 Ga0209026_1009929
1428 Ga0209677_100008
1429 Ga0209677_100020
1430 Ga0209677_100350
1431 Ga0209677_107624
1432 Ga0209148_1000019
1433 Ga0209148_1000034
1434 Ga0209759_1000045
1435 Ga0209759_1002029
1436 Ga0209759_1007962
1437 Ga0209129_1000111
1438 Ga0209129_1001197
1439 Ga0209233_1000049
1440 Ga0209565_1000110
1441 Ga0209565_1001804
1442 Ga0209455_1000011
1443 Ga0209455_1007159
1444 Ga0209673_1000175
1445 Ga0209673_1000944
1446 Ga0209673_1000992
1447 Ga0209673_1001347
1448 Ga0209130_1000205
1449 Ga0209130_1000332
1450 Ga0209675_1000192
1451 Ga0209675_1003468
1452 Ga0209675_1009747
1453 Ga0209675_1017748
1454 Ga0209676_1000005
1455 Ga0209676_1000356
1456 Ga0209676_1003888
1457 Ga0209676_1044656
1458 Ga0209025_1000096
1459 Ga0209025_1000116
1460 Ga0209025_1027245
1461 Ga0209564_1000155
1462 Ga0209564_1000298
1463 Ga0209758_1000107
1464 Ga0209758_1009267
1465 Ga0209050_1000007
1466 Ga0209050_1000155
1467 Ga0209050_1000575
1468 Ga0209050_1003630
1469 Ga0209050_1022292
1470 Ga0209256_1000015
1471 Ga0209256_1000038
1472 Ga0209256_1000087
1473 Ga0207426_1000090
1474 Ga0207426_1000123
1475 Ga0207426_1001768
1476 Ga0207426_1032945
1477 Ga0209051_1000009
1478 Ga0209051_1000073
1479 Ga0209051_1000092
1480 Ga0209051_1000598
1481 Ga0209051_1001817
1482 Ga0209051_1005786
1483 Ga0209257_1000011
1484 Ga0209257_1000139
1485 Ga0209257_1000576
1486 Ga0209257_1000870
1487 Ga0207656_10010379
1488 Ga0207696_1008369
1489 Ga0207696_1024868
1490 Ga0207655_1002169
1491 Ga0207655_1002182
1492 Ga0207655_1033787
1493 Ga0207713_1006007
1494 Ga0207713_1009327
1495 Ga0207713_1024270
1496 Ga0207645_10163938
1497 Ga0207705_10002977
1498 Ga0207695_10001142
1499 Ga0207695_10012413
1500 Ga0207671_10007218
1501 Ga0207693_10012704
1502 Ga0207657_10177300
1503 Ga0207649_10000463
1504 Ga0207649_10001113
1505 Ga0207649_10124093
1506 Ga0207681_10014629
1507 Ga0207694_10000103
1508 Ga0207694_10169094
1509 Ga0207694_10256178
1510 Ga0207659_10250138
1511 Ga0207690_10004528
1512 Ga0207690_10036454
1513 Ga0207690_10358862
1514 Ga0207706_10019491
1515 Ga0207706_10078135
1516 Ga0207709_10000353
1517 Ga0207709_10001645
1518 Ga0207709_10036454
1519 Ga0207709_10060254
1520 Ga0207709_10121767
1521 Ga0207704_10548860
1522 Ga0207691_10199935
1523 Ga0207711_10014842
1524 Ga0207689_10246475
1525 Ga0207679_10000002
1526 Ga0207679_10000533
1527 Ga0207679_10180827
1528 Ga0207667_10000073
1529 Ga0207667_10000076
1530 Ga0207667_10000147
1531 Ga0207667_10000166
1532 Ga0207667_10001488
1533 Ga0207667_10126447
1534 Ga0207667_10582762
1535 Ga0207712_10082844
1536 Ga0207640_10003888
1537 Ga0207658_10082854
1538 Ga0207658_10330294
1539 Ga0207677_10143188
1540 Ga0207703_10046150
1541 Ga0207639_10205885
1542 Ga0207639_10655920
1543 Ga0207678_10000015
1544 Ga0207702_10000053
1545 Ga0207648_10083787
1546 Ga0207648_10169854
1547 Ga0207683_10031804
1548 Ga0207683_10074997
1549 Ga0207683_10472411
1550 Ga0207698_10090797
1551 Ga0209281_1000055
1552 Ga0209281_1000057
1553 Ga0209983_1001261
1554 Ga0209971_1001963
1555 Ga0209971_1032372
1556 Ga0207428_10005518
1557 Ga0207428_10056681
1558 Ga0207428_10081256
1559 Ga0268266_10282896
1560 Ga0265334_10035702
1561 Ga0307515_10000028
1562 Ga0307515_10000109
1563 Ga0307515_10010767
1564 Ga0307515_10018244
1565 Ga0307515_10030494
1566 Ga0307515_10133994
1567 Ga0307515_10229916
1568 Ga0307512_10013840
1569 Ga0316177_1124424
1570 Ga0316176_1202515
1571 Ga0314311_1048379
1572 Ga0316180_1154980
1573 Ga0316183_1077578
1574 Ga0316181_1010717
1575 Ga0265330_10000059
1576 Ga0265332_10000002
1577 Ga0265325_10009004
1578 Ga0265327_10000842
1579 Ga0265327_10003824
1580 Ga0307513_10000990
1581 Ga0307513_10021840
1582 Ga0307513_10039886
1583 Ga0307513_10064222
1584 Ga0307513_10175158
1585 Ga0307513_10259306
1586 Ga0307509_10085885
1587 Ga0307408_100030750
1588 Ga0307408_100193231
1589 Ga0307508_10000101
1590 Ga0307514_10000225
1591 Ga0307514_10006401
1592 Ga0307514_10008985
1593 Ga0265314_10000012
1594 Ga0316576_10208691
1595 Ga0316576_10337668
1596 Ga0316578_10177242
1597 Ga0316578_10209631
1598 Ga0307516_10011288
1599 Ga0307405_10191829
1600 Ga0307406_10001953
1601 Ga0307407_10282677
1602 Ga0307412_10031599
1603 Ga0307416_100025521
1604 Ga0307416_100088997
1605 Ga0307414_10022867
1606 Ga0316574_0011223
1607 Ga0316584_0043873
1608 Ga0395899_0000023
1609 Ga0395899_0033546
1610 Ga0395900_0000019
1611 Ga0395900_0000146
1612 Ga0395900_0008274
1613 Ga0395900_0044793
1614 Ga0395900_0046317
1615 Ga0395898_0000016
1616 Ga0395898_0000617
1617 Ga0395898_0070883
1618 Ga0395901_0000004
1619 Ga0395901_0000326
1620 Ga0395901_0002868
1621 Ga0436361_0106476
1622 Ga0436361_0272349
1623 Ga0436361_0325069
1624 Ga0436361_1051926
1625 Ga0436361_1073848
1626 Ga0436361_1080802
1627 Ga0439436_0000305
1628 Ga0439436_0000469
1629 Ga0439438_004004
1630 Ga0439438_018382
1631 Ga0439439_0030749
1632 Ga0439447_000006
1633 Ga0439447_000080
1634 Ga0439447_000235
1635 Ga0439447_000632
1636 Ga0439447_000765
1637 Ga0439466_0001045
1638 Ga0439466_0003209
1639 Ga0439466_0004351
1640 Ga0439466_0006387
1641 Ga0439465_0004405
1642 Ga0439465_0055628
1643 Ga0451800_1156584
1644 Ga0451853_2167458
1645 Ga0439433_0000296
1646 Ga0439445_0000826
1647 Ga0439445_0008083
1648 Ga0439432_002294
1649 Ga0439432_002407
1650 Ga0439432_014129
1651 Ga0439432_035764
1652 Ga0439449_0000061
1653 Ga0439452_000408
1654 Ga0439452_000448
1655 Ga0439452_000685
1656 Ga0439452_002094
1657 Ga0439452_035096
1658 Ga0439456_000828
1659 Ga0439457_002853
1660 Ga0439462_0001960
1661 Ga0450911_000368
1662 Ga0450911_006679
1663 Ga0450919_002935
1664 Ga0450919_006455
1665 Ga0450920_000143
1666 Ga0450922_000379
1667 Ga0450902_001332
1668 Ga0450902_016417
1669 Ga0450903_002119
1670 Ga0450903_003370
1671 Ga0450903_004901
1672 Ga0450906_005913
1673 Ga0450907_000703
1674 Ga0450907_001150
1675 Ga0450910_002081
1676 Ga0450910_010942
1677 Ga0439446_0000601
1678 Ga0439446_0011883
1679 Ga0450908_002647
1680 Ga0439434_0000957
1681 Ga0439434_0001034
1682 Ga0439434_0007289
1683 Ga0439460_0000208
1684 Ga0451577_0060171
1685 Ga0466986_0107857
1686 Ga0466969_0039905
1687 Ga0466972_0040999
1688 Ga0466965_0014038
1689 Ga0466966_0000009
1690 Ga0466966_0003478
1691 Ga0466961_0000077
1692 Ga0466961_0000143
1693 Ga0466961_0026460
1694 Ga0466963_0005514
1695 Ga0466964_0025728
1696 Ga0466971_0014751
1697 Ga0466971_0018637
1698 Ga0466968_0028543
1699 Ga0466968_0076108
1700 Ga0466970_0004578
1701 Ga0466957_0017713
1702 Ga0466959_0009963
1703 Ga0466959_0014577
1704 Ga0495617_000188
1705 Ga0495617_049911
1706 Ga0495627_000426
1707 Ga0495603_0002299
1708 Ga0495603_0011470
1709 Ga0495603_0015411
1710 Ga0495603_0028632
1711 Ga0495590_0000074
1712 Ga0495590_0002718
1713 Ga0495590_0021643
1714 Ga0495590_0057690
1715 Ga0495591_000951
1716 Ga0495591_001372
1717 Ga0495591_001663
1718 Ga0495591_003339
1719 Ga0495591_008688
1720 Ga0495591_031829
1721 Ga0495629_0000837
1722 Ga0495629_0002001
1723 Ga0495629_0003794
1724 Ga0495629_0046455
1725 Ga0495638_0002170
1726 Ga0495638_0003829
1727 Ga0495638_0019240
1728 Ga0495638_0070278
1729 Ga0495638_0108574
1730 Ga0495638_0164490
1731 Ga0495638_0208018
1732 Ga0495641_0015039
1733 Ga0495651_0023682
1734 Ga0495651_0031030
1735 Ga0495651_0130342
1736 Ga0495653_0005124
1737 Ga0495653_0012630
1738 Ga0495653_0040848
1739 Ga0495653_0103603
1740 Ga0495653_0110361
1741 Ga0495653_0111753
1742 Ga0495653_0138584
1743 Ga0495650_0001121
1744 Ga0495650_0024249
1745 Ga0495650_0060269
1746 Ga0495650_0072990
1747 Ga0495580_0000062
1748 Ga0495580_0000269
1749 Ga0495580_0007455
1750 Ga0495582_0310259
1751 Ga0495605_0001196
1752 Ga0495605_0002710
1753 Ga0495605_0008024
1754 Ga0495605_0014664
1755 Ga0495605_0156509
1756 Ga0495639_0019038
1757 Ga0495639_0086531
1758 Ga0495662_0072192
1759 Ga0495664_0036492
1760 Ga0495584_0000928
1761 Ga0495584_0011136
1762 Ga0495584_0021779
1763 Ga0495584_0035830
1764 Ga0495585_0000626
1765 Ga0495585_0003853
1766 Ga0495585_0028645
1767 Ga0495594_0007964
1768 Ga0495596_0001577
1769 Ga0495596_0016914
1770 Ga0495596_0070562
1771 Ga0495607_0006252
1772 Ga0495607_0019474
1773 Ga0495607_0020158
1774 Ga0495607_0035206
1775 Ga0495583_0000172
1776 Ga0495606_0000859
1777 Ga0495606_0001889
1778 Ga0495606_0002982
1779 Ga0495606_0006443
1780 Ga0495608_0002271
1781 Ga0495608_0002682
1782 Ga0495610_0003096
1783 Ga0495610_0015345
1784 Ga0495610_0036339
1785 Ga0495610_0041273
1786 Ga0495616_0000323
1787 Ga0495616_0001007
1788 Ga0495616_0060631
1789 Ga0495618_0003996
1790 Ga0495618_0125635
1791 Ga0495628_0024205
1792 Ga0495628_0024253
1793 Ga0495628_0065924
1794 Ga0495628_0148574
1795 Ga0495628_0149659
1796 Ga0495630_0014914
1797 Ga0495630_0034549
1798 Ga0495630_0042479
1799 Ga0495630_0049412
1800 Ga0495630_0195895
1801 Ga0495631_0000196
1802 Ga0495631_0000455
1803 Ga0495631_0002595
1804 Ga0495632_0000617
1805 Ga0495632_0032129
1806 Ga0495632_0032293
1807 Ga0495632_0040974
1808 Ga0495637_0084932
1809 Ga0495643_0000095
1810 Ga0495643_0000532
1811 Ga0495643_0002524
1812 Ga0495643_0008892
1813 Ga0495643_0023529
1814 Ga0495643_0027714
1815 Ga0495643_0058840
1816 Ga0495644_0000008
1817 Ga0495644_0000032
1818 Ga0495644_0001957
1819 Ga0495648_0000678
1820 Ga0495648_0000886
1821 Ga0495648_0001712
1822 Ga0495648_0012148
1823 Ga0495648_0018328
1824 Ga0495648_0034287
1825 Ga0495648_0047210
1826 Ga0495648_0112967
1827 Ga0495663_0014116
1828 Ga0495666_0000497
1829 Ga0495666_0003130
1830 Ga0495666_0008007
1831 Ga0495666_0038876
1832 Ga0495642_0000008
1833 Ga0495642_0000059
1834 Ga0495652_0005080
1835 Ga0495652_0008766
1836 Ga0495652_0028025
1837 Ga0495652_0159642
1838 Ga0495652_0175814
1839 Ga0495652_0226906
1840 Ga0495654_0028655
1841 Ga0495654_0032458
1842 Ga0495654_0033073
1843 Ga0495654_0042135
1844 Ga0495665_0001953
1845 Ga0495665_0002510
1846 Ga0495665_0037769
1847 Ga0495665_0166156
1848 Ga0495640_0002419
1849 Ga0495640_0121404
1850 Ga0495586_0036587
1851 Ga0495586_0119469
1852 Ga0495587_0000102
1853 Ga0495587_0081019
1854 Ga0495609_0000677
1855 Ga0495609_0063042
1856 Ga0495621_0034517
1857 Ga0495597_0000562
1858 Ga0495597_0030975
1859 Ga0495597_0101001
1860 Ga0495645_0003620
1861 Ga0495645_0058981
1862 Ga0495645_0082041
1863 Ga0495622_0000005
1864 Ga0495622_0000205
1865 Ga0495622_0004376
1866 Ga0495633_0018257
1867 Ga0495667_0013764
1868 Ga0495656_0000060
1869 Ga0495656_0019583
1870 Ga0495656_0128322
1871 Ga0495634_0000380
1872 Ga0495634_0001826
1873 Ga0495611_0004432
1874 Ga0495611_0043444
1875 Ga0495625_0000888
1876 Ga0495625_0009629
1877 Ga0495625_0150876
1878 Ga0495635_0000921
1879 Ga0495635_0018816
1880 Ga0495635_0063054
1881 Ga0495659_0002830
1882 Ga0495661_0006996
1883 Ga0495661_0009949
1884 Ga0495661_0020583
1885 Ga0495661_0047008
1886 Ga0495661_0052194
1887 Ga0495661_0070500
1888 Ga0495588_0000485
1889 Ga0495657_0013688
1890 Ga0495657_0100308
1891 Ga0495599_0004627
1892 Ga0495599_0012745
1893 Ga0495599_0024043
1894 Ga0495599_0035407
1895 Ga0495599_0162296
1896 Ga0495623_0002336
1897 Ga0495623_0022340
1898 Ga0495646_0009968
1899 Ga0495646_0013242
1900 Ga0495646_0033595
1901 Ga0495646_0034680
1902 Ga0495646_0053677
1903 Ga0495646_0062053
1904 Ga0495646_0083312
1905 Ga0495669_0000278
1906 Ga0495669_0090314
1907 Ga0495613_0007730
1908 Ga0495613_0039429
1909 Ga0495613_0050772
1910 Ga0495624_0000817
1911 Ga0495624_0015267
1912 Ga0495624_0040718
1913 Ga0495624_0129079
1914 Ga0495624_0143416
1915 Ga0495624_0221730
1916 Ga0495670_0000519
1917 Ga0495670_0004175
1918 Ga0495670_0031554
1919 Ga0495670_0141382
1920 Ga0495671_0000536
1921 Ga0495671_0003200
1922 Ga0495671_0021990
1923 Ga0495671_0037450
1924 Ga0495671_0152346
1925 Ga0495649_0001299
1926 Ga0495649_0001695
1927 Ga0495649_0002422
1928 Ga0495649_0028016
1929 Ga0495649_0056176
1930 Ga0495589_0000214
1931 Ga0495589_0002921
1932 Ga0495589_0017112
1933 Ga0495589_0036788
1934 Ga0495589_0113425
1935 Ga0495600_0000303
1936 Ga0495600_0014053
1937 Ga0495600_0050463
1938 Ga0495660_0019398
1939 Ga0495660_0046228
1940 Ga0495660_0050087
1941 Ga0495660_0107487
1942 Ga0495581_0000974
1943 Ga0495604_0023319
1944 Ga0495604_0186498
1945 Ga0495636_0034219
1946 Ga0495674_0005269
1947 Ga0495674_0006339
1948 Ga0495674_0017847
1949 Ga0495674_0036874
1950 Ga0495674_0058724
1951 Ga0495674_0070895
1952 Ga0495674_0385602
1953 Ga0495672_0000143
1954 Ga0495672_0000496
1955 Ga0495672_0000737
1956 Ga0495672_0001053
1957 Ga0495672_0003747
1958 Ga0495672_0009789
1959 Ga0495672_0012589
1960 Ga0495672_0026526
1961 Ga0495672_0059186
1962 Ga0495676_0032555
1963 Ga0495676_0261183
1964 Ga0495680_0011162
1965 Ga0495680_0016439
1966 Ga0495680_0017483
1967 Ga0495680_0053085
1968 Ga0495680_0104301
1969 Ga0495680_0341064
1970 Ga0495683_0000146
1971 Ga0495683_0000882
1972 Ga0495683_0001972
1973 Ga0495683_0002296
1974 Ga0495683_0015769
1975 Ga0495683_0024109
1976 Ga0495683_0098081
1977 Ga0495687_000091
1978 Ga0495687_001312
1979 Ga0495687_001359
1980 Ga0495677_0000236
1981 Ga0495679_000272
1982 Ga0495679_001867
1983 Ga0495679_004456
1984 Ga0495685_010247
1985 Ga0495673_0001717
1986 Ga0495673_0038734
1987 Ga0495673_0047539
1988 Ga0495681_0000069
1989 Ga0495681_0000128
1990 Ga0495681_0000220
1991 Ga0495681_0001304
1992 Ga0495681_0003028
1993 Ga0495681_0019482
1994 Ga0495681_0019915
1995 Ga0495684_0314937
1996 Ga0495686_0012185
1997 Ga0495686_0033912
1998 Ga0495593_0000227
1999 Ga0495593_0000308
2000 Ga0495593_0007850
2001 Ga0495593_0007932
2002 Ga0495593_0026545
2003 Ga0495593_0032454
2004 Ga0495602_0018173
2005 Ga0495602_0025932
2006 Ga0495602_0038822
2007 Ga0495602_0048671
2008 Ga0495602_0327338
2009 Ga0495614_0000338
2010 Ga0495614_0011292
2011 Ga0495614_0029155
2012 Ga0495614_0068977
2013 Ga0495626_0000083
2014 Ga0495626_0002410
2015 Ga0495626_0038755
2016 Ga0495626_0051292
2017 Ga0495626_0087181
2018 Ga0496100_0007557
2019 Ga0496100_0098859
2020 Ga0496100_0404620
2021 Ga0496101_0025631
2022 Ga0496102_0000272
2023 Ga0496102_0010230
2024 Ga0496102_0019842
2025 Ga0496102_0367730
2026 Ga0496103_0000330
2027 Ga0496103_0001182
2028 Ga0496103_0002633
2029 Ga0496103_0075449
2030 Ga0496104_0001821
2031 Ga0496104_0178957
2032 Ga0496105_0000437
2033 Ga0496105_0028200
2034 Ga0496107_0028423
2035 Ga0496107_0222254
2036 Ga0496110_0022865
2037 Ga0496110_0029512
2038 Ga0496110_0330281
2039 Ga0496111_0003072
2040 Ga0496113_0010518
2041 Ga0496113_0076826
2042 Ga0496114_0004992
2043 Ga0496114_0067196
2044 Ga0496115_0094831
2045 Ga0496116_0006783
2046 Ga0496116_0019420
2047 Ga0496116_0020388
2048 Ga0496116_0078039
2049 Ga0496116_0116889
2050 Ga0496117_0004341
2051 Ga0496117_0007626
2052 Ga0496117_0021528
2053 Ga0496117_0046142
2054 Ga0496117_0114647
2055 Ga0496117_0188848
2056 Ga0496118_0001543
2057 Ga0496118_0006740
2058 Ga0496118_0010168
2059 Ga0496118_0012208
2060 Ga0496118_0029641
2061 Ga0496118_0034928
2062 Ga0496118_0036603
2063 Ga0496118_0061015
2064 Ga0496118_0113644
2065 Ga0496120_0038047
2066 Ga0496121_0006320
2067 Ga0496121_0006891
2068 Ga0496121_0055336
2069 Ga0496121_0177926
2070 Ga0496121_0182657
2071 Ga0496121_0201458
2072 Ga0496122_0000217
2073 Ga0496122_0000375
2074 Ga0496122_0001599
2075 Ga0496122_0002181
2076 Ga0496122_0011301
2077 Ga0496122_0028435
2078 Ga0496123_0000057
2079 Ga0496123_0000267
2080 Ga0496123_0003201
2081 Ga0496123_0024780
2082 Ga0496123_0031385
2083 Ga0496123_0095092
2084 Ga0496123_0105389
2085 Ga0496124_0011374
2086 Ga0496124_0020902
2087 Ga0496124_0027362
2088 Ga0496124_0043328
2089 Ga0496124_0188384
2090 Ga0496124_0288894
2091 Ga0496125_0000710
2092 Ga0496125_0003337
2093 Ga0496125_0006710
2094 Ga0496125_0007526
2095 Ga0496125_0010218
2096 Ga0496125_0011820
2097 Ga0496125_0012669
2098 Ga0496125_0025084
2099 Ga0496125_0045550
2100 Ga0496125_0127760
2101 Ga0496126_0000114
2102 Ga0496126_0000475
2103 Ga0496126_0001848
2104 Ga0496126_0004098
2105 Ga0496126_0226179
2106 Ga0495678_000837
2107 Ga0495678_002725
2108 Ga0495678_025713
2109 Ga0495678_039529
2110 Ga0495682_0001415
2111 Ga0495682_0010663
2112 Ga0495682_0066119
2113 Ga0501031_0004220
2114 Ga0501034_0157053
2115 Ga0501034_0496662
2116 Ga0501037_0143571
2117 Ga0501080_0526996
2118 Ga0501044_0156297
2119 nmdc:mga0k408_26139_c1
2120 nmdc:mga07m45_1219_c1
2121 nmdc:mga07m45_1806_c2
2122 nmdc:mga07m45_25541_c1
2123 nmdc:mga07m45_51387_c1
2124 Ga0495601_0283984
2125 Ga0500610_0027281
2126 Ga0500610_0028356
2127 Ga0500643_001890
2128 Ga0500651_0000052
2129 Ga0500571_000036
2130 Ga0500594_0001934
2131 Ga0500595_002080
2132 Ga0500608_021702
2133 Ga0500618_000385
2134 Ga0500658_0000033
2135 Ga0500658_0000040
2136 Ga0500658_0016242
2137 Ga0500559_0001604
2138 Ga0500559_0001672
2139 Ga0500564_011334
2140 Ga0500568_0003399
2141 Ga0500574_026443
2142 Ga0500616_0083773
2143 Ga0500619_000329
2144 Ga0500622_0015326
2145 Ga0500634_0024021
2146 Ga0500634_0066608
2147 Ga0500587_000979
2148 Ga0587072_000102
2149 2510249185
2150 2510285086
2151 2510294077
2152 2510313111
2153 2511247648
2154 2511279989
2155 2511303728
2156 2511351024
2157 2511353879
2158 2511360242
2159 2511384179
2160 2513229736
2161 2514047695
2162 2515680544
2163 2521558944
2164 2548497577
2165 2550697194
2166 2553003752
2167 2585145215
2168 2587680961
2169 2587759882
2170 2588212911
2171 2588224186
2172 2590600643
2173 2597030359
2174 2599446361
2175 2599625945
2176 2599674973
2177 2599683867
2178 2599695530
2179 2643866493
2180 2643953290
2181 2643993261
2182 2644021030
2183 2644061306
2184 2644076653
2185 2644294150
2186 2644329567
2187 2644398346
2188 2644646147
2189 2719642406
2190 2729145426
2191 2738701891
2192 2738722423
2193 2738883897
2194 2739243632
2195 2739249127
2196 2739256189
2197 2739282787
2198 2739289826
2199 2739295138
2200 2740061186
2201 2746090610
2202 2746099092
2203 2765568815
2204 2765576359
2205 2774119857
2206 2774128181
2207 2784312213
2208 2808857949
2209 2808926471
2210 2808938209
2211 2808948605
2212 2808966461
2213 2808970323
2214 2808984322
2215 2809001291
2216 2809004830
2217 2809012029
2218 2809130675
2219 2809149847
2220 2816474153
2221 2819542404
2222 2819591352
2223 2819596204
2224 2819615466
2225 2831270454
2226 2831867738
2227 2838056682
2228 2839096301
2229 2842456442
2230 2842681506
2231 2842738414
2232 2842808697
2233 2852620011
2234 2856294497
2235 2857367870
2236 2860339206
2237 2884812340
2238 2884837146
2239 2884853438
2240 2885194082
2241 2885266637
2242 2889293133
2243 2891636911
2244 2894025678
2245 2896155445
2246 2899925585
2247 2900581299
2248 2902687723
2249 2904444615
2250 2904454667
2251 2904460410
2252 2904480370
2253 2904486438
2254 2904534730
2255 2904584619
2256 2904591086
2257 2904605286
2258 2904622351
2259 2917835468
2260 2919048453
2261 2919081025
2262 2919129191
2263 2919464219
2264 2923512605
2265 2928038320
2266 2928046075
2267 2928053774
2268 2928059503
2269 2928067317
2270 2928076284
2271 2928088919
2272 2928119690
2273 2928132636
2274 2928504251
2275 2929524614
2276 2931400839
2277 2932426627
2278 2939589090
2279 2939639890
2280 2945912828
2281 2945947036
2282 2945976722
2283 2945984905
2284 2974299663
2285 2984504482
2286 2990712304
2287 2998347672
2288 8011354140
2289 8019781232
2290 8040172932
2291 8055304436
2292 8056128409

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

56

217

0.98

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

219

346

0.94

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

56

148

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q3c-assembly1.cif.gz_A crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad 0.9858 1 290
3obb-assembly1.cif.gz_A crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 0.9836 2 290
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.9808 1 291
3q3c-assembly1.cif.gz_A crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad 0.9692 1 290
3obb-assembly1.cif.gz_A crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 0.9605 2 290
ID Description Score Start End Superfamily
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9891 2 162 3.40.50.720
af_F1QE62_196_329_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9798 165 293 1.10.1040.10
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9791 3 161 3.40.50.720
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9789 3 158 3.40.50.720
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9778 1 160 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5N7K0K0-F1-model_v4 NAD-binding protein 0.9923 132 291 GO:0006574
GO:0008442
GO:0051287
AF-A0A5J6QHA7-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) 0.9917 2 290 GO:0006574
GO:0008442
GO:0050661
GO:0051287
AF-H0C0K4-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9914 165 291 GO:0016616
GO:0051287
AF-A0A833W004-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) 0.9905 2 292 GO:0005739
GO:0006574
GO:0008442
GO:0050661
GO:0051287
AF-U2A157-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9891 132 290 GO:0016054
GO:0016616
GO:0050661
GO:0051287

Map