F490792
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1146 | 548 | 2292 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300006058|Ga0075432_10077766|Ga0075432_100777662 |
| Length | 352 |
| Sequence | MISAGRRPASAGQELNDAIRCLPATTKRKACKPSSKSVRRISCTADPHSQKVVIMHIGFLGLGNMGGPMARNLLKAGHSLTVFDPFPQAVAALVEAGASAADSPAAVAKAKVEVIITMLPTADHVMQVYRGKDGLLANIGQGVLLIDSSTIDPLSAREVAKFALAQGNPMLDAPVSGGTGGAAAGTLTFMVGGPVSVFDQALPILSAMGRNIVHCGGAGNGQVAKIANNMLLGISMVGVAEAIALGVALGMDAKVLAGVIGTSTGRCWSSEINNPFPGVLENAPASRGYSGGFGTDLMLKDLGLATEAAKHARQPVVLGAAAQQLYQTFSLQGNGGLDFSAIIKLFRGEAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 186 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 187 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 188 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 189 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 190 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 191 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 220 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 221 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 222 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 231 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 232 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 233 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 234 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 235 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 236 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 237 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 238 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 239 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 240 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 241 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 242 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 243 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 244 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 372 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 373 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 374 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 375 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 376 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 389 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 392 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 393 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 396 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 398 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 401 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 402 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 404 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 406 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 407 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 408 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 409 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 410 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 411 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 412 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 413 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 414 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 415 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 416 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 417 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 418 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 419 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 420 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 421 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 422 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 423 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 424 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 425 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 426 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 427 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 428 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 429 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 430 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 431 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 432 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 433 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 434 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 435 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 436 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 437 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 438 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 439 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 440 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 441 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 442 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 443 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 444 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 445 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 446 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 447 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 448 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 449 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 450 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 451 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 452 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 453 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 454 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 455 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 456 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 457 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 458 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 459 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 460 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 461 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 462 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 463 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 464 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 465 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 466 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 467 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 468 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 469 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 470 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 471 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 472 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 473 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 474 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 475 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 476 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 477 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 478 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 479 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 480 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 481 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 482 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 483 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 484 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 485 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 486 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 487 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 488 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 489 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 490 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 491 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 492 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 493 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 494 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 495 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 496 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 497 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 498 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 499 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 500 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 501 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 502 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 503 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 504 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 505 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 506 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 507 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 508 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 509 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 510 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 511 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 512 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 513 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 514 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 515 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 516 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 517 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 518 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 519 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 520 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 521 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 522 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 523 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 524 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 525 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 526 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 527 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 528 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 529 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 530 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 531 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 532 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 533 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 534 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 535 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 536 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 537 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 538 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 539 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 540 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 541 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 542 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 543 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 544 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 545 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 546 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 547 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 548 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.65 |
| Metatranscriptomes | 0.79 |
| Isolates | 12.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 16.84 |
| Nodule | 1.92 |
| Rhizoplane | 2.79 |
| Rhizosphere | 63.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075432_10077766 | 3300006058 | Bacteria | 1199 |
| 2 | MRS2a_Contig_6410 | 2124908027 | Bacteria | 6723 |
| 3 | JGI24740J21852_10000275 | 3300001979 | Bacteria | 21803 |
| 4 | JGI24740J21852_10024395 | 3300001979 | Bacteria | 2052 |
| 5 | JGI25155J39150_1000740 | 3300002704 | Bacteria | 5618 |
| 6 | JGI25155J39150_1000889 | 3300002704 | Bacteria | 4225 |
| 7 | JGI25156J39149_1001996 | 3300002705 | Bacteria | 7822 |
| 8 | JGI25156J39149_1003358 | 3300002705 | Bacteria | 5280 |
| 9 | JGI25156J39149_1009248 | 3300002705 | Bacteria | 2409 |
| 10 | JGI25162J39368_1000369 | 3300002737 | Bacteria | 38411 |
| 11 | JGI25162J39368_1000370 | 3300002737 | Bacteria | 38244 |
| 12 | JGI25154J39366_1000522 | 3300002738 | Bacteria | 19339 |
| 13 | JGI25154J39366_1002282 | 3300002738 | Bacteria | 5183 |
| 14 | JGI25157J39369_1000336 | 3300002741 | Bacteria | 33359 |
| 15 | JGI25152J39213_1002215 | 3300002773 | Bacteria | 7563 |
| 16 | JGI25152J39213_1005545 | 3300002773 | Bacteria | 3640 |
| 17 | JGI25150J39212_1001247 | 3300002774 | Bacteria | 7366 |
| 18 | JGI25150J39212_1001590 | 3300002774 | Bacteria | 6195 |
| 19 | JGI25159J45721_1002135 | 3300002987 | Bacteria | 7731 |
| 20 | JGI25159J45721_1006297 | 3300002987 | Bacteria | 3574 |
| 21 | JGI25151J46595_10004105 | 3300003187 | Bacteria | 7794 |
| 22 | JGI25151J46595_10004592 | 3300003187 | Bacteria | 7274 |
| 23 | JGI25151J46595_10016037 | 3300003187 | Bacteria | 3284 |
| 24 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 25 | JGI25153J46596_10004442 | 3300003215 | Bacteria | 7563 |
| 26 | JGI25153J46596_10006559 | 3300003215 | Bacteria | 5866 |
| 27 | rootH2_10045628 | 3300003320 | Bacteria | 2640 |
| 28 | rootH2_10085097 | 3300003320 | Bacteria | 3806 |
| 29 | rootL2_10022424 | 3300003322 | Bacteria | 13530 |
| 30 | rootL2_10234216 | 3300003322 | Bacteria | 1207 |
| 31 | rootH1_10106878 | 3300003323 | Bacteria | 1338 |
| 32 | JGI25160J50197_1002977 | 3300003354 | Bacteria | 7731 |
| 33 | JGI25160J50197_1009553 | 3300003354 | Bacteria | 3585 |
| 34 | JGI25161J50226_1001358 | 3300003374 | Bacteria | 7527 |
| 35 | JGI25161J50226_1004239 | 3300003374 | Bacteria | 3045 |
| 36 | Ga0006562J51391_1033784 | 3300003578 | Bacteria | 7163 |
| 37 | Ga0006562J51391_1033786 | 3300003578 | Bacteria | 3270 |
| 38 | Ga0006562J51391_1036841 | 3300003578 | Bacteria | 2530 |
| 39 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 40 | Ga0055538_1000255 | 3300003751 | Bacteria | 28208 |
| 41 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 42 | Ga0055539_1000059 | 3300003752 | Bacteria | 146394 |
| 43 | Ga0055539_1000288 | 3300003752 | Bacteria | 28208 |
| 44 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 45 | Ga0055533_1000273 | 3300003756 | Bacteria | 28208 |
| 46 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 47 | Ga0055532_1000025 | 3300003758 | Bacteria | 240145 |
| 48 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 49 | Ga0055525_1000372 | 3300003759 | Bacteria | 29628 |
| 50 | Ga0055525_1000389 | 3300003759 | Bacteria | 28208 |
| 51 | Ga0055535_1000019 | 3300003761 | Bacteria | 240145 |
| 52 | Ga0055535_1000215 | 3300003761 | Bacteria | 61211 |
| 53 | Ga0055535_1009321 | 3300003761 | Bacteria | 1701 |
| 54 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 55 | Ga0055542_1001074 | 3300003762 | Bacteria | 16816 |
| 56 | Ga0055529_1000035 | 3300003763 | Bacteria | 240145 |
| 57 | Ga0055526_1003413 | 3300003771 | Bacteria | 10097 |
| 58 | Ga0055526_1005028 | 3300003771 | Bacteria | 7731 |
| 59 | Ga0055537_1001816 | 3300003773 | Bacteria | 7731 |
| 60 | Ga0055524_1000109 | 3300003775 | Bacteria | 100308 |
| 61 | Ga0055524_1003044 | 3300003775 | Bacteria | 8295 |
| 62 | Ga0055524_1003404 | 3300003775 | Bacteria | 7731 |
| 63 | Ga0055536_1001609 | 3300003781 | Bacteria | 13474 |
| 64 | Ga0055536_1003572 | 3300003781 | Bacteria | 8312 |
| 65 | Ga0055536_1006289 | 3300003781 | Bacteria | 5587 |
| 66 | Ga0055536_1023079 | 3300003781 | Bacteria | 1838 |
| 67 | Ga0055534_1001943 | 3300003784 | Bacteria | 7587 |
| 68 | Ga0055528_1003588 | 3300003790 | Bacteria | 7731 |
| 69 | Ga0055530_10001847 | 3300003791 | Bacteria | 14560 |
| 70 | Ga0055530_10004499 | 3300003791 | Bacteria | 7145 |
| 71 | Ga0055530_10028296 | 3300003791 | Bacteria | 1515 |
| 72 | Ga0055540_1000408 | 3300003792 | Bacteria | 34822 |
| 73 | Ga0055540_1001457 | 3300003792 | Bacteria | 14106 |
| 74 | Ga0055540_1003628 | 3300003792 | Bacteria | 7363 |
| 75 | Ga0055540_1005917 | 3300003792 | Bacteria | 4990 |
| 76 | Ga0055540_1045228 | 3300003792 | Bacteria | 931 |
| 77 | Ga0055531_10001899 | 3300003794 | Bacteria | 14631 |
| 78 | Ga0055531_10003404 | 3300003794 | Bacteria | 10163 |
| 79 | Ga0055531_10009281 | 3300003794 | Bacteria | 5050 |
| 80 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 81 | Ga0055541_1000187 | 3300003841 | Bacteria | 28208 |
| 82 | Ga0055541_1007448 | 3300003841 | Bacteria | 1795 |
| 83 | Ga0055543_1001655 | 3300004625 | Bacteria | 8481 |
| 84 | Ga0055543_1001835 | 3300004625 | Bacteria | 7773 |
| 85 | Ga0065165_1005005 | 3300005262 | Bacteria | 7769 |
| 86 | Ga0065165_1006473 | 3300005262 | Bacteria | 6126 |
| 87 | Ga0065714_10000250 | 3300005288 | Bacteria | 6675 |
| 88 | Ga0065714_10004039 | 3300005288 | Bacteria | 10143 |
| 89 | Ga0065714_10064584 | 3300005288 | Bacteria | 32069 |
| 90 | Ga0065704_10085551 | 3300005289 | Bacteria | 3211 |
| 91 | Ga0065704_10120439 | 3300005289 | Bacteria | 1783 |
| 92 | Ga0065712_10001860 | 3300005290 | Bacteria | 5886 |
| 93 | Ga0065715_10009160 | 3300005293 | Bacteria | 2734 |
| 94 | Ga0070658_10002173 | 3300005327 | Bacteria | 16454 |
| 95 | Ga0070690_100326244 | 3300005330 | Bacteria | 1108 |
| 96 | Ga0068869_100300229 | 3300005334 | Bacteria | 1296 |
| 97 | Ga0070682_100000175 | 3300005337 | Bacteria | 47814 |
| 98 | Ga0070682_100358758 | 3300005337 | Bacteria | 1089 |
| 99 | Ga0070660_100184238 | 3300005339 | Bacteria | 1690 |
| 100 | Ga0070691_10077359 | 3300005341 | Bacteria | 1624 |
| 101 | Ga0070661_100000767 | 3300005344 | Bacteria | 23151 |
| 102 | Ga0070661_100000769 | 3300005344 | Bacteria | 23131 |
| 103 | Ga0070668_100562095 | 3300005347 | Bacteria | 994 |
| 104 | Ga0070669_100020846 | 3300005353 | Bacteria | 4682 |
| 105 | Ga0070675_100059478 | 3300005354 | Bacteria | 3152 |
| 106 | Ga0070674_100086439 | 3300005356 | Bacteria | 2253 |
| 107 | Ga0070659_100003572 | 3300005366 | Bacteria | 11070 |
| 108 | Ga0070659_100231782 | 3300005366 | Bacteria | 1526 |
| 109 | Ga0070667_100020167 | 3300005367 | Bacteria | 5534 |
| 110 | Ga0070667_100474452 | 3300005367 | Bacteria | 1145 |
| 111 | Ga0070701_10234224 | 3300005438 | Bacteria | 1101 |
| 112 | Ga0070663_100000009 | 3300005455 | Bacteria | 187718 |
| 113 | Ga0070678_100054293 | 3300005456 | Bacteria | 2919 |
| 114 | Ga0070678_100300932 | 3300005456 | Bacteria | 1363 |
| 115 | Ga0070662_100002684 | 3300005457 | Bacteria | 10977 |
| 116 | Ga0070662_100089639 | 3300005457 | Bacteria | 2307 |
| 117 | Ga0070672_100351298 | 3300005543 | Bacteria | 1257 |
| 118 | Ga0070672_100489457 | 3300005543 | Bacteria | 1063 |
| 119 | Ga0070665_100241195 | 3300005548 | Bacteria | 1808 |
| 120 | Ga0068855_100000526 | 3300005563 | Bacteria | 46919 |
| 121 | Ga0068855_100009723 | 3300005563 | Bacteria | 11605 |
| 122 | Ga0068855_100245073 | 3300005563 | Bacteria | 2000 |
| 123 | Ga0070664_100000010 | 3300005564 | Bacteria | 165664 |
| 124 | Ga0070664_100050800 | 3300005564 | Bacteria | 3510 |
| 125 | Ga0070664_100051488 | 3300005564 | Bacteria | 3487 |
| 126 | Ga0068857_100036269 | 3300005577 | Bacteria | 4369 |
| 127 | Ga0068854_100000017 | 3300005578 | Bacteria | 142796 |
| 128 | Ga0068854_100002811 | 3300005578 | Bacteria | 10820 |
| 129 | Ga0068856_100000069 | 3300005614 | Bacteria | 95628 |
| 130 | Ga0068852_100034306 | 3300005616 | Bacteria | 4220 |
| 131 | Ga0068852_100200450 | 3300005616 | Bacteria | 1888 |
| 132 | Ga0068852_100385353 | 3300005616 | Bacteria | 1376 |
| 133 | Ga0068851_10064492 | 3300005834 | Bacteria | 1883 |
| 134 | Ga0075363_100119461 | 3300006048 | Bacteria | 1471 |
| 135 | Ga0075364_10001331 | 3300006051 | Bacteria | 13297 |
| 136 | Ga0075364_10001778 | 3300006051 | Bacteria | 11926 |
| 137 | Ga0075432_10000580 | 3300006058 | Bacteria | 11042 |
| 138 | Ga0075432_10000757 | 3300006058 | Bacteria | 10035 |
| 139 | Ga0075432_10015678 | 3300006058 | Bacteria | 2585 |
| 140 | Ga0075432_10063717 | 3300006058 | Bacteria | 1316 |
| 141 | Ga0070712_100003321 | 3300006175 | Bacteria | 9891 |
| 142 | Ga0075362_10001714 | 3300006177 | Bacteria | 7108 |
| 143 | Ga0075369_10044618 | 3300006186 | Bacteria | 1905 |
| 144 | Ga0075370_10001452 | 3300006353 | Bacteria | 10291 |
| 145 | Ga0075370_10017786 | 3300006353 | Bacteria | 3845 |
| 146 | Ga0075370_10028586 | 3300006353 | Bacteria | 3100 |
| 147 | Ga0075370_10061894 | 3300006353 | Bacteria | 2132 |
| 148 | Ga0068865_100388775 | 3300006881 | Bacteria | 1140 |
| 149 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 150 | Ga0079104_1000276 | 3300006946 | Bacteria | 66810 |
| 151 | Ga0105251_10002438 | 3300009011 | Bacteria | 14633 |
| 152 | Ga0105251_10024172 | 3300009011 | Bacteria | 3123 |
| 153 | Ga0105251_10040737 | 3300009011 | Bacteria | 2264 |
| 154 | Ga0105251_10115783 | 3300009011 | Bacteria | 1219 |
| 155 | Ga0105244_10000775 | 3300009036 | Bacteria | 27296 |
| 156 | Ga0105244_10001886 | 3300009036 | Bacteria | 16292 |
| 157 | Ga0105244_10041540 | 3300009036 | Bacteria | 2382 |
| 158 | Ga0105244_10056822 | 3300009036 | Bacteria | 1979 |
| 159 | Ga0105244_10178129 | 3300009036 | Bacteria | 1009 |
| 160 | Ga0105250_10002637 | 3300009092 | Bacteria | 8909 |
| 161 | Ga0105250_10014086 | 3300009092 | Bacteria | 3291 |
| 162 | Ga0105240_10000497 | 3300009093 | Bacteria | 72381 |
| 163 | Ga0105240_10031065 | 3300009093 | Bacteria | 6931 |
| 164 | Ga0105240_10129678 | 3300009093 | Bacteria | 3026 |
| 165 | Ga0105240_10653354 | 3300009093 | Bacteria | 1152 |
| 166 | Ga0105243_10000588 | 3300009148 | Bacteria | 36466 |
| 167 | Ga0105243_10012543 | 3300009148 | Bacteria | 6409 |
| 168 | Ga0105243_10063016 | 3300009148 | Bacteria | 2970 |
| 169 | Ga0105243_10131262 | 3300009148 | Bacteria | 2125 |
| 170 | Ga0105243_10337434 | 3300009148 | Bacteria | 1379 |
| 171 | Ga0105237_10003695 | 3300009545 | Bacteria | 18037 |
| 172 | Ga0105237_10417715 | 3300009545 | Bacteria | 1347 |
| 173 | Ga0105238_10000117 | 3300009551 | Bacteria | 89001 |
| 174 | Ga0105238_10049693 | 3300009551 | Bacteria | 4223 |
| 175 | Ga0105238_10244084 | 3300009551 | Bacteria | 1774 |
| 176 | Ga0105249_10138083 | 3300009553 | Bacteria | 2335 |
| 177 | Ga0105249_10453187 | 3300009553 | Bacteria | 1322 |
| 178 | Ga0105239_10091600 | 3300010375 | Bacteria | 3355 |
| 179 | Ga0105246_10118211 | 3300011119 | Bacteria | 1960 |
| 180 | Ga0157339_1003179 | 3300012505 | Bacteria | 1169 |
| 181 | Ga0157373_10014005 | 3300013100 | Bacteria | 5879 |
| 182 | Ga0157373_10022728 | 3300013100 | Bacteria | 4548 |
| 183 | Ga0157373_10033887 | 3300013100 | Bacteria | 3669 |
| 184 | Ga0157373_10050217 | 3300013100 | Bacteria | 2971 |
| 185 | Ga0157371_10000033 | 3300013102 | Bacteria | 225328 |
| 186 | Ga0157371_10002234 | 3300013102 | Bacteria | 18717 |
| 187 | Ga0157371_10003692 | 3300013102 | Bacteria | 13743 |
| 188 | Ga0157371_10006955 | 3300013102 | Bacteria | 9215 |
| 189 | Ga0157371_10020177 | 3300013102 | Bacteria | 4905 |
| 190 | Ga0157370_10000010 | 3300013104 | Bacteria | 218199 |
| 191 | Ga0157370_10000055 | 3300013104 | Bacteria | 118355 |
| 192 | Ga0157370_10000372 | 3300013104 | Bacteria | 56499 |
| 193 | Ga0157370_10015682 | 3300013104 | Bacteria | 7696 |
| 194 | Ga0157370_10015692 | 3300013104 | Bacteria | 7694 |
| 195 | Ga0157370_10270775 | 3300013104 | Bacteria | 1569 |
| 196 | Ga0157369_10000093 | 3300013105 | Bacteria | 122566 |
| 197 | Ga0157369_10000665 | 3300013105 | Bacteria | 44336 |
| 198 | Ga0157369_10015219 | 3300013105 | Bacteria | 8683 |
| 199 | Ga0157369_10061241 | 3300013105 | Bacteria | 4058 |
| 200 | Ga0157369_10238705 | 3300013105 | Bacteria | 1899 |
| 201 | Ga0157378_10441404 | 3300013297 | Bacteria | 1290 |
| 202 | Ga0163162_10002312 | 3300013306 | Bacteria | 17879 |
| 203 | Ga0163162_10108037 | 3300013306 | Bacteria | 2878 |
| 204 | Ga0157372_10001138 | 3300013307 | Bacteria | 28923 |
| 205 | Ga0157372_10639833 | 3300013307 | Bacteria | 1239 |
| 206 | Ga0182008_10000494 | 3300014497 | Bacteria | 29731 |
| 207 | Ga0182008_10004710 | 3300014497 | Bacteria | 7912 |
| 208 | Ga0182008_10007370 | 3300014497 | Bacteria | 6080 |
| 209 | Ga0182008_10024459 | 3300014497 | Bacteria | 3075 |
| 210 | Ga0182008_10025372 | 3300014497 | Bacteria | 3010 |
| 211 | Ga0182008_10097064 | 3300014497 | Bacteria | 1455 |
| 212 | Ga0157379_10345012 | 3300014968 | Bacteria | 1362 |
| 213 | Ga0182006_1001948 | 3300015261 | Bacteria | 11716 |
| 214 | Ga0182006_1005485 | 3300015261 | Bacteria | 6041 |
| 215 | Ga0182006_1006078 | 3300015261 | Bacteria | 5646 |
| 216 | Ga0182006_1007977 | 3300015261 | Bacteria | 4812 |
| 217 | Ga0182006_1015536 | 3300015261 | Bacteria | 3263 |
| 218 | Ga0182006_1015571 | 3300015261 | Bacteria | 3258 |
| 219 | Ga0182006_1019964 | 3300015261 | Bacteria | 2813 |
| 220 | Ga0182006_1029274 | 3300015261 | Bacteria | 2232 |
| 221 | Ga0182006_1075071 | 3300015261 | Bacteria | 1245 |
| 222 | Ga0182007_10001204 | 3300015262 | Bacteria | 14045 |
| 223 | Ga0182007_10003889 | 3300015262 | Bacteria | 6925 |
| 224 | Ga0182007_10011950 | 3300015262 | Bacteria | 3355 |
| 225 | Ga0182005_1000351 | 3300015265 | Bacteria | 26159 |
| 226 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 227 | Ga0163161_10000060 | 3300017792 | Bacteria | 112916 |
| 228 | Ga0163161_10041431 | 3300017792 | Bacteria | 3309 |
| 229 | Ga0163161_10053743 | 3300017792 | Bacteria | 2921 |
| 230 | Ga0163161_10059503 | 3300017792 | Bacteria | 2778 |
| 231 | Ga0163161_10293593 | 3300017792 | Bacteria | 1278 |
| 232 | Ga0206351_10970006 | 3300020077 | Bacteria | 8596 |
| 233 | Ga0206350_11606970 | 3300020080 | Bacteria | 1085 |
| 234 | Ga0206353_10422469 | 3300020082 | Bacteria | 5620 |
| 235 | Ga0154015_1175498 | 3300020610 | Bacteria | 9266 |
| 236 | Ga0213872_10002036 | 3300021361 | Bacteria | 12286 |
| 237 | Ga0213872_10009541 | 3300021361 | Bacteria | 4653 |
| 238 | Ga0213872_10013428 | 3300021361 | Bacteria | 3837 |
| 239 | Ga0213872_10028339 | 3300021361 | Bacteria | 2568 |
| 240 | Ga0224712_10000006 | 3300022467 | Bacteria | 30817 |
| 241 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 242 | Ga0209435_104520 | 3300025206 | Bacteria | 1572 |
| 243 | Ga0209760_101527 | 3300025207 | Bacteria | 2400 |
| 244 | Ga0209436_101334 | 3300025208 | Bacteria | 8739 |
| 245 | Ga0209436_103436 | 3300025208 | Bacteria | 4216 |
| 246 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 247 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 248 | Ga0209784_100281 | 3300025224 | Bacteria | 28775 |
| 249 | Ga0209784_100461 | 3300025224 | Bacteria | 17042 |
| 250 | Ga0209784_100809 | 3300025224 | Bacteria | 7208 |
| 251 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 252 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 253 | Ga0209566_100473 | 3300025225 | Bacteria | 28775 |
| 254 | Ga0209566_100805 | 3300025225 | Bacteria | 16357 |
| 255 | Ga0209566_100952 | 3300025225 | Bacteria | 13060 |
| 256 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 257 | Ga0209674_100045 | 3300025226 | Bacteria | 362387 |
| 258 | Ga0209674_100114 | 3300025226 | Bacteria | 139197 |
| 259 | Ga0209674_100330 | 3300025226 | Bacteria | 28775 |
| 260 | Ga0209672_102145 | 3300025228 | Bacteria | 5230 |
| 261 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 262 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 263 | Ga0209147_100769 | 3300025229 | Bacteria | 15688 |
| 264 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 265 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 266 | Ga0209563_100218 | 3300025230 | Bacteria | 28775 |
| 267 | Ga0209563_105701 | 3300025230 | Bacteria | 2224 |
| 268 | Ga0207427_100639 | 3300025231 | Bacteria | 16992 |
| 269 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 270 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 271 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 272 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 273 | Ga0209258_100210 | 3300025242 | Bacteria | 117131 |
| 274 | Ga0207425_1000180 | 3300025245 | Bacteria | 52117 |
| 275 | Ga0207425_1032436 | 3300025245 | Bacteria | 1034 |
| 276 | Ga0209646_1000027 | 3300025246 | Bacteria | 395141 |
| 277 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 278 | Ga0209646_1000200 | 3300025246 | Bacteria | 71297 |
| 279 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 280 | Ga0209026_1002370 | 3300025250 | Bacteria | 7128 |
| 281 | Ga0209026_1009929 | 3300025250 | Bacteria | 1819 |
| 282 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 283 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 284 | Ga0209677_100350 | 3300025253 | Bacteria | 28775 |
| 285 | Ga0209677_107624 | 3300025253 | Bacteria | 2258 |
| 286 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 287 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 288 | Ga0209759_1000045 | 3300025256 | Bacteria | 235654 |
| 289 | Ga0209759_1002029 | 3300025256 | Bacteria | 9571 |
| 290 | Ga0209759_1007962 | 3300025256 | Bacteria | 3350 |
| 291 | Ga0209129_1000111 | 3300025258 | Bacteria | 148853 |
| 292 | Ga0209129_1001197 | 3300025258 | Bacteria | 14948 |
| 293 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 294 | Ga0209565_1000110 | 3300025263 | Bacteria | 119879 |
| 295 | Ga0209565_1001804 | 3300025263 | Bacteria | 8626 |
| 296 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 297 | Ga0209455_1007159 | 3300025272 | Bacteria | 3186 |
| 298 | Ga0209673_1000175 | 3300025273 | Bacteria | 131239 |
| 299 | Ga0209673_1000944 | 3300025273 | Bacteria | 36333 |
| 300 | Ga0209673_1000992 | 3300025273 | Bacteria | 34667 |
| 301 | Ga0209673_1001347 | 3300025273 | Bacteria | 24544 |
| 302 | Ga0209130_1000205 | 3300025284 | Bacteria | 79260 |
| 303 | Ga0209130_1000332 | 3300025284 | Bacteria | 54263 |
| 304 | Ga0209675_1000192 | 3300025291 | Bacteria | 66905 |
| 305 | Ga0209675_1003468 | 3300025291 | Bacteria | 7476 |
| 306 | Ga0209675_1009747 | 3300025291 | Bacteria | 3358 |
| 307 | Ga0209675_1017748 | 3300025291 | Bacteria | 2021 |
| 308 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 309 | Ga0209676_1000356 | 3300025292 | Bacteria | 86657 |
| 310 | Ga0209676_1003888 | 3300025292 | Bacteria | 8709 |
| 311 | Ga0209676_1044656 | 3300025292 | Bacteria | 1213 |
| 312 | Ga0209025_1000096 | 3300025294 | Bacteria | 239153 |
| 313 | Ga0209025_1000116 | 3300025294 | Bacteria | 218293 |
| 314 | Ga0209025_1027245 | 3300025294 | Bacteria | 2839 |
| 315 | Ga0209564_1000155 | 3300025295 | Bacteria | 165859 |
| 316 | Ga0209564_1000298 | 3300025295 | Bacteria | 99805 |
| 317 | Ga0209758_1000107 | 3300025297 | Bacteria | 218293 |
| 318 | Ga0209758_1009267 | 3300025297 | Bacteria | 6160 |
| 319 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 320 | Ga0209050_1000155 | 3300025298 | Bacteria | 159095 |
| 321 | Ga0209050_1000575 | 3300025298 | Bacteria | 59696 |
| 322 | Ga0209050_1003630 | 3300025298 | Bacteria | 11172 |
| 323 | Ga0209050_1022292 | 3300025298 | Bacteria | 2272 |
| 324 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 325 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 326 | Ga0209256_1000087 | 3300025299 | Bacteria | 218290 |
| 327 | Ga0207426_1000090 | 3300025302 | Bacteria | 280662 |
| 328 | Ga0207426_1000123 | 3300025302 | Bacteria | 218290 |
| 329 | Ga0207426_1001768 | 3300025302 | Bacteria | 16308 |
| 330 | Ga0207426_1032945 | 3300025302 | Bacteria | 1675 |
| 331 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 332 | Ga0209051_1000073 | 3300025303 | Bacteria | 208874 |
| 333 | Ga0209051_1000092 | 3300025303 | Bacteria | 170056 |
| 334 | Ga0209051_1000598 | 3300025303 | Bacteria | 42554 |
| 335 | Ga0209051_1001817 | 3300025303 | Bacteria | 16890 |
| 336 | Ga0209051_1005786 | 3300025303 | Bacteria | 7118 |
| 337 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 338 | Ga0209257_1000139 | 3300025304 | Bacteria | 202285 |
| 339 | Ga0209257_1000576 | 3300025304 | Bacteria | 61751 |
| 340 | Ga0209257_1000870 | 3300025304 | Bacteria | 42856 |
| 341 | Ga0207656_10010379 | 3300025321 | Bacteria | 3488 |
| 342 | Ga0207696_1008369 | 3300025711 | Bacteria | 3967 |
| 343 | Ga0207696_1024868 | 3300025711 | Bacteria | 1873 |
| 344 | Ga0207655_1002169 | 3300025728 | Bacteria | 16356 |
| 345 | Ga0207655_1002182 | 3300025728 | Bacteria | 16254 |
| 346 | Ga0207655_1033787 | 3300025728 | Bacteria | 2312 |
| 347 | Ga0207713_1006007 | 3300025735 | Bacteria | 7485 |
| 348 | Ga0207713_1009327 | 3300025735 | Bacteria | 5542 |
| 349 | Ga0207713_1024270 | 3300025735 | Bacteria | 2831 |
| 350 | Ga0207645_10163938 | 3300025907 | Bacteria | 1455 |
| 351 | Ga0207705_10002977 | 3300025909 | Bacteria | 12937 |
| 352 | Ga0207695_10001142 | 3300025913 | Bacteria | 46029 |
| 353 | Ga0207695_10012413 | 3300025913 | Bacteria | 10229 |
| 354 | Ga0207671_10007218 | 3300025914 | Bacteria | 9678 |
| 355 | Ga0207693_10012704 | 3300025915 | Bacteria | 6801 |
| 356 | Ga0207657_10177300 | 3300025919 | Bacteria | 1724 |
| 357 | Ga0207649_10000463 | 3300025920 | Bacteria | 29184 |
| 358 | Ga0207649_10001113 | 3300025920 | Bacteria | 16303 |
| 359 | Ga0207649_10124093 | 3300025920 | Bacteria | 1745 |
| 360 | Ga0207681_10014629 | 3300025923 | Bacteria | 4883 |
| 361 | Ga0207694_10000103 | 3300025924 | Bacteria | 92553 |
| 362 | Ga0207694_10169094 | 3300025924 | Bacteria | 1769 |
| 363 | Ga0207694_10256178 | 3300025924 | Bacteria | 1433 |
| 364 | Ga0207659_10250138 | 3300025926 | Bacteria | 1438 |
| 365 | Ga0207690_10004528 | 3300025932 | Bacteria | 8209 |
| 366 | Ga0207690_10036454 | 3300025932 | Bacteria | 3185 |
| 367 | Ga0207690_10358862 | 3300025932 | Bacteria | 1154 |
| 368 | Ga0207706_10019491 | 3300025933 | Bacteria | 6103 |
| 369 | Ga0207706_10078135 | 3300025933 | Bacteria | 2911 |
| 370 | Ga0207709_10000353 | 3300025935 | Bacteria | 46902 |
| 371 | Ga0207709_10001645 | 3300025935 | Bacteria | 15124 |
| 372 | Ga0207709_10036454 | 3300025935 | Bacteria | 2914 |
| 373 | Ga0207709_10060254 | 3300025935 | Bacteria | 2366 |
| 374 | Ga0207709_10121767 | 3300025935 | Bacteria | 1762 |
| 375 | Ga0207704_10548860 | 3300025938 | Bacteria | 939 |
| 376 | Ga0207691_10199935 | 3300025940 | Bacteria | 1740 |
| 377 | Ga0207711_10014842 | 3300025941 | Bacteria | 6472 |
| 378 | Ga0207689_10246475 | 3300025942 | Bacteria | 1477 |
| 379 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 380 | Ga0207679_10000533 | 3300025945 | Bacteria | 25744 |
| 381 | Ga0207679_10180827 | 3300025945 | Bacteria | 1744 |
| 382 | Ga0207667_10000073 | 3300025949 | Bacteria | 174391 |
| 383 | Ga0207667_10000076 | 3300025949 | Bacteria | 166704 |
| 384 | Ga0207667_10000147 | 3300025949 | Bacteria | 106918 |
| 385 | Ga0207667_10000166 | 3300025949 | Bacteria | 97376 |
| 386 | Ga0207667_10001488 | 3300025949 | Bacteria | 29411 |
| 387 | Ga0207667_10126447 | 3300025949 | Bacteria | 2633 |
| 388 | Ga0207667_10582762 | 3300025949 | Bacteria | 1129 |
| 389 | Ga0207712_10082844 | 3300025961 | Bacteria | 2339 |
| 390 | Ga0207640_10003888 | 3300025981 | Bacteria | 8063 |
| 391 | Ga0207658_10082854 | 3300025986 | Bacteria | 2464 |
| 392 | Ga0207658_10330294 | 3300025986 | Bacteria | 1322 |
| 393 | Ga0207677_10143188 | 3300026023 | Bacteria | 1833 |
| 394 | Ga0207703_10046150 | 3300026035 | Bacteria | 3508 |
| 395 | Ga0207639_10205885 | 3300026041 | Bacteria | 1690 |
| 396 | Ga0207639_10655920 | 3300026041 | Bacteria | 971 |
| 397 | Ga0207678_10000015 | 3300026067 | Bacteria | 138937 |
| 398 | Ga0207702_10000053 | 3300026078 | Bacteria | 137538 |
| 399 | Ga0207648_10083787 | 3300026089 | Bacteria | 2781 |
| 400 | Ga0207648_10169854 | 3300026089 | Bacteria | 1927 |
| 401 | Ga0207683_10031804 | 3300026121 | Bacteria | 4581 |
| 402 | Ga0207683_10074997 | 3300026121 | Bacteria | 2994 |
| 403 | Ga0207683_10472411 | 3300026121 | Bacteria | 1157 |
| 404 | Ga0207698_10090797 | 3300026142 | Bacteria | 2499 |
| 405 | Ga0209281_1000055 | 3300027111 | Bacteria | 308297 |
| 406 | Ga0209281_1000057 | 3300027111 | Bacteria | 307145 |
| 407 | Ga0209983_1001261 | 3300027665 | Bacteria | 5626 |
| 408 | Ga0209971_1001963 | 3300027682 | Bacteria | 5014 |
| 409 | Ga0209971_1032372 | 3300027682 | Bacteria | 1255 |
| 410 | Ga0207428_10005518 | 3300027907 | Bacteria | 11784 |
| 411 | Ga0207428_10056681 | 3300027907 | Bacteria | 3112 |
| 412 | Ga0207428_10081256 | 3300027907 | Bacteria | 2531 |
| 413 | Ga0268266_10282896 | 3300028379 | Bacteria | 1543 |
| 414 | Ga0265334_10035702 | 3300028573 | Bacteria | 1966 |
| 415 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 416 | Ga0307515_10000109 | 3300028794 | Bacteria | 195895 |
| 417 | Ga0307515_10010767 | 3300028794 | Bacteria | 17455 |
| 418 | Ga0307515_10018244 | 3300028794 | Bacteria | 12726 |
| 419 | Ga0307515_10030494 | 3300028794 | Bacteria | 9051 |
| 420 | Ga0307515_10133994 | 3300028794 | Bacteria | 2707 |
| 421 | Ga0307515_10229916 | 3300028794 | Bacteria | 1650 |
| 422 | Ga0307512_10013840 | 3300030522 | Bacteria | 7539 |
| 423 | Ga0316177_1124424 | 3300030731 | Bacteria | 4941 |
| 424 | Ga0316176_1202515 | 3300030732 | Bacteria | 3104 |
| 425 | Ga0314311_1048379 | 3300030733 | Bacteria | 2959 |
| 426 | Ga0316180_1154980 | 3300030736 | Bacteria | 1450 |
| 427 | Ga0316183_1077578 | 3300030742 | Bacteria | 7591 |
| 428 | Ga0316181_1010717 | 3300030744 | Bacteria | 1638 |
| 429 | Ga0265330_10000059 | 3300031235 | Bacteria | 97975 |
| 430 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 431 | Ga0265325_10009004 | 3300031241 | Bacteria | 5860 |
| 432 | Ga0265327_10000842 | 3300031251 | Bacteria | 45767 |
| 433 | Ga0265327_10003824 | 3300031251 | Bacteria | 13916 |
| 434 | Ga0307513_10000990 | 3300031456 | Bacteria | 41065 |
| 435 | Ga0307513_10021840 | 3300031456 | Bacteria | 7544 |
| 436 | Ga0307513_10039886 | 3300031456 | Bacteria | 5199 |
| 437 | Ga0307513_10064222 | 3300031456 | Bacteria | 3870 |
| 438 | Ga0307513_10175158 | 3300031456 | Bacteria | 2017 |
| 439 | Ga0307513_10259306 | 3300031456 | Bacteria | 1529 |
| 440 | Ga0307509_10085885 | 3300031507 | Bacteria | 3237 |
| 441 | Ga0307408_100030750 | 3300031548 | Bacteria | 3731 |
| 442 | Ga0307408_100193231 | 3300031548 | Bacteria | 1641 |
| 443 | Ga0307508_10000101 | 3300031616 | Bacteria | 100858 |
| 444 | Ga0307514_10000225 | 3300031649 | Bacteria | 151002 |
| 445 | Ga0307514_10006401 | 3300031649 | Bacteria | 10269 |
| 446 | Ga0307514_10008985 | 3300031649 | Bacteria | 8442 |
| 447 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 448 | Ga0316576_10208691 | 3300031727 | Bacteria | 1470 |
| 449 | Ga0316576_10337668 | 3300031727 | Bacteria | 1122 |
| 450 | Ga0316578_10177242 | 3300031728 | Bacteria | 1285 |
| 451 | Ga0316578_10209631 | 3300031728 | Bacteria | 1172 |
| 452 | Ga0307516_10011288 | 3300031730 | Bacteria | 9730 |
| 453 | Ga0307405_10191829 | 3300031731 | Bacteria | 1476 |
| 454 | Ga0307406_10001953 | 3300031901 | Bacteria | 11263 |
| 455 | Ga0307407_10282677 | 3300031903 | Bacteria | 1150 |
| 456 | Ga0307412_10031599 | 3300031911 | Bacteria | 3345 |
| 457 | Ga0307416_100025521 | 3300032002 | Bacteria | 4333 |
| 458 | Ga0307416_100088997 | 3300032002 | Bacteria | 2642 |
| 459 | Ga0307414_10022867 | 3300032004 | Bacteria | 3952 |
| 460 | Ga0316574_0011223 | 3300035398 | Bacteria | 5087 |
| 461 | Ga0316584_0043873 | 3300036712 | Bacteria | 3335 |
| 462 | Ga0395899_0000023 | 3300037312 | Bacteria | 367159 |
| 463 | Ga0395899_0033546 | 3300037312 | Bacteria | 3855 |
| 464 | Ga0395900_0000019 | 3300037418 | Bacteria | 357240 |
| 465 | Ga0395900_0000146 | 3300037418 | Bacteria | 118779 |
| 466 | Ga0395900_0008274 | 3300037418 | Bacteria | 10704 |
| 467 | Ga0395900_0044793 | 3300037418 | Bacteria | 4558 |
| 468 | Ga0395900_0046317 | 3300037418 | Bacteria | 4477 |
| 469 | Ga0395898_0000016 | 3300037466 | Bacteria | 435585 |
| 470 | Ga0395898_0000617 | 3300037466 | Bacteria | 65254 |
| 471 | Ga0395898_0070883 | 3300037466 | Bacteria | 3368 |
| 472 | Ga0395901_0000004 | 3300038443 | Bacteria | 657361 |
| 473 | Ga0395901_0000326 | 3300038443 | Bacteria | 58686 |
| 474 | Ga0395901_0002868 | 3300038443 | Bacteria | 17405 |
| 475 | Ga0436361_0106476 | 3300039447 | Bacteria | 19218 |
| 476 | Ga0436361_0272349 | 3300039447 | Bacteria | 22942 |
| 477 | Ga0436361_0325069 | 3300039447 | Bacteria | 7873 |
| 478 | Ga0436361_1051926 | 3300039447 | Bacteria | 23370 |
| 479 | Ga0436361_1073848 | 3300039447 | Bacteria | 2843 |
| 480 | Ga0436361_1080802 | 3300039447 | Bacteria | 4291 |
| 481 | Ga0439436_0000305 | 3300041404 | Bacteria | 11948 |
| 482 | Ga0439436_0000469 | 3300041404 | Bacteria | 10388 |
| 483 | Ga0439438_004004 | 3300041405 | Bacteria | 5786 |
| 484 | Ga0439438_018382 | 3300041405 | Bacteria | 1992 |
| 485 | Ga0439439_0030749 | 3300041406 | Bacteria | 1366 |
| 486 | Ga0439447_000006 | 3300041407 | Bacteria | 101894 |
| 487 | Ga0439447_000080 | 3300041407 | Bacteria | 34054 |
| 488 | Ga0439447_000235 | 3300041407 | Bacteria | 19642 |
| 489 | Ga0439447_000632 | 3300041407 | Bacteria | 13107 |
| 490 | Ga0439447_000765 | 3300041407 | Bacteria | 11888 |
| 491 | Ga0439466_0001045 | 3300041411 | Bacteria | 10692 |
| 492 | Ga0439466_0003209 | 3300041411 | Bacteria | 6369 |
| 493 | Ga0439466_0004351 | 3300041411 | Bacteria | 5462 |
| 494 | Ga0439466_0006387 | 3300041411 | Bacteria | 4483 |
| 495 | Ga0439465_0004405 | 3300041413 | Bacteria | 4554 |
| 496 | Ga0439465_0055628 | 3300041413 | Bacteria | 1303 |
| 497 | Ga0451800_1156584 | 3300041459 | Bacteria | 1381 |
| 498 | Ga0451853_2167458 | 3300041512 | Bacteria | 1427 |
| 499 | Ga0439433_0000296 | 3300041999 | Bacteria | 8605 |
| 500 | Ga0439445_0000826 | 3300042004 | Bacteria | 6542 |
| 501 | Ga0439445_0008083 | 3300042004 | Bacteria | 2455 |
| 502 | Ga0439432_002294 | 3300042006 | Bacteria | 7213 |
| 503 | Ga0439432_002407 | 3300042006 | Bacteria | 7059 |
| 504 | Ga0439432_014129 | 3300042006 | Bacteria | 2704 |
| 505 | Ga0439432_035764 | 3300042006 | Bacteria | 1591 |
| 506 | Ga0439449_0000061 | 3300042007 | Bacteria | 33240 |
| 507 | Ga0439452_000408 | 3300042010 | Bacteria | 25266 |
| 508 | Ga0439452_000448 | 3300042010 | Bacteria | 23342 |
| 509 | Ga0439452_000685 | 3300042010 | Bacteria | 16684 |
| 510 | Ga0439452_002094 | 3300042010 | Bacteria | 7561 |
| 511 | Ga0439452_035096 | 3300042010 | Bacteria | 1208 |
| 512 | Ga0439456_000828 | 3300042013 | Bacteria | 6271 |
| 513 | Ga0439457_002853 | 3300042014 | Bacteria | 4825 |
| 514 | Ga0439462_0001960 | 3300042015 | Bacteria | 4707 |
| 515 | Ga0450911_000368 | 3300042115 | Bacteria | 15027 |
| 516 | Ga0450911_006679 | 3300042115 | Bacteria | 1706 |
| 517 | Ga0450919_002935 | 3300042121 | Bacteria | 2180 |
| 518 | Ga0450919_006455 | 3300042121 | Bacteria | 1387 |
| 519 | Ga0450920_000143 | 3300042122 | Bacteria | 9984 |
| 520 | Ga0450922_000379 | 3300042124 | Bacteria | 4780 |
| 521 | Ga0450902_001332 | 3300042137 | Bacteria | 3336 |
| 522 | Ga0450902_016417 | 3300042137 | Bacteria | 1207 |
| 523 | Ga0450903_002119 | 3300042138 | Bacteria | 3562 |
| 524 | Ga0450903_003370 | 3300042138 | Bacteria | 2770 |
| 525 | Ga0450903_004901 | 3300042138 | Bacteria | 2258 |
| 526 | Ga0450906_005913 | 3300042145 | Bacteria | 2492 |
| 527 | Ga0450907_000703 | 3300042146 | Bacteria | 8615 |
| 528 | Ga0450907_001150 | 3300042146 | Bacteria | 5984 |
| 529 | Ga0450910_002081 | 3300042147 | Bacteria | 2603 |
| 530 | Ga0450910_010942 | 3300042147 | Bacteria | 1298 |
| 531 | Ga0439446_0000601 | 3300042156 | Bacteria | 7388 |
| 532 | Ga0439446_0011883 | 3300042156 | Bacteria | 2371 |
| 533 | Ga0450908_002647 | 3300042184 | Bacteria | 3511 |
| 534 | Ga0439434_0000957 | 3300042435 | Bacteria | 8317 |
| 535 | Ga0439434_0001034 | 3300042435 | Bacteria | 8059 |
| 536 | Ga0439434_0007289 | 3300042435 | Bacteria | 3241 |
| 537 | Ga0439460_0000208 | 3300042461 | Bacteria | 11639 |
| 538 | Ga0451577_0060171 | 3300042876 | Bacteria | 3386 |
| 539 | Ga0466986_0107857 | 3300044650 | Bacteria | 1915 |
| 540 | Ga0466969_0039905 | 3300044656 | Bacteria | 2355 |
| 541 | Ga0466972_0040999 | 3300044658 | Bacteria | 2254 |
| 542 | Ga0466965_0014038 | 3300044683 | Bacteria | 3787 |
| 543 | Ga0466966_0000009 | 3300044684 | Bacteria | 150954 |
| 544 | Ga0466966_0003478 | 3300044684 | Bacteria | 10377 |
| 545 | Ga0466961_0000077 | 3300044693 | Bacteria | 60661 |
| 546 | Ga0466961_0000143 | 3300044693 | Bacteria | 48172 |
| 547 | Ga0466961_0026460 | 3300044693 | Bacteria | 3729 |
| 548 | Ga0466963_0005514 | 3300044694 | Bacteria | 7407 |
| 549 | Ga0466964_0025728 | 3300044706 | Bacteria | 2300 |
| 550 | Ga0466971_0014751 | 3300044719 | Bacteria | 3439 |
| 551 | Ga0466971_0018637 | 3300044719 | Bacteria | 3076 |
| 552 | Ga0466968_0028543 | 3300044735 | Bacteria | 2301 |
| 553 | Ga0466968_0076108 | 3300044735 | Bacteria | 1468 |
| 554 | Ga0466970_0004578 | 3300044765 | Bacteria | 6824 |
| 555 | Ga0466957_0017713 | 3300044842 | Bacteria | 4177 |
| 556 | Ga0466959_0009963 | 3300045049 | Bacteria | 6773 |
| 557 | Ga0466959_0014577 | 3300045049 | Bacteria | 5718 |
| 558 | Ga0495617_000188 | 3300046452 | Bacteria | 39074 |
| 559 | Ga0495617_049911 | 3300046452 | Bacteria | 1392 |
| 560 | Ga0495627_000426 | 3300046453 | Bacteria | 36618 |
| 561 | Ga0495603_0002299 | 3300046455 | Bacteria | 11218 |
| 562 | Ga0495603_0011470 | 3300046455 | Bacteria | 5364 |
| 563 | Ga0495603_0015411 | 3300046455 | Bacteria | 4624 |
| 564 | Ga0495603_0028632 | 3300046455 | Bacteria | 3361 |
| 565 | Ga0495590_0000074 | 3300046457 | Bacteria | 69286 |
| 566 | Ga0495590_0002718 | 3300046457 | Bacteria | 7308 |
| 567 | Ga0495590_0021643 | 3300046457 | Bacteria | 2277 |
| 568 | Ga0495590_0057690 | 3300046457 | Bacteria | 1357 |
| 569 | Ga0495591_000951 | 3300046458 | Bacteria | 19801 |
| 570 | Ga0495591_001372 | 3300046458 | Bacteria | 15253 |
| 571 | Ga0495591_001663 | 3300046458 | Bacteria | 13391 |
| 572 | Ga0495591_003339 | 3300046458 | Bacteria | 8341 |
| 573 | Ga0495591_008688 | 3300046458 | Bacteria | 4132 |
| 574 | Ga0495591_031829 | 3300046458 | Bacteria | 1578 |
| 575 | Ga0495629_0000837 | 3300046459 | Bacteria | 24977 |
| 576 | Ga0495629_0002001 | 3300046459 | Bacteria | 15835 |
| 577 | Ga0495629_0003794 | 3300046459 | Bacteria | 11387 |
| 578 | Ga0495629_0046455 | 3300046459 | Bacteria | 3045 |
| 579 | Ga0495638_0002170 | 3300046460 | Bacteria | 16458 |
| 580 | Ga0495638_0003829 | 3300046460 | Bacteria | 11677 |
| 581 | Ga0495638_0019240 | 3300046460 | Bacteria | 4519 |
| 582 | Ga0495638_0070278 | 3300046460 | Bacteria | 2143 |
| 583 | Ga0495638_0108574 | 3300046460 | Bacteria | 1650 |
| 584 | Ga0495638_0164490 | 3300046460 | Bacteria | 1277 |
| 585 | Ga0495638_0208018 | 3300046460 | Bacteria | 1100 |
| 586 | Ga0495641_0015039 | 3300046461 | Bacteria | 4158 |
| 587 | Ga0495651_0023682 | 3300046462 | Bacteria | 4774 |
| 588 | Ga0495651_0031030 | 3300046462 | Bacteria | 4169 |
| 589 | Ga0495651_0130342 | 3300046462 | Bacteria | 1836 |
| 590 | Ga0495653_0005124 | 3300046463 | Bacteria | 10636 |
| 591 | Ga0495653_0012630 | 3300046463 | Bacteria | 6898 |
| 592 | Ga0495653_0040848 | 3300046463 | Bacteria | 3623 |
| 593 | Ga0495653_0103603 | 3300046463 | Bacteria | 2057 |
| 594 | Ga0495653_0110361 | 3300046463 | Bacteria | 1977 |
| 595 | Ga0495653_0111753 | 3300046463 | Bacteria | 1962 |
| 596 | Ga0495653_0138584 | 3300046463 | Bacteria | 1714 |
| 597 | Ga0495650_0001121 | 3300046471 | Bacteria | 29246 |
| 598 | Ga0495650_0024249 | 3300046471 | Bacteria | 2867 |
| 599 | Ga0495650_0060269 | 3300046471 | Bacteria | 1525 |
| 600 | Ga0495650_0072990 | 3300046471 | Bacteria | 1341 |
| 601 | Ga0495580_0000062 | 3300046472 | Bacteria | 63605 |
| 602 | Ga0495580_0000269 | 3300046472 | Bacteria | 41829 |
| 603 | Ga0495580_0007455 | 3300046472 | Bacteria | 8793 |
| 604 | Ga0495582_0310259 | 3300046473 | Bacteria | 907 |
| 605 | Ga0495605_0001196 | 3300046474 | Bacteria | 17290 |
| 606 | Ga0495605_0002710 | 3300046474 | Bacteria | 10822 |
| 607 | Ga0495605_0008024 | 3300046474 | Bacteria | 5977 |
| 608 | Ga0495605_0014664 | 3300046474 | Bacteria | 4283 |
| 609 | Ga0495605_0156509 | 3300046474 | Bacteria | 1013 |
| 610 | Ga0495639_0019038 | 3300046475 | Bacteria | 2994 |
| 611 | Ga0495639_0086531 | 3300046475 | Bacteria | 1466 |
| 612 | Ga0495662_0072192 | 3300046476 | Bacteria | 1673 |
| 613 | Ga0495664_0036492 | 3300046477 | Bacteria | 2897 |
| 614 | Ga0495584_0000928 | 3300046491 | Bacteria | 18571 |
| 615 | Ga0495584_0011136 | 3300046491 | Bacteria | 4610 |
| 616 | Ga0495584_0021779 | 3300046491 | Bacteria | 3254 |
| 617 | Ga0495584_0035830 | 3300046491 | Bacteria | 2507 |
| 618 | Ga0495585_0000626 | 3300046492 | Bacteria | 32752 |
| 619 | Ga0495585_0003853 | 3300046492 | Bacteria | 9967 |
| 620 | Ga0495585_0028645 | 3300046492 | Bacteria | 3175 |
| 621 | Ga0495594_0007964 | 3300046499 | Bacteria | 5447 |
| 622 | Ga0495596_0001577 | 3300046500 | Bacteria | 13001 |
| 623 | Ga0495596_0016914 | 3300046500 | Bacteria | 3026 |
| 624 | Ga0495596_0070562 | 3300046500 | Bacteria | 1357 |
| 625 | Ga0495607_0006252 | 3300046501 | Bacteria | 8400 |
| 626 | Ga0495607_0019474 | 3300046501 | Bacteria | 4311 |
| 627 | Ga0495607_0020158 | 3300046501 | Bacteria | 4219 |
| 628 | Ga0495607_0035206 | 3300046501 | Bacteria | 3030 |
| 629 | Ga0495583_0000172 | 3300046506 | Bacteria | 109791 |
| 630 | Ga0495606_0000859 | 3300046507 | Bacteria | 45541 |
| 631 | Ga0495606_0001889 | 3300046507 | Bacteria | 26207 |
| 632 | Ga0495606_0002982 | 3300046507 | Bacteria | 18610 |
| 633 | Ga0495606_0006443 | 3300046507 | Bacteria | 10823 |
| 634 | Ga0495608_0002271 | 3300046511 | Bacteria | 13872 |
| 635 | Ga0495608_0002682 | 3300046511 | Bacteria | 12786 |
| 636 | Ga0495610_0003096 | 3300046512 | Bacteria | 13267 |
| 637 | Ga0495610_0015345 | 3300046512 | Bacteria | 4456 |
| 638 | Ga0495610_0036339 | 3300046512 | Bacteria | 2518 |
| 639 | Ga0495610_0041273 | 3300046512 | Bacteria | 2318 |
| 640 | Ga0495616_0000323 | 3300046513 | Bacteria | 38118 |
| 641 | Ga0495616_0001007 | 3300046513 | Bacteria | 20154 |
| 642 | Ga0495616_0060631 | 3300046513 | Bacteria | 1857 |
| 643 | Ga0495618_0003996 | 3300046514 | Bacteria | 9094 |
| 644 | Ga0495618_0125635 | 3300046514 | Bacteria | 1643 |
| 645 | Ga0495628_0024205 | 3300046516 | Bacteria | 4971 |
| 646 | Ga0495628_0024253 | 3300046516 | Bacteria | 4967 |
| 647 | Ga0495628_0065924 | 3300046516 | Bacteria | 2831 |
| 648 | Ga0495628_0148574 | 3300046516 | Bacteria | 1785 |
| 649 | Ga0495628_0149659 | 3300046516 | Bacteria | 1779 |
| 650 | Ga0495630_0014914 | 3300046517 | Bacteria | 5666 |
| 651 | Ga0495630_0034549 | 3300046517 | Bacteria | 3776 |
| 652 | Ga0495630_0042479 | 3300046517 | Bacteria | 3395 |
| 653 | Ga0495630_0049412 | 3300046517 | Bacteria | 3148 |
| 654 | Ga0495630_0195895 | 3300046517 | Bacteria | 1541 |
| 655 | Ga0495631_0000196 | 3300046518 | Bacteria | 41587 |
| 656 | Ga0495631_0000455 | 3300046518 | Bacteria | 27845 |
| 657 | Ga0495631_0002595 | 3300046518 | Bacteria | 10109 |
| 658 | Ga0495632_0000617 | 3300046519 | Bacteria | 32894 |
| 659 | Ga0495632_0032129 | 3300046519 | Bacteria | 2707 |
| 660 | Ga0495632_0032293 | 3300046519 | Bacteria | 2698 |
| 661 | Ga0495632_0040974 | 3300046519 | Bacteria | 2329 |
| 662 | Ga0495637_0084932 | 3300046520 | Bacteria | 1256 |
| 663 | Ga0495643_0000095 | 3300046522 | Bacteria | 148901 |
| 664 | Ga0495643_0000532 | 3300046522 | Bacteria | 47478 |
| 665 | Ga0495643_0002524 | 3300046522 | Bacteria | 14366 |
| 666 | Ga0495643_0008892 | 3300046522 | Bacteria | 6312 |
| 667 | Ga0495643_0023529 | 3300046522 | Bacteria | 3502 |
| 668 | Ga0495643_0027714 | 3300046522 | Bacteria | 3181 |
| 669 | Ga0495643_0058840 | 3300046522 | Bacteria | 2044 |
| 670 | Ga0495644_0000008 | 3300046523 | Bacteria | 109929 |
| 671 | Ga0495644_0000032 | 3300046523 | Bacteria | 65821 |
| 672 | Ga0495644_0001957 | 3300046523 | Bacteria | 8273 |
| 673 | Ga0495648_0000678 | 3300046524 | Bacteria | 36351 |
| 674 | Ga0495648_0000886 | 3300046524 | Bacteria | 31443 |
| 675 | Ga0495648_0001712 | 3300046524 | Bacteria | 21190 |
| 676 | Ga0495648_0012148 | 3300046524 | Bacteria | 6442 |
| 677 | Ga0495648_0018328 | 3300046524 | Bacteria | 4961 |
| 678 | Ga0495648_0034287 | 3300046524 | Bacteria | 3305 |
| 679 | Ga0495648_0047210 | 3300046524 | Bacteria | 2663 |
| 680 | Ga0495648_0112967 | 3300046524 | Bacteria | 1474 |
| 681 | Ga0495663_0014116 | 3300046525 | Bacteria | 2237 |
| 682 | Ga0495666_0000497 | 3300046526 | Bacteria | 17494 |
| 683 | Ga0495666_0003130 | 3300046526 | Bacteria | 8317 |
| 684 | Ga0495666_0008007 | 3300046526 | Bacteria | 5293 |
| 685 | Ga0495666_0038876 | 3300046526 | Bacteria | 2312 |
| 686 | Ga0495642_0000008 | 3300046528 | Bacteria | 162190 |
| 687 | Ga0495642_0000059 | 3300046528 | Bacteria | 66129 |
| 688 | Ga0495652_0005080 | 3300046529 | Bacteria | 12452 |
| 689 | Ga0495652_0008766 | 3300046529 | Bacteria | 9205 |
| 690 | Ga0495652_0028025 | 3300046529 | Bacteria | 4960 |
| 691 | Ga0495652_0159642 | 3300046529 | Bacteria | 1752 |
| 692 | Ga0495652_0175814 | 3300046529 | Bacteria | 1648 |
| 693 | Ga0495652_0226906 | 3300046529 | Bacteria | 1399 |
| 694 | Ga0495654_0028655 | 3300046530 | Bacteria | 2845 |
| 695 | Ga0495654_0032458 | 3300046530 | Bacteria | 2647 |
| 696 | Ga0495654_0033073 | 3300046530 | Bacteria | 2618 |
| 697 | Ga0495654_0042135 | 3300046530 | Bacteria | 2268 |
| 698 | Ga0495665_0001953 | 3300046531 | Bacteria | 11125 |
| 699 | Ga0495665_0002510 | 3300046531 | Bacteria | 9908 |
| 700 | Ga0495665_0037769 | 3300046531 | Bacteria | 2576 |
| 701 | Ga0495665_0166156 | 3300046531 | Bacteria | 1149 |
| 702 | Ga0495640_0002419 | 3300046533 | Bacteria | 14983 |
| 703 | Ga0495640_0121404 | 3300046533 | Bacteria | 1698 |
| 704 | Ga0495586_0036587 | 3300046535 | Bacteria | 2635 |
| 705 | Ga0495586_0119469 | 3300046535 | Bacteria | 1471 |
| 706 | Ga0495587_0000102 | 3300046536 | Bacteria | 64693 |
| 707 | Ga0495587_0081019 | 3300046536 | Bacteria | 1881 |
| 708 | Ga0495609_0000677 | 3300046538 | Bacteria | 26312 |
| 709 | Ga0495609_0063042 | 3300046538 | Bacteria | 1636 |
| 710 | Ga0495621_0034517 | 3300046539 | Bacteria | 1748 |
| 711 | Ga0495597_0000562 | 3300046542 | Bacteria | 30814 |
| 712 | Ga0495597_0030975 | 3300046542 | Bacteria | 2435 |
| 713 | Ga0495597_0101001 | 3300046542 | Bacteria | 1216 |
| 714 | Ga0495645_0003620 | 3300046543 | Bacteria | 10489 |
| 715 | Ga0495645_0058981 | 3300046543 | Bacteria | 2784 |
| 716 | Ga0495645_0082041 | 3300046543 | Bacteria | 2313 |
| 717 | Ga0495622_0000005 | 3300046557 | Bacteria | 254434 |
| 718 | Ga0495622_0000205 | 3300046557 | Bacteria | 46745 |
| 719 | Ga0495622_0004376 | 3300046557 | Bacteria | 6578 |
| 720 | Ga0495633_0018257 | 3300046558 | Bacteria | 3566 |
| 721 | Ga0495667_0013764 | 3300046559 | Bacteria | 5465 |
| 722 | Ga0495656_0000060 | 3300046615 | Bacteria | 52471 |
| 723 | Ga0495656_0019583 | 3300046615 | Bacteria | 2613 |
| 724 | Ga0495656_0128322 | 3300046615 | Bacteria | 1204 |
| 725 | Ga0495634_0000380 | 3300046642 | Bacteria | 43395 |
| 726 | Ga0495634_0001826 | 3300046642 | Bacteria | 18400 |
| 727 | Ga0495611_0004432 | 3300046648 | Bacteria | 6074 |
| 728 | Ga0495611_0043444 | 3300046648 | Bacteria | 2009 |
| 729 | Ga0495625_0000888 | 3300046660 | Bacteria | 40400 |
| 730 | Ga0495625_0009629 | 3300046660 | Bacteria | 8059 |
| 731 | Ga0495625_0150876 | 3300046660 | Bacteria | 1562 |
| 732 | Ga0495635_0000921 | 3300046663 | Bacteria | 19357 |
| 733 | Ga0495635_0018816 | 3300046663 | Bacteria | 4820 |
| 734 | Ga0495635_0063054 | 3300046663 | Bacteria | 2545 |
| 735 | Ga0495659_0002830 | 3300046664 | Bacteria | 5575 |
| 736 | Ga0495661_0006996 | 3300046665 | Bacteria | 7887 |
| 737 | Ga0495661_0009949 | 3300046665 | Bacteria | 6504 |
| 738 | Ga0495661_0020583 | 3300046665 | Bacteria | 4305 |
| 739 | Ga0495661_0047008 | 3300046665 | Bacteria | 2630 |
| 740 | Ga0495661_0052194 | 3300046665 | Bacteria | 2464 |
| 741 | Ga0495661_0070500 | 3300046665 | Bacteria | 2045 |
| 742 | Ga0495588_0000485 | 3300046674 | Bacteria | 19722 |
| 743 | Ga0495657_0013688 | 3300046675 | Bacteria | 5975 |
| 744 | Ga0495657_0100308 | 3300046675 | Bacteria | 1846 |
| 745 | Ga0495599_0004627 | 3300046678 | Bacteria | 8152 |
| 746 | Ga0495599_0012745 | 3300046678 | Bacteria | 5186 |
| 747 | Ga0495599_0024043 | 3300046678 | Bacteria | 3810 |
| 748 | Ga0495599_0035407 | 3300046678 | Bacteria | 3134 |
| 749 | Ga0495599_0162296 | 3300046678 | Bacteria | 1381 |
| 750 | Ga0495623_0002336 | 3300046679 | Bacteria | 12643 |
| 751 | Ga0495623_0022340 | 3300046679 | Bacteria | 4087 |
| 752 | Ga0495646_0009968 | 3300046680 | Bacteria | 6040 |
| 753 | Ga0495646_0013242 | 3300046680 | Bacteria | 5241 |
| 754 | Ga0495646_0033595 | 3300046680 | Bacteria | 3189 |
| 755 | Ga0495646_0034680 | 3300046680 | Bacteria | 3133 |
| 756 | Ga0495646_0053677 | 3300046680 | Bacteria | 2428 |
| 757 | Ga0495646_0062053 | 3300046680 | Bacteria | 2223 |
| 758 | Ga0495646_0083312 | 3300046680 | Bacteria | 1859 |
| 759 | Ga0495669_0000278 | 3300046684 | Bacteria | 29293 |
| 760 | Ga0495669_0090314 | 3300046684 | Bacteria | 1413 |
| 761 | Ga0495613_0007730 | 3300046689 | Bacteria | 7997 |
| 762 | Ga0495613_0039429 | 3300046689 | Bacteria | 3502 |
| 763 | Ga0495613_0050772 | 3300046689 | Bacteria | 3058 |
| 764 | Ga0495624_0000817 | 3300046690 | Bacteria | 24613 |
| 765 | Ga0495624_0015267 | 3300046690 | Bacteria | 5193 |
| 766 | Ga0495624_0040718 | 3300046690 | Bacteria | 2975 |
| 767 | Ga0495624_0129079 | 3300046690 | Bacteria | 1550 |
| 768 | Ga0495624_0143416 | 3300046690 | Bacteria | 1462 |
| 769 | Ga0495624_0221730 | 3300046690 | Bacteria | 1146 |
| 770 | Ga0495670_0000519 | 3300046691 | Bacteria | 18194 |
| 771 | Ga0495670_0004175 | 3300046691 | Bacteria | 7076 |
| 772 | Ga0495670_0031554 | 3300046691 | Bacteria | 2633 |
| 773 | Ga0495670_0141382 | 3300046691 | Bacteria | 1258 |
| 774 | Ga0495671_0000536 | 3300046692 | Bacteria | 28671 |
| 775 | Ga0495671_0003200 | 3300046692 | Bacteria | 10173 |
| 776 | Ga0495671_0021990 | 3300046692 | Bacteria | 3344 |
| 777 | Ga0495671_0037450 | 3300046692 | Bacteria | 2452 |
| 778 | Ga0495671_0152346 | 3300046692 | Bacteria | 1125 |
| 779 | Ga0495649_0001299 | 3300046694 | Bacteria | 19087 |
| 780 | Ga0495649_0001695 | 3300046694 | Bacteria | 16312 |
| 781 | Ga0495649_0002422 | 3300046694 | Bacteria | 13154 |
| 782 | Ga0495649_0028016 | 3300046694 | Bacteria | 3123 |
| 783 | Ga0495649_0056176 | 3300046694 | Bacteria | 2126 |
| 784 | Ga0495589_0000214 | 3300046794 | Bacteria | 49214 |
| 785 | Ga0495589_0002921 | 3300046794 | Bacteria | 9433 |
| 786 | Ga0495589_0017112 | 3300046794 | Bacteria | 3723 |
| 787 | Ga0495589_0036788 | 3300046794 | Bacteria | 2453 |
| 788 | Ga0495589_0113425 | 3300046794 | Bacteria | 1307 |
| 789 | Ga0495600_0000303 | 3300046809 | Bacteria | 26375 |
| 790 | Ga0495600_0014053 | 3300046809 | Bacteria | 5041 |
| 791 | Ga0495600_0050463 | 3300046809 | Bacteria | 2715 |
| 792 | Ga0495660_0019398 | 3300046810 | Bacteria | 3903 |
| 793 | Ga0495660_0046228 | 3300046810 | Bacteria | 2387 |
| 794 | Ga0495660_0050087 | 3300046810 | Bacteria | 2277 |
| 795 | Ga0495660_0107487 | 3300046810 | Bacteria | 1427 |
| 796 | Ga0495581_0000974 | 3300047315 | Bacteria | 15397 |
| 797 | Ga0495604_0023319 | 3300047317 | Bacteria | 4937 |
| 798 | Ga0495604_0186498 | 3300047317 | Bacteria | 1448 |
| 799 | Ga0495636_0034219 | 3300047318 | Bacteria | 2090 |
| 800 | Ga0495674_0005269 | 3300047319 | Bacteria | 12396 |
| 801 | Ga0495674_0006339 | 3300047319 | Bacteria | 11336 |
| 802 | Ga0495674_0017847 | 3300047319 | Bacteria | 6608 |
| 803 | Ga0495674_0036874 | 3300047319 | Bacteria | 4396 |
| 804 | Ga0495674_0058724 | 3300047319 | Bacteria | 3361 |
| 805 | Ga0495674_0070895 | 3300047319 | Bacteria | 3010 |
| 806 | Ga0495674_0385602 | 3300047319 | Bacteria | 1133 |
| 807 | Ga0495672_0000143 | 3300047320 | Bacteria | 105045 |
| 808 | Ga0495672_0000496 | 3300047320 | Bacteria | 45517 |
| 809 | Ga0495672_0000737 | 3300047320 | Bacteria | 35956 |
| 810 | Ga0495672_0001053 | 3300047320 | Bacteria | 28162 |
| 811 | Ga0495672_0003747 | 3300047320 | Bacteria | 12818 |
| 812 | Ga0495672_0009789 | 3300047320 | Bacteria | 6901 |
| 813 | Ga0495672_0012589 | 3300047320 | Bacteria | 5893 |
| 814 | Ga0495672_0026526 | 3300047320 | Bacteria | 3696 |
| 815 | Ga0495672_0059186 | 3300047320 | Bacteria | 2217 |
| 816 | Ga0495676_0032555 | 3300047321 | Bacteria | 4399 |
| 817 | Ga0495676_0261183 | 3300047321 | Bacteria | 1178 |
| 818 | Ga0495680_0011162 | 3300047322 | Bacteria | 7977 |
| 819 | Ga0495680_0016439 | 3300047322 | Bacteria | 6354 |
| 820 | Ga0495680_0017483 | 3300047322 | Bacteria | 6122 |
| 821 | Ga0495680_0053085 | 3300047322 | Bacteria | 3156 |
| 822 | Ga0495680_0104301 | 3300047322 | Bacteria | 2109 |
| 823 | Ga0495680_0341064 | 3300047322 | Bacteria | 1045 |
| 824 | Ga0495683_0000146 | 3300047323 | Bacteria | 69465 |
| 825 | Ga0495683_0000882 | 3300047323 | Bacteria | 21171 |
| 826 | Ga0495683_0001972 | 3300047323 | Bacteria | 12815 |
| 827 | Ga0495683_0002296 | 3300047323 | Bacteria | 11659 |
| 828 | Ga0495683_0015769 | 3300047323 | Bacteria | 3923 |
| 829 | Ga0495683_0024109 | 3300047323 | Bacteria | 3124 |
| 830 | Ga0495683_0098081 | 3300047323 | Bacteria | 1412 |
| 831 | Ga0495687_000091 | 3300047443 | Bacteria | 140319 |
| 832 | Ga0495687_001312 | 3300047443 | Bacteria | 23262 |
| 833 | Ga0495687_001359 | 3300047443 | Bacteria | 22671 |
| 834 | Ga0495677_0000236 | 3300047445 | Bacteria | 24957 |
| 835 | Ga0495679_000272 | 3300047446 | Bacteria | 43249 |
| 836 | Ga0495679_001867 | 3300047446 | Bacteria | 11342 |
| 837 | Ga0495679_004456 | 3300047446 | Bacteria | 6453 |
| 838 | Ga0495685_010247 | 3300047447 | Bacteria | 3141 |
| 839 | Ga0495673_0001717 | 3300047469 | Bacteria | 16748 |
| 840 | Ga0495673_0038734 | 3300047469 | Bacteria | 2166 |
| 841 | Ga0495673_0047539 | 3300047469 | Bacteria | 1895 |
| 842 | Ga0495681_0000069 | 3300047470 | Bacteria | 96229 |
| 843 | Ga0495681_0000128 | 3300047470 | Bacteria | 66467 |
| 844 | Ga0495681_0000220 | 3300047470 | Bacteria | 47456 |
| 845 | Ga0495681_0001304 | 3300047470 | Bacteria | 18879 |
| 846 | Ga0495681_0003028 | 3300047470 | Bacteria | 11810 |
| 847 | Ga0495681_0019482 | 3300047470 | Bacteria | 3704 |
| 848 | Ga0495681_0019915 | 3300047470 | Bacteria | 3649 |
| 849 | Ga0495684_0314937 | 3300047471 | Bacteria | 1120 |
| 850 | Ga0495686_0012185 | 3300047472 | Bacteria | 6026 |
| 851 | Ga0495686_0033912 | 3300047472 | Bacteria | 3291 |
| 852 | Ga0495593_0000227 | 3300047673 | Bacteria | 30157 |
| 853 | Ga0495593_0000308 | 3300047673 | Bacteria | 26776 |
| 854 | Ga0495593_0007850 | 3300047673 | Bacteria | 6215 |
| 855 | Ga0495593_0007932 | 3300047673 | Bacteria | 6186 |
| 856 | Ga0495593_0026545 | 3300047673 | Bacteria | 3196 |
| 857 | Ga0495593_0032454 | 3300047673 | Bacteria | 2846 |
| 858 | Ga0495602_0018173 | 3300048088 | Bacteria | 7031 |
| 859 | Ga0495602_0025932 | 3300048088 | Bacteria | 5664 |
| 860 | Ga0495602_0038822 | 3300048088 | Bacteria | 4395 |
| 861 | Ga0495602_0048671 | 3300048088 | Bacteria | 3806 |
| 862 | Ga0495602_0327338 | 3300048088 | Bacteria | 1112 |
| 863 | Ga0495614_0000338 | 3300048089 | Bacteria | 18550 |
| 864 | Ga0495614_0011292 | 3300048089 | Bacteria | 3930 |
| 865 | Ga0495614_0029155 | 3300048089 | Bacteria | 2375 |
| 866 | Ga0495614_0068977 | 3300048089 | Bacteria | 1523 |
| 867 | Ga0495626_0000083 | 3300048091 | Bacteria | 127169 |
| 868 | Ga0495626_0002410 | 3300048091 | Bacteria | 13026 |
| 869 | Ga0495626_0038755 | 3300048091 | Bacteria | 2258 |
| 870 | Ga0495626_0051292 | 3300048091 | Bacteria | 1903 |
| 871 | Ga0495626_0087181 | 3300048091 | Bacteria | 1378 |
| 872 | Ga0496100_0007557 | 3300048903 | Bacteria | 6004 |
| 873 | Ga0496100_0098859 | 3300048903 | Bacteria | 2006 |
| 874 | Ga0496100_0404620 | 3300048903 | Bacteria | 1040 |
| 875 | Ga0496101_0025631 | 3300048904 | Bacteria | 4092 |
| 876 | Ga0496102_0000272 | 3300048905 | Bacteria | 65744 |
| 877 | Ga0496102_0010230 | 3300048905 | Bacteria | 8065 |
| 878 | Ga0496102_0019842 | 3300048905 | Bacteria | 5926 |
| 879 | Ga0496102_0367730 | 3300048905 | Bacteria | 1354 |
| 880 | Ga0496103_0000330 | 3300048906 | Bacteria | 43422 |
| 881 | Ga0496103_0001182 | 3300048906 | Bacteria | 17920 |
| 882 | Ga0496103_0002633 | 3300048906 | Bacteria | 11243 |
| 883 | Ga0496103_0075449 | 3300048906 | Bacteria | 2115 |
| 884 | Ga0496104_0001821 | 3300048907 | Bacteria | 18471 |
| 885 | Ga0496104_0178957 | 3300048907 | Bacteria | 2031 |
| 886 | Ga0496105_0000437 | 3300048908 | Bacteria | 27324 |
| 887 | Ga0496105_0028200 | 3300048908 | Bacteria | 4591 |
| 888 | Ga0496107_0028423 | 3300048910 | Bacteria | 3974 |
| 889 | Ga0496107_0222254 | 3300048910 | Bacteria | 1405 |
| 890 | Ga0496110_0022865 | 3300048913 | Bacteria | 5312 |
| 891 | Ga0496110_0029512 | 3300048913 | Bacteria | 4721 |
| 892 | Ga0496110_0330281 | 3300048913 | Bacteria | 1389 |
| 893 | Ga0496111_0003072 | 3300048914 | Bacteria | 10254 |
| 894 | Ga0496113_0010518 | 3300048916 | Bacteria | 6119 |
| 895 | Ga0496113_0076826 | 3300048916 | Bacteria | 2552 |
| 896 | Ga0496114_0004992 | 3300048917 | Bacteria | 10352 |
| 897 | Ga0496114_0067196 | 3300048917 | Bacteria | 3007 |
| 898 | Ga0496115_0094831 | 3300048918 | Bacteria | 2442 |
| 899 | Ga0496116_0006783 | 3300048919 | Bacteria | 10306 |
| 900 | Ga0496116_0019420 | 3300048919 | Bacteria | 5204 |
| 901 | Ga0496116_0020388 | 3300048919 | Bacteria | 5036 |
| 902 | Ga0496116_0078039 | 3300048919 | Bacteria | 2067 |
| 903 | Ga0496116_0116889 | 3300048919 | Bacteria | 1553 |
| 904 | Ga0496117_0004341 | 3300048920 | Bacteria | 15738 |
| 905 | Ga0496117_0007626 | 3300048920 | Bacteria | 10502 |
| 906 | Ga0496117_0021528 | 3300048920 | Bacteria | 5212 |
| 907 | Ga0496117_0046142 | 3300048920 | Bacteria | 3137 |
| 908 | Ga0496117_0114647 | 3300048920 | Bacteria | 1670 |
| 909 | Ga0496117_0188848 | 3300048920 | Bacteria | 1176 |
| 910 | Ga0496118_0001543 | 3300048921 | Bacteria | 34234 |
| 911 | Ga0496118_0006740 | 3300048921 | Bacteria | 12509 |
| 912 | Ga0496118_0010168 | 3300048921 | Bacteria | 9347 |
| 913 | Ga0496118_0012208 | 3300048921 | Bacteria | 8275 |
| 914 | Ga0496118_0029641 | 3300048921 | Bacteria | 4585 |
| 915 | Ga0496118_0034928 | 3300048921 | Bacteria | 4093 |
| 916 | Ga0496118_0036603 | 3300048921 | Bacteria | 3964 |
| 917 | Ga0496118_0061015 | 3300048921 | Bacteria | 2795 |
| 918 | Ga0496118_0113644 | 3300048921 | Bacteria | 1788 |
| 919 | Ga0496120_0038047 | 3300048923 | Bacteria | 2850 |
| 920 | Ga0496121_0006320 | 3300048924 | Bacteria | 14783 |
| 921 | Ga0496121_0006891 | 3300048924 | Bacteria | 13884 |
| 922 | Ga0496121_0055336 | 3300048924 | Bacteria | 3306 |
| 923 | Ga0496121_0177926 | 3300048924 | Bacteria | 1538 |
| 924 | Ga0496121_0182657 | 3300048924 | Bacteria | 1512 |
| 925 | Ga0496121_0201458 | 3300048924 | Bacteria | 1418 |
| 926 | Ga0496122_0000217 | 3300048925 | Bacteria | 128502 |
| 927 | Ga0496122_0000375 | 3300048925 | Bacteria | 95681 |
| 928 | Ga0496122_0001599 | 3300048925 | Bacteria | 35428 |
| 929 | Ga0496122_0002181 | 3300048925 | Bacteria | 28671 |
| 930 | Ga0496122_0011301 | 3300048925 | Bacteria | 9065 |
| 931 | Ga0496122_0028435 | 3300048925 | Bacteria | 4743 |
| 932 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 933 | Ga0496123_0000267 | 3300048926 | Bacteria | 104282 |
| 934 | Ga0496123_0003201 | 3300048926 | Bacteria | 18672 |
| 935 | Ga0496123_0024780 | 3300048926 | Bacteria | 4546 |
| 936 | Ga0496123_0031385 | 3300048926 | Bacteria | 3867 |
| 937 | Ga0496123_0095092 | 3300048926 | Bacteria | 1754 |
| 938 | Ga0496123_0105389 | 3300048926 | Bacteria | 1627 |
| 939 | Ga0496124_0011374 | 3300048927 | Bacteria | 8900 |
| 940 | Ga0496124_0020902 | 3300048927 | Bacteria | 6039 |
| 941 | Ga0496124_0027362 | 3300048927 | Bacteria | 5119 |
| 942 | Ga0496124_0043328 | 3300048927 | Bacteria | 3869 |
| 943 | Ga0496124_0188384 | 3300048927 | Bacteria | 1581 |
| 944 | Ga0496124_0288894 | 3300048927 | Bacteria | 1191 |
| 945 | Ga0496125_0000710 | 3300048928 | Bacteria | 55020 |
| 946 | Ga0496125_0003337 | 3300048928 | Bacteria | 19564 |
| 947 | Ga0496125_0006710 | 3300048928 | Bacteria | 12375 |
| 948 | Ga0496125_0007526 | 3300048928 | Bacteria | 11575 |
| 949 | Ga0496125_0010218 | 3300048928 | Bacteria | 9516 |
| 950 | Ga0496125_0011820 | 3300048928 | Bacteria | 8700 |
| 951 | Ga0496125_0012669 | 3300048928 | Bacteria | 8346 |
| 952 | Ga0496125_0025084 | 3300048928 | Bacteria | 5469 |
| 953 | Ga0496125_0045550 | 3300048928 | Bacteria | 3689 |
| 954 | Ga0496125_0127760 | 3300048928 | Bacteria | 1797 |
| 955 | Ga0496126_0000114 | 3300048929 | Bacteria | 188605 |
| 956 | Ga0496126_0000475 | 3300048929 | Bacteria | 79715 |
| 957 | Ga0496126_0001848 | 3300048929 | Bacteria | 30899 |
| 958 | Ga0496126_0004098 | 3300048929 | Bacteria | 17650 |
| 959 | Ga0496126_0226179 | 3300048929 | Bacteria | 1569 |
| 960 | Ga0495678_000837 | 3300049459 | Bacteria | 27507 |
| 961 | Ga0495678_002725 | 3300049459 | Bacteria | 11624 |
| 962 | Ga0495678_025713 | 3300049459 | Bacteria | 2523 |
| 963 | Ga0495678_039529 | 3300049459 | Bacteria | 1902 |
| 964 | Ga0495682_0001415 | 3300049460 | Bacteria | 13027 |
| 965 | Ga0495682_0010663 | 3300049460 | Bacteria | 3550 |
| 966 | Ga0495682_0066119 | 3300049460 | Bacteria | 1303 |
| 967 | Ga0501031_0004220 | 3300049568 | Bacteria | 9287 |
| 968 | Ga0501034_0157053 | 3300049571 | Bacteria | 2248 |
| 969 | Ga0501034_0496662 | 3300049571 | Bacteria | 1134 |
| 970 | Ga0501037_0143571 | 3300049573 | Bacteria | 1708 |
| 971 | Ga0501080_0526996 | 3300049742 | Bacteria | 1054 |
| 972 | Ga0501044_0156297 | 3300049823 | Bacteria | 2260 |
| 973 | nmdc:mga0k408_26139_c1 | 3300050493 | Bacteria | 3309 |
| 974 | nmdc:mga07m45_1219_c1 | 3300050496 | Bacteria | 11658 |
| 975 | nmdc:mga07m45_1806_c2 | 3300050496 | Bacteria | 8273 |
| 976 | nmdc:mga07m45_25541_c1 | 3300050496 | Bacteria | 3240 |
| 977 | nmdc:mga07m45_51387_c1 | 3300050496 | Bacteria | 2324 |
| 978 | Ga0495601_0283984 | 3300053077 | Bacteria | 1079 |
| 979 | Ga0500610_0027281 | 3300053079 | Bacteria | 2866 |
| 980 | Ga0500610_0028356 | 3300053079 | Bacteria | 2820 |
| 981 | Ga0500643_001890 | 3300053087 | Bacteria | 11384 |
| 982 | Ga0500651_0000052 | 3300053093 | Bacteria | 76301 |
| 983 | Ga0500571_000036 | 3300053110 | Bacteria | 42725 |
| 984 | Ga0500594_0001934 | 3300053118 | Bacteria | 4484 |
| 985 | Ga0500595_002080 | 3300053119 | Bacteria | 10237 |
| 986 | Ga0500608_021702 | 3300053122 | Bacteria | 2969 |
| 987 | Ga0500618_000385 | 3300053125 | Bacteria | 30497 |
| 988 | Ga0500658_0000033 | 3300053134 | Bacteria | 89738 |
| 989 | Ga0500658_0000040 | 3300053134 | Bacteria | 79293 |
| 990 | Ga0500658_0016242 | 3300053134 | Bacteria | 2772 |
| 991 | Ga0500559_0001604 | 3300053136 | Bacteria | 12590 |
| 992 | Ga0500559_0001672 | 3300053136 | Bacteria | 12246 |
| 993 | Ga0500564_011334 | 3300053138 | Bacteria | 3930 |
| 994 | Ga0500568_0003399 | 3300053139 | Bacteria | 8894 |
| 995 | Ga0500574_026443 | 3300053141 | Bacteria | 1522 |
| 996 | Ga0500616_0083773 | 3300053153 | Bacteria | 1596 |
| 997 | Ga0500619_000329 | 3300053154 | Bacteria | 9224 |
| 998 | Ga0500622_0015326 | 3300053156 | Bacteria | 4105 |
| 999 | Ga0500634_0024021 | 3300053161 | Bacteria | 3315 |
| 1000 | Ga0500634_0066608 | 3300053161 | Bacteria | 1897 |
| 1001 | Ga0500587_000979 | 3300053739 | Bacteria | 3846 |
| 1002 | Ga0587072_000102 | 3300059643 | Bacteria | 6796 |
| 1003 | 2510249185 | 2510065045 | Bacteria | 7761063 |
| 1004 | 2510285086 | 2510065053 | Bacteria | 5005518 |
| 1005 | 2510294077 | 2510065055 | Bacteria | 5037935 |
| 1006 | 2510313111 | 2510065058 | Bacteria | 5005894 |
| 1007 | 2511247648 | 2511231003 | Bacteria | 5606035 |
| 1008 | 2511279989 | 2511231008 | Bacteria | 6624100 |
| 1009 | 2511303728 | 2511231012 | Bacteria | 6738011 |
| 1010 | 2511351024 | 2511231020 | Bacteria | 6115223 |
| 1011 | 2511353879 | 2511231021 | Bacteria | 7302637 |
| 1012 | 2511360242 | 2511231022 | Bacteria | 6719296 |
| 1013 | 2511384179 | 2511231026 | Bacteria | 5225445 |
| 1014 | 2513229736 | 2513020051 | Bacteria | 6053213 |
| 1015 | 2514047695 | 2513237166 | Bacteria | 10373764 |
| 1016 | 2515680544 | 2515154122 | Bacteria | 8609520 |
| 1017 | 2521558944 | 2521172590 | Bacteria | 5047645 |
| 1018 | 2548497577 | 2547132374 | Bacteria | 5530232 |
| 1019 | 2550697194 | 2548876994 | Bacteria | 4904866 |
| 1020 | 2553003752 | 2551306416 | Bacteria | 6152985 |
| 1021 | 2585145215 | 2582581278 | Bacteria | 5296881 |
| 1022 | 2587680961 | 2585428045 | Bacteria | 5203023 |
| 1023 | 2587759882 | 2585428062 | Bacteria | 6842168 |
| 1024 | 2588212911 | 2585428183 | Bacteria | 5166119 |
| 1025 | 2588224186 | 2585428185 | Bacteria | 4969476 |
| 1026 | 2590600643 | 2588254255 | Bacteria | 5014294 |
| 1027 | 2597030359 | 2596583598 | Bacteria | 5251611 |
| 1028 | 2599446361 | 2599185178 | Bacteria | 5365746 |
| 1029 | 2599625945 | 2599185214 | Bacteria | 8209958 |
| 1030 | 2599674973 | 2599185226 | Bacteria | 8233575 |
| 1031 | 2599683867 | 2599185227 | Bacteria | 8246414 |
| 1032 | 2599695530 | 2599185229 | Bacteria | 8216126 |
| 1033 | 2643866493 | 2643221570 | Bacteria | 5103772 |
| 1034 | 2643953290 | 2643221589 | Bacteria | 6250934 |
| 1035 | 2643993261 | 2643221596 | Bacteria | 5006805 |
| 1036 | 2644021030 | 2643221602 | Bacteria | 6249926 |
| 1037 | 2644061306 | 2643221609 | Bacteria | 6756331 |
| 1038 | 2644076653 | 2643221611 | Bacteria | 6820941 |
| 1039 | 2644294150 | 2643221652 | Bacteria | 5140275 |
| 1040 | 2644329567 | 2643221658 | Bacteria | 6064537 |
| 1041 | 2644398346 | 2643221672 | Bacteria | 6322190 |
| 1042 | 2644646147 | 2643221717 | Bacteria | 5676132 |
| 1043 | 2719642406 | 2718217991 | Bacteria | 7829542 |
| 1044 | 2729145426 | 2728369097 | Bacteria | 4333476 |
| 1045 | 2738701891 | 2738541273 | Bacteria | 4048577 |
| 1046 | 2738722423 | 2738541277 | Bacteria | 7458140 |
| 1047 | 2738883897 | 2738541307 | Bacteria | 8606193 |
| 1048 | 2739243632 | 2738543012 | Bacteria | 7115078 |
| 1049 | 2739249127 | 2738543013 | Bacteria | 5618633 |
| 1050 | 2739256189 | 2738543014 | Bacteria | 4048139 |
| 1051 | 2739282787 | 2738543019 | Bacteria | 7459457 |
| 1052 | 2739289826 | 2738543020 | Bacteria | 5718238 |
| 1053 | 2739295138 | 2738543021 | Bacteria | 5718241 |
| 1054 | 2740061186 | 2739367874 | Bacteria | 4872888 |
| 1055 | 2746090610 | 2744054900 | Bacteria | 8399525 |
| 1056 | 2746099092 | 2744054901 | Bacteria | 8397047 |
| 1057 | 2765568815 | 2765235838 | Bacteria | 5445269 |
| 1058 | 2765576359 | 2765235839 | Bacteria | 5314748 |
| 1059 | 2774119857 | 2773857670 | Bacteria | 6407454 |
| 1060 | 2774128181 | 2773857672 | Bacteria | 4993178 |
| 1061 | 2784312213 | 2784132072 | Bacteria | 6596533 |
| 1062 | 2808857949 | 2808606361 | Bacteria | 6136259 |
| 1063 | 2808926471 | 2808606376 | Bacteria | 6248667 |
| 1064 | 2808938209 | 2808606378 | Bacteria | 6177535 |
| 1065 | 2808948605 | 2808606380 | Bacteria | 6248705 |
| 1066 | 2808966461 | 2808606383 | Bacteria | 6138645 |
| 1067 | 2808970323 | 2808606384 | Bacteria | 8474373 |
| 1068 | 2808984322 | 2808606386 | Bacteria | 4471946 |
| 1069 | 2809001291 | 2808606389 | Bacteria | 6138126 |
| 1070 | 2809004830 | 2808606390 | Bacteria | 8476311 |
| 1071 | 2809012029 | 2808606391 | Bacteria | 8308166 |
| 1072 | 2809130675 | 2808606415 | Bacteria | 4576710 |
| 1073 | 2809149847 | 2808606419 | Bacteria | 4576925 |
| 1074 | 2816474153 | 2816332133 | Bacteria | 7249298 |
| 1075 | 2819542404 | 2818991436 | Bacteria | 5376622 |
| 1076 | 2819591352 | 2818991445 | Bacteria | 4955017 |
| 1077 | 2819596204 | 2818991446 | Bacteria | 7757362 |
| 1078 | 2819615466 | 2818991449 | Bacteria | 5518009 |
| 1079 | 2831270454 | 2831265667 | Bacteria | 7184833 |
| 1080 | 2831867738 | 2831864461 | Bacteria | 6502356 |
| 1081 | 2838056682 | 2838054893 | Bacteria | 7451788 |
| 1082 | 2839096301 | 2839094727 | Bacteria | 5534556 |
| 1083 | 2842456442 | 2842454564 | Bacteria | 8730687 |
| 1084 | 2842681506 | 2842677519 | Bacteria | 5615038 |
| 1085 | 2842738414 | 2842733646 | Bacteria | 5716726 |
| 1086 | 2842808697 | 2842805378 | Bacteria | 5385175 |
| 1087 | 2852620011 | 2852618963 | Bacteria | 4577824 |
| 1088 | 2856294497 | 2856287931 | Bacteria | 7223934 |
| 1089 | 2857367870 | 2857357740 | Bacteria | 9937880 |
| 1090 | 2860339206 | 2860339153 | Bacteria | 6846989 |
| 1091 | 2884812340 | 2884811622 | Bacteria | 5552861 |
| 1092 | 2884837146 | 2884836552 | Bacteria | 5219991 |
| 1093 | 2884853438 | 2884852848 | Bacteria | 5221161 |
| 1094 | 2885194082 | 2885192300 | Bacteria | 5882526 |
| 1095 | 2885266637 | 2885266251 | Bacteria | 4796748 |
| 1096 | 2889293133 | 2889290771 | Bacteria | 5530962 |
| 1097 | 2891636911 | 2891633521 | Bacteria | 4602265 |
| 1098 | 2894025678 | 2894023352 | Bacteria | 5167372 |
| 1099 | 2896155445 | 2896154374 | Bacteria | 5221518 |
| 1100 | 2899925585 | 2899924645 | Bacteria | 7487985 |
| 1101 | 2900581299 | 2900577576 | Bacteria | 5438534 |
| 1102 | 2902687723 | 2902682994 | Bacteria | 8951596 |
| 1103 | 2904444615 | 2904439833 | Bacteria | 5931679 |
| 1104 | 2904454667 | 2904449895 | Bacteria | 6927402 |
| 1105 | 2904460410 | 2904456579 | Bacteria | 6819253 |
| 1106 | 2904480370 | 2904479285 | Bacteria | 5073931 |
| 1107 | 2904486438 | 2904483920 | Bacteria | 7545285 |
| 1108 | 2904534730 | 2904530477 | Bacteria | 5876334 |
| 1109 | 2904584619 | 2904584206 | Bacteria | 6028872 |
| 1110 | 2904591086 | 2904589729 | Bacteria | 6113573 |
| 1111 | 2904605286 | 2904601388 | Bacteria | 5884906 |
| 1112 | 2904622351 | 2904615490 | Bacteria | 10047340 |
| 1113 | 2917835468 | 2917832318 | Bacteria | 5346010 |
| 1114 | 2919048453 | 2919046199 | Bacteria | 5567169 |
| 1115 | 2919081025 | 2919079590 | Bacteria | 5946433 |
| 1116 | 2919129191 | 2919125081 | Bacteria | 5385106 |
| 1117 | 2919464219 | 2919462493 | Bacteria | 5817112 |
| 1118 | 2923512605 | 2923510766 | Bacteria | 5926163 |
| 1119 | 2928038320 | 2928037797 | Bacteria | 7273642 |
| 1120 | 2928046075 | 2928044640 | Bacteria | 7271509 |
| 1121 | 2928053774 | 2928051484 | Bacteria | 7773759 |
| 1122 | 2928059503 | 2928058823 | Bacteria | 5520022 |
| 1123 | 2928067317 | 2928064002 | Bacteria | 7419480 |
| 1124 | 2928076284 | 2928070936 | Bacteria | 8062541 |
| 1125 | 2928088919 | 2928084124 | Bacteria | 7159212 |
| 1126 | 2928119690 | 2928115317 | Bacteria | 6477646 |
| 1127 | 2928132636 | 2928130867 | Bacteria | 5467269 |
| 1128 | 2928504251 | 2928503688 | Bacteria | 7268108 |
| 1129 | 2929524614 | 2929520902 | Bacteria | 6765052 |
| 1130 | 2931400839 | 2931396565 | Bacteria | 7251677 |
| 1131 | 2932426627 | 2932422444 | Bacteria | 4678430 |
| 1132 | 2939589090 | 2939582691 | Bacteria | 7088898 |
| 1133 | 2939639890 | 2939636861 | Bacteria | 6297853 |
| 1134 | 2945912828 | 2945909444 | Bacteria | 7065066 |
| 1135 | 2945947036 | 2945945610 | Bacteria | 5951079 |
| 1136 | 2945976722 | 2945972063 | Bacteria | 6086495 |
| 1137 | 2945984905 | 2945984333 | Bacteria | 7358892 |
| 1138 | 2974299663 | 2974298342 | Bacteria | 4840922 |
| 1139 | 2984504482 | 2984504281 | Bacteria | 5262371 |
| 1140 | 2990712304 | 2990710928 | Bacteria | 5002431 |
| 1141 | 2998347672 | 2998344455 | Bacteria | 4222996 |
| 1142 | 8011354140 | 8011350971 | Bacteria | 6158957 |
| 1143 | 8019781232 | 8019775933 | Bacteria | 6858656 |
| 1144 | 8040172932 | 8040167225 | Bacteria | 6542727 |
| 1145 | 8055304436 | 8055301274 | Bacteria | 8587385 |
| 1146 | 8056128409 | 8056125926 | Bacteria | 6228218 |
| 1147 | Ga0075432_10077766 | |||
| 1148 | MRS2a_Contig_6410 | |||
| 1149 | JGI24740J21852_10000275 | |||
| 1150 | JGI24740J21852_10024395 | |||
| 1151 | JGI25155J39150_1000740 | |||
| 1152 | JGI25155J39150_1000889 | |||
| 1153 | JGI25156J39149_1001996 | |||
| 1154 | JGI25156J39149_1003358 | |||
| 1155 | JGI25156J39149_1009248 | |||
| 1156 | JGI25162J39368_1000369 | |||
| 1157 | JGI25162J39368_1000370 | |||
| 1158 | JGI25154J39366_1000522 | |||
| 1159 | JGI25154J39366_1002282 | |||
| 1160 | JGI25157J39369_1000336 | |||
| 1161 | JGI25152J39213_1002215 | |||
| 1162 | JGI25152J39213_1005545 | |||
| 1163 | JGI25150J39212_1001247 | |||
| 1164 | JGI25150J39212_1001590 | |||
| 1165 | JGI25159J45721_1002135 | |||
| 1166 | JGI25159J45721_1006297 | |||
| 1167 | JGI25151J46595_10004105 | |||
| 1168 | JGI25151J46595_10004592 | |||
| 1169 | JGI25151J46595_10016037 | |||
| 1170 | JGI25165J46597_1000022 | |||
| 1171 | JGI25153J46596_10004442 | |||
| 1172 | JGI25153J46596_10006559 | |||
| 1173 | rootH2_10045628 | |||
| 1174 | rootH2_10085097 | |||
| 1175 | rootL2_10022424 | |||
| 1176 | rootL2_10234216 | |||
| 1177 | rootH1_10106878 | |||
| 1178 | JGI25160J50197_1002977 | |||
| 1179 | JGI25160J50197_1009553 | |||
| 1180 | JGI25161J50226_1001358 | |||
| 1181 | JGI25161J50226_1004239 | |||
| 1182 | Ga0006562J51391_1033784 | |||
| 1183 | Ga0006562J51391_1033786 | |||
| 1184 | Ga0006562J51391_1036841 | |||
| 1185 | Ga0055538_1000011 | |||
| 1186 | Ga0055538_1000255 | |||
| 1187 | Ga0055539_1000016 | |||
| 1188 | Ga0055539_1000059 | |||
| 1189 | Ga0055539_1000288 | |||
| 1190 | Ga0055533_1000019 | |||
| 1191 | Ga0055533_1000273 | |||
| 1192 | Ga0055532_1000016 | |||
| 1193 | Ga0055532_1000025 | |||
| 1194 | Ga0055525_1000042 | |||
| 1195 | Ga0055525_1000372 | |||
| 1196 | Ga0055525_1000389 | |||
| 1197 | Ga0055535_1000019 | |||
| 1198 | Ga0055535_1000215 | |||
| 1199 | Ga0055535_1009321 | |||
| 1200 | Ga0055542_1000004 | |||
| 1201 | Ga0055542_1001074 | |||
| 1202 | Ga0055529_1000035 | |||
| 1203 | Ga0055526_1003413 | |||
| 1204 | Ga0055526_1005028 | |||
| 1205 | Ga0055537_1001816 | |||
| 1206 | Ga0055524_1000109 | |||
| 1207 | Ga0055524_1003044 | |||
| 1208 | Ga0055524_1003404 | |||
| 1209 | Ga0055536_1001609 | |||
| 1210 | Ga0055536_1003572 | |||
| 1211 | Ga0055536_1006289 | |||
| 1212 | Ga0055536_1023079 | |||
| 1213 | Ga0055534_1001943 | |||
| 1214 | Ga0055528_1003588 | |||
| 1215 | Ga0055530_10001847 | |||
| 1216 | Ga0055530_10004499 | |||
| 1217 | Ga0055530_10028296 | |||
| 1218 | Ga0055540_1000408 | |||
| 1219 | Ga0055540_1001457 | |||
| 1220 | Ga0055540_1003628 | |||
| 1221 | Ga0055540_1005917 | |||
| 1222 | Ga0055540_1045228 | |||
| 1223 | Ga0055531_10001899 | |||
| 1224 | Ga0055531_10003404 | |||
| 1225 | Ga0055531_10009281 | |||
| 1226 | Ga0055541_1000017 | |||
| 1227 | Ga0055541_1000187 | |||
| 1228 | Ga0055541_1007448 | |||
| 1229 | Ga0055543_1001655 | |||
| 1230 | Ga0055543_1001835 | |||
| 1231 | Ga0065165_1005005 | |||
| 1232 | Ga0065165_1006473 | |||
| 1233 | Ga0065714_10000250 | |||
| 1234 | Ga0065714_10004039 | |||
| 1235 | Ga0065714_10064584 | |||
| 1236 | Ga0065704_10085551 | |||
| 1237 | Ga0065704_10120439 | |||
| 1238 | Ga0065712_10001860 | |||
| 1239 | Ga0065715_10009160 | |||
| 1240 | Ga0070658_10002173 | |||
| 1241 | Ga0070690_100326244 | |||
| 1242 | Ga0068869_100300229 | |||
| 1243 | Ga0070682_100000175 | |||
| 1244 | Ga0070682_100358758 | |||
| 1245 | Ga0070660_100184238 | |||
| 1246 | Ga0070691_10077359 | |||
| 1247 | Ga0070661_100000767 | |||
| 1248 | Ga0070661_100000769 | |||
| 1249 | Ga0070668_100562095 | |||
| 1250 | Ga0070669_100020846 | |||
| 1251 | Ga0070675_100059478 | |||
| 1252 | Ga0070674_100086439 | |||
| 1253 | Ga0070659_100003572 | |||
| 1254 | Ga0070659_100231782 | |||
| 1255 | Ga0070667_100020167 | |||
| 1256 | Ga0070667_100474452 | |||
| 1257 | Ga0070701_10234224 | |||
| 1258 | Ga0070663_100000009 | |||
| 1259 | Ga0070678_100054293 | |||
| 1260 | Ga0070678_100300932 | |||
| 1261 | Ga0070662_100002684 | |||
| 1262 | Ga0070662_100089639 | |||
| 1263 | Ga0070672_100351298 | |||
| 1264 | Ga0070672_100489457 | |||
| 1265 | Ga0070665_100241195 | |||
| 1266 | Ga0068855_100000526 | |||
| 1267 | Ga0068855_100009723 | |||
| 1268 | Ga0068855_100245073 | |||
| 1269 | Ga0070664_100000010 | |||
| 1270 | Ga0070664_100050800 | |||
| 1271 | Ga0070664_100051488 | |||
| 1272 | Ga0068857_100036269 | |||
| 1273 | Ga0068854_100000017 | |||
| 1274 | Ga0068854_100002811 | |||
| 1275 | Ga0068856_100000069 | |||
| 1276 | Ga0068852_100034306 | |||
| 1277 | Ga0068852_100200450 | |||
| 1278 | Ga0068852_100385353 | |||
| 1279 | Ga0068851_10064492 | |||
| 1280 | Ga0075363_100119461 | |||
| 1281 | Ga0075364_10001331 | |||
| 1282 | Ga0075364_10001778 | |||
| 1283 | Ga0075432_10000580 | |||
| 1284 | Ga0075432_10000757 | |||
| 1285 | Ga0075432_10015678 | |||
| 1286 | Ga0075432_10063717 | |||
| 1287 | Ga0070712_100003321 | |||
| 1288 | Ga0075362_10001714 | |||
| 1289 | Ga0075369_10044618 | |||
| 1290 | Ga0075370_10001452 | |||
| 1291 | Ga0075370_10017786 | |||
| 1292 | Ga0075370_10028586 | |||
| 1293 | Ga0075370_10061894 | |||
| 1294 | Ga0068865_100388775 | |||
| 1295 | Ga0079104_1000001 | |||
| 1296 | Ga0079104_1000276 | |||
| 1297 | Ga0105251_10002438 | |||
| 1298 | Ga0105251_10024172 | |||
| 1299 | Ga0105251_10040737 | |||
| 1300 | Ga0105251_10115783 | |||
| 1301 | Ga0105244_10000775 | |||
| 1302 | Ga0105244_10001886 | |||
| 1303 | Ga0105244_10041540 | |||
| 1304 | Ga0105244_10056822 | |||
| 1305 | Ga0105244_10178129 | |||
| 1306 | Ga0105250_10002637 | |||
| 1307 | Ga0105250_10014086 | |||
| 1308 | Ga0105240_10000497 | |||
| 1309 | Ga0105240_10031065 | |||
| 1310 | Ga0105240_10129678 | |||
| 1311 | Ga0105240_10653354 | |||
| 1312 | Ga0105243_10000588 | |||
| 1313 | Ga0105243_10012543 | |||
| 1314 | Ga0105243_10063016 | |||
| 1315 | Ga0105243_10131262 | |||
| 1316 | Ga0105243_10337434 | |||
| 1317 | Ga0105237_10003695 | |||
| 1318 | Ga0105237_10417715 | |||
| 1319 | Ga0105238_10000117 | |||
| 1320 | Ga0105238_10049693 | |||
| 1321 | Ga0105238_10244084 | |||
| 1322 | Ga0105249_10138083 | |||
| 1323 | Ga0105249_10453187 | |||
| 1324 | Ga0105239_10091600 | |||
| 1325 | Ga0105246_10118211 | |||
| 1326 | Ga0157339_1003179 | |||
| 1327 | Ga0157373_10014005 | |||
| 1328 | Ga0157373_10022728 | |||
| 1329 | Ga0157373_10033887 | |||
| 1330 | Ga0157373_10050217 | |||
| 1331 | Ga0157371_10000033 | |||
| 1332 | Ga0157371_10002234 | |||
| 1333 | Ga0157371_10003692 | |||
| 1334 | Ga0157371_10006955 | |||
| 1335 | Ga0157371_10020177 | |||
| 1336 | Ga0157370_10000010 | |||
| 1337 | Ga0157370_10000055 | |||
| 1338 | Ga0157370_10000372 | |||
| 1339 | Ga0157370_10015682 | |||
| 1340 | Ga0157370_10015692 | |||
| 1341 | Ga0157370_10270775 | |||
| 1342 | Ga0157369_10000093 | |||
| 1343 | Ga0157369_10000665 | |||
| 1344 | Ga0157369_10015219 | |||
| 1345 | Ga0157369_10061241 | |||
| 1346 | Ga0157369_10238705 | |||
| 1347 | Ga0157378_10441404 | |||
| 1348 | Ga0163162_10002312 | |||
| 1349 | Ga0163162_10108037 | |||
| 1350 | Ga0157372_10001138 | |||
| 1351 | Ga0157372_10639833 | |||
| 1352 | Ga0182008_10000494 | |||
| 1353 | Ga0182008_10004710 | |||
| 1354 | Ga0182008_10007370 | |||
| 1355 | Ga0182008_10024459 | |||
| 1356 | Ga0182008_10025372 | |||
| 1357 | Ga0182008_10097064 | |||
| 1358 | Ga0157379_10345012 | |||
| 1359 | Ga0182006_1001948 | |||
| 1360 | Ga0182006_1005485 | |||
| 1361 | Ga0182006_1006078 | |||
| 1362 | Ga0182006_1007977 | |||
| 1363 | Ga0182006_1015536 | |||
| 1364 | Ga0182006_1015571 | |||
| 1365 | Ga0182006_1019964 | |||
| 1366 | Ga0182006_1029274 | |||
| 1367 | Ga0182006_1075071 | |||
| 1368 | Ga0182007_10001204 | |||
| 1369 | Ga0182007_10003889 | |||
| 1370 | Ga0182007_10011950 | |||
| 1371 | Ga0182005_1000351 | |||
| 1372 | Ga0183362_10001 | |||
| 1373 | Ga0163161_10000060 | |||
| 1374 | Ga0163161_10041431 | |||
| 1375 | Ga0163161_10053743 | |||
| 1376 | Ga0163161_10059503 | |||
| 1377 | Ga0163161_10293593 | |||
| 1378 | Ga0206351_10970006 | |||
| 1379 | Ga0206350_11606970 | |||
| 1380 | Ga0206353_10422469 | |||
| 1381 | Ga0154015_1175498 | |||
| 1382 | Ga0213872_10002036 | |||
| 1383 | Ga0213872_10009541 | |||
| 1384 | Ga0213872_10013428 | |||
| 1385 | Ga0213872_10028339 | |||
| 1386 | Ga0224712_10000006 | |||
| 1387 | Ga0209435_100016 | |||
| 1388 | Ga0209435_104520 | |||
| 1389 | Ga0209760_101527 | |||
| 1390 | Ga0209436_101334 | |||
| 1391 | Ga0209436_103436 | |||
| 1392 | Ga0209784_100008 | |||
| 1393 | Ga0209784_100019 | |||
| 1394 | Ga0209784_100281 | |||
| 1395 | Ga0209784_100461 | |||
| 1396 | Ga0209784_100809 | |||
| 1397 | Ga0209566_100006 | |||
| 1398 | Ga0209566_100017 | |||
| 1399 | Ga0209566_100473 | |||
| 1400 | Ga0209566_100805 | |||
| 1401 | Ga0209566_100952 | |||
| 1402 | Ga0209674_100031 | |||
| 1403 | Ga0209674_100045 | |||
| 1404 | Ga0209674_100114 | |||
| 1405 | Ga0209674_100330 | |||
| 1406 | Ga0209672_102145 | |||
| 1407 | Ga0209147_100005 | |||
| 1408 | Ga0209147_100023 | |||
| 1409 | Ga0209147_100769 | |||
| 1410 | Ga0209563_100016 | |||
| 1411 | Ga0209563_100035 | |||
| 1412 | Ga0209563_100218 | |||
| 1413 | Ga0209563_105701 | |||
| 1414 | Ga0207427_100639 | |||
| 1415 | Ga0209437_100038 | |||
| 1416 | Ga0209437_100080 | |||
| 1417 | Ga0209258_100007 | |||
| 1418 | Ga0209258_100022 | |||
| 1419 | Ga0209258_100210 | |||
| 1420 | Ga0207425_1000180 | |||
| 1421 | Ga0207425_1032436 | |||
| 1422 | Ga0209646_1000027 | |||
| 1423 | Ga0209646_1000033 | |||
| 1424 | Ga0209646_1000200 | |||
| 1425 | Ga0209026_1000031 | |||
| 1426 | Ga0209026_1002370 | |||
| 1427 | Ga0209026_1009929 | |||
| 1428 | Ga0209677_100008 | |||
| 1429 | Ga0209677_100020 | |||
| 1430 | Ga0209677_100350 | |||
| 1431 | Ga0209677_107624 | |||
| 1432 | Ga0209148_1000019 | |||
| 1433 | Ga0209148_1000034 | |||
| 1434 | Ga0209759_1000045 | |||
| 1435 | Ga0209759_1002029 | |||
| 1436 | Ga0209759_1007962 | |||
| 1437 | Ga0209129_1000111 | |||
| 1438 | Ga0209129_1001197 | |||
| 1439 | Ga0209233_1000049 | |||
| 1440 | Ga0209565_1000110 | |||
| 1441 | Ga0209565_1001804 | |||
| 1442 | Ga0209455_1000011 | |||
| 1443 | Ga0209455_1007159 | |||
| 1444 | Ga0209673_1000175 | |||
| 1445 | Ga0209673_1000944 | |||
| 1446 | Ga0209673_1000992 | |||
| 1447 | Ga0209673_1001347 | |||
| 1448 | Ga0209130_1000205 | |||
| 1449 | Ga0209130_1000332 | |||
| 1450 | Ga0209675_1000192 | |||
| 1451 | Ga0209675_1003468 | |||
| 1452 | Ga0209675_1009747 | |||
| 1453 | Ga0209675_1017748 | |||
| 1454 | Ga0209676_1000005 | |||
| 1455 | Ga0209676_1000356 | |||
| 1456 | Ga0209676_1003888 | |||
| 1457 | Ga0209676_1044656 | |||
| 1458 | Ga0209025_1000096 | |||
| 1459 | Ga0209025_1000116 | |||
| 1460 | Ga0209025_1027245 | |||
| 1461 | Ga0209564_1000155 | |||
| 1462 | Ga0209564_1000298 | |||
| 1463 | Ga0209758_1000107 | |||
| 1464 | Ga0209758_1009267 | |||
| 1465 | Ga0209050_1000007 | |||
| 1466 | Ga0209050_1000155 | |||
| 1467 | Ga0209050_1000575 | |||
| 1468 | Ga0209050_1003630 | |||
| 1469 | Ga0209050_1022292 | |||
| 1470 | Ga0209256_1000015 | |||
| 1471 | Ga0209256_1000038 | |||
| 1472 | Ga0209256_1000087 | |||
| 1473 | Ga0207426_1000090 | |||
| 1474 | Ga0207426_1000123 | |||
| 1475 | Ga0207426_1001768 | |||
| 1476 | Ga0207426_1032945 | |||
| 1477 | Ga0209051_1000009 | |||
| 1478 | Ga0209051_1000073 | |||
| 1479 | Ga0209051_1000092 | |||
| 1480 | Ga0209051_1000598 | |||
| 1481 | Ga0209051_1001817 | |||
| 1482 | Ga0209051_1005786 | |||
| 1483 | Ga0209257_1000011 | |||
| 1484 | Ga0209257_1000139 | |||
| 1485 | Ga0209257_1000576 | |||
| 1486 | Ga0209257_1000870 | |||
| 1487 | Ga0207656_10010379 | |||
| 1488 | Ga0207696_1008369 | |||
| 1489 | Ga0207696_1024868 | |||
| 1490 | Ga0207655_1002169 | |||
| 1491 | Ga0207655_1002182 | |||
| 1492 | Ga0207655_1033787 | |||
| 1493 | Ga0207713_1006007 | |||
| 1494 | Ga0207713_1009327 | |||
| 1495 | Ga0207713_1024270 | |||
| 1496 | Ga0207645_10163938 | |||
| 1497 | Ga0207705_10002977 | |||
| 1498 | Ga0207695_10001142 | |||
| 1499 | Ga0207695_10012413 | |||
| 1500 | Ga0207671_10007218 | |||
| 1501 | Ga0207693_10012704 | |||
| 1502 | Ga0207657_10177300 | |||
| 1503 | Ga0207649_10000463 | |||
| 1504 | Ga0207649_10001113 | |||
| 1505 | Ga0207649_10124093 | |||
| 1506 | Ga0207681_10014629 | |||
| 1507 | Ga0207694_10000103 | |||
| 1508 | Ga0207694_10169094 | |||
| 1509 | Ga0207694_10256178 | |||
| 1510 | Ga0207659_10250138 | |||
| 1511 | Ga0207690_10004528 | |||
| 1512 | Ga0207690_10036454 | |||
| 1513 | Ga0207690_10358862 | |||
| 1514 | Ga0207706_10019491 | |||
| 1515 | Ga0207706_10078135 | |||
| 1516 | Ga0207709_10000353 | |||
| 1517 | Ga0207709_10001645 | |||
| 1518 | Ga0207709_10036454 | |||
| 1519 | Ga0207709_10060254 | |||
| 1520 | Ga0207709_10121767 | |||
| 1521 | Ga0207704_10548860 | |||
| 1522 | Ga0207691_10199935 | |||
| 1523 | Ga0207711_10014842 | |||
| 1524 | Ga0207689_10246475 | |||
| 1525 | Ga0207679_10000002 | |||
| 1526 | Ga0207679_10000533 | |||
| 1527 | Ga0207679_10180827 | |||
| 1528 | Ga0207667_10000073 | |||
| 1529 | Ga0207667_10000076 | |||
| 1530 | Ga0207667_10000147 | |||
| 1531 | Ga0207667_10000166 | |||
| 1532 | Ga0207667_10001488 | |||
| 1533 | Ga0207667_10126447 | |||
| 1534 | Ga0207667_10582762 | |||
| 1535 | Ga0207712_10082844 | |||
| 1536 | Ga0207640_10003888 | |||
| 1537 | Ga0207658_10082854 | |||
| 1538 | Ga0207658_10330294 | |||
| 1539 | Ga0207677_10143188 | |||
| 1540 | Ga0207703_10046150 | |||
| 1541 | Ga0207639_10205885 | |||
| 1542 | Ga0207639_10655920 | |||
| 1543 | Ga0207678_10000015 | |||
| 1544 | Ga0207702_10000053 | |||
| 1545 | Ga0207648_10083787 | |||
| 1546 | Ga0207648_10169854 | |||
| 1547 | Ga0207683_10031804 | |||
| 1548 | Ga0207683_10074997 | |||
| 1549 | Ga0207683_10472411 | |||
| 1550 | Ga0207698_10090797 | |||
| 1551 | Ga0209281_1000055 | |||
| 1552 | Ga0209281_1000057 | |||
| 1553 | Ga0209983_1001261 | |||
| 1554 | Ga0209971_1001963 | |||
| 1555 | Ga0209971_1032372 | |||
| 1556 | Ga0207428_10005518 | |||
| 1557 | Ga0207428_10056681 | |||
| 1558 | Ga0207428_10081256 | |||
| 1559 | Ga0268266_10282896 | |||
| 1560 | Ga0265334_10035702 | |||
| 1561 | Ga0307515_10000028 | |||
| 1562 | Ga0307515_10000109 | |||
| 1563 | Ga0307515_10010767 | |||
| 1564 | Ga0307515_10018244 | |||
| 1565 | Ga0307515_10030494 | |||
| 1566 | Ga0307515_10133994 | |||
| 1567 | Ga0307515_10229916 | |||
| 1568 | Ga0307512_10013840 | |||
| 1569 | Ga0316177_1124424 | |||
| 1570 | Ga0316176_1202515 | |||
| 1571 | Ga0314311_1048379 | |||
| 1572 | Ga0316180_1154980 | |||
| 1573 | Ga0316183_1077578 | |||
| 1574 | Ga0316181_1010717 | |||
| 1575 | Ga0265330_10000059 | |||
| 1576 | Ga0265332_10000002 | |||
| 1577 | Ga0265325_10009004 | |||
| 1578 | Ga0265327_10000842 | |||
| 1579 | Ga0265327_10003824 | |||
| 1580 | Ga0307513_10000990 | |||
| 1581 | Ga0307513_10021840 | |||
| 1582 | Ga0307513_10039886 | |||
| 1583 | Ga0307513_10064222 | |||
| 1584 | Ga0307513_10175158 | |||
| 1585 | Ga0307513_10259306 | |||
| 1586 | Ga0307509_10085885 | |||
| 1587 | Ga0307408_100030750 | |||
| 1588 | Ga0307408_100193231 | |||
| 1589 | Ga0307508_10000101 | |||
| 1590 | Ga0307514_10000225 | |||
| 1591 | Ga0307514_10006401 | |||
| 1592 | Ga0307514_10008985 | |||
| 1593 | Ga0265314_10000012 | |||
| 1594 | Ga0316576_10208691 | |||
| 1595 | Ga0316576_10337668 | |||
| 1596 | Ga0316578_10177242 | |||
| 1597 | Ga0316578_10209631 | |||
| 1598 | Ga0307516_10011288 | |||
| 1599 | Ga0307405_10191829 | |||
| 1600 | Ga0307406_10001953 | |||
| 1601 | Ga0307407_10282677 | |||
| 1602 | Ga0307412_10031599 | |||
| 1603 | Ga0307416_100025521 | |||
| 1604 | Ga0307416_100088997 | |||
| 1605 | Ga0307414_10022867 | |||
| 1606 | Ga0316574_0011223 | |||
| 1607 | Ga0316584_0043873 | |||
| 1608 | Ga0395899_0000023 | |||
| 1609 | Ga0395899_0033546 | |||
| 1610 | Ga0395900_0000019 | |||
| 1611 | Ga0395900_0000146 | |||
| 1612 | Ga0395900_0008274 | |||
| 1613 | Ga0395900_0044793 | |||
| 1614 | Ga0395900_0046317 | |||
| 1615 | Ga0395898_0000016 | |||
| 1616 | Ga0395898_0000617 | |||
| 1617 | Ga0395898_0070883 | |||
| 1618 | Ga0395901_0000004 | |||
| 1619 | Ga0395901_0000326 | |||
| 1620 | Ga0395901_0002868 | |||
| 1621 | Ga0436361_0106476 | |||
| 1622 | Ga0436361_0272349 | |||
| 1623 | Ga0436361_0325069 | |||
| 1624 | Ga0436361_1051926 | |||
| 1625 | Ga0436361_1073848 | |||
| 1626 | Ga0436361_1080802 | |||
| 1627 | Ga0439436_0000305 | |||
| 1628 | Ga0439436_0000469 | |||
| 1629 | Ga0439438_004004 | |||
| 1630 | Ga0439438_018382 | |||
| 1631 | Ga0439439_0030749 | |||
| 1632 | Ga0439447_000006 | |||
| 1633 | Ga0439447_000080 | |||
| 1634 | Ga0439447_000235 | |||
| 1635 | Ga0439447_000632 | |||
| 1636 | Ga0439447_000765 | |||
| 1637 | Ga0439466_0001045 | |||
| 1638 | Ga0439466_0003209 | |||
| 1639 | Ga0439466_0004351 | |||
| 1640 | Ga0439466_0006387 | |||
| 1641 | Ga0439465_0004405 | |||
| 1642 | Ga0439465_0055628 | |||
| 1643 | Ga0451800_1156584 | |||
| 1644 | Ga0451853_2167458 | |||
| 1645 | Ga0439433_0000296 | |||
| 1646 | Ga0439445_0000826 | |||
| 1647 | Ga0439445_0008083 | |||
| 1648 | Ga0439432_002294 | |||
| 1649 | Ga0439432_002407 | |||
| 1650 | Ga0439432_014129 | |||
| 1651 | Ga0439432_035764 | |||
| 1652 | Ga0439449_0000061 | |||
| 1653 | Ga0439452_000408 | |||
| 1654 | Ga0439452_000448 | |||
| 1655 | Ga0439452_000685 | |||
| 1656 | Ga0439452_002094 | |||
| 1657 | Ga0439452_035096 | |||
| 1658 | Ga0439456_000828 | |||
| 1659 | Ga0439457_002853 | |||
| 1660 | Ga0439462_0001960 | |||
| 1661 | Ga0450911_000368 | |||
| 1662 | Ga0450911_006679 | |||
| 1663 | Ga0450919_002935 | |||
| 1664 | Ga0450919_006455 | |||
| 1665 | Ga0450920_000143 | |||
| 1666 | Ga0450922_000379 | |||
| 1667 | Ga0450902_001332 | |||
| 1668 | Ga0450902_016417 | |||
| 1669 | Ga0450903_002119 | |||
| 1670 | Ga0450903_003370 | |||
| 1671 | Ga0450903_004901 | |||
| 1672 | Ga0450906_005913 | |||
| 1673 | Ga0450907_000703 | |||
| 1674 | Ga0450907_001150 | |||
| 1675 | Ga0450910_002081 | |||
| 1676 | Ga0450910_010942 | |||
| 1677 | Ga0439446_0000601 | |||
| 1678 | Ga0439446_0011883 | |||
| 1679 | Ga0450908_002647 | |||
| 1680 | Ga0439434_0000957 | |||
| 1681 | Ga0439434_0001034 | |||
| 1682 | Ga0439434_0007289 | |||
| 1683 | Ga0439460_0000208 | |||
| 1684 | Ga0451577_0060171 | |||
| 1685 | Ga0466986_0107857 | |||
| 1686 | Ga0466969_0039905 | |||
| 1687 | Ga0466972_0040999 | |||
| 1688 | Ga0466965_0014038 | |||
| 1689 | Ga0466966_0000009 | |||
| 1690 | Ga0466966_0003478 | |||
| 1691 | Ga0466961_0000077 | |||
| 1692 | Ga0466961_0000143 | |||
| 1693 | Ga0466961_0026460 | |||
| 1694 | Ga0466963_0005514 | |||
| 1695 | Ga0466964_0025728 | |||
| 1696 | Ga0466971_0014751 | |||
| 1697 | Ga0466971_0018637 | |||
| 1698 | Ga0466968_0028543 | |||
| 1699 | Ga0466968_0076108 | |||
| 1700 | Ga0466970_0004578 | |||
| 1701 | Ga0466957_0017713 | |||
| 1702 | Ga0466959_0009963 | |||
| 1703 | Ga0466959_0014577 | |||
| 1704 | Ga0495617_000188 | |||
| 1705 | Ga0495617_049911 | |||
| 1706 | Ga0495627_000426 | |||
| 1707 | Ga0495603_0002299 | |||
| 1708 | Ga0495603_0011470 | |||
| 1709 | Ga0495603_0015411 | |||
| 1710 | Ga0495603_0028632 | |||
| 1711 | Ga0495590_0000074 | |||
| 1712 | Ga0495590_0002718 | |||
| 1713 | Ga0495590_0021643 | |||
| 1714 | Ga0495590_0057690 | |||
| 1715 | Ga0495591_000951 | |||
| 1716 | Ga0495591_001372 | |||
| 1717 | Ga0495591_001663 | |||
| 1718 | Ga0495591_003339 | |||
| 1719 | Ga0495591_008688 | |||
| 1720 | Ga0495591_031829 | |||
| 1721 | Ga0495629_0000837 | |||
| 1722 | Ga0495629_0002001 | |||
| 1723 | Ga0495629_0003794 | |||
| 1724 | Ga0495629_0046455 | |||
| 1725 | Ga0495638_0002170 | |||
| 1726 | Ga0495638_0003829 | |||
| 1727 | Ga0495638_0019240 | |||
| 1728 | Ga0495638_0070278 | |||
| 1729 | Ga0495638_0108574 | |||
| 1730 | Ga0495638_0164490 | |||
| 1731 | Ga0495638_0208018 | |||
| 1732 | Ga0495641_0015039 | |||
| 1733 | Ga0495651_0023682 | |||
| 1734 | Ga0495651_0031030 | |||
| 1735 | Ga0495651_0130342 | |||
| 1736 | Ga0495653_0005124 | |||
| 1737 | Ga0495653_0012630 | |||
| 1738 | Ga0495653_0040848 | |||
| 1739 | Ga0495653_0103603 | |||
| 1740 | Ga0495653_0110361 | |||
| 1741 | Ga0495653_0111753 | |||
| 1742 | Ga0495653_0138584 | |||
| 1743 | Ga0495650_0001121 | |||
| 1744 | Ga0495650_0024249 | |||
| 1745 | Ga0495650_0060269 | |||
| 1746 | Ga0495650_0072990 | |||
| 1747 | Ga0495580_0000062 | |||
| 1748 | Ga0495580_0000269 | |||
| 1749 | Ga0495580_0007455 | |||
| 1750 | Ga0495582_0310259 | |||
| 1751 | Ga0495605_0001196 | |||
| 1752 | Ga0495605_0002710 | |||
| 1753 | Ga0495605_0008024 | |||
| 1754 | Ga0495605_0014664 | |||
| 1755 | Ga0495605_0156509 | |||
| 1756 | Ga0495639_0019038 | |||
| 1757 | Ga0495639_0086531 | |||
| 1758 | Ga0495662_0072192 | |||
| 1759 | Ga0495664_0036492 | |||
| 1760 | Ga0495584_0000928 | |||
| 1761 | Ga0495584_0011136 | |||
| 1762 | Ga0495584_0021779 | |||
| 1763 | Ga0495584_0035830 | |||
| 1764 | Ga0495585_0000626 | |||
| 1765 | Ga0495585_0003853 | |||
| 1766 | Ga0495585_0028645 | |||
| 1767 | Ga0495594_0007964 | |||
| 1768 | Ga0495596_0001577 | |||
| 1769 | Ga0495596_0016914 | |||
| 1770 | Ga0495596_0070562 | |||
| 1771 | Ga0495607_0006252 | |||
| 1772 | Ga0495607_0019474 | |||
| 1773 | Ga0495607_0020158 | |||
| 1774 | Ga0495607_0035206 | |||
| 1775 | Ga0495583_0000172 | |||
| 1776 | Ga0495606_0000859 | |||
| 1777 | Ga0495606_0001889 | |||
| 1778 | Ga0495606_0002982 | |||
| 1779 | Ga0495606_0006443 | |||
| 1780 | Ga0495608_0002271 | |||
| 1781 | Ga0495608_0002682 | |||
| 1782 | Ga0495610_0003096 | |||
| 1783 | Ga0495610_0015345 | |||
| 1784 | Ga0495610_0036339 | |||
| 1785 | Ga0495610_0041273 | |||
| 1786 | Ga0495616_0000323 | |||
| 1787 | Ga0495616_0001007 | |||
| 1788 | Ga0495616_0060631 | |||
| 1789 | Ga0495618_0003996 | |||
| 1790 | Ga0495618_0125635 | |||
| 1791 | Ga0495628_0024205 | |||
| 1792 | Ga0495628_0024253 | |||
| 1793 | Ga0495628_0065924 | |||
| 1794 | Ga0495628_0148574 | |||
| 1795 | Ga0495628_0149659 | |||
| 1796 | Ga0495630_0014914 | |||
| 1797 | Ga0495630_0034549 | |||
| 1798 | Ga0495630_0042479 | |||
| 1799 | Ga0495630_0049412 | |||
| 1800 | Ga0495630_0195895 | |||
| 1801 | Ga0495631_0000196 | |||
| 1802 | Ga0495631_0000455 | |||
| 1803 | Ga0495631_0002595 | |||
| 1804 | Ga0495632_0000617 | |||
| 1805 | Ga0495632_0032129 | |||
| 1806 | Ga0495632_0032293 | |||
| 1807 | Ga0495632_0040974 | |||
| 1808 | Ga0495637_0084932 | |||
| 1809 | Ga0495643_0000095 | |||
| 1810 | Ga0495643_0000532 | |||
| 1811 | Ga0495643_0002524 | |||
| 1812 | Ga0495643_0008892 | |||
| 1813 | Ga0495643_0023529 | |||
| 1814 | Ga0495643_0027714 | |||
| 1815 | Ga0495643_0058840 | |||
| 1816 | Ga0495644_0000008 | |||
| 1817 | Ga0495644_0000032 | |||
| 1818 | Ga0495644_0001957 | |||
| 1819 | Ga0495648_0000678 | |||
| 1820 | Ga0495648_0000886 | |||
| 1821 | Ga0495648_0001712 | |||
| 1822 | Ga0495648_0012148 | |||
| 1823 | Ga0495648_0018328 | |||
| 1824 | Ga0495648_0034287 | |||
| 1825 | Ga0495648_0047210 | |||
| 1826 | Ga0495648_0112967 | |||
| 1827 | Ga0495663_0014116 | |||
| 1828 | Ga0495666_0000497 | |||
| 1829 | Ga0495666_0003130 | |||
| 1830 | Ga0495666_0008007 | |||
| 1831 | Ga0495666_0038876 | |||
| 1832 | Ga0495642_0000008 | |||
| 1833 | Ga0495642_0000059 | |||
| 1834 | Ga0495652_0005080 | |||
| 1835 | Ga0495652_0008766 | |||
| 1836 | Ga0495652_0028025 | |||
| 1837 | Ga0495652_0159642 | |||
| 1838 | Ga0495652_0175814 | |||
| 1839 | Ga0495652_0226906 | |||
| 1840 | Ga0495654_0028655 | |||
| 1841 | Ga0495654_0032458 | |||
| 1842 | Ga0495654_0033073 | |||
| 1843 | Ga0495654_0042135 | |||
| 1844 | Ga0495665_0001953 | |||
| 1845 | Ga0495665_0002510 | |||
| 1846 | Ga0495665_0037769 | |||
| 1847 | Ga0495665_0166156 | |||
| 1848 | Ga0495640_0002419 | |||
| 1849 | Ga0495640_0121404 | |||
| 1850 | Ga0495586_0036587 | |||
| 1851 | Ga0495586_0119469 | |||
| 1852 | Ga0495587_0000102 | |||
| 1853 | Ga0495587_0081019 | |||
| 1854 | Ga0495609_0000677 | |||
| 1855 | Ga0495609_0063042 | |||
| 1856 | Ga0495621_0034517 | |||
| 1857 | Ga0495597_0000562 | |||
| 1858 | Ga0495597_0030975 | |||
| 1859 | Ga0495597_0101001 | |||
| 1860 | Ga0495645_0003620 | |||
| 1861 | Ga0495645_0058981 | |||
| 1862 | Ga0495645_0082041 | |||
| 1863 | Ga0495622_0000005 | |||
| 1864 | Ga0495622_0000205 | |||
| 1865 | Ga0495622_0004376 | |||
| 1866 | Ga0495633_0018257 | |||
| 1867 | Ga0495667_0013764 | |||
| 1868 | Ga0495656_0000060 | |||
| 1869 | Ga0495656_0019583 | |||
| 1870 | Ga0495656_0128322 | |||
| 1871 | Ga0495634_0000380 | |||
| 1872 | Ga0495634_0001826 | |||
| 1873 | Ga0495611_0004432 | |||
| 1874 | Ga0495611_0043444 | |||
| 1875 | Ga0495625_0000888 | |||
| 1876 | Ga0495625_0009629 | |||
| 1877 | Ga0495625_0150876 | |||
| 1878 | Ga0495635_0000921 | |||
| 1879 | Ga0495635_0018816 | |||
| 1880 | Ga0495635_0063054 | |||
| 1881 | Ga0495659_0002830 | |||
| 1882 | Ga0495661_0006996 | |||
| 1883 | Ga0495661_0009949 | |||
| 1884 | Ga0495661_0020583 | |||
| 1885 | Ga0495661_0047008 | |||
| 1886 | Ga0495661_0052194 | |||
| 1887 | Ga0495661_0070500 | |||
| 1888 | Ga0495588_0000485 | |||
| 1889 | Ga0495657_0013688 | |||
| 1890 | Ga0495657_0100308 | |||
| 1891 | Ga0495599_0004627 | |||
| 1892 | Ga0495599_0012745 | |||
| 1893 | Ga0495599_0024043 | |||
| 1894 | Ga0495599_0035407 | |||
| 1895 | Ga0495599_0162296 | |||
| 1896 | Ga0495623_0002336 | |||
| 1897 | Ga0495623_0022340 | |||
| 1898 | Ga0495646_0009968 | |||
| 1899 | Ga0495646_0013242 | |||
| 1900 | Ga0495646_0033595 | |||
| 1901 | Ga0495646_0034680 | |||
| 1902 | Ga0495646_0053677 | |||
| 1903 | Ga0495646_0062053 | |||
| 1904 | Ga0495646_0083312 | |||
| 1905 | Ga0495669_0000278 | |||
| 1906 | Ga0495669_0090314 | |||
| 1907 | Ga0495613_0007730 | |||
| 1908 | Ga0495613_0039429 | |||
| 1909 | Ga0495613_0050772 | |||
| 1910 | Ga0495624_0000817 | |||
| 1911 | Ga0495624_0015267 | |||
| 1912 | Ga0495624_0040718 | |||
| 1913 | Ga0495624_0129079 | |||
| 1914 | Ga0495624_0143416 | |||
| 1915 | Ga0495624_0221730 | |||
| 1916 | Ga0495670_0000519 | |||
| 1917 | Ga0495670_0004175 | |||
| 1918 | Ga0495670_0031554 | |||
| 1919 | Ga0495670_0141382 | |||
| 1920 | Ga0495671_0000536 | |||
| 1921 | Ga0495671_0003200 | |||
| 1922 | Ga0495671_0021990 | |||
| 1923 | Ga0495671_0037450 | |||
| 1924 | Ga0495671_0152346 | |||
| 1925 | Ga0495649_0001299 | |||
| 1926 | Ga0495649_0001695 | |||
| 1927 | Ga0495649_0002422 | |||
| 1928 | Ga0495649_0028016 | |||
| 1929 | Ga0495649_0056176 | |||
| 1930 | Ga0495589_0000214 | |||
| 1931 | Ga0495589_0002921 | |||
| 1932 | Ga0495589_0017112 | |||
| 1933 | Ga0495589_0036788 | |||
| 1934 | Ga0495589_0113425 | |||
| 1935 | Ga0495600_0000303 | |||
| 1936 | Ga0495600_0014053 | |||
| 1937 | Ga0495600_0050463 | |||
| 1938 | Ga0495660_0019398 | |||
| 1939 | Ga0495660_0046228 | |||
| 1940 | Ga0495660_0050087 | |||
| 1941 | Ga0495660_0107487 | |||
| 1942 | Ga0495581_0000974 | |||
| 1943 | Ga0495604_0023319 | |||
| 1944 | Ga0495604_0186498 | |||
| 1945 | Ga0495636_0034219 | |||
| 1946 | Ga0495674_0005269 | |||
| 1947 | Ga0495674_0006339 | |||
| 1948 | Ga0495674_0017847 | |||
| 1949 | Ga0495674_0036874 | |||
| 1950 | Ga0495674_0058724 | |||
| 1951 | Ga0495674_0070895 | |||
| 1952 | Ga0495674_0385602 | |||
| 1953 | Ga0495672_0000143 | |||
| 1954 | Ga0495672_0000496 | |||
| 1955 | Ga0495672_0000737 | |||
| 1956 | Ga0495672_0001053 | |||
| 1957 | Ga0495672_0003747 | |||
| 1958 | Ga0495672_0009789 | |||
| 1959 | Ga0495672_0012589 | |||
| 1960 | Ga0495672_0026526 | |||
| 1961 | Ga0495672_0059186 | |||
| 1962 | Ga0495676_0032555 | |||
| 1963 | Ga0495676_0261183 | |||
| 1964 | Ga0495680_0011162 | |||
| 1965 | Ga0495680_0016439 | |||
| 1966 | Ga0495680_0017483 | |||
| 1967 | Ga0495680_0053085 | |||
| 1968 | Ga0495680_0104301 | |||
| 1969 | Ga0495680_0341064 | |||
| 1970 | Ga0495683_0000146 | |||
| 1971 | Ga0495683_0000882 | |||
| 1972 | Ga0495683_0001972 | |||
| 1973 | Ga0495683_0002296 | |||
| 1974 | Ga0495683_0015769 | |||
| 1975 | Ga0495683_0024109 | |||
| 1976 | Ga0495683_0098081 | |||
| 1977 | Ga0495687_000091 | |||
| 1978 | Ga0495687_001312 | |||
| 1979 | Ga0495687_001359 | |||
| 1980 | Ga0495677_0000236 | |||
| 1981 | Ga0495679_000272 | |||
| 1982 | Ga0495679_001867 | |||
| 1983 | Ga0495679_004456 | |||
| 1984 | Ga0495685_010247 | |||
| 1985 | Ga0495673_0001717 | |||
| 1986 | Ga0495673_0038734 | |||
| 1987 | Ga0495673_0047539 | |||
| 1988 | Ga0495681_0000069 | |||
| 1989 | Ga0495681_0000128 | |||
| 1990 | Ga0495681_0000220 | |||
| 1991 | Ga0495681_0001304 | |||
| 1992 | Ga0495681_0003028 | |||
| 1993 | Ga0495681_0019482 | |||
| 1994 | Ga0495681_0019915 | |||
| 1995 | Ga0495684_0314937 | |||
| 1996 | Ga0495686_0012185 | |||
| 1997 | Ga0495686_0033912 | |||
| 1998 | Ga0495593_0000227 | |||
| 1999 | Ga0495593_0000308 | |||
| 2000 | Ga0495593_0007850 | |||
| 2001 | Ga0495593_0007932 | |||
| 2002 | Ga0495593_0026545 | |||
| 2003 | Ga0495593_0032454 | |||
| 2004 | Ga0495602_0018173 | |||
| 2005 | Ga0495602_0025932 | |||
| 2006 | Ga0495602_0038822 | |||
| 2007 | Ga0495602_0048671 | |||
| 2008 | Ga0495602_0327338 | |||
| 2009 | Ga0495614_0000338 | |||
| 2010 | Ga0495614_0011292 | |||
| 2011 | Ga0495614_0029155 | |||
| 2012 | Ga0495614_0068977 | |||
| 2013 | Ga0495626_0000083 | |||
| 2014 | Ga0495626_0002410 | |||
| 2015 | Ga0495626_0038755 | |||
| 2016 | Ga0495626_0051292 | |||
| 2017 | Ga0495626_0087181 | |||
| 2018 | Ga0496100_0007557 | |||
| 2019 | Ga0496100_0098859 | |||
| 2020 | Ga0496100_0404620 | |||
| 2021 | Ga0496101_0025631 | |||
| 2022 | Ga0496102_0000272 | |||
| 2023 | Ga0496102_0010230 | |||
| 2024 | Ga0496102_0019842 | |||
| 2025 | Ga0496102_0367730 | |||
| 2026 | Ga0496103_0000330 | |||
| 2027 | Ga0496103_0001182 | |||
| 2028 | Ga0496103_0002633 | |||
| 2029 | Ga0496103_0075449 | |||
| 2030 | Ga0496104_0001821 | |||
| 2031 | Ga0496104_0178957 | |||
| 2032 | Ga0496105_0000437 | |||
| 2033 | Ga0496105_0028200 | |||
| 2034 | Ga0496107_0028423 | |||
| 2035 | Ga0496107_0222254 | |||
| 2036 | Ga0496110_0022865 | |||
| 2037 | Ga0496110_0029512 | |||
| 2038 | Ga0496110_0330281 | |||
| 2039 | Ga0496111_0003072 | |||
| 2040 | Ga0496113_0010518 | |||
| 2041 | Ga0496113_0076826 | |||
| 2042 | Ga0496114_0004992 | |||
| 2043 | Ga0496114_0067196 | |||
| 2044 | Ga0496115_0094831 | |||
| 2045 | Ga0496116_0006783 | |||
| 2046 | Ga0496116_0019420 | |||
| 2047 | Ga0496116_0020388 | |||
| 2048 | Ga0496116_0078039 | |||
| 2049 | Ga0496116_0116889 | |||
| 2050 | Ga0496117_0004341 | |||
| 2051 | Ga0496117_0007626 | |||
| 2052 | Ga0496117_0021528 | |||
| 2053 | Ga0496117_0046142 | |||
| 2054 | Ga0496117_0114647 | |||
| 2055 | Ga0496117_0188848 | |||
| 2056 | Ga0496118_0001543 | |||
| 2057 | Ga0496118_0006740 | |||
| 2058 | Ga0496118_0010168 | |||
| 2059 | Ga0496118_0012208 | |||
| 2060 | Ga0496118_0029641 | |||
| 2061 | Ga0496118_0034928 | |||
| 2062 | Ga0496118_0036603 | |||
| 2063 | Ga0496118_0061015 | |||
| 2064 | Ga0496118_0113644 | |||
| 2065 | Ga0496120_0038047 | |||
| 2066 | Ga0496121_0006320 | |||
| 2067 | Ga0496121_0006891 | |||
| 2068 | Ga0496121_0055336 | |||
| 2069 | Ga0496121_0177926 | |||
| 2070 | Ga0496121_0182657 | |||
| 2071 | Ga0496121_0201458 | |||
| 2072 | Ga0496122_0000217 | |||
| 2073 | Ga0496122_0000375 | |||
| 2074 | Ga0496122_0001599 | |||
| 2075 | Ga0496122_0002181 | |||
| 2076 | Ga0496122_0011301 | |||
| 2077 | Ga0496122_0028435 | |||
| 2078 | Ga0496123_0000057 | |||
| 2079 | Ga0496123_0000267 | |||
| 2080 | Ga0496123_0003201 | |||
| 2081 | Ga0496123_0024780 | |||
| 2082 | Ga0496123_0031385 | |||
| 2083 | Ga0496123_0095092 | |||
| 2084 | Ga0496123_0105389 | |||
| 2085 | Ga0496124_0011374 | |||
| 2086 | Ga0496124_0020902 | |||
| 2087 | Ga0496124_0027362 | |||
| 2088 | Ga0496124_0043328 | |||
| 2089 | Ga0496124_0188384 | |||
| 2090 | Ga0496124_0288894 | |||
| 2091 | Ga0496125_0000710 | |||
| 2092 | Ga0496125_0003337 | |||
| 2093 | Ga0496125_0006710 | |||
| 2094 | Ga0496125_0007526 | |||
| 2095 | Ga0496125_0010218 | |||
| 2096 | Ga0496125_0011820 | |||
| 2097 | Ga0496125_0012669 | |||
| 2098 | Ga0496125_0025084 | |||
| 2099 | Ga0496125_0045550 | |||
| 2100 | Ga0496125_0127760 | |||
| 2101 | Ga0496126_0000114 | |||
| 2102 | Ga0496126_0000475 | |||
| 2103 | Ga0496126_0001848 | |||
| 2104 | Ga0496126_0004098 | |||
| 2105 | Ga0496126_0226179 | |||
| 2106 | Ga0495678_000837 | |||
| 2107 | Ga0495678_002725 | |||
| 2108 | Ga0495678_025713 | |||
| 2109 | Ga0495678_039529 | |||
| 2110 | Ga0495682_0001415 | |||
| 2111 | Ga0495682_0010663 | |||
| 2112 | Ga0495682_0066119 | |||
| 2113 | Ga0501031_0004220 | |||
| 2114 | Ga0501034_0157053 | |||
| 2115 | Ga0501034_0496662 | |||
| 2116 | Ga0501037_0143571 | |||
| 2117 | Ga0501080_0526996 | |||
| 2118 | Ga0501044_0156297 | |||
| 2119 | nmdc:mga0k408_26139_c1 | |||
| 2120 | nmdc:mga07m45_1219_c1 | |||
| 2121 | nmdc:mga07m45_1806_c2 | |||
| 2122 | nmdc:mga07m45_25541_c1 | |||
| 2123 | nmdc:mga07m45_51387_c1 | |||
| 2124 | Ga0495601_0283984 | |||
| 2125 | Ga0500610_0027281 | |||
| 2126 | Ga0500610_0028356 | |||
| 2127 | Ga0500643_001890 | |||
| 2128 | Ga0500651_0000052 | |||
| 2129 | Ga0500571_000036 | |||
| 2130 | Ga0500594_0001934 | |||
| 2131 | Ga0500595_002080 | |||
| 2132 | Ga0500608_021702 | |||
| 2133 | Ga0500618_000385 | |||
| 2134 | Ga0500658_0000033 | |||
| 2135 | Ga0500658_0000040 | |||
| 2136 | Ga0500658_0016242 | |||
| 2137 | Ga0500559_0001604 | |||
| 2138 | Ga0500559_0001672 | |||
| 2139 | Ga0500564_011334 | |||
| 2140 | Ga0500568_0003399 | |||
| 2141 | Ga0500574_026443 | |||
| 2142 | Ga0500616_0083773 | |||
| 2143 | Ga0500619_000329 | |||
| 2144 | Ga0500622_0015326 | |||
| 2145 | Ga0500634_0024021 | |||
| 2146 | Ga0500634_0066608 | |||
| 2147 | Ga0500587_000979 | |||
| 2148 | Ga0587072_000102 | |||
| 2149 | 2510249185 | |||
| 2150 | 2510285086 | |||
| 2151 | 2510294077 | |||
| 2152 | 2510313111 | |||
| 2153 | 2511247648 | |||
| 2154 | 2511279989 | |||
| 2155 | 2511303728 | |||
| 2156 | 2511351024 | |||
| 2157 | 2511353879 | |||
| 2158 | 2511360242 | |||
| 2159 | 2511384179 | |||
| 2160 | 2513229736 | |||
| 2161 | 2514047695 | |||
| 2162 | 2515680544 | |||
| 2163 | 2521558944 | |||
| 2164 | 2548497577 | |||
| 2165 | 2550697194 | |||
| 2166 | 2553003752 | |||
| 2167 | 2585145215 | |||
| 2168 | 2587680961 | |||
| 2169 | 2587759882 | |||
| 2170 | 2588212911 | |||
| 2171 | 2588224186 | |||
| 2172 | 2590600643 | |||
| 2173 | 2597030359 | |||
| 2174 | 2599446361 | |||
| 2175 | 2599625945 | |||
| 2176 | 2599674973 | |||
| 2177 | 2599683867 | |||
| 2178 | 2599695530 | |||
| 2179 | 2643866493 | |||
| 2180 | 2643953290 | |||
| 2181 | 2643993261 | |||
| 2182 | 2644021030 | |||
| 2183 | 2644061306 | |||
| 2184 | 2644076653 | |||
| 2185 | 2644294150 | |||
| 2186 | 2644329567 | |||
| 2187 | 2644398346 | |||
| 2188 | 2644646147 | |||
| 2189 | 2719642406 | |||
| 2190 | 2729145426 | |||
| 2191 | 2738701891 | |||
| 2192 | 2738722423 | |||
| 2193 | 2738883897 | |||
| 2194 | 2739243632 | |||
| 2195 | 2739249127 | |||
| 2196 | 2739256189 | |||
| 2197 | 2739282787 | |||
| 2198 | 2739289826 | |||
| 2199 | 2739295138 | |||
| 2200 | 2740061186 | |||
| 2201 | 2746090610 | |||
| 2202 | 2746099092 | |||
| 2203 | 2765568815 | |||
| 2204 | 2765576359 | |||
| 2205 | 2774119857 | |||
| 2206 | 2774128181 | |||
| 2207 | 2784312213 | |||
| 2208 | 2808857949 | |||
| 2209 | 2808926471 | |||
| 2210 | 2808938209 | |||
| 2211 | 2808948605 | |||
| 2212 | 2808966461 | |||
| 2213 | 2808970323 | |||
| 2214 | 2808984322 | |||
| 2215 | 2809001291 | |||
| 2216 | 2809004830 | |||
| 2217 | 2809012029 | |||
| 2218 | 2809130675 | |||
| 2219 | 2809149847 | |||
| 2220 | 2816474153 | |||
| 2221 | 2819542404 | |||
| 2222 | 2819591352 | |||
| 2223 | 2819596204 | |||
| 2224 | 2819615466 | |||
| 2225 | 2831270454 | |||
| 2226 | 2831867738 | |||
| 2227 | 2838056682 | |||
| 2228 | 2839096301 | |||
| 2229 | 2842456442 | |||
| 2230 | 2842681506 | |||
| 2231 | 2842738414 | |||
| 2232 | 2842808697 | |||
| 2233 | 2852620011 | |||
| 2234 | 2856294497 | |||
| 2235 | 2857367870 | |||
| 2236 | 2860339206 | |||
| 2237 | 2884812340 | |||
| 2238 | 2884837146 | |||
| 2239 | 2884853438 | |||
| 2240 | 2885194082 | |||
| 2241 | 2885266637 | |||
| 2242 | 2889293133 | |||
| 2243 | 2891636911 | |||
| 2244 | 2894025678 | |||
| 2245 | 2896155445 | |||
| 2246 | 2899925585 | |||
| 2247 | 2900581299 | |||
| 2248 | 2902687723 | |||
| 2249 | 2904444615 | |||
| 2250 | 2904454667 | |||
| 2251 | 2904460410 | |||
| 2252 | 2904480370 | |||
| 2253 | 2904486438 | |||
| 2254 | 2904534730 | |||
| 2255 | 2904584619 | |||
| 2256 | 2904591086 | |||
| 2257 | 2904605286 | |||
| 2258 | 2904622351 | |||
| 2259 | 2917835468 | |||
| 2260 | 2919048453 | |||
| 2261 | 2919081025 | |||
| 2262 | 2919129191 | |||
| 2263 | 2919464219 | |||
| 2264 | 2923512605 | |||
| 2265 | 2928038320 | |||
| 2266 | 2928046075 | |||
| 2267 | 2928053774 | |||
| 2268 | 2928059503 | |||
| 2269 | 2928067317 | |||
| 2270 | 2928076284 | |||
| 2271 | 2928088919 | |||
| 2272 | 2928119690 | |||
| 2273 | 2928132636 | |||
| 2274 | 2928504251 | |||
| 2275 | 2929524614 | |||
| 2276 | 2931400839 | |||
| 2277 | 2932426627 | |||
| 2278 | 2939589090 | |||
| 2279 | 2939639890 | |||
| 2280 | 2945912828 | |||
| 2281 | 2945947036 | |||
| 2282 | 2945976722 | |||
| 2283 | 2945984905 | |||
| 2284 | 2974299663 | |||
| 2285 | 2984504482 | |||
| 2286 | 2990712304 | |||
| 2287 | 2998347672 | |||
| 2288 | 8011354140 | |||
| 2289 | 8019781232 | |||
| 2290 | 8040172932 | |||
| 2291 | 8055304436 | |||
| 2292 | 8056128409 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
219
346
0.94
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q3c-assembly1.cif.gz_A | crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad | 0.9858 | 1 | 290 |
| 3obb-assembly1.cif.gz_A | crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 | 0.9836 | 2 | 290 |
| 2gf2-assembly1.cif.gz_A | crystal structure of human hydroxyisobutyrate dehydrogenase | 0.9808 | 1 | 291 |
| 3q3c-assembly1.cif.gz_A | crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with nad | 0.9692 | 1 | 290 |
| 3obb-assembly1.cif.gz_A | crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 | 0.9605 | 2 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QE62_28_195_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9891 | 2 | 162 | 3.40.50.720 |
| af_F1QE62_196_329_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9798 | 165 | 293 | 1.10.1040.10 |
| af_Q9XTI0_3_164_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9791 | 3 | 161 | 3.40.50.720 |
| af_P0A9V8_1_162_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9789 | 3 | 158 | 3.40.50.720 |
| af_Q4DFE2_2_165_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9778 | 1 | 160 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N7K0K0-F1-model_v4 | NAD-binding protein | 0.9923 | 132 | 291 |
GO:0006574
GO:0008442 GO:0051287 |
| AF-A0A5J6QHA7-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) | 0.9917 | 2 | 290 |
GO:0006574
GO:0008442 GO:0050661 GO:0051287 |
| AF-H0C0K4-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase | 0.9914 | 165 | 291 |
GO:0016616
GO:0051287 |
| AF-A0A833W004-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31) | 0.9905 | 2 | 292 |
GO:0005739
GO:0006574 GO:0008442 GO:0050661 GO:0051287 |
| AF-U2A157-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein | 0.9891 | 132 | 290 |
GO:0016054
GO:0016616 GO:0050661 GO:0051287 |