F490793

General Info

Members Datasets Scaffolds Average Seq Length
1146 486 2292 225

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10006687|Ga0105244_100066877
Length 269
Sequence MASLAIVYRQASIAPQIRPLCKDGAAENGRRQPEQRKIAHLFYCKPTAMTTYRIAPSILSADFARLGEEVRNVVSAGADIIRFDVMDNHYVPNLTIGPLVCQAIRPHVDVPIDVHLMVKPVDRIIPDFAKAGANIITFHPEASDHIDRSLSLIRDHGCKAGLVFNPATPLSYLEHVMDKVDMILIMSVNPGFGGQSFIPQALKKIAEARRLIDESGRDILLEVDGGIKIDNIAAAAAAGADTFVAGSAIFGQPDYKAVIDAMRANLAKV

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
193 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
194 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
234 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
270 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
296 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
308 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
309 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
336 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
343 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
364 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
365 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
400 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
401 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
402 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
416 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
417 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
418 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
419 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
420 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
421 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
422 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
423 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
424 2643221556 Massilia sp. Root1485 Isolate Unclassified
425 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
426 2643221638 Duganella sp. Root336D2 Isolate Unclassified
427 2643221645 Massilia sp. Root351 Isolate Unclassified
428 2643221664 Massilia sp. Root418 Isolate Unclassified
429 2643221684 Massilia sp. Root133 Isolate Unclassified
430 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
431 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
432 2738541280 Massilia sp. GV090 Isolate Unclassified
433 2738541297 Duganella sp. GV083 Isolate Unclassified
434 2738541300 Massilia sp. GV016 Isolate Unclassified
435 2738541357 Duganella sp. GV053 Isolate Unclassified
436 2738543003 Duganella sp. GV066 Isolate Unclassified
437 2738543018 Massilia sp. GV045 Isolate Unclassified
438 2738543026 Duganella sp. GV089 Isolate Unclassified
439 2738543029 Duganella sp. GV039 Isolate Unclassified
440 2738543030 Massilia sp. GV097 Isolate Unclassified
441 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
442 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
443 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
444 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
445 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
446 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
447 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
448 2818991436 Collimonas arenae 515 Isolate Unclassified
449 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
450 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
451 2821131069 Duganella sp. 1224 Isolate Unclassified
452 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
453 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
454 2842711865 Duganella sp. R-73148 Isolate Unclassified
455 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
456 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
457 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
458 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
459 2857553236 Duganella sp. R-74557 Isolate Unclassified
460 2857558681 Duganella sp. R-74565 Isolate Unclassified
461 2857564685 Duganella sp. R-74599 Isolate Unclassified
462 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
463 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
464 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
465 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
466 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
467 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
468 2904424332 Duganella sp. 1411 Isolate Rhizosphere
469 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
470 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
471 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
472 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
473 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
474 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
475 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
476 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
477 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
478 2919476304 Duganella sp. 3397 Isolate Unclassified
479 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
480 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
481 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
482 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
483 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
484 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
485 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
486 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.8
Metatranscriptomes 1.92
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.3
Nodule 0.87
Rhizoplane 2.62
Rhizosphere 76.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10006687 3300009036 Bacteria 7422
2 JGI25155J39150_1000864 3300002704 Bacteria 4425
3 JGI25156J39149_1008946 3300002705 Bacteria 2476
4 JGI25162J39368_1004179 3300002737 Bacteria 3516
5 JGI25162J39368_1013055 3300002737 Bacteria 930
6 JGI25154J39366_1000845 3300002738 Bacteria 13292
7 JGI25158J39367_1000818 3300002739 Bacteria 5933
8 JGI25158J39367_1008485 3300002739 Bacteria 1427
9 JGI25158J39367_1024630 3300002739 Bacteria 712
10 JGI25157J39369_1000372 3300002741 Bacteria 30863
11 JGI25152J39213_1001993 3300002773 Bacteria 8063
12 JGI25152J39213_1009823 3300002773 Bacteria 2238
13 JGI25150J39212_1000910 3300002774 Bacteria 9622
14 JGI25150J39212_1001503 3300002774 Bacteria 6441
15 JGI25159J45721_1005724 3300002987 Bacteria 3849
16 JGI25159J45721_1007426 3300002987 Bacteria 3145
17 JGI25159J45721_1015531 3300002987 Bacteria 1663
18 JGI25165J46597_1000713 3300003214 Bacteria 26161
19 JGI25165J46597_1001348 3300003214 Bacteria 13684
20 JGI25153J46596_10004223 3300003215 Bacteria 7781
21 JGI25160J50197_1003453 3300003354 Bacteria 7072
22 JGI25161J50226_1007576 3300003374 Bacteria 1797
23 Ga0007409J51694_1012308 3300003575 Bacteria 1879
24 Ga0007416J51690_1027150 3300003577 Bacteria 969
25 Ga0032354_1062149 3300003693 Bacteria 1766
26 Ga0055538_1000062 3300003751 Bacteria 105260
27 Ga0055538_1000281 3300003751 Bacteria 26161
28 Ga0055539_1000093 3300003752 Bacteria 105260
29 Ga0055539_1000305 3300003752 Bacteria 26161
30 Ga0055533_1000105 3300003756 Bacteria 105260
31 Ga0055533_1000286 3300003756 Bacteria 26161
32 Ga0055533_1000737 3300003756 Bacteria 10552
33 Ga0055533_1002031 3300003756 Bacteria 4911
34 Ga0055532_1000034 3300003758 Bacteria 210984
35 Ga0055532_1000092 3300003758 Bacteria 103243
36 Ga0055525_1000018 3300003759 Bacteria 393974
37 Ga0055525_1000137 3300003759 Bacteria 105260
38 Ga0055525_1000405 3300003759 Bacteria 26891
39 Ga0055527_1000035 3300003760 Bacteria 138481
40 Ga0055535_1000050 3300003761 Bacteria 138481
41 Ga0055535_1013520 3300003761 Bacteria 1201
42 Ga0055542_1000120 3300003762 Bacteria 103243
43 Ga0055529_1000089 3300003763 Bacteria 138481
44 Ga0055529_1000152 3300003763 Bacteria 98133
45 Ga0055526_1001033 3300003771 Bacteria 20365
46 Ga0055526_1003235 3300003771 Bacteria 10491
47 Ga0055526_1004446 3300003771 Bacteria 8418
48 Ga0055526_1005708 3300003771 Bacteria 7051
49 Ga0055526_1007871 3300003771 Bacteria 5440
50 Ga0055537_1000580 3300003773 Bacteria 20336
51 Ga0055537_1012740 3300003773 Bacteria 1621
52 Ga0055524_1000899 3300003775 Bacteria 19266
53 Ga0055524_1002755 3300003775 Bacteria 8837
54 Ga0055524_1003183 3300003775 Bacteria 8063
55 Ga0055524_1003663 3300003775 Bacteria 7366
56 Ga0055524_1008827 3300003775 Bacteria 4153
57 Ga0055524_1010041 3300003775 Bacteria 3798
58 Ga0055524_1011926 3300003775 Bacteria 3364
59 Ga0055534_1000283 3300003784 Bacteria 34520
60 Ga0055534_1005190 3300003784 Bacteria 3562
61 Ga0055534_1022725 3300003784 Bacteria 1034
62 Ga0055528_1000495 3300003790 Bacteria 31111
63 Ga0055528_1006705 3300003790 Bacteria 5191
64 Ga0055530_10003928 3300003791 Bacteria 8047
65 Ga0055530_10008706 3300003791 Bacteria 4016
66 Ga0055530_10019894 3300003791 Bacteria 2022
67 Ga0055531_10021682 3300003794 Bacteria 2481
68 Ga0055531_10041167 3300003794 Bacteria 1342
69 Ga0055541_1000063 3300003841 Bacteria 105260
70 Ga0055541_1000198 3300003841 Bacteria 26161
71 Ga0058692_1000027 3300003856 Bacteria 198745
72 Ga0055543_1002300 3300004625 Bacteria 6432
73 Ga0055543_1010334 3300004625 Bacteria 1961
74 Ga0065165_1002857 3300005262 Bacteria 13394
75 Ga0065165_1004075 3300005262 Bacteria 9468
76 Ga0065165_1006132 3300005262 Bacteria 6432
77 Ga0065165_1013870 3300005262 Bacteria 3168
78 Ga0065165_1041906 3300005262 Bacteria 1355
79 Ga0065703_1000515 3300005272 Bacteria 19094
80 Ga0065714_10127055 3300005288 Bacteria 1246
81 Ga0070683_100267191 3300005329 Bacteria 1627
82 Ga0070670_100599001 3300005331 Bacteria 986
83 Ga0070680_100334382 3300005336 Bacteria 1287
84 Ga0070680_100437688 3300005336 Bacteria 1116
85 Ga0070682_100022524 3300005337 Bacteria 3733
86 Ga0070660_100022139 3300005339 Bacteria 4696
87 Ga0070660_100044408 3300005339 Bacteria 3399
88 Ga0070661_100025891 3300005344 Bacteria 4216
89 Ga0070668_100419691 3300005347 Bacteria 1145
90 Ga0070669_100003722 3300005353 Bacteria 11007
91 Ga0070675_100605379 3300005354 Bacteria 994
92 Ga0070674_100830540 3300005356 Bacteria 800
93 Ga0070659_100001752 3300005366 Bacteria 15587
94 Ga0070659_100676594 3300005366 Bacteria 891
95 Ga0070667_100131493 3300005367 Bacteria 2185
96 Ga0070714_100012283 3300005435 Bacteria 6833
97 Ga0070663_100011336 3300005455 Bacteria 5592
98 Ga0070663_100043195 3300005455 Bacteria 3171
99 Ga0070663_100205529 3300005455 Bacteria 1539
100 Ga0070663_100741381 3300005455 Bacteria 838
101 Ga0070662_100036858 3300005457 Bacteria 3463
102 Ga0070662_100133362 3300005457 Bacteria 1918
103 Ga0070681_10467082 3300005458 Bacteria 1174
104 Ga0070706_100042249 3300005467 Bacteria 4211
105 Ga0070706_100074408 3300005467 Bacteria 3144
106 Ga0070707_100252943 3300005468 Bacteria 1715
107 Ga0070699_100795151 3300005518 Bacteria 866
108 Ga0070679_100087655 3300005530 Bacteria 3100
109 Ga0070684_100840667 3300005535 Bacteria 859
110 Ga0070697_100055245 3300005536 Bacteria 3228
111 Ga0070697_100064585 3300005536 Bacteria 2989
112 Ga0070697_100084697 3300005536 Bacteria 2614
113 Ga0068853_100127886 3300005539 Bacteria 2271
114 Ga0070695_100010846 3300005545 Bacteria 5443
115 Ga0070696_100389706 3300005546 Bacteria 1088
116 Ga0070665_100016024 3300005548 Bacteria 7524
117 Ga0070704_100322552 3300005549 Bacteria 1295
118 Ga0068855_100025280 3300005563 Bacteria 7108
119 Ga0068855_100035272 3300005563 Bacteria 5958
120 Ga0068855_100365494 3300005563 Bacteria 1587
121 Ga0068855_100459419 3300005563 Bacteria 1389
122 Ga0068854_100007632 3300005578 Bacteria 6921
123 Ga0068856_100165342 3300005614 Bacteria 2224
124 Ga0068856_100438406 3300005614 Bacteria 1327
125 Ga0068852_100004237 3300005616 Bacteria 10127
126 Ga0068859_100137698 3300005617 Bacteria 2515
127 Ga0068863_100349786 3300005841 Bacteria 1439
128 Ga0068860_100028951 3300005843 Bacteria 5329
129 Ga0068860_100205246 3300005843 Bacteria 1911
130 Ga0070717_10119390 3300006028 Bacteria 2257
131 Ga0070717_10186186 3300006028 Bacteria 1812
132 Ga0070717_10963357 3300006028 Bacteria 777
133 Ga0070712_100003531 3300006175 Bacteria 9625
134 Ga0075434_100013297 3300006871 Bacteria 7827
135 Ga0097620_100137704 3300006931 Bacteria 2515
136 Ga0079104_1013403 3300006946 Bacteria 2526
137 Ga0099826_10000010 3300006948 Bacteria 314346
138 Ga0075435_100025552 3300007076 Bacteria 4598
139 Ga0105244_10002041 3300009036 Bacteria 15556
140 Ga0105244_10029464 3300009036 Bacteria 2933
141 Ga0105244_10065752 3300009036 Bacteria 1816
142 Ga0105244_10099021 3300009036 Bacteria 1427
143 Ga0105240_10001608 3300009093 Bacteria 38292
144 Ga0105240_10007637 3300009093 Bacteria 15663
145 Ga0105240_10016336 3300009093 Bacteria 10052
146 Ga0105240_10038235 3300009093 Bacteria 6157
147 Ga0105240_10070890 3300009093 Bacteria 4310
148 Ga0105240_10146806 3300009093 Bacteria 2814
149 Ga0111539_10029979 3300009094 Bacteria 6617
150 Ga0111539_10124601 3300009094 Bacteria 3020
151 Ga0105245_10711439 3300009098 Bacteria 1038
152 Ga0105247_10003833 3300009101 Bacteria 9729
153 Ga0114129_10241688 3300009147 Bacteria 2427
154 Ga0105243_10000343 3300009148 Bacteria 50175
155 Ga0105243_10280106 3300009148 Bacteria 1501
156 Ga0105241_10603550 3300009174 Bacteria 992
157 Ga0105242_10046831 3300009176 Bacteria 3510
158 Ga0105237_10034417 3300009545 Bacteria 5130
159 Ga0105237_10099866 3300009545 Bacteria 2893
160 Ga0105238_10000763 3300009551 Bacteria 33477
161 Ga0105238_10183076 3300009551 Bacteria 2071
162 Ga0105249_10719777 3300009553 Bacteria 1059
163 Ga0105239_10010387 3300010375 Bacteria 10421
164 Ga0105239_10328870 3300010375 Bacteria 1724
165 Ga0105246_10178491 3300011119 Bacteria 1633
166 Ga0157371_10000018 3300013102 Bacteria 310522
167 Ga0157370_10247198 3300013104 Bacteria 1650
168 Ga0157370_10653786 3300013104 Bacteria 961
169 Ga0157374_10202904 3300013296 Bacteria 1942
170 Ga0157374_10213758 3300013296 Bacteria 1891
171 Ga0157378_10271726 3300013297 Bacteria 1630
172 Ga0157378_10399506 3300013297 Bacteria 1354
173 Ga0163162_10154463 3300013306 Bacteria 2414
174 Ga0163163_10095925 3300014325 Bacteria 2986
175 Ga0163163_10344627 3300014325 Bacteria 1545
176 Ga0182008_10003605 3300014497 Bacteria 9271
177 Ga0182008_10022601 3300014497 Bacteria 3220
178 Ga0182008_10054820 3300014497 Bacteria 1972
179 Ga0182006_1000033 3300015261 Bacteria 238180
180 Ga0182006_1000080 3300015261 Bacteria 122163
181 Ga0182006_1005060 3300015261 Bacteria 6338
182 Ga0182006_1012892 3300015261 Bacteria 3648
183 Ga0182006_1082631 3300015261 Bacteria 1169
184 Ga0182007_10000042 3300015262 Bacteria 111840
185 Ga0182007_10003815 3300015262 Bacteria 7019
186 Ga0182007_10006803 3300015262 Bacteria 4866
187 Ga0182005_1000016 3300015265 Bacteria 346889
188 Ga0182005_1000024 3300015265 Bacteria 238256
189 Ga0182005_1001434 3300015265 Bacteria 9601
190 Ga0163161_10012023 3300017792 Bacteria 6004
191 Ga0163161_10056209 3300017792 Bacteria 2858
192 Ga0163161_10095458 3300017792 Bacteria 2206
193 Ga0197907_10734725 3300020069 Bacteria 1446
194 Ga0206355_1336031 3300020076 Bacteria 1834
195 Ga0206350_11154362 3300020080 Bacteria 4713
196 Ga0206354_10998826 3300020081 Bacteria 1461
197 Ga0206353_10779650 3300020082 Bacteria 1651
198 Ga0213872_10000430 3300021361 Bacteria 34377
199 Ga0213872_10004434 3300021361 Bacteria 7457
200 Ga0213872_10004797 3300021361 Bacteria 7060
201 Ga0213872_10011815 3300021361 Bacteria 4126
202 Ga0213872_10128204 3300021361 Bacteria 1119
203 Ga0224712_10003485 3300022467 Bacteria 4098
204 Ga0209435_100007 3300025206 Bacteria 516857
205 Ga0209436_101663 3300025208 Bacteria 7403
206 Ga0209436_102178 3300025208 Bacteria 6116
207 Ga0209436_104811 3300025208 Bacteria 3247
208 Ga0209784_100010 3300025224 Bacteria 683664
209 Ga0209784_100021 3300025224 Bacteria 408534
210 Ga0209566_100008 3300025225 Bacteria 683664
211 Ga0209566_100119 3300025225 Bacteria 105312
212 Ga0209674_100019 3300025226 Bacteria 683664
213 Ga0209674_100036 3300025226 Bacteria 408534
214 Ga0209674_100259 3300025226 Bacteria 42956
215 Ga0209147_100017 3300025229 Bacteria 516857
216 Ga0209563_100011 3300025230 Bacteria 1187808
217 Ga0209563_100021 3300025230 Bacteria 683764
218 Ga0209563_100040 3300025230 Bacteria 408534
219 Ga0207427_100759 3300025231 Bacteria 14690
220 Ga0207427_100936 3300025231 Bacteria 12429
221 Ga0209437_100019 3300025233 Bacteria 683764
222 Ga0209437_100332 3300025233 Bacteria 58796
223 Ga0209437_105500 3300025233 Bacteria 2154
224 Ga0209258_101277 3300025242 Bacteria 9457
225 Ga0207425_1000021 3300025245 Bacteria 367537
226 Ga0207425_1000829 3300025245 Bacteria 15420
227 Ga0207425_1001943 3300025245 Bacteria 7781
228 Ga0207425_1018992 3300025245 Bacteria 1486
229 Ga0209646_1000044 3300025246 Bacteria 334596
230 Ga0209646_1000107 3300025246 Bacteria 163112
231 Ga0209646_1000190 3300025246 Bacteria 75772
232 Ga0209026_1000063 3300025250 Bacteria 211324
233 Ga0209677_100011 3300025253 Bacteria 683664
234 Ga0209677_100023 3300025253 Bacteria 408534
235 Ga0209677_101699 3300025253 Bacteria 9186
236 Ga0209148_1000237 3300025254 Bacteria 88748
237 Ga0209759_1000048 3300025256 Bacteria 224817
238 Ga0209759_1000195 3300025256 Bacteria 96092
239 Ga0209759_1000351 3300025256 Bacteria 59891
240 Ga0209759_1003045 3300025256 Bacteria 6904
241 Ga0209129_1000020 3300025258 Bacteria 457053
242 Ga0209129_1014565 3300025258 Bacteria 1669
243 Ga0209233_1000025 3300025261 Bacteria 683764
244 Ga0209233_1000173 3300025261 Bacteria 145995
245 Ga0209565_1000055 3300025263 Bacteria 201184
246 Ga0209565_1000677 3300025263 Bacteria 21295
247 Ga0209565_1002957 3300025263 Bacteria 5775
248 Ga0209565_1003264 3300025263 Bacteria 5342
249 Ga0209565_1010498 3300025263 Bacteria 2293
250 Ga0209455_1000070 3300025272 Bacteria 307867
251 Ga0209455_1004771 3300025272 Bacteria 4345
252 Ga0209673_1000040 3300025273 Bacteria 312633
253 Ga0209673_1003338 3300025273 Bacteria 9600
254 Ga0209673_1053678 3300025273 Bacteria 1049
255 Ga0209130_1000169 3300025284 Bacteria 95167
256 Ga0209130_1002260 3300025284 Bacteria 9942
257 Ga0209130_1003537 3300025284 Bacteria 6551
258 Ga0209675_1000052 3300025291 Bacteria 201332
259 Ga0209675_1007962 3300025291 Bacteria 3965
260 Ga0209675_1008529 3300025291 Bacteria 3752
261 Ga0209025_1001876 3300025294 Bacteria 24626
262 Ga0209564_1000027 3300025295 Bacteria 518458
263 Ga0209564_1000047 3300025295 Bacteria 368031
264 Ga0209564_1000063 3300025295 Bacteria 318515
265 Ga0209564_1000271 3300025295 Bacteria 108422
266 Ga0209564_1001666 3300025295 Bacteria 21297
267 Ga0209564_1022873 3300025295 Bacteria 2191
268 Ga0209758_1000288 3300025297 Bacteria 99096
269 Ga0209758_1000436 3300025297 Bacteria 70342
270 Ga0209050_1000050 3300025298 Bacteria 362578
271 Ga0209050_1005131 3300025298 Bacteria 8406
272 Ga0209050_1006673 3300025298 Bacteria 6755
273 Ga0209256_1000054 3300025299 Bacteria 298431
274 Ga0209256_1000100 3300025299 Bacteria 201246
275 Ga0209256_1000754 3300025299 Bacteria 42096
276 Ga0209256_1004828 3300025299 Bacteria 8169
277 Ga0209256_1005964 3300025299 Bacteria 6697
278 Ga0207426_1003112 3300025302 Bacteria 9466
279 Ga0207426_1036654 3300025302 Bacteria 1557
280 Ga0209257_1006073 3300025304 Bacteria 8031
281 Ga0209257_1009189 3300025304 Bacteria 5370
282 Ga0207696_1021563 3300025711 Bacteria 2061
283 Ga0207655_1001604 3300025728 Bacteria 20191
284 Ga0207655_1001651 3300025728 Bacteria 19767
285 Ga0207655_1004763 3300025728 Bacteria 9466
286 Ga0207713_1002759 3300025735 Bacteria 12446
287 Ga0207713_1002761 3300025735 Bacteria 12439
288 Ga0207710_10000057 3300025900 Bacteria 177544
289 Ga0207705_10009748 3300025909 Bacteria 6988
290 Ga0207705_10121345 3300025909 Bacteria 1940
291 Ga0207684_10025468 3300025910 Bacteria 5041
292 Ga0207684_10103272 3300025910 Bacteria 2437
293 Ga0207654_10112395 3300025911 Bacteria 1697
294 Ga0207654_10146993 3300025911 Bacteria 1509
295 Ga0207707_10070128 3300025912 Bacteria 3054
296 Ga0207695_10007667 3300025913 Bacteria 13670
297 Ga0207695_10008939 3300025913 Bacteria 12470
298 Ga0207695_10012318 3300025913 Bacteria 10275
299 Ga0207695_10060948 3300025913 Bacteria 3902
300 Ga0207695_10100367 3300025913 Bacteria 2890
301 Ga0207695_10135206 3300025913 Bacteria 2419
302 Ga0207695_10209182 3300025913 Bacteria 1862
303 Ga0207695_10393672 3300025913 Bacteria 1270
304 Ga0207671_10004652 3300025914 Bacteria 12996
305 Ga0207671_10069660 3300025914 Bacteria 2621
306 Ga0207660_10317649 3300025917 Bacteria 1243
307 Ga0207657_10012688 3300025919 Bacteria 8304
308 Ga0207657_10027581 3300025919 Bacteria 5200
309 Ga0207649_10009529 3300025920 Bacteria 5316
310 Ga0207652_10454486 3300025921 Bacteria 1154
311 Ga0207646_10014703 3300025922 Bacteria 7415
312 Ga0207681_10002504 3300025923 Bacteria 11673
313 Ga0207694_10013544 3300025924 Bacteria 6144
314 Ga0207650_10046359 3300025925 Bacteria 3201
315 Ga0207650_10262264 3300025925 Bacteria 1402
316 Ga0207687_10042299 3300025927 Bacteria 3133
317 Ga0207700_10078045 3300025928 Bacteria 2574
318 Ga0207664_10023812 3300025929 Bacteria 4594
319 Ga0207690_10000951 3300025932 Bacteria 18563
320 Ga0207690_10013294 3300025932 Bacteria 4944
321 Ga0207690_10214873 3300025932 Bacteria 1468
322 Ga0207706_10110175 3300025933 Bacteria 2422
323 Ga0207706_10111892 3300025933 Bacteria 2402
324 Ga0207686_10034904 3300025934 Bacteria 3014
325 Ga0207709_10000057 3300025935 Bacteria 216617
326 Ga0207709_10277379 3300025935 Bacteria 1237
327 Ga0207661_10557896 3300025944 Bacteria 1050
328 Ga0207679_10010560 3300025945 Bacteria 5952
329 Ga0207667_10000912 3300025949 Bacteria 37632
330 Ga0207667_10020489 3300025949 Bacteria 7353
331 Ga0207667_10145306 3300025949 Bacteria 2441
332 Ga0207667_10502785 3300025949 Bacteria 1229
333 Ga0207668_10035510 3300025972 Bacteria 3320
334 Ga0207668_10270570 3300025972 Bacteria 1389
335 Ga0207640_10064502 3300025981 Bacteria 2439
336 Ga0207658_10028565 3300025986 Bacteria 3929
337 Ga0207703_10052391 3300026035 Bacteria 3313
338 Ga0207639_10550936 3300026041 Bacteria 1059
339 Ga0207678_10021915 3300026067 Bacteria 5600
340 Ga0207678_10097386 3300026067 Bacteria 2514
341 Ga0207702_10363895 3300026078 Bacteria 1387
342 Ga0207702_10539705 3300026078 Bacteria 1140
343 Ga0207702_10887820 3300026078 Bacteria 883
344 Ga0207641_10700557 3300026088 Bacteria 997
345 Ga0207674_10204005 3300026116 Bacteria 1926
346 Ga0207674_10632048 3300026116 Bacteria 1034
347 Ga0207683_10369797 3300026121 Bacteria 1317
348 Ga0207683_10680611 3300026121 Bacteria 953
349 Ga0207698_10166721 3300026142 Bacteria 1934
350 Ga0209281_1005141 3300027111 Bacteria 3702
351 Ga0209371_1000074 3300027312 Bacteria 198823
352 Ga0209371_1004235 3300027312 Bacteria 6376
353 Ga0209970_1022343 3300027614 Bacteria 1074
354 Ga0209983_1048630 3300027665 Bacteria 926
355 Ga0209282_1000009 3300027666 Bacteria 233366
356 Ga0209974_10034083 3300027876 Bacteria 1690
357 Ga0207428_10037235 3300027907 Bacteria 3959
358 Ga0207428_10146957 3300027907 Bacteria 1796
359 Ga0268264_10064081 3300028381 Bacteria 3092
360 Ga0265334_10037067 3300028573 Bacteria 1924
361 Ga0307515_10000037 3300028794 Bacteria 331970
362 Ga0307515_10001585 3300028794 Bacteria 50742
363 Ga0307515_10002662 3300028794 Bacteria 38277
364 Ga0307515_10120443 3300028794 Bacteria 2977
365 Ga0268256_1000067 3300030500 Bacteria 198823
366 Ga0268256_1003593 3300030500 Bacteria 6909
367 Ga0316177_1056605 3300030731 Bacteria 1637
368 Ga0316180_1139639 3300030736 Bacteria 1975
369 Ga0316181_1015625 3300030744 Bacteria 3944
370 Ga0265330_10007637 3300031235 Bacteria 5256
371 Ga0265332_10000253 3300031238 Bacteria 42715
372 Ga0265325_10056921 3300031241 Bacteria 1995
373 Ga0265329_10001506 3300031242 Bacteria 11154
374 Ga0265331_10004185 3300031250 Bacteria 9045
375 Ga0265327_10016288 3300031251 Bacteria 4731
376 Ga0265316_10004554 3300031344 Bacteria 13770
377 Ga0307513_10004052 3300031456 Bacteria 19647
378 Ga0307513_10405500 3300031456 Bacteria 1097
379 Ga0307408_100000432 3300031548 Bacteria 37289
380 Ga0307408_100002407 3300031548 Bacteria 13173
381 Ga0307408_100009332 3300031548 Bacteria 6466
382 Ga0307408_100042644 3300031548 Bacteria 3224
383 Ga0265314_10036954 3300031711 Bacteria 3543
384 Ga0307516_10001680 3300031730 Bacteria 30456
385 Ga0307516_10078081 3300031730 Bacteria 3157
386 Ga0307405_10570872 3300031731 Bacteria 919
387 Ga0307518_10120389 3300031838 Bacteria 1858
388 Ga0307410_10176546 3300031852 Bacteria 1614
389 Ga0307406_10333007 3300031901 Bacteria 1179
390 Ga0307412_10366015 3300031911 Bacteria 1163
391 Ga0307416_100000975 3300032002 Bacteria 15137
392 Ga0307414_10072470 3300032004 Bacteria 2488
393 Ga0307414_10448523 3300032004 Bacteria 1131
394 Ga0373953_0207558 3300035117 Bacteria 848
395 Ga0373931_0201987 3300035691 Bacteria 1188
396 Ga0373935_0188183 3300035692 Bacteria 1421
397 Ga0373935_0413182 3300035692 Bacteria 970
398 Ga0373927_0003380 3300035695 Bacteria 11492
399 Ga0373927_0067197 3300035695 Bacteria 2320
400 Ga0373927_0109525 3300035695 Bacteria 1799
401 Ga0373933_0187494 3300035724 Bacteria 1321
402 Ga0373947_0139128 3300035725 Bacteria 1556
403 Ga0373937_0043911 3300036401 Bacteria 4082
404 Ga0373937_0167163 3300036401 Bacteria 2063
405 Ga0373937_0959462 3300036401 Bacteria 804
406 Ga0373925_0021367 3300037068 Bacteria 4715
407 Ga0373925_0485079 3300037068 Bacteria 1014
408 Ga0373925_0690712 3300037068 Bacteria 841
409 Ga0395899_0000521 3300037312 Bacteria 42304
410 Ga0395899_0002806 3300037312 Bacteria 14038
411 Ga0395899_0003830 3300037312 Bacteria 11871
412 Ga0395899_0010327 3300037312 Bacteria 7157
413 Ga0395899_0011850 3300037312 Bacteria 6675
414 Ga0395899_0079948 3300037312 Bacteria 2380
415 Ga0395899_0170770 3300037312 Bacteria 1531
416 Ga0395900_0010081 3300037418 Bacteria 9664
417 Ga0395900_0014022 3300037418 Bacteria 8184
418 Ga0395900_0031672 3300037418 Bacteria 5435
419 Ga0395900_0036395 3300037418 Bacteria 5074
420 Ga0395900_0038700 3300037418 Bacteria 4915
421 Ga0395900_0147914 3300037418 Bacteria 2401
422 Ga0395898_0020590 3300037466 Bacteria 6699
423 Ga0395898_0031143 3300037466 Bacteria 5333
424 Ga0395898_0420563 3300037466 Bacteria 1273
425 Ga0395905_0010442 3300037471 Bacteria 9034
426 Ga0395905_0013127 3300037471 Bacteria 7952
427 Ga0395905_0030081 3300037471 Bacteria 5118
428 Ga0395905_0085053 3300037471 Bacteria 2964
429 Ga0395905_0109483 3300037471 Bacteria 2594
430 Ga0395905_0280476 3300037471 Bacteria 1552
431 Ga0395901_0002710 3300038443 Bacteria 17843
432 Ga0395901_0002897 3300038443 Bacteria 17321
433 Ga0395901_0027008 3300038443 Bacteria 5895
434 Ga0395901_0357208 3300038443 Bacteria 1507
435 Ga0395901_0637442 3300038443 Bacteria 1070
436 Ga0436365_0436116 3300039437 Bacteria 922
437 Ga0436360_0123446 3300039438 Bacteria 2138
438 Ga0436361_0009051 3300039447 Bacteria 7525
439 Ga0436361_0013073 3300039447 Bacteria 17617
440 Ga0436361_0039131 3300039447 Bacteria 6153
441 Ga0436361_0167678 3300039447 Bacteria 2088
442 Ga0436361_0389557 3300039447 Bacteria 1530
443 Ga0436361_0558892 3300039447 Bacteria 1370
444 Ga0436361_0930389 3300039447 Bacteria 10390
445 Ga0436361_0959711 3300039447 Bacteria 1483
446 Ga0436362_1188435 3300039453 Bacteria 1660
447 Ga0439466_0015406 3300041411 Bacteria 2776
448 Ga0451843_1496344 3300041509 Bacteria 1077
449 Ga0439448_0031608 3300042005 Bacteria 1681
450 Ga0439455_0005794 3300042012 Bacteria 2529
451 Ga0439455_0016980 3300042012 Bacteria 1690
452 Ga0450904_001582 3300042139 Bacteria 3095
453 Ga0439458_0054788 3300042157 Bacteria 988
454 Ga0450893_0019345 3300042532 Bacteria 1165
455 Ga0451577_0000941 3300042876 Bacteria 42690
456 Ga0451577_0003646 3300042876 Bacteria 16899
457 Ga0451577_0090201 3300042876 Bacteria 2735
458 Ga0466972_0000420 3300044658 Bacteria 22023
459 Ga0466972_0024846 3300044658 Bacteria 2973
460 Ga0466965_0019525 3300044683 Bacteria 3254
461 Ga0466965_0091695 3300044683 Bacteria 1546
462 Ga0466966_0013203 3300044684 Bacteria 5470
463 Ga0466966_0122910 3300044684 Bacteria 1593
464 Ga0466961_0119384 3300044693 Bacteria 1656
465 Ga0466964_0029535 3300044706 Bacteria 2165
466 Ga0453684_0208793 3300044712 Bacteria 2271
467 Ga0466971_0144021 3300044719 Bacteria 1110
468 Ga0466957_0001920 3300044842 Bacteria 11037
469 Ga0466957_0005784 3300044842 Bacteria 6952
470 Ga0466960_0324217 3300044901 Bacteria 873
471 Ga0466960_0340141 3300044901 Bacteria 854
472 Ga0466959_0219057 3300045049 Bacteria 1321
473 Ga0451576_0241374 3300045051 Bacteria 1887
474 Ga0451576_1102472 3300045051 Bacteria 831
475 Ga0466967_0107630 3300045976 Bacteria 2557
476 Ga0495617_000022 3300046452 Bacteria 185975
477 Ga0495617_001209 3300046452 Bacteria 11631
478 Ga0495617_056815 3300046452 Bacteria 1297
479 Ga0495627_000011 3300046453 Bacteria 354522
480 Ga0495627_000398 3300046453 Bacteria 38966
481 Ga0495627_028145 3300046453 Bacteria 1797
482 Ga0495592_0002825 3300046454 Bacteria 12317
483 Ga0495592_0006056 3300046454 Bacteria 8996
484 Ga0495592_0158030 3300046454 Bacteria 1562
485 Ga0495603_0039081 3300046455 Bacteria 2844
486 Ga0495603_0039573 3300046455 Bacteria 2824
487 Ga0495590_0000057 3300046457 Bacteria 93720
488 Ga0495590_0000143 3300046457 Bacteria 43197
489 Ga0495590_0109534 3300046457 Bacteria 985
490 Ga0495591_001766 3300046458 Bacteria 12837
491 Ga0495591_003364 3300046458 Bacteria 8313
492 Ga0495629_0000309 3300046459 Bacteria 41866
493 Ga0495629_0009192 3300046459 Bacteria 7235
494 Ga0495629_0016157 3300046459 Bacteria 5357
495 Ga0495629_0200043 3300046459 Bacteria 1381
496 Ga0495638_0005569 3300046460 Bacteria 9312
497 Ga0495638_0054252 3300046460 Bacteria 2492
498 Ga0495638_0138239 3300046460 Bacteria 1424
499 Ga0495651_0009905 3300046462 Bacteria 7329
500 Ga0495651_0015762 3300046462 Bacteria 5853
501 Ga0495651_0067759 3300046462 Bacteria 2722
502 Ga0495651_0479253 3300046462 Bacteria 799
503 Ga0495653_0000044 3300046463 Bacteria 115591
504 Ga0495653_0001283 3300046463 Bacteria 19431
505 Ga0495653_0010444 3300046463 Bacteria 7597
506 Ga0495653_0030963 3300046463 Bacteria 4256
507 Ga0495653_0046652 3300046463 Bacteria 3354
508 Ga0495653_0091446 3300046463 Bacteria 2224
509 Ga0495653_0126045 3300046463 Bacteria 1818
510 Ga0495650_0000082 3300046471 Bacteria 239477
511 Ga0495650_0000254 3300046471 Bacteria 103512
512 Ga0495650_0001173 3300046471 Bacteria 27987
513 Ga0495650_0001749 3300046471 Bacteria 19780
514 Ga0495650_0003298 3300046471 Bacteria 11915
515 Ga0495650_0004336 3300046471 Bacteria 9777
516 Ga0495650_0005780 3300046471 Bacteria 7898
517 Ga0495650_0039016 3300046471 Bacteria 2052
518 Ga0495580_0007546 3300046472 Bacteria 8728
519 Ga0495580_0011457 3300046472 Bacteria 6861
520 Ga0495580_0045269 3300046472 Bacteria 3126
521 Ga0495580_0055619 3300046472 Bacteria 2787
522 Ga0495580_0137598 3300046472 Bacteria 1693
523 Ga0495582_0039310 3300046473 Bacteria 2604
524 Ga0495605_0000098 3300046474 Bacteria 109816
525 Ga0495605_0000102 3300046474 Bacteria 107430
526 Ga0495605_0000153 3300046474 Bacteria 88955
527 Ga0495605_0014088 3300046474 Bacteria 4386
528 Ga0495605_0025625 3300046474 Bacteria 3072
529 Ga0495605_0044553 3300046474 Bacteria 2192
530 Ga0495605_0050130 3300046474 Bacteria 2037
531 Ga0495605_0055414 3300046474 Bacteria 1915
532 Ga0495605_0129962 3300046474 Bacteria 1136
533 Ga0495639_0090146 3300046475 Bacteria 1438
534 Ga0495662_0013868 3300046476 Bacteria 3922
535 Ga0495662_0163596 3300046476 Bacteria 1096
536 Ga0495584_0000005 3300046491 Bacteria 306957
537 Ga0495584_0000232 3300046491 Bacteria 40218
538 Ga0495584_0000729 3300046491 Bacteria 21708
539 Ga0495584_0008319 3300046491 Bacteria 5372
540 Ga0495584_0010267 3300046491 Bacteria 4811
541 Ga0495584_0037347 3300046491 Bacteria 2454
542 Ga0495584_0045754 3300046491 Bacteria 2207
543 Ga0495585_0000023 3300046492 Bacteria 149218
544 Ga0495585_0004011 3300046492 Bacteria 9694
545 Ga0495585_0004403 3300046492 Bacteria 9135
546 Ga0495585_0007615 3300046492 Bacteria 6614
547 Ga0495585_0011749 3300046492 Bacteria 5175
548 Ga0495585_0011755 3300046492 Bacteria 5173
549 Ga0495585_0024181 3300046492 Bacteria 3485
550 Ga0495585_0031217 3300046492 Bacteria 3025
551 Ga0495585_0041530 3300046492 Bacteria 2579
552 Ga0495585_0051302 3300046492 Bacteria 2286
553 Ga0495585_0125200 3300046492 Bacteria 1356
554 Ga0495585_0129940 3300046492 Bacteria 1326
555 Ga0495594_0047218 3300046499 Bacteria 2364
556 Ga0495594_0172740 3300046499 Bacteria 1229
557 Ga0495596_0002525 3300046500 Bacteria 9800
558 Ga0495596_0002817 3300046500 Bacteria 9094
559 Ga0495596_0003901 3300046500 Bacteria 7393
560 Ga0495596_0005514 3300046500 Bacteria 5961
561 Ga0495596_0008285 3300046500 Bacteria 4633
562 Ga0495596_0009969 3300046500 Bacteria 4159
563 Ga0495596_0014021 3300046500 Bacteria 3381
564 Ga0495596_0069983 3300046500 Bacteria 1363
565 Ga0495607_0005043 3300046501 Bacteria 9579
566 Ga0495607_0012840 3300046501 Bacteria 5508
567 Ga0495607_0018756 3300046501 Bacteria 4400
568 Ga0495607_0039833 3300046501 Bacteria 2803
569 Ga0495607_0046368 3300046501 Bacteria 2553
570 Ga0495607_0087055 3300046501 Bacteria 1701
571 Ga0495607_0092601 3300046501 Bacteria 1634
572 Ga0495583_0000150 3300046506 Bacteria 117772
573 Ga0495583_0000597 3300046506 Bacteria 49120
574 Ga0495583_0001383 3300046506 Bacteria 24824
575 Ga0495583_0001918 3300046506 Bacteria 19228
576 Ga0495583_0007069 3300046506 Bacteria 7173
577 Ga0495583_0021299 3300046506 Bacteria 3339
578 Ga0495583_0023523 3300046506 Bacteria 3114
579 Ga0495583_0030505 3300046506 Bacteria 2624
580 Ga0495606_0000090 3300046507 Bacteria 154737
581 Ga0495606_0000099 3300046507 Bacteria 150950
582 Ga0495606_0000524 3300046507 Bacteria 62049
583 Ga0495606_0002603 3300046507 Bacteria 20634
584 Ga0495606_0002891 3300046507 Bacteria 18970
585 Ga0495606_0003267 3300046507 Bacteria 17378
586 Ga0495606_0009874 3300046507 Bacteria 8001
587 Ga0495606_0015472 3300046507 Bacteria 5874
588 Ga0495606_0036555 3300046507 Bacteria 3343
589 Ga0495606_0085609 3300046507 Bacteria 1950
590 Ga0495608_0024843 3300046511 Bacteria 4093
591 Ga0495608_0033895 3300046511 Bacteria 3448
592 Ga0495610_0000017 3300046512 Bacteria 365675
593 Ga0495610_0000668 3300046512 Bacteria 33359
594 Ga0495610_0007137 3300046512 Bacteria 7529
595 Ga0495610_0007163 3300046512 Bacteria 7504
596 Ga0495610_0017836 3300046512 Bacteria 4033
597 Ga0495616_0004647 3300046513 Bacteria 8621
598 Ga0495616_0028823 3300046513 Bacteria 2936
599 Ga0495616_0031376 3300046513 Bacteria 2782
600 Ga0495616_0040079 3300046513 Bacteria 2395
601 Ga0495616_0090387 3300046513 Bacteria 1450
602 Ga0495618_0018085 3300046514 Bacteria 4326
603 Ga0495618_0038016 3300046514 Bacteria 3024
604 Ga0495620_0062742 3300046515 Bacteria 1542
605 Ga0495620_0207762 3300046515 Bacteria 752
606 Ga0495628_0037325 3300046516 Bacteria 3895
607 Ga0495628_0185811 3300046516 Bacteria 1570
608 Ga0495628_0484651 3300046516 Bacteria 894
609 Ga0495630_0016484 3300046517 Bacteria 5401
610 Ga0495630_0067147 3300046517 Bacteria 2695
611 Ga0495630_0104673 3300046517 Bacteria 2142
612 Ga0495630_0564455 3300046517 Bacteria 873
613 Ga0495631_0001332 3300046518 Bacteria 15128
614 Ga0495631_0001436 3300046518 Bacteria 14479
615 Ga0495631_0019040 3300046518 Bacteria 3224
616 Ga0495631_0031266 3300046518 Bacteria 2409
617 Ga0495631_0061086 3300046518 Bacteria 1634
618 Ga0495631_0085211 3300046518 Bacteria 1361
619 Ga0495632_0000052 3300046519 Bacteria 132992
620 Ga0495632_0001555 3300046519 Bacteria 18930
621 Ga0495632_0006741 3300046519 Bacteria 7342
622 Ga0495632_0007457 3300046519 Bacteria 6871
623 Ga0495632_0012494 3300046519 Bacteria 4897
624 Ga0495632_0062533 3300046519 Bacteria 1804
625 Ga0495632_0091401 3300046519 Bacteria 1442
626 Ga0495637_0000018 3300046520 Bacteria 186671
627 Ga0495637_0000195 3300046520 Bacteria 47191
628 Ga0495643_0000109 3300046522 Bacteria 135859
629 Ga0495643_0000250 3300046522 Bacteria 78905
630 Ga0495643_0001163 3300046522 Bacteria 25714
631 Ga0495643_0003256 3300046522 Bacteria 12009
632 Ga0495643_0009083 3300046522 Bacteria 6228
633 Ga0495643_0012298 3300046522 Bacteria 5168
634 Ga0495643_0037303 3300046522 Bacteria 2667
635 Ga0495644_0001139 3300046523 Bacteria 10903
636 Ga0495644_0005133 3300046523 Bacteria 5126
637 Ga0495644_0015724 3300046523 Bacteria 2900
638 Ga0495644_0031603 3300046523 Bacteria 2000
639 Ga0495644_0066258 3300046523 Bacteria 1356
640 Ga0495648_0001296 3300046524 Bacteria 24870
641 Ga0495648_0001297 3300046524 Bacteria 24870
642 Ga0495648_0001425 3300046524 Bacteria 23386
643 Ga0495648_0003753 3300046524 Bacteria 13223
644 Ga0495648_0006123 3300046524 Bacteria 9862
645 Ga0495648_0016758 3300046524 Bacteria 5270
646 Ga0495648_0021171 3300046524 Bacteria 4511
647 Ga0495648_0115771 3300046524 Bacteria 1449
648 Ga0495663_0002215 3300046525 Bacteria 5914
649 Ga0495666_0001817 3300046526 Bacteria 10541
650 Ga0495666_0015331 3300046526 Bacteria 3815
651 Ga0495666_0028531 3300046526 Bacteria 2746
652 Ga0495666_0061855 3300046526 Bacteria 1788
653 Ga0495666_0079786 3300046526 Bacteria 1549
654 Ga0495642_0000529 3300046528 Bacteria 19421
655 Ga0495642_0003891 3300046528 Bacteria 5852
656 Ga0495642_0021798 3300046528 Bacteria 2521
657 Ga0495642_0024066 3300046528 Bacteria 2407
658 Ga0495642_0069033 3300046528 Bacteria 1475
659 Ga0495652_0019566 3300046529 Bacteria 6026
660 Ga0495652_0038115 3300046529 Bacteria 4166
661 Ga0495652_0039668 3300046529 Bacteria 4071
662 Ga0495654_0000030 3300046530 Bacteria 216715
663 Ga0495665_0008461 3300046531 Bacteria 5582
664 Ga0495665_0021613 3300046531 Bacteria 3458
665 Ga0495640_0022469 3300046533 Bacteria 4609
666 Ga0495586_0024085 3300046535 Bacteria 3251
667 Ga0495586_0058801 3300046535 Bacteria 2088
668 Ga0495586_0088469 3300046535 Bacteria 1709
669 Ga0495587_0027154 3300046536 Bacteria 3486
670 Ga0495609_0000007 3300046538 Bacteria 398812
671 Ga0495609_0002820 3300046538 Bacteria 10412
672 Ga0495609_0003952 3300046538 Bacteria 8301
673 Ga0495609_0004429 3300046538 Bacteria 7680
674 Ga0495609_0004923 3300046538 Bacteria 7170
675 Ga0495609_0005405 3300046538 Bacteria 6723
676 Ga0495609_0006790 3300046538 Bacteria 5791
677 Ga0495609_0033240 3300046538 Bacteria 2341
678 Ga0495621_0078893 3300046539 Bacteria 1225
679 Ga0495597_0001285 3300046542 Bacteria 18457
680 Ga0495597_0001411 3300046542 Bacteria 17326
681 Ga0495597_0004502 3300046542 Bacteria 7634
682 Ga0495597_0005863 3300046542 Bacteria 6420
683 Ga0495597_0013491 3300046542 Bacteria 3910
684 Ga0495597_0016066 3300046542 Bacteria 3539
685 Ga0495597_0025847 3300046542 Bacteria 2701
686 Ga0495597_0028495 3300046542 Bacteria 2556
687 Ga0495645_0032325 3300046543 Bacteria 3816
688 Ga0495622_0001323 3300046557 Bacteria 12700
689 Ga0495622_0002393 3300046557 Bacteria 9126
690 Ga0495622_0006213 3300046557 Bacteria 5545
691 Ga0495622_0027424 3300046557 Bacteria 2658
692 Ga0495633_0000917 3300046558 Bacteria 24985
693 Ga0495633_0003343 3300046558 Bacteria 10770
694 Ga0495633_0007909 3300046558 Bacteria 6063
695 Ga0495633_0008903 3300046558 Bacteria 5597
696 Ga0495633_0010820 3300046558 Bacteria 4962
697 Ga0495633_0017263 3300046558 Bacteria 3696
698 Ga0495633_0018510 3300046558 Bacteria 3537
699 Ga0495633_0024206 3300046558 Bacteria 3002
700 Ga0495633_0026061 3300046558 Bacteria 2871
701 Ga0495633_0031949 3300046558 Bacteria 2546
702 Ga0495656_0009431 3300046615 Bacteria 3509
703 Ga0495656_0010160 3300046615 Bacteria 3412
704 Ga0495668_0000035 3300046616 Bacteria 240241
705 Ga0495668_0000211 3300046616 Bacteria 84615
706 Ga0495668_0000286 3300046616 Bacteria 69771
707 Ga0495668_0000939 3300046616 Bacteria 32535
708 Ga0495668_0004452 3300046616 Bacteria 9939
709 Ga0495668_0004959 3300046616 Bacteria 9225
710 Ga0495668_0028649 3300046616 Bacteria 3149
711 Ga0495668_0033106 3300046616 Bacteria 2905
712 Ga0495668_0062448 3300046616 Bacteria 2052
713 Ga0495668_0138067 3300046616 Bacteria 1334
714 Ga0495634_0007428 3300046642 Bacteria 8236
715 Ga0495634_0166313 3300046642 Bacteria 1388
716 Ga0495634_0212852 3300046642 Bacteria 1195
717 Ga0495611_0001030 3300046648 Bacteria 14761
718 Ga0495611_0006926 3300046648 Bacteria 4818
719 Ga0495611_0011215 3300046648 Bacteria 3799
720 Ga0495611_0018089 3300046648 Bacteria 3020
721 Ga0495611_0034137 3300046648 Bacteria 2248
722 Ga0495611_0087296 3300046648 Bacteria 1439
723 Ga0495611_0087994 3300046648 Bacteria 1433
724 Ga0495625_0001765 3300046660 Bacteria 25007
725 Ga0495625_0011811 3300046660 Bacteria 7094
726 Ga0495625_0013440 3300046660 Bacteria 6580
727 Ga0495625_0017244 3300046660 Bacteria 5654
728 Ga0495625_0168901 3300046660 Bacteria 1461
729 Ga0495635_0008609 3300046663 Bacteria 7123
730 Ga0495635_0017174 3300046663 Bacteria 5053
731 Ga0495659_0002549 3300046664 Bacteria 5876
732 Ga0495659_0006857 3300046664 Bacteria 3601
733 Ga0495661_0000074 3300046665 Bacteria 120402
734 Ga0495661_0004739 3300046665 Bacteria 9770
735 Ga0495661_0013502 3300046665 Bacteria 5484
736 Ga0495661_0014184 3300046665 Bacteria 5338
737 Ga0495661_0014749 3300046665 Bacteria 5231
738 Ga0495661_0020025 3300046665 Bacteria 4375
739 Ga0495661_0024133 3300046665 Bacteria 3937
740 Ga0495661_0037951 3300046665 Bacteria 3004
741 Ga0495661_0038019 3300046665 Bacteria 3002
742 Ga0495661_0040241 3300046665 Bacteria 2900
743 Ga0495661_0040415 3300046665 Bacteria 2892
744 Ga0495661_0049980 3300046665 Bacteria 2533
745 Ga0495661_0142641 3300046665 Bacteria 1301
746 Ga0495661_0156620 3300046665 Bacteria 1226
747 Ga0495661_0213376 3300046665 Bacteria 1003
748 Ga0495588_0000451 3300046674 Bacteria 20713
749 Ga0495588_0014692 3300046674 Bacteria 3754
750 Ga0495588_0062365 3300046674 Bacteria 1932
751 Ga0495588_0335857 3300046674 Bacteria 794
752 Ga0495657_0056172 3300046675 Bacteria 2623
753 Ga0495599_0094584 3300046678 Bacteria 1864
754 Ga0495599_0103013 3300046678 Bacteria 1778
755 Ga0495623_0012523 3300046679 Bacteria 5487
756 Ga0495623_0027099 3300046679 Bacteria 3686
757 Ga0495623_0027845 3300046679 Bacteria 3638
758 Ga0495623_0046617 3300046679 Bacteria 2750
759 Ga0495646_0005966 3300046680 Bacteria 7720
760 Ga0495646_0032746 3300046680 Bacteria 3233
761 Ga0495658_0140807 3300046683 Bacteria 1475
762 Ga0495669_0000101 3300046684 Bacteria 53876
763 Ga0495669_0000495 3300046684 Bacteria 18130
764 Ga0495669_0001145 3300046684 Bacteria 10993
765 Ga0495669_0004673 3300046684 Bacteria 5677
766 Ga0495669_0043467 3300046684 Bacteria 2000
767 Ga0495613_0061877 3300046689 Bacteria 2740
768 Ga0495613_0067028 3300046689 Bacteria 2620
769 Ga0495613_0171020 3300046689 Bacteria 1542
770 Ga0495624_0003624 3300046690 Bacteria 11417
771 Ga0495624_0004359 3300046690 Bacteria 10375
772 Ga0495624_0034365 3300046690 Bacteria 3279
773 Ga0495624_0063072 3300046690 Bacteria 2317
774 Ga0495624_0116779 3300046690 Bacteria 1639
775 Ga0495670_0000859 3300046691 Bacteria 14714
776 Ga0495670_0011198 3300046691 Bacteria 4409
777 Ga0495670_0017486 3300046691 Bacteria 3528
778 Ga0495670_0025115 3300046691 Bacteria 2946
779 Ga0495670_0040948 3300046691 Bacteria 2311
780 Ga0495671_0000605 3300046692 Bacteria 26398
781 Ga0495671_0007126 3300046692 Bacteria 6404
782 Ga0495671_0031947 3300046692 Bacteria 2689
783 Ga0495671_0062914 3300046692 Bacteria 1828
784 Ga0495671_0087233 3300046692 Bacteria 1528
785 Ga0495671_0107585 3300046692 Bacteria 1361
786 Ga0495649_0006762 3300046694 Bacteria 7105
787 Ga0495649_0008705 3300046694 Bacteria 6087
788 Ga0495649_0008952 3300046694 Bacteria 5984
789 Ga0495649_0066219 3300046694 Bacteria 1938
790 Ga0495589_0000086 3300046794 Bacteria 86130
791 Ga0495589_0000132 3300046794 Bacteria 68363
792 Ga0495589_0004038 3300046794 Bacteria 7863
793 Ga0495589_0006701 3300046794 Bacteria 6066
794 Ga0495589_0008251 3300046794 Bacteria 5441
795 Ga0495589_0025964 3300046794 Bacteria 2969
796 Ga0495589_0043578 3300046794 Bacteria 2232
797 Ga0495589_0057044 3300046794 Bacteria 1921
798 Ga0495600_0015355 3300046809 Bacteria 4841
799 Ga0495600_0020745 3300046809 Bacteria 4203
800 Ga0495600_0036329 3300046809 Bacteria 3201
801 Ga0495660_0004409 3300046810 Bacteria 8522
802 Ga0495660_0007681 3300046810 Bacteria 6335
803 Ga0495660_0008293 3300046810 Bacteria 6083
804 Ga0495660_0008498 3300046810 Bacteria 6012
805 Ga0495660_0014335 3300046810 Bacteria 4588
806 Ga0495660_0024343 3300046810 Bacteria 3449
807 Ga0495660_0026896 3300046810 Bacteria 3257
808 Ga0495660_0057832 3300046810 Bacteria 2090
809 Ga0495660_0069704 3300046810 Bacteria 1868
810 Ga0495660_0084017 3300046810 Bacteria 1665
811 Ga0495660_0084438 3300046810 Bacteria 1660
812 Ga0495581_0022613 3300047315 Bacteria 3642
813 Ga0495581_0027614 3300047315 Bacteria 3291
814 Ga0495581_0047000 3300047315 Bacteria 2494
815 Ga0495581_0204894 3300047315 Bacteria 1154
816 Ga0495604_0003813 3300047317 Bacteria 12003
817 Ga0495604_0012895 3300047317 Bacteria 6658
818 Ga0495604_0018243 3300047317 Bacteria 5618
819 Ga0495604_0032878 3300047317 Bacteria 4108
820 Ga0495636_0040337 3300047318 Bacteria 1935
821 Ga0495674_0011663 3300047319 Bacteria 8289
822 Ga0495674_0026818 3300047319 Bacteria 5269
823 Ga0495674_0039008 3300047319 Bacteria 4258
824 Ga0495674_0053476 3300047319 Bacteria 3549
825 Ga0495672_0000013 3300047320 Bacteria 511827
826 Ga0495672_0000278 3300047320 Bacteria 71017
827 Ga0495672_0001189 3300047320 Bacteria 26357
828 Ga0495672_0006089 3300047320 Bacteria 9422
829 Ga0495672_0006593 3300047320 Bacteria 8935
830 Ga0495672_0007759 3300047320 Bacteria 8030
831 Ga0495672_0008561 3300047320 Bacteria 7530
832 Ga0495672_0021147 3300047320 Bacteria 4248
833 Ga0495672_0096773 3300047320 Bacteria 1608
834 Ga0495676_0000015 3300047321 Bacteria 199492
835 Ga0495676_0089686 3300047321 Bacteria 2303
836 Ga0495676_0110694 3300047321 Bacteria 2015
837 Ga0495676_0134159 3300047321 Bacteria 1783
838 Ga0495680_0019772 3300047322 Bacteria 5679
839 Ga0495680_0070676 3300047322 Bacteria 2660
840 Ga0495680_0080980 3300047322 Bacteria 2452
841 Ga0495683_0000036 3300047323 Bacteria 144974
842 Ga0495683_0003534 3300047323 Bacteria 9097
843 Ga0495683_0003640 3300047323 Bacteria 8935
844 Ga0495683_0006050 3300047323 Bacteria 6641
845 Ga0495683_0006168 3300047323 Bacteria 6571
846 Ga0495683_0013934 3300047323 Bacteria 4192
847 Ga0495683_0015050 3300047323 Bacteria 4029
848 Ga0495683_0019227 3300047323 Bacteria 3526
849 Ga0495683_0047196 3300047323 Bacteria 2161
850 Ga0495683_0090903 3300047323 Bacteria 1479
851 Ga0495687_000038 3300047443 Bacteria 251616
852 Ga0495687_000057 3300047443 Bacteria 186224
853 Ga0495687_001055 3300047443 Bacteria 27247
854 Ga0495687_001122 3300047443 Bacteria 26027
855 Ga0495687_007401 3300047443 Bacteria 6469
856 Ga0495687_008762 3300047443 Bacteria 5746
857 Ga0495687_010094 3300047443 Bacteria 5206
858 Ga0495687_017705 3300047443 Bacteria 3542
859 Ga0495687_025518 3300047443 Bacteria 2792
860 Ga0495687_028152 3300047443 Bacteria 2617
861 Ga0495687_113151 3300047443 Bacteria 993
862 Ga0495675_0019161 3300047444 Bacteria 4347
863 Ga0495675_0077014 3300047444 Bacteria 2101
864 Ga0495675_0091327 3300047444 Bacteria 1911
865 Ga0495677_0000004 3300047445 Bacteria 248210
866 Ga0495677_0000948 3300047445 Bacteria 11680
867 Ga0495677_0005364 3300047445 Bacteria 4864
868 Ga0495677_0017287 3300047445 Bacteria 2615
869 Ga0495677_0022617 3300047445 Bacteria 2280
870 Ga0495679_000271 3300047446 Bacteria 43383
871 Ga0495679_001332 3300047446 Bacteria 14284
872 Ga0495679_002051 3300047446 Bacteria 10639
873 Ga0495679_010678 3300047446 Bacteria 3591
874 Ga0495685_000299 3300047447 Bacteria 16305
875 Ga0495685_029782 3300047447 Bacteria 1877
876 Ga0495685_086303 3300047447 Bacteria 1042
877 Ga0495673_0000069 3300047469 Bacteria 218170
878 Ga0495673_0000203 3300047469 Bacteria 89918
879 Ga0495673_0000236 3300047469 Bacteria 79618
880 Ga0495673_0009876 3300047469 Bacteria 5239
881 Ga0495673_0013406 3300047469 Bacteria 4306
882 Ga0495673_0066045 3300047469 Bacteria 1535
883 Ga0495681_0014222 3300047470 Bacteria 4577
884 Ga0495681_0031624 3300047470 Bacteria 2675
885 Ga0495681_0032950 3300047470 Bacteria 2601
886 Ga0495681_0037197 3300047470 Bacteria 2400
887 Ga0495681_0081584 3300047470 Bacteria 1442
888 Ga0495686_0007873 3300047472 Bacteria 7916
889 Ga0495686_0008513 3300047472 Bacteria 7519
890 Ga0495686_0035881 3300047472 Bacteria 3183
891 Ga0495686_0160983 3300047472 Bacteria 1311
892 Ga0495593_0002329 3300047673 Bacteria 11410
893 Ga0495593_0008400 3300047673 Bacteria 6005
894 Ga0495593_0049839 3300047673 Bacteria 2220
895 Ga0495602_0018389 3300048088 Bacteria 6983
896 Ga0495602_0026740 3300048088 Bacteria 5560
897 Ga0495602_0039345 3300048088 Bacteria 4355
898 Ga0495602_0102875 3300048088 Bacteria 2339
899 Ga0495614_0009542 3300048089 Bacteria 4290
900 Ga0495614_0020278 3300048089 Bacteria 2875
901 Ga0495614_0022236 3300048089 Bacteria 2737
902 Ga0495615_0003471 3300048090 Bacteria 2645
903 Ga0495626_0000048 3300048091 Bacteria 161634
904 Ga0495626_0000279 3300048091 Bacteria 56185
905 Ga0495626_0000998 3300048091 Bacteria 24336
906 Ga0495626_0001757 3300048091 Bacteria 16497
907 Ga0495626_0007693 3300048091 Bacteria 5971
908 Ga0495626_0008828 3300048091 Bacteria 5481
909 Ga0495626_0009702 3300048091 Bacteria 5189
910 Ga0495626_0010181 3300048091 Bacteria 5042
911 Ga0495626_0027137 3300048091 Bacteria 2785
912 Ga0496100_0033511 3300048903 Bacteria 3214
913 Ga0496100_0175340 3300048903 Bacteria 1547
914 Ga0496101_0045775 3300048904 Bacteria 3135
915 Ga0496101_0251187 3300048904 Bacteria 1378
916 Ga0496101_0320679 3300048904 Bacteria 1216
917 Ga0496102_0000478 3300048905 Bacteria 44372
918 Ga0496102_0007956 3300048905 Bacteria 9059
919 Ga0496102_0008640 3300048905 Bacteria 8741
920 Ga0496102_0017344 3300048905 Bacteria 6306
921 Ga0496102_0165543 3300048905 Bacteria 2080
922 Ga0496102_0291127 3300048905 Bacteria 1539
923 Ga0496103_0017663 3300048906 Bacteria 4270
924 Ga0496103_0083968 3300048906 Bacteria 2005
925 Ga0496103_0092200 3300048906 Bacteria 1912
926 Ga0496106_0055391 3300048909 Bacteria 2997
927 Ga0496109_0035631 3300048912 Bacteria 4490
928 Ga0496109_0133006 3300048912 Bacteria 2323
929 Ga0496109_0286482 3300048912 Bacteria 1553
930 Ga0496110_0000092 3300048913 Bacteria 48035
931 Ga0496110_0148346 3300048913 Bacteria 2122
932 Ga0496110_0527297 3300048913 Bacteria 1074
933 Ga0496111_0267910 3300048914 Bacteria 1267
934 Ga0496111_0504127 3300048914 Bacteria 891
935 Ga0496114_0007265 3300048917 Bacteria 8748
936 Ga0496114_0068845 3300048917 Bacteria 2971
937 Ga0496114_0072052 3300048917 Bacteria 2905
938 Ga0496115_0019582 3300048918 Bacteria 5210
939 Ga0496115_0125816 3300048918 Bacteria 2111
940 Ga0496115_0526259 3300048918 Bacteria 948
941 Ga0496116_0051271 3300048919 Bacteria 2742
942 Ga0496117_0000005 3300048920 Bacteria 777468
943 Ga0496117_0031619 3300048920 Bacteria 4036
944 Ga0496117_0074896 3300048920 Bacteria 2251
945 Ga0496118_0000031 3300048921 Bacteria 339329
946 Ga0496118_0011234 3300048921 Bacteria 8767
947 Ga0496118_0040491 3300048921 Bacteria 3704
948 Ga0496121_0028888 3300048924 Bacteria 5149
949 Ga0496121_0034811 3300048924 Bacteria 4526
950 Ga0496121_0038335 3300048924 Bacteria 4247
951 Ga0496122_0003525 3300048925 Bacteria 20479
952 Ga0496123_0000084 3300048926 Bacteria 187479
953 Ga0496123_0003683 3300048926 Bacteria 16896
954 Ga0496124_0010436 3300048927 Bacteria 9401
955 Ga0496124_0017631 3300048927 Bacteria 6723
956 Ga0496124_0023504 3300048927 Bacteria 5625
957 Ga0496124_0075273 3300048927 Bacteria 2789
958 Ga0496124_0314938 3300048927 Bacteria 1123
959 Ga0496125_0000368 3300048928 Bacteria 84924
960 Ga0496125_0015656 3300048928 Bacteria 7317
961 Ga0496125_0022691 3300048928 Bacteria 5820
962 Ga0496125_0356719 3300048928 Bacteria 871
963 Ga0495678_000010 3300049459 Bacteria 357896
964 Ga0495678_000034 3300049459 Bacteria 207827
965 Ga0495678_000383 3300049459 Bacteria 44894
966 Ga0495678_001376 3300049459 Bacteria 19384
967 Ga0495678_004680 3300049459 Bacteria 7830
968 Ga0495678_009666 3300049459 Bacteria 4744
969 Ga0495682_0008734 3300049460 Bacteria 3986
970 Ga0495682_0023768 3300049460 Bacteria 2286
971 Ga0495682_0035992 3300049460 Bacteria 1822
972 Ga0495682_0042554 3300049460 Bacteria 1664
973 Ga0501313_011247 3300049529 Bacteria 1030
974 Ga0501031_0007227 3300049568 Bacteria 7246
975 Ga0501031_0023720 3300049568 Bacteria 3998
976 Ga0501031_0047236 3300049568 Bacteria 2806
977 Ga0501031_0083405 3300049568 Bacteria 2083
978 Ga0501031_0233715 3300049568 Bacteria 1196
979 Ga0501032_0000993 3300049569 Bacteria 22838
980 Ga0501032_0003737 3300049569 Bacteria 11547
981 Ga0501032_0008533 3300049569 Bacteria 7472
982 Ga0501032_0009695 3300049569 Bacteria 6973
983 Ga0501032_0010759 3300049569 Bacteria 6586
984 Ga0501033_0001281 3300049570 Bacteria 22428
985 Ga0501033_0003589 3300049570 Bacteria 12679
986 Ga0501033_0094590 3300049570 Bacteria 2185
987 Ga0501033_0097761 3300049570 Bacteria 2144
988 Ga0501034_0010675 3300049571 Bacteria 9544
989 Ga0501034_0047250 3300049571 Bacteria 4348
990 Ga0501036_0004255 3300049572 Bacteria 11545
991 Ga0501036_0007404 3300049572 Bacteria 8944
992 Ga0501036_0023088 3300049572 Bacteria 5235
993 Ga0501036_0041052 3300049572 Bacteria 3916
994 Ga0501036_0532592 3300049572 Bacteria 976
995 Ga0501037_0018199 3300049573 Bacteria 5176
996 Ga0501037_0152888 3300049573 Bacteria 1648
997 Ga0501038_0003012 3300049574 Bacteria 15712
998 Ga0501038_0014124 3300049574 Bacteria 7275
999 Ga0501038_0021009 3300049574 Bacteria 5865
1000 Ga0501038_0022730 3300049574 Bacteria 5613
1001 Ga0501038_0048365 3300049574 Bacteria 3681
1002 Ga0501038_0064086 3300049574 Bacteria 3135
1003 Ga0501038_0245046 3300049574 Bacteria 1421
1004 Ga0501039_0070245 3300049575 Bacteria 2720
1005 Ga0501039_0194977 3300049575 Bacteria 1592
1006 Ga0501039_0205027 3300049575 Bacteria 1550
1007 Ga0501040_0009384 3300049576 Bacteria 6374
1008 Ga0501040_0036297 3300049576 Bacteria 3344
1009 Ga0501041_0064783 3300049577 Bacteria 2238
1010 Ga0501042_0095513 3300049578 Bacteria 2135
1011 Ga0501043_0001204 3300049579 Bacteria 22765
1012 Ga0501043_0003787 3300049579 Bacteria 12433
1013 Ga0501043_0006411 3300049579 Bacteria 9451
1014 Ga0501043_0074970 3300049579 Bacteria 2657
1015 Ga0501043_0099085 3300049579 Bacteria 2291
1016 Ga0501046_0000851 3300049580 Bacteria 29697
1017 Ga0501046_0010292 3300049580 Bacteria 8047
1018 Ga0501046_0025411 3300049580 Bacteria 4847
1019 Ga0501047_0009059 3300049581 Bacteria 9398
1020 Ga0501047_0013028 3300049581 Bacteria 7875
1021 Ga0501047_0118332 3300049581 Bacteria 2531
1022 Ga0501048_0006174 3300049582 Bacteria 9119
1023 Ga0501048_0031474 3300049582 Bacteria 3838
1024 Ga0501048_0511305 3300049582 Bacteria 861
1025 Ga0501068_0007808 3300049584 Bacteria 5927
1026 Ga0501069_0333703 3300049585 Bacteria 892
1027 Ga0501071_0159016 3300049587 Bacteria 1688
1028 Ga0501076_0099498 3300049592 Bacteria 2343
1029 Ga0501077_0296754 3300049593 Bacteria 1029
1030 Ga0501083_0190954 3300049744 Bacteria 1337
1031 Ga0501269_000473 3300049766 Bacteria 8609
1032 Ga0501035_0000450 3300049822 Bacteria 46029
1033 Ga0501035_0001403 3300049822 Bacteria 24742
1034 Ga0501035_0006010 3300049822 Bacteria 11433
1035 Ga0501035_0039300 3300049822 Bacteria 4282
1036 Ga0501035_0094400 3300049822 Bacteria 2630
1037 Ga0501044_0000068 3300049823 Bacteria 126642
1038 Ga0501044_0002232 3300049823 Bacteria 22168
1039 Ga0501044_0003674 3300049823 Bacteria 17246
1040 Ga0501044_0069533 3300049823 Bacteria 3584
1041 Ga0501044_0151081 3300049823 Bacteria 2304
1042 Ga0501044_0411021 3300049823 Bacteria 1264
1043 Ga0501044_0479769 3300049823 Bacteria 1147
1044 Ga0501045_0038488 3300049824 Bacteria 3478
1045 Ga0501045_0084777 3300049824 Bacteria 2338
1046 Ga0501045_0085123 3300049824 Bacteria 2333
1047 nmdc:mga05p37_379775_c1 3300050507 Bacteria 1656
1048 nmdc:mga06r32_493829_c1 3300050510 Bacteria 1201
1049 nmdc:mga08y16_26878_c1 3300050511 Bacteria 6065
1050 nmdc:mga08y16_41626_c1 3300050511 Bacteria 4812
1051 nmdc:mga0rr50_21481_c1 3300050513 Bacteria 4407
1052 nmdc:mga0a205_245298_c1 3300050515 Bacteria 1672
1053 Ga0495601_0022528 3300053077 Bacteria 3867
1054 Ga0495595_0068653 3300053084 Bacteria 1672
1055 Ga0495619_0083858 3300053085 Bacteria 2150
1056 Ga0495619_0195917 3300053085 Bacteria 1399
1057 Ga0495619_0526661 3300053085 Bacteria 812
1058 Ga0500618_000653 3300053125 Bacteria 20633
1059 Ga0500574_000047 3300053141 Bacteria 14143
1060 Ga0500619_001638 3300053154 Bacteria 4031
1061 Ga0587084_000383 3300059477 Bacteria 3349
1062 Ga0587066_022305 3300059490 Bacteria 1058
1063 Ga0587080_001172 3300059503 Bacteria 2718
1064 Ga0587082_041449 3300059504 Bacteria 845
1065 Ga0587090_012266 3300059510 Bacteria 1220
1066 Ga0587067_006197 3300059640 Bacteria 1657
1067 Ga0587068_000998 3300059641 Bacteria 2980
1068 Ga0587068_018470 3300059641 Bacteria 1123
1069 Ga0587069_024441 3300059642 Bacteria 932
1070 Ga0587078_010017 3300059646 Bacteria 1083
1071 Ga0587079_020003 3300059647 Bacteria 1190
1072 Ga0587111_0030375 3300060346 Bacteria 1100
1073 Ga0501082_0397025 3300060353 Bacteria 1203
1074 Ga0466962_0018529 3300061719 Bacteria 3348
1075 2509130720 2508501125 Bacteria 7208311
1076 2511250319 2511231003 Bacteria 5606035
1077 2511387575 2511231026 Bacteria 5225445
1078 2513962723 2513237151 Bacteria 6309801
1079 2521559825 2521172590 Bacteria 5047645
1080 2550693198 2548876994 Bacteria 4904866
1081 2553007041 2551306416 Bacteria 6152985
1082 2601672280 2600255292 Bacteria 6300551
1083 2643791751 2643221554 Bacteria 6603920
1084 2643796626 2643221556 Bacteria 7251154
1085 2644027062 2643221603 Bacteria 6147767
1086 2644216770 2643221638 Bacteria 6579467
1087 2644254520 2643221645 Bacteria 7207331
1088 2644360067 2643221664 Bacteria 7272945
1089 2644472748 2643221684 Bacteria 7145183
1090 2678229772 2675903507 Bacteria 3737791
1091 2723879546 2721755763 Bacteria 4464185
1092 2738742908 2738541280 Bacteria 6630198
1093 2738827059 2738541297 Bacteria 6549566
1094 2738845996 2738541300 Bacteria 6675882
1095 2739150856 2738541357 Bacteria 6549408
1096 2739192775 2738543003 Bacteria 6549560
1097 2739276904 2738543018 Bacteria 6718814
1098 2739319252 2738543026 Bacteria 6549408
1099 2739337493 2738543029 Bacteria 6549249
1100 2739345948 2738543030 Bacteria 6719714
1101 2746087352 2744054900 Bacteria 8399525
1102 2746093141 2744054901 Bacteria 8397047
1103 2765571081 2765235838 Bacteria 5445269
1104 2808984989 2808606386 Bacteria 4471946
1105 2809130121 2808606415 Bacteria 4576710
1106 2809145546 2808606418 Bacteria 6724496
1107 2809150402 2808606419 Bacteria 4576925
1108 2819544513 2818991436 Bacteria 5376622
1109 2819594072 2818991445 Bacteria 4955017
1110 2819618266 2818991449 Bacteria 5518009
1111 2821136479 2821131069 Bacteria 6108407
1112 2828308164 2828305725 Bacteria 4916900
1113 2839096677 2839094727 Bacteria 5534556
1114 2842713688 2842711865 Bacteria 7155354
1115 2846036739 2846033681 Bacteria 4377894
1116 2846042157 2846037992 Bacteria 4526407
1117 2852621374 2852618963 Bacteria 4577824
1118 2857549311 2857547612 Bacteria 6179999
1119 2857558528 2857553236 Bacteria 6166726
1120 2857562343 2857558681 Bacteria 6617694
1121 2857568296 2857564685 Bacteria 6290584
1122 2884815177 2884811622 Bacteria 5552861
1123 2884839899 2884836552 Bacteria 5219991
1124 2884856290 2884852848 Bacteria 5221161
1125 2885081343 2885080285 Bacteria 6355622
1126 2896158655 2896154374 Bacteria 5221518
1127 2900637200 2900634093 Bacteria 10263517
1128 2904428561 2904424332 Bacteria 7633521
1129 2904444391 2904439833 Bacteria 5931679
1130 2904490244 2904483920 Bacteria 7545285
1131 2904535544 2904530477 Bacteria 5876334
1132 2904588116 2904584206 Bacteria 6028872
1133 2904595152 2904589729 Bacteria 6113573
1134 2904606065 2904601388 Bacteria 5884906
1135 2916182549 2916178963 Bacteria 5265078
1136 2919051309 2919046199 Bacteria 5567169
1137 2919084263 2919079590 Bacteria 5946433
1138 2919477228 2919476304 Bacteria 5888696
1139 2919533414 2919527303 Bacteria 7718827
1140 2923513592 2923510766 Bacteria 5926163
1141 2928135291 2928130867 Bacteria 5467269
1142 2932416365 2932410948 Bacteria 6312192
1143 2932422242 2932416698 Bacteria 6315112
1144 642623073 642555113 Bacteria 8214658
1145 8047675699 8047673197 Bacteria 7395230
1146 8055307286 8055301274 Bacteria 8587385
1147 Ga0105244_10006687
1148 JGI25155J39150_1000864
1149 JGI25156J39149_1008946
1150 JGI25162J39368_1004179
1151 JGI25162J39368_1013055
1152 JGI25154J39366_1000845
1153 JGI25158J39367_1000818
1154 JGI25158J39367_1008485
1155 JGI25158J39367_1024630
1156 JGI25157J39369_1000372
1157 JGI25152J39213_1001993
1158 JGI25152J39213_1009823
1159 JGI25150J39212_1000910
1160 JGI25150J39212_1001503
1161 JGI25159J45721_1005724
1162 JGI25159J45721_1007426
1163 JGI25159J45721_1015531
1164 JGI25165J46597_1000713
1165 JGI25165J46597_1001348
1166 JGI25153J46596_10004223
1167 JGI25160J50197_1003453
1168 JGI25161J50226_1007576
1169 Ga0007409J51694_1012308
1170 Ga0007416J51690_1027150
1171 Ga0032354_1062149
1172 Ga0055538_1000062
1173 Ga0055538_1000281
1174 Ga0055539_1000093
1175 Ga0055539_1000305
1176 Ga0055533_1000105
1177 Ga0055533_1000286
1178 Ga0055533_1000737
1179 Ga0055533_1002031
1180 Ga0055532_1000034
1181 Ga0055532_1000092
1182 Ga0055525_1000018
1183 Ga0055525_1000137
1184 Ga0055525_1000405
1185 Ga0055527_1000035
1186 Ga0055535_1000050
1187 Ga0055535_1013520
1188 Ga0055542_1000120
1189 Ga0055529_1000089
1190 Ga0055529_1000152
1191 Ga0055526_1001033
1192 Ga0055526_1003235
1193 Ga0055526_1004446
1194 Ga0055526_1005708
1195 Ga0055526_1007871
1196 Ga0055537_1000580
1197 Ga0055537_1012740
1198 Ga0055524_1000899
1199 Ga0055524_1002755
1200 Ga0055524_1003183
1201 Ga0055524_1003663
1202 Ga0055524_1008827
1203 Ga0055524_1010041
1204 Ga0055524_1011926
1205 Ga0055534_1000283
1206 Ga0055534_1005190
1207 Ga0055534_1022725
1208 Ga0055528_1000495
1209 Ga0055528_1006705
1210 Ga0055530_10003928
1211 Ga0055530_10008706
1212 Ga0055530_10019894
1213 Ga0055531_10021682
1214 Ga0055531_10041167
1215 Ga0055541_1000063
1216 Ga0055541_1000198
1217 Ga0058692_1000027
1218 Ga0055543_1002300
1219 Ga0055543_1010334
1220 Ga0065165_1002857
1221 Ga0065165_1004075
1222 Ga0065165_1006132
1223 Ga0065165_1013870
1224 Ga0065165_1041906
1225 Ga0065703_1000515
1226 Ga0065714_10127055
1227 Ga0070683_100267191
1228 Ga0070670_100599001
1229 Ga0070680_100334382
1230 Ga0070680_100437688
1231 Ga0070682_100022524
1232 Ga0070660_100022139
1233 Ga0070660_100044408
1234 Ga0070661_100025891
1235 Ga0070668_100419691
1236 Ga0070669_100003722
1237 Ga0070675_100605379
1238 Ga0070674_100830540
1239 Ga0070659_100001752
1240 Ga0070659_100676594
1241 Ga0070667_100131493
1242 Ga0070714_100012283
1243 Ga0070663_100011336
1244 Ga0070663_100043195
1245 Ga0070663_100205529
1246 Ga0070663_100741381
1247 Ga0070662_100036858
1248 Ga0070662_100133362
1249 Ga0070681_10467082
1250 Ga0070706_100042249
1251 Ga0070706_100074408
1252 Ga0070707_100252943
1253 Ga0070699_100795151
1254 Ga0070679_100087655
1255 Ga0070684_100840667
1256 Ga0070697_100055245
1257 Ga0070697_100064585
1258 Ga0070697_100084697
1259 Ga0068853_100127886
1260 Ga0070695_100010846
1261 Ga0070696_100389706
1262 Ga0070665_100016024
1263 Ga0070704_100322552
1264 Ga0068855_100025280
1265 Ga0068855_100035272
1266 Ga0068855_100365494
1267 Ga0068855_100459419
1268 Ga0068854_100007632
1269 Ga0068856_100165342
1270 Ga0068856_100438406
1271 Ga0068852_100004237
1272 Ga0068859_100137698
1273 Ga0068863_100349786
1274 Ga0068860_100028951
1275 Ga0068860_100205246
1276 Ga0070717_10119390
1277 Ga0070717_10186186
1278 Ga0070717_10963357
1279 Ga0070712_100003531
1280 Ga0075434_100013297
1281 Ga0097620_100137704
1282 Ga0079104_1013403
1283 Ga0099826_10000010
1284 Ga0075435_100025552
1285 Ga0105244_10002041
1286 Ga0105244_10029464
1287 Ga0105244_10065752
1288 Ga0105244_10099021
1289 Ga0105240_10001608
1290 Ga0105240_10007637
1291 Ga0105240_10016336
1292 Ga0105240_10038235
1293 Ga0105240_10070890
1294 Ga0105240_10146806
1295 Ga0111539_10029979
1296 Ga0111539_10124601
1297 Ga0105245_10711439
1298 Ga0105247_10003833
1299 Ga0114129_10241688
1300 Ga0105243_10000343
1301 Ga0105243_10280106
1302 Ga0105241_10603550
1303 Ga0105242_10046831
1304 Ga0105237_10034417
1305 Ga0105237_10099866
1306 Ga0105238_10000763
1307 Ga0105238_10183076
1308 Ga0105249_10719777
1309 Ga0105239_10010387
1310 Ga0105239_10328870
1311 Ga0105246_10178491
1312 Ga0157371_10000018
1313 Ga0157370_10247198
1314 Ga0157370_10653786
1315 Ga0157374_10202904
1316 Ga0157374_10213758
1317 Ga0157378_10271726
1318 Ga0157378_10399506
1319 Ga0163162_10154463
1320 Ga0163163_10095925
1321 Ga0163163_10344627
1322 Ga0182008_10003605
1323 Ga0182008_10022601
1324 Ga0182008_10054820
1325 Ga0182006_1000033
1326 Ga0182006_1000080
1327 Ga0182006_1005060
1328 Ga0182006_1012892
1329 Ga0182006_1082631
1330 Ga0182007_10000042
1331 Ga0182007_10003815
1332 Ga0182007_10006803
1333 Ga0182005_1000016
1334 Ga0182005_1000024
1335 Ga0182005_1001434
1336 Ga0163161_10012023
1337 Ga0163161_10056209
1338 Ga0163161_10095458
1339 Ga0197907_10734725
1340 Ga0206355_1336031
1341 Ga0206350_11154362
1342 Ga0206354_10998826
1343 Ga0206353_10779650
1344 Ga0213872_10000430
1345 Ga0213872_10004434
1346 Ga0213872_10004797
1347 Ga0213872_10011815
1348 Ga0213872_10128204
1349 Ga0224712_10003485
1350 Ga0209435_100007
1351 Ga0209436_101663
1352 Ga0209436_102178
1353 Ga0209436_104811
1354 Ga0209784_100010
1355 Ga0209784_100021
1356 Ga0209566_100008
1357 Ga0209566_100119
1358 Ga0209674_100019
1359 Ga0209674_100036
1360 Ga0209674_100259
1361 Ga0209147_100017
1362 Ga0209563_100011
1363 Ga0209563_100021
1364 Ga0209563_100040
1365 Ga0207427_100759
1366 Ga0207427_100936
1367 Ga0209437_100019
1368 Ga0209437_100332
1369 Ga0209437_105500
1370 Ga0209258_101277
1371 Ga0207425_1000021
1372 Ga0207425_1000829
1373 Ga0207425_1001943
1374 Ga0207425_1018992
1375 Ga0209646_1000044
1376 Ga0209646_1000107
1377 Ga0209646_1000190
1378 Ga0209026_1000063
1379 Ga0209677_100011
1380 Ga0209677_100023
1381 Ga0209677_101699
1382 Ga0209148_1000237
1383 Ga0209759_1000048
1384 Ga0209759_1000195
1385 Ga0209759_1000351
1386 Ga0209759_1003045
1387 Ga0209129_1000020
1388 Ga0209129_1014565
1389 Ga0209233_1000025
1390 Ga0209233_1000173
1391 Ga0209565_1000055
1392 Ga0209565_1000677
1393 Ga0209565_1002957
1394 Ga0209565_1003264
1395 Ga0209565_1010498
1396 Ga0209455_1000070
1397 Ga0209455_1004771
1398 Ga0209673_1000040
1399 Ga0209673_1003338
1400 Ga0209673_1053678
1401 Ga0209130_1000169
1402 Ga0209130_1002260
1403 Ga0209130_1003537
1404 Ga0209675_1000052
1405 Ga0209675_1007962
1406 Ga0209675_1008529
1407 Ga0209025_1001876
1408 Ga0209564_1000027
1409 Ga0209564_1000047
1410 Ga0209564_1000063
1411 Ga0209564_1000271
1412 Ga0209564_1001666
1413 Ga0209564_1022873
1414 Ga0209758_1000288
1415 Ga0209758_1000436
1416 Ga0209050_1000050
1417 Ga0209050_1005131
1418 Ga0209050_1006673
1419 Ga0209256_1000054
1420 Ga0209256_1000100
1421 Ga0209256_1000754
1422 Ga0209256_1004828
1423 Ga0209256_1005964
1424 Ga0207426_1003112
1425 Ga0207426_1036654
1426 Ga0209257_1006073
1427 Ga0209257_1009189
1428 Ga0207696_1021563
1429 Ga0207655_1001604
1430 Ga0207655_1001651
1431 Ga0207655_1004763
1432 Ga0207713_1002759
1433 Ga0207713_1002761
1434 Ga0207710_10000057
1435 Ga0207705_10009748
1436 Ga0207705_10121345
1437 Ga0207684_10025468
1438 Ga0207684_10103272
1439 Ga0207654_10112395
1440 Ga0207654_10146993
1441 Ga0207707_10070128
1442 Ga0207695_10007667
1443 Ga0207695_10008939
1444 Ga0207695_10012318
1445 Ga0207695_10060948
1446 Ga0207695_10100367
1447 Ga0207695_10135206
1448 Ga0207695_10209182
1449 Ga0207695_10393672
1450 Ga0207671_10004652
1451 Ga0207671_10069660
1452 Ga0207660_10317649
1453 Ga0207657_10012688
1454 Ga0207657_10027581
1455 Ga0207649_10009529
1456 Ga0207652_10454486
1457 Ga0207646_10014703
1458 Ga0207681_10002504
1459 Ga0207694_10013544
1460 Ga0207650_10046359
1461 Ga0207650_10262264
1462 Ga0207687_10042299
1463 Ga0207700_10078045
1464 Ga0207664_10023812
1465 Ga0207690_10000951
1466 Ga0207690_10013294
1467 Ga0207690_10214873
1468 Ga0207706_10110175
1469 Ga0207706_10111892
1470 Ga0207686_10034904
1471 Ga0207709_10000057
1472 Ga0207709_10277379
1473 Ga0207661_10557896
1474 Ga0207679_10010560
1475 Ga0207667_10000912
1476 Ga0207667_10020489
1477 Ga0207667_10145306
1478 Ga0207667_10502785
1479 Ga0207668_10035510
1480 Ga0207668_10270570
1481 Ga0207640_10064502
1482 Ga0207658_10028565
1483 Ga0207703_10052391
1484 Ga0207639_10550936
1485 Ga0207678_10021915
1486 Ga0207678_10097386
1487 Ga0207702_10363895
1488 Ga0207702_10539705
1489 Ga0207702_10887820
1490 Ga0207641_10700557
1491 Ga0207674_10204005
1492 Ga0207674_10632048
1493 Ga0207683_10369797
1494 Ga0207683_10680611
1495 Ga0207698_10166721
1496 Ga0209281_1005141
1497 Ga0209371_1000074
1498 Ga0209371_1004235
1499 Ga0209970_1022343
1500 Ga0209983_1048630
1501 Ga0209282_1000009
1502 Ga0209974_10034083
1503 Ga0207428_10037235
1504 Ga0207428_10146957
1505 Ga0268264_10064081
1506 Ga0265334_10037067
1507 Ga0307515_10000037
1508 Ga0307515_10001585
1509 Ga0307515_10002662
1510 Ga0307515_10120443
1511 Ga0268256_1000067
1512 Ga0268256_1003593
1513 Ga0316177_1056605
1514 Ga0316180_1139639
1515 Ga0316181_1015625
1516 Ga0265330_10007637
1517 Ga0265332_10000253
1518 Ga0265325_10056921
1519 Ga0265329_10001506
1520 Ga0265331_10004185
1521 Ga0265327_10016288
1522 Ga0265316_10004554
1523 Ga0307513_10004052
1524 Ga0307513_10405500
1525 Ga0307408_100000432
1526 Ga0307408_100002407
1527 Ga0307408_100009332
1528 Ga0307408_100042644
1529 Ga0265314_10036954
1530 Ga0307516_10001680
1531 Ga0307516_10078081
1532 Ga0307405_10570872
1533 Ga0307518_10120389
1534 Ga0307410_10176546
1535 Ga0307406_10333007
1536 Ga0307412_10366015
1537 Ga0307416_100000975
1538 Ga0307414_10072470
1539 Ga0307414_10448523
1540 Ga0373953_0207558
1541 Ga0373931_0201987
1542 Ga0373935_0188183
1543 Ga0373935_0413182
1544 Ga0373927_0003380
1545 Ga0373927_0067197
1546 Ga0373927_0109525
1547 Ga0373933_0187494
1548 Ga0373947_0139128
1549 Ga0373937_0043911
1550 Ga0373937_0167163
1551 Ga0373937_0959462
1552 Ga0373925_0021367
1553 Ga0373925_0485079
1554 Ga0373925_0690712
1555 Ga0395899_0000521
1556 Ga0395899_0002806
1557 Ga0395899_0003830
1558 Ga0395899_0010327
1559 Ga0395899_0011850
1560 Ga0395899_0079948
1561 Ga0395899_0170770
1562 Ga0395900_0010081
1563 Ga0395900_0014022
1564 Ga0395900_0031672
1565 Ga0395900_0036395
1566 Ga0395900_0038700
1567 Ga0395900_0147914
1568 Ga0395898_0020590
1569 Ga0395898_0031143
1570 Ga0395898_0420563
1571 Ga0395905_0010442
1572 Ga0395905_0013127
1573 Ga0395905_0030081
1574 Ga0395905_0085053
1575 Ga0395905_0109483
1576 Ga0395905_0280476
1577 Ga0395901_0002710
1578 Ga0395901_0002897
1579 Ga0395901_0027008
1580 Ga0395901_0357208
1581 Ga0395901_0637442
1582 Ga0436365_0436116
1583 Ga0436360_0123446
1584 Ga0436361_0009051
1585 Ga0436361_0013073
1586 Ga0436361_0039131
1587 Ga0436361_0167678
1588 Ga0436361_0389557
1589 Ga0436361_0558892
1590 Ga0436361_0930389
1591 Ga0436361_0959711
1592 Ga0436362_1188435
1593 Ga0439466_0015406
1594 Ga0451843_1496344
1595 Ga0439448_0031608
1596 Ga0439455_0005794
1597 Ga0439455_0016980
1598 Ga0450904_001582
1599 Ga0439458_0054788
1600 Ga0450893_0019345
1601 Ga0451577_0000941
1602 Ga0451577_0003646
1603 Ga0451577_0090201
1604 Ga0466972_0000420
1605 Ga0466972_0024846
1606 Ga0466965_0019525
1607 Ga0466965_0091695
1608 Ga0466966_0013203
1609 Ga0466966_0122910
1610 Ga0466961_0119384
1611 Ga0466964_0029535
1612 Ga0453684_0208793
1613 Ga0466971_0144021
1614 Ga0466957_0001920
1615 Ga0466957_0005784
1616 Ga0466960_0324217
1617 Ga0466960_0340141
1618 Ga0466959_0219057
1619 Ga0451576_0241374
1620 Ga0451576_1102472
1621 Ga0466967_0107630
1622 Ga0495617_000022
1623 Ga0495617_001209
1624 Ga0495617_056815
1625 Ga0495627_000011
1626 Ga0495627_000398
1627 Ga0495627_028145
1628 Ga0495592_0002825
1629 Ga0495592_0006056
1630 Ga0495592_0158030
1631 Ga0495603_0039081
1632 Ga0495603_0039573
1633 Ga0495590_0000057
1634 Ga0495590_0000143
1635 Ga0495590_0109534
1636 Ga0495591_001766
1637 Ga0495591_003364
1638 Ga0495629_0000309
1639 Ga0495629_0009192
1640 Ga0495629_0016157
1641 Ga0495629_0200043
1642 Ga0495638_0005569
1643 Ga0495638_0054252
1644 Ga0495638_0138239
1645 Ga0495651_0009905
1646 Ga0495651_0015762
1647 Ga0495651_0067759
1648 Ga0495651_0479253
1649 Ga0495653_0000044
1650 Ga0495653_0001283
1651 Ga0495653_0010444
1652 Ga0495653_0030963
1653 Ga0495653_0046652
1654 Ga0495653_0091446
1655 Ga0495653_0126045
1656 Ga0495650_0000082
1657 Ga0495650_0000254
1658 Ga0495650_0001173
1659 Ga0495650_0001749
1660 Ga0495650_0003298
1661 Ga0495650_0004336
1662 Ga0495650_0005780
1663 Ga0495650_0039016
1664 Ga0495580_0007546
1665 Ga0495580_0011457
1666 Ga0495580_0045269
1667 Ga0495580_0055619
1668 Ga0495580_0137598
1669 Ga0495582_0039310
1670 Ga0495605_0000098
1671 Ga0495605_0000102
1672 Ga0495605_0000153
1673 Ga0495605_0014088
1674 Ga0495605_0025625
1675 Ga0495605_0044553
1676 Ga0495605_0050130
1677 Ga0495605_0055414
1678 Ga0495605_0129962
1679 Ga0495639_0090146
1680 Ga0495662_0013868
1681 Ga0495662_0163596
1682 Ga0495584_0000005
1683 Ga0495584_0000232
1684 Ga0495584_0000729
1685 Ga0495584_0008319
1686 Ga0495584_0010267
1687 Ga0495584_0037347
1688 Ga0495584_0045754
1689 Ga0495585_0000023
1690 Ga0495585_0004011
1691 Ga0495585_0004403
1692 Ga0495585_0007615
1693 Ga0495585_0011749
1694 Ga0495585_0011755
1695 Ga0495585_0024181
1696 Ga0495585_0031217
1697 Ga0495585_0041530
1698 Ga0495585_0051302
1699 Ga0495585_0125200
1700 Ga0495585_0129940
1701 Ga0495594_0047218
1702 Ga0495594_0172740
1703 Ga0495596_0002525
1704 Ga0495596_0002817
1705 Ga0495596_0003901
1706 Ga0495596_0005514
1707 Ga0495596_0008285
1708 Ga0495596_0009969
1709 Ga0495596_0014021
1710 Ga0495596_0069983
1711 Ga0495607_0005043
1712 Ga0495607_0012840
1713 Ga0495607_0018756
1714 Ga0495607_0039833
1715 Ga0495607_0046368
1716 Ga0495607_0087055
1717 Ga0495607_0092601
1718 Ga0495583_0000150
1719 Ga0495583_0000597
1720 Ga0495583_0001383
1721 Ga0495583_0001918
1722 Ga0495583_0007069
1723 Ga0495583_0021299
1724 Ga0495583_0023523
1725 Ga0495583_0030505
1726 Ga0495606_0000090
1727 Ga0495606_0000099
1728 Ga0495606_0000524
1729 Ga0495606_0002603
1730 Ga0495606_0002891
1731 Ga0495606_0003267
1732 Ga0495606_0009874
1733 Ga0495606_0015472
1734 Ga0495606_0036555
1735 Ga0495606_0085609
1736 Ga0495608_0024843
1737 Ga0495608_0033895
1738 Ga0495610_0000017
1739 Ga0495610_0000668
1740 Ga0495610_0007137
1741 Ga0495610_0007163
1742 Ga0495610_0017836
1743 Ga0495616_0004647
1744 Ga0495616_0028823
1745 Ga0495616_0031376
1746 Ga0495616_0040079
1747 Ga0495616_0090387
1748 Ga0495618_0018085
1749 Ga0495618_0038016
1750 Ga0495620_0062742
1751 Ga0495620_0207762
1752 Ga0495628_0037325
1753 Ga0495628_0185811
1754 Ga0495628_0484651
1755 Ga0495630_0016484
1756 Ga0495630_0067147
1757 Ga0495630_0104673
1758 Ga0495630_0564455
1759 Ga0495631_0001332
1760 Ga0495631_0001436
1761 Ga0495631_0019040
1762 Ga0495631_0031266
1763 Ga0495631_0061086
1764 Ga0495631_0085211
1765 Ga0495632_0000052
1766 Ga0495632_0001555
1767 Ga0495632_0006741
1768 Ga0495632_0007457
1769 Ga0495632_0012494
1770 Ga0495632_0062533
1771 Ga0495632_0091401
1772 Ga0495637_0000018
1773 Ga0495637_0000195
1774 Ga0495643_0000109
1775 Ga0495643_0000250
1776 Ga0495643_0001163
1777 Ga0495643_0003256
1778 Ga0495643_0009083
1779 Ga0495643_0012298
1780 Ga0495643_0037303
1781 Ga0495644_0001139
1782 Ga0495644_0005133
1783 Ga0495644_0015724
1784 Ga0495644_0031603
1785 Ga0495644_0066258
1786 Ga0495648_0001296
1787 Ga0495648_0001297
1788 Ga0495648_0001425
1789 Ga0495648_0003753
1790 Ga0495648_0006123
1791 Ga0495648_0016758
1792 Ga0495648_0021171
1793 Ga0495648_0115771
1794 Ga0495663_0002215
1795 Ga0495666_0001817
1796 Ga0495666_0015331
1797 Ga0495666_0028531
1798 Ga0495666_0061855
1799 Ga0495666_0079786
1800 Ga0495642_0000529
1801 Ga0495642_0003891
1802 Ga0495642_0021798
1803 Ga0495642_0024066
1804 Ga0495642_0069033
1805 Ga0495652_0019566
1806 Ga0495652_0038115
1807 Ga0495652_0039668
1808 Ga0495654_0000030
1809 Ga0495665_0008461
1810 Ga0495665_0021613
1811 Ga0495640_0022469
1812 Ga0495586_0024085
1813 Ga0495586_0058801
1814 Ga0495586_0088469
1815 Ga0495587_0027154
1816 Ga0495609_0000007
1817 Ga0495609_0002820
1818 Ga0495609_0003952
1819 Ga0495609_0004429
1820 Ga0495609_0004923
1821 Ga0495609_0005405
1822 Ga0495609_0006790
1823 Ga0495609_0033240
1824 Ga0495621_0078893
1825 Ga0495597_0001285
1826 Ga0495597_0001411
1827 Ga0495597_0004502
1828 Ga0495597_0005863
1829 Ga0495597_0013491
1830 Ga0495597_0016066
1831 Ga0495597_0025847
1832 Ga0495597_0028495
1833 Ga0495645_0032325
1834 Ga0495622_0001323
1835 Ga0495622_0002393
1836 Ga0495622_0006213
1837 Ga0495622_0027424
1838 Ga0495633_0000917
1839 Ga0495633_0003343
1840 Ga0495633_0007909
1841 Ga0495633_0008903
1842 Ga0495633_0010820
1843 Ga0495633_0017263
1844 Ga0495633_0018510
1845 Ga0495633_0024206
1846 Ga0495633_0026061
1847 Ga0495633_0031949
1848 Ga0495656_0009431
1849 Ga0495656_0010160
1850 Ga0495668_0000035
1851 Ga0495668_0000211
1852 Ga0495668_0000286
1853 Ga0495668_0000939
1854 Ga0495668_0004452
1855 Ga0495668_0004959
1856 Ga0495668_0028649
1857 Ga0495668_0033106
1858 Ga0495668_0062448
1859 Ga0495668_0138067
1860 Ga0495634_0007428
1861 Ga0495634_0166313
1862 Ga0495634_0212852
1863 Ga0495611_0001030
1864 Ga0495611_0006926
1865 Ga0495611_0011215
1866 Ga0495611_0018089
1867 Ga0495611_0034137
1868 Ga0495611_0087296
1869 Ga0495611_0087994
1870 Ga0495625_0001765
1871 Ga0495625_0011811
1872 Ga0495625_0013440
1873 Ga0495625_0017244
1874 Ga0495625_0168901
1875 Ga0495635_0008609
1876 Ga0495635_0017174
1877 Ga0495659_0002549
1878 Ga0495659_0006857
1879 Ga0495661_0000074
1880 Ga0495661_0004739
1881 Ga0495661_0013502
1882 Ga0495661_0014184
1883 Ga0495661_0014749
1884 Ga0495661_0020025
1885 Ga0495661_0024133
1886 Ga0495661_0037951
1887 Ga0495661_0038019
1888 Ga0495661_0040241
1889 Ga0495661_0040415
1890 Ga0495661_0049980
1891 Ga0495661_0142641
1892 Ga0495661_0156620
1893 Ga0495661_0213376
1894 Ga0495588_0000451
1895 Ga0495588_0014692
1896 Ga0495588_0062365
1897 Ga0495588_0335857
1898 Ga0495657_0056172
1899 Ga0495599_0094584
1900 Ga0495599_0103013
1901 Ga0495623_0012523
1902 Ga0495623_0027099
1903 Ga0495623_0027845
1904 Ga0495623_0046617
1905 Ga0495646_0005966
1906 Ga0495646_0032746
1907 Ga0495658_0140807
1908 Ga0495669_0000101
1909 Ga0495669_0000495
1910 Ga0495669_0001145
1911 Ga0495669_0004673
1912 Ga0495669_0043467
1913 Ga0495613_0061877
1914 Ga0495613_0067028
1915 Ga0495613_0171020
1916 Ga0495624_0003624
1917 Ga0495624_0004359
1918 Ga0495624_0034365
1919 Ga0495624_0063072
1920 Ga0495624_0116779
1921 Ga0495670_0000859
1922 Ga0495670_0011198
1923 Ga0495670_0017486
1924 Ga0495670_0025115
1925 Ga0495670_0040948
1926 Ga0495671_0000605
1927 Ga0495671_0007126
1928 Ga0495671_0031947
1929 Ga0495671_0062914
1930 Ga0495671_0087233
1931 Ga0495671_0107585
1932 Ga0495649_0006762
1933 Ga0495649_0008705
1934 Ga0495649_0008952
1935 Ga0495649_0066219
1936 Ga0495589_0000086
1937 Ga0495589_0000132
1938 Ga0495589_0004038
1939 Ga0495589_0006701
1940 Ga0495589_0008251
1941 Ga0495589_0025964
1942 Ga0495589_0043578
1943 Ga0495589_0057044
1944 Ga0495600_0015355
1945 Ga0495600_0020745
1946 Ga0495600_0036329
1947 Ga0495660_0004409
1948 Ga0495660_0007681
1949 Ga0495660_0008293
1950 Ga0495660_0008498
1951 Ga0495660_0014335
1952 Ga0495660_0024343
1953 Ga0495660_0026896
1954 Ga0495660_0057832
1955 Ga0495660_0069704
1956 Ga0495660_0084017
1957 Ga0495660_0084438
1958 Ga0495581_0022613
1959 Ga0495581_0027614
1960 Ga0495581_0047000
1961 Ga0495581_0204894
1962 Ga0495604_0003813
1963 Ga0495604_0012895
1964 Ga0495604_0018243
1965 Ga0495604_0032878
1966 Ga0495636_0040337
1967 Ga0495674_0011663
1968 Ga0495674_0026818
1969 Ga0495674_0039008
1970 Ga0495674_0053476
1971 Ga0495672_0000013
1972 Ga0495672_0000278
1973 Ga0495672_0001189
1974 Ga0495672_0006089
1975 Ga0495672_0006593
1976 Ga0495672_0007759
1977 Ga0495672_0008561
1978 Ga0495672_0021147
1979 Ga0495672_0096773
1980 Ga0495676_0000015
1981 Ga0495676_0089686
1982 Ga0495676_0110694
1983 Ga0495676_0134159
1984 Ga0495680_0019772
1985 Ga0495680_0070676
1986 Ga0495680_0080980
1987 Ga0495683_0000036
1988 Ga0495683_0003534
1989 Ga0495683_0003640
1990 Ga0495683_0006050
1991 Ga0495683_0006168
1992 Ga0495683_0013934
1993 Ga0495683_0015050
1994 Ga0495683_0019227
1995 Ga0495683_0047196
1996 Ga0495683_0090903
1997 Ga0495687_000038
1998 Ga0495687_000057
1999 Ga0495687_001055
2000 Ga0495687_001122
2001 Ga0495687_007401
2002 Ga0495687_008762
2003 Ga0495687_010094
2004 Ga0495687_017705
2005 Ga0495687_025518
2006 Ga0495687_028152
2007 Ga0495687_113151
2008 Ga0495675_0019161
2009 Ga0495675_0077014
2010 Ga0495675_0091327
2011 Ga0495677_0000004
2012 Ga0495677_0000948
2013 Ga0495677_0005364
2014 Ga0495677_0017287
2015 Ga0495677_0022617
2016 Ga0495679_000271
2017 Ga0495679_001332
2018 Ga0495679_002051
2019 Ga0495679_010678
2020 Ga0495685_000299
2021 Ga0495685_029782
2022 Ga0495685_086303
2023 Ga0495673_0000069
2024 Ga0495673_0000203
2025 Ga0495673_0000236
2026 Ga0495673_0009876
2027 Ga0495673_0013406
2028 Ga0495673_0066045
2029 Ga0495681_0014222
2030 Ga0495681_0031624
2031 Ga0495681_0032950
2032 Ga0495681_0037197
2033 Ga0495681_0081584
2034 Ga0495686_0007873
2035 Ga0495686_0008513
2036 Ga0495686_0035881
2037 Ga0495686_0160983
2038 Ga0495593_0002329
2039 Ga0495593_0008400
2040 Ga0495593_0049839
2041 Ga0495602_0018389
2042 Ga0495602_0026740
2043 Ga0495602_0039345
2044 Ga0495602_0102875
2045 Ga0495614_0009542
2046 Ga0495614_0020278
2047 Ga0495614_0022236
2048 Ga0495615_0003471
2049 Ga0495626_0000048
2050 Ga0495626_0000279
2051 Ga0495626_0000998
2052 Ga0495626_0001757
2053 Ga0495626_0007693
2054 Ga0495626_0008828
2055 Ga0495626_0009702
2056 Ga0495626_0010181
2057 Ga0495626_0027137
2058 Ga0496100_0033511
2059 Ga0496100_0175340
2060 Ga0496101_0045775
2061 Ga0496101_0251187
2062 Ga0496101_0320679
2063 Ga0496102_0000478
2064 Ga0496102_0007956
2065 Ga0496102_0008640
2066 Ga0496102_0017344
2067 Ga0496102_0165543
2068 Ga0496102_0291127
2069 Ga0496103_0017663
2070 Ga0496103_0083968
2071 Ga0496103_0092200
2072 Ga0496106_0055391
2073 Ga0496109_0035631
2074 Ga0496109_0133006
2075 Ga0496109_0286482
2076 Ga0496110_0000092
2077 Ga0496110_0148346
2078 Ga0496110_0527297
2079 Ga0496111_0267910
2080 Ga0496111_0504127
2081 Ga0496114_0007265
2082 Ga0496114_0068845
2083 Ga0496114_0072052
2084 Ga0496115_0019582
2085 Ga0496115_0125816
2086 Ga0496115_0526259
2087 Ga0496116_0051271
2088 Ga0496117_0000005
2089 Ga0496117_0031619
2090 Ga0496117_0074896
2091 Ga0496118_0000031
2092 Ga0496118_0011234
2093 Ga0496118_0040491
2094 Ga0496121_0028888
2095 Ga0496121_0034811
2096 Ga0496121_0038335
2097 Ga0496122_0003525
2098 Ga0496123_0000084
2099 Ga0496123_0003683
2100 Ga0496124_0010436
2101 Ga0496124_0017631
2102 Ga0496124_0023504
2103 Ga0496124_0075273
2104 Ga0496124_0314938
2105 Ga0496125_0000368
2106 Ga0496125_0015656
2107 Ga0496125_0022691
2108 Ga0496125_0356719
2109 Ga0495678_000010
2110 Ga0495678_000034
2111 Ga0495678_000383
2112 Ga0495678_001376
2113 Ga0495678_004680
2114 Ga0495678_009666
2115 Ga0495682_0008734
2116 Ga0495682_0023768
2117 Ga0495682_0035992
2118 Ga0495682_0042554
2119 Ga0501313_011247
2120 Ga0501031_0007227
2121 Ga0501031_0023720
2122 Ga0501031_0047236
2123 Ga0501031_0083405
2124 Ga0501031_0233715
2125 Ga0501032_0000993
2126 Ga0501032_0003737
2127 Ga0501032_0008533
2128 Ga0501032_0009695
2129 Ga0501032_0010759
2130 Ga0501033_0001281
2131 Ga0501033_0003589
2132 Ga0501033_0094590
2133 Ga0501033_0097761
2134 Ga0501034_0010675
2135 Ga0501034_0047250
2136 Ga0501036_0004255
2137 Ga0501036_0007404
2138 Ga0501036_0023088
2139 Ga0501036_0041052
2140 Ga0501036_0532592
2141 Ga0501037_0018199
2142 Ga0501037_0152888
2143 Ga0501038_0003012
2144 Ga0501038_0014124
2145 Ga0501038_0021009
2146 Ga0501038_0022730
2147 Ga0501038_0048365
2148 Ga0501038_0064086
2149 Ga0501038_0245046
2150 Ga0501039_0070245
2151 Ga0501039_0194977
2152 Ga0501039_0205027
2153 Ga0501040_0009384
2154 Ga0501040_0036297
2155 Ga0501041_0064783
2156 Ga0501042_0095513
2157 Ga0501043_0001204
2158 Ga0501043_0003787
2159 Ga0501043_0006411
2160 Ga0501043_0074970
2161 Ga0501043_0099085
2162 Ga0501046_0000851
2163 Ga0501046_0010292
2164 Ga0501046_0025411
2165 Ga0501047_0009059
2166 Ga0501047_0013028
2167 Ga0501047_0118332
2168 Ga0501048_0006174
2169 Ga0501048_0031474
2170 Ga0501048_0511305
2171 Ga0501068_0007808
2172 Ga0501069_0333703
2173 Ga0501071_0159016
2174 Ga0501076_0099498
2175 Ga0501077_0296754
2176 Ga0501083_0190954
2177 Ga0501269_000473
2178 Ga0501035_0000450
2179 Ga0501035_0001403
2180 Ga0501035_0006010
2181 Ga0501035_0039300
2182 Ga0501035_0094400
2183 Ga0501044_0000068
2184 Ga0501044_0002232
2185 Ga0501044_0003674
2186 Ga0501044_0069533
2187 Ga0501044_0151081
2188 Ga0501044_0411021
2189 Ga0501044_0479769
2190 Ga0501045_0038488
2191 Ga0501045_0084777
2192 Ga0501045_0085123
2193 nmdc:mga05p37_379775_c1
2194 nmdc:mga06r32_493829_c1
2195 nmdc:mga08y16_26878_c1
2196 nmdc:mga08y16_41626_c1
2197 nmdc:mga0rr50_21481_c1
2198 nmdc:mga0a205_245298_c1
2199 Ga0495601_0022528
2200 Ga0495595_0068653
2201 Ga0495619_0083858
2202 Ga0495619_0195917
2203 Ga0495619_0526661
2204 Ga0500618_000653
2205 Ga0500574_000047
2206 Ga0500619_001638
2207 Ga0587084_000383
2208 Ga0587066_022305
2209 Ga0587080_001172
2210 Ga0587082_041449
2211 Ga0587090_012266
2212 Ga0587067_006197
2213 Ga0587068_000998
2214 Ga0587068_018470
2215 Ga0587069_024441
2216 Ga0587078_010017
2217 Ga0587079_020003
2218 Ga0587111_0030375
2219 Ga0501082_0397025
2220 Ga0466962_0018529
2221 2509130720
2222 2511250319
2223 2511387575
2224 2513962723
2225 2521559825
2226 2550693198
2227 2553007041
2228 2601672280
2229 2643791751
2230 2643796626
2231 2644027062
2232 2644216770
2233 2644254520
2234 2644360067
2235 2644472748
2236 2678229772
2237 2723879546
2238 2738742908
2239 2738827059
2240 2738845996
2241 2739150856
2242 2739192775
2243 2739276904
2244 2739319252
2245 2739337493
2246 2739345948
2247 2746087352
2248 2746093141
2249 2765571081
2250 2808984989
2251 2809130121
2252 2809145546
2253 2809150402
2254 2819544513
2255 2819594072
2256 2819618266
2257 2821136479
2258 2828308164
2259 2839096677
2260 2842713688
2261 2846036739
2262 2846042157
2263 2852621374
2264 2857549311
2265 2857558528
2266 2857562343
2267 2857568296
2268 2884815177
2269 2884839899
2270 2884856290
2271 2885081343
2272 2896158655
2273 2900637200
2274 2904428561
2275 2904444391
2276 2904490244
2277 2904535544
2278 2904588116
2279 2904595152
2280 2904606065
2281 2916182549
2282 2919051309
2283 2919084263
2284 2919477228
2285 2919533414
2286 2923513592
2287 2928135291
2288 2932416365
2289 2932422242
2290 642623073
2291 8047675699
2292 8055307286

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

53

250

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9566 4 219
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9548 5 219
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9532 4 219
7u5y-assembly1.cif.gz_E crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa 0.949 1 219
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9464 4 218
ID Description Score Start End Superfamily
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9593 1 220 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9551 1 220 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9465 3 220 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9441 4 219 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9381 3 220 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6M1CNY9-F1-model_v4 deleted 0.9841 55 219
AF-A0A661INI8-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9788 56 218 GO:0005975
GO:0016857
AF-A0A7C2L3C1-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9631 50 218 GO:0005975
GO:0016857
AF-A0A376PPY3-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9627 1 220 GO:0004750
GO:0006098
GO:0006298
GO:0009007
GO:0009307
GO:0019323
GO:0032259
GO:0043565
GO:0046872
GO:1904047
AF-A0A3C0I162-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9622 1 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Map