F490793
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1146 | 486 | 2292 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10006687|Ga0105244_100066877 |
| Length | 269 |
| Sequence | MASLAIVYRQASIAPQIRPLCKDGAAENGRRQPEQRKIAHLFYCKPTAMTTYRIAPSILSADFARLGEEVRNVVSAGADIIRFDVMDNHYVPNLTIGPLVCQAIRPHVDVPIDVHLMVKPVDRIIPDFAKAGANIITFHPEASDHIDRSLSLIRDHGCKAGLVFNPATPLSYLEHVMDKVDMILIMSVNPGFGGQSFIPQALKKIAEARRLIDESGRDILLEVDGGIKIDNIAAAAAAGADTFVAGSAIFGQPDYKAVIDAMRANLAKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 36 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 79 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 193 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 194 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 198 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 231 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 234 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 235 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 236 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 401 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 402 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 416 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 417 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 418 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 419 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 420 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 421 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 422 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 423 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 424 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 425 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 426 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 427 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 428 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 429 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 430 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 431 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 432 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 433 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 434 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 435 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 436 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 437 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 438 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 439 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 440 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 441 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 442 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 443 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 444 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 445 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 446 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 447 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 448 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 449 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 450 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 451 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 452 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 453 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 454 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 455 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 456 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 457 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 458 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 459 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 460 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 461 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 462 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 463 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 464 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 465 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 466 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 467 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 468 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 469 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 470 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 471 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 472 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 473 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 474 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 475 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 476 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 477 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 478 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 479 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 480 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 481 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 482 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 483 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 484 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 485 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 486 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.8 |
| Metatranscriptomes | 1.92 |
| Isolates | 6.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.3 |
| Nodule | 0.87 |
| Rhizoplane | 2.62 |
| Rhizosphere | 76.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10006687 | 3300009036 | Bacteria | 7422 |
| 2 | JGI25155J39150_1000864 | 3300002704 | Bacteria | 4425 |
| 3 | JGI25156J39149_1008946 | 3300002705 | Bacteria | 2476 |
| 4 | JGI25162J39368_1004179 | 3300002737 | Bacteria | 3516 |
| 5 | JGI25162J39368_1013055 | 3300002737 | Bacteria | 930 |
| 6 | JGI25154J39366_1000845 | 3300002738 | Bacteria | 13292 |
| 7 | JGI25158J39367_1000818 | 3300002739 | Bacteria | 5933 |
| 8 | JGI25158J39367_1008485 | 3300002739 | Bacteria | 1427 |
| 9 | JGI25158J39367_1024630 | 3300002739 | Bacteria | 712 |
| 10 | JGI25157J39369_1000372 | 3300002741 | Bacteria | 30863 |
| 11 | JGI25152J39213_1001993 | 3300002773 | Bacteria | 8063 |
| 12 | JGI25152J39213_1009823 | 3300002773 | Bacteria | 2238 |
| 13 | JGI25150J39212_1000910 | 3300002774 | Bacteria | 9622 |
| 14 | JGI25150J39212_1001503 | 3300002774 | Bacteria | 6441 |
| 15 | JGI25159J45721_1005724 | 3300002987 | Bacteria | 3849 |
| 16 | JGI25159J45721_1007426 | 3300002987 | Bacteria | 3145 |
| 17 | JGI25159J45721_1015531 | 3300002987 | Bacteria | 1663 |
| 18 | JGI25165J46597_1000713 | 3300003214 | Bacteria | 26161 |
| 19 | JGI25165J46597_1001348 | 3300003214 | Bacteria | 13684 |
| 20 | JGI25153J46596_10004223 | 3300003215 | Bacteria | 7781 |
| 21 | JGI25160J50197_1003453 | 3300003354 | Bacteria | 7072 |
| 22 | JGI25161J50226_1007576 | 3300003374 | Bacteria | 1797 |
| 23 | Ga0007409J51694_1012308 | 3300003575 | Bacteria | 1879 |
| 24 | Ga0007416J51690_1027150 | 3300003577 | Bacteria | 969 |
| 25 | Ga0032354_1062149 | 3300003693 | Bacteria | 1766 |
| 26 | Ga0055538_1000062 | 3300003751 | Bacteria | 105260 |
| 27 | Ga0055538_1000281 | 3300003751 | Bacteria | 26161 |
| 28 | Ga0055539_1000093 | 3300003752 | Bacteria | 105260 |
| 29 | Ga0055539_1000305 | 3300003752 | Bacteria | 26161 |
| 30 | Ga0055533_1000105 | 3300003756 | Bacteria | 105260 |
| 31 | Ga0055533_1000286 | 3300003756 | Bacteria | 26161 |
| 32 | Ga0055533_1000737 | 3300003756 | Bacteria | 10552 |
| 33 | Ga0055533_1002031 | 3300003756 | Bacteria | 4911 |
| 34 | Ga0055532_1000034 | 3300003758 | Bacteria | 210984 |
| 35 | Ga0055532_1000092 | 3300003758 | Bacteria | 103243 |
| 36 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 37 | Ga0055525_1000137 | 3300003759 | Bacteria | 105260 |
| 38 | Ga0055525_1000405 | 3300003759 | Bacteria | 26891 |
| 39 | Ga0055527_1000035 | 3300003760 | Bacteria | 138481 |
| 40 | Ga0055535_1000050 | 3300003761 | Bacteria | 138481 |
| 41 | Ga0055535_1013520 | 3300003761 | Bacteria | 1201 |
| 42 | Ga0055542_1000120 | 3300003762 | Bacteria | 103243 |
| 43 | Ga0055529_1000089 | 3300003763 | Bacteria | 138481 |
| 44 | Ga0055529_1000152 | 3300003763 | Bacteria | 98133 |
| 45 | Ga0055526_1001033 | 3300003771 | Bacteria | 20365 |
| 46 | Ga0055526_1003235 | 3300003771 | Bacteria | 10491 |
| 47 | Ga0055526_1004446 | 3300003771 | Bacteria | 8418 |
| 48 | Ga0055526_1005708 | 3300003771 | Bacteria | 7051 |
| 49 | Ga0055526_1007871 | 3300003771 | Bacteria | 5440 |
| 50 | Ga0055537_1000580 | 3300003773 | Bacteria | 20336 |
| 51 | Ga0055537_1012740 | 3300003773 | Bacteria | 1621 |
| 52 | Ga0055524_1000899 | 3300003775 | Bacteria | 19266 |
| 53 | Ga0055524_1002755 | 3300003775 | Bacteria | 8837 |
| 54 | Ga0055524_1003183 | 3300003775 | Bacteria | 8063 |
| 55 | Ga0055524_1003663 | 3300003775 | Bacteria | 7366 |
| 56 | Ga0055524_1008827 | 3300003775 | Bacteria | 4153 |
| 57 | Ga0055524_1010041 | 3300003775 | Bacteria | 3798 |
| 58 | Ga0055524_1011926 | 3300003775 | Bacteria | 3364 |
| 59 | Ga0055534_1000283 | 3300003784 | Bacteria | 34520 |
| 60 | Ga0055534_1005190 | 3300003784 | Bacteria | 3562 |
| 61 | Ga0055534_1022725 | 3300003784 | Bacteria | 1034 |
| 62 | Ga0055528_1000495 | 3300003790 | Bacteria | 31111 |
| 63 | Ga0055528_1006705 | 3300003790 | Bacteria | 5191 |
| 64 | Ga0055530_10003928 | 3300003791 | Bacteria | 8047 |
| 65 | Ga0055530_10008706 | 3300003791 | Bacteria | 4016 |
| 66 | Ga0055530_10019894 | 3300003791 | Bacteria | 2022 |
| 67 | Ga0055531_10021682 | 3300003794 | Bacteria | 2481 |
| 68 | Ga0055531_10041167 | 3300003794 | Bacteria | 1342 |
| 69 | Ga0055541_1000063 | 3300003841 | Bacteria | 105260 |
| 70 | Ga0055541_1000198 | 3300003841 | Bacteria | 26161 |
| 71 | Ga0058692_1000027 | 3300003856 | Bacteria | 198745 |
| 72 | Ga0055543_1002300 | 3300004625 | Bacteria | 6432 |
| 73 | Ga0055543_1010334 | 3300004625 | Bacteria | 1961 |
| 74 | Ga0065165_1002857 | 3300005262 | Bacteria | 13394 |
| 75 | Ga0065165_1004075 | 3300005262 | Bacteria | 9468 |
| 76 | Ga0065165_1006132 | 3300005262 | Bacteria | 6432 |
| 77 | Ga0065165_1013870 | 3300005262 | Bacteria | 3168 |
| 78 | Ga0065165_1041906 | 3300005262 | Bacteria | 1355 |
| 79 | Ga0065703_1000515 | 3300005272 | Bacteria | 19094 |
| 80 | Ga0065714_10127055 | 3300005288 | Bacteria | 1246 |
| 81 | Ga0070683_100267191 | 3300005329 | Bacteria | 1627 |
| 82 | Ga0070670_100599001 | 3300005331 | Bacteria | 986 |
| 83 | Ga0070680_100334382 | 3300005336 | Bacteria | 1287 |
| 84 | Ga0070680_100437688 | 3300005336 | Bacteria | 1116 |
| 85 | Ga0070682_100022524 | 3300005337 | Bacteria | 3733 |
| 86 | Ga0070660_100022139 | 3300005339 | Bacteria | 4696 |
| 87 | Ga0070660_100044408 | 3300005339 | Bacteria | 3399 |
| 88 | Ga0070661_100025891 | 3300005344 | Bacteria | 4216 |
| 89 | Ga0070668_100419691 | 3300005347 | Bacteria | 1145 |
| 90 | Ga0070669_100003722 | 3300005353 | Bacteria | 11007 |
| 91 | Ga0070675_100605379 | 3300005354 | Bacteria | 994 |
| 92 | Ga0070674_100830540 | 3300005356 | Bacteria | 800 |
| 93 | Ga0070659_100001752 | 3300005366 | Bacteria | 15587 |
| 94 | Ga0070659_100676594 | 3300005366 | Bacteria | 891 |
| 95 | Ga0070667_100131493 | 3300005367 | Bacteria | 2185 |
| 96 | Ga0070714_100012283 | 3300005435 | Bacteria | 6833 |
| 97 | Ga0070663_100011336 | 3300005455 | Bacteria | 5592 |
| 98 | Ga0070663_100043195 | 3300005455 | Bacteria | 3171 |
| 99 | Ga0070663_100205529 | 3300005455 | Bacteria | 1539 |
| 100 | Ga0070663_100741381 | 3300005455 | Bacteria | 838 |
| 101 | Ga0070662_100036858 | 3300005457 | Bacteria | 3463 |
| 102 | Ga0070662_100133362 | 3300005457 | Bacteria | 1918 |
| 103 | Ga0070681_10467082 | 3300005458 | Bacteria | 1174 |
| 104 | Ga0070706_100042249 | 3300005467 | Bacteria | 4211 |
| 105 | Ga0070706_100074408 | 3300005467 | Bacteria | 3144 |
| 106 | Ga0070707_100252943 | 3300005468 | Bacteria | 1715 |
| 107 | Ga0070699_100795151 | 3300005518 | Bacteria | 866 |
| 108 | Ga0070679_100087655 | 3300005530 | Bacteria | 3100 |
| 109 | Ga0070684_100840667 | 3300005535 | Bacteria | 859 |
| 110 | Ga0070697_100055245 | 3300005536 | Bacteria | 3228 |
| 111 | Ga0070697_100064585 | 3300005536 | Bacteria | 2989 |
| 112 | Ga0070697_100084697 | 3300005536 | Bacteria | 2614 |
| 113 | Ga0068853_100127886 | 3300005539 | Bacteria | 2271 |
| 114 | Ga0070695_100010846 | 3300005545 | Bacteria | 5443 |
| 115 | Ga0070696_100389706 | 3300005546 | Bacteria | 1088 |
| 116 | Ga0070665_100016024 | 3300005548 | Bacteria | 7524 |
| 117 | Ga0070704_100322552 | 3300005549 | Bacteria | 1295 |
| 118 | Ga0068855_100025280 | 3300005563 | Bacteria | 7108 |
| 119 | Ga0068855_100035272 | 3300005563 | Bacteria | 5958 |
| 120 | Ga0068855_100365494 | 3300005563 | Bacteria | 1587 |
| 121 | Ga0068855_100459419 | 3300005563 | Bacteria | 1389 |
| 122 | Ga0068854_100007632 | 3300005578 | Bacteria | 6921 |
| 123 | Ga0068856_100165342 | 3300005614 | Bacteria | 2224 |
| 124 | Ga0068856_100438406 | 3300005614 | Bacteria | 1327 |
| 125 | Ga0068852_100004237 | 3300005616 | Bacteria | 10127 |
| 126 | Ga0068859_100137698 | 3300005617 | Bacteria | 2515 |
| 127 | Ga0068863_100349786 | 3300005841 | Bacteria | 1439 |
| 128 | Ga0068860_100028951 | 3300005843 | Bacteria | 5329 |
| 129 | Ga0068860_100205246 | 3300005843 | Bacteria | 1911 |
| 130 | Ga0070717_10119390 | 3300006028 | Bacteria | 2257 |
| 131 | Ga0070717_10186186 | 3300006028 | Bacteria | 1812 |
| 132 | Ga0070717_10963357 | 3300006028 | Bacteria | 777 |
| 133 | Ga0070712_100003531 | 3300006175 | Bacteria | 9625 |
| 134 | Ga0075434_100013297 | 3300006871 | Bacteria | 7827 |
| 135 | Ga0097620_100137704 | 3300006931 | Bacteria | 2515 |
| 136 | Ga0079104_1013403 | 3300006946 | Bacteria | 2526 |
| 137 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 138 | Ga0075435_100025552 | 3300007076 | Bacteria | 4598 |
| 139 | Ga0105244_10002041 | 3300009036 | Bacteria | 15556 |
| 140 | Ga0105244_10029464 | 3300009036 | Bacteria | 2933 |
| 141 | Ga0105244_10065752 | 3300009036 | Bacteria | 1816 |
| 142 | Ga0105244_10099021 | 3300009036 | Bacteria | 1427 |
| 143 | Ga0105240_10001608 | 3300009093 | Bacteria | 38292 |
| 144 | Ga0105240_10007637 | 3300009093 | Bacteria | 15663 |
| 145 | Ga0105240_10016336 | 3300009093 | Bacteria | 10052 |
| 146 | Ga0105240_10038235 | 3300009093 | Bacteria | 6157 |
| 147 | Ga0105240_10070890 | 3300009093 | Bacteria | 4310 |
| 148 | Ga0105240_10146806 | 3300009093 | Bacteria | 2814 |
| 149 | Ga0111539_10029979 | 3300009094 | Bacteria | 6617 |
| 150 | Ga0111539_10124601 | 3300009094 | Bacteria | 3020 |
| 151 | Ga0105245_10711439 | 3300009098 | Bacteria | 1038 |
| 152 | Ga0105247_10003833 | 3300009101 | Bacteria | 9729 |
| 153 | Ga0114129_10241688 | 3300009147 | Bacteria | 2427 |
| 154 | Ga0105243_10000343 | 3300009148 | Bacteria | 50175 |
| 155 | Ga0105243_10280106 | 3300009148 | Bacteria | 1501 |
| 156 | Ga0105241_10603550 | 3300009174 | Bacteria | 992 |
| 157 | Ga0105242_10046831 | 3300009176 | Bacteria | 3510 |
| 158 | Ga0105237_10034417 | 3300009545 | Bacteria | 5130 |
| 159 | Ga0105237_10099866 | 3300009545 | Bacteria | 2893 |
| 160 | Ga0105238_10000763 | 3300009551 | Bacteria | 33477 |
| 161 | Ga0105238_10183076 | 3300009551 | Bacteria | 2071 |
| 162 | Ga0105249_10719777 | 3300009553 | Bacteria | 1059 |
| 163 | Ga0105239_10010387 | 3300010375 | Bacteria | 10421 |
| 164 | Ga0105239_10328870 | 3300010375 | Bacteria | 1724 |
| 165 | Ga0105246_10178491 | 3300011119 | Bacteria | 1633 |
| 166 | Ga0157371_10000018 | 3300013102 | Bacteria | 310522 |
| 167 | Ga0157370_10247198 | 3300013104 | Bacteria | 1650 |
| 168 | Ga0157370_10653786 | 3300013104 | Bacteria | 961 |
| 169 | Ga0157374_10202904 | 3300013296 | Bacteria | 1942 |
| 170 | Ga0157374_10213758 | 3300013296 | Bacteria | 1891 |
| 171 | Ga0157378_10271726 | 3300013297 | Bacteria | 1630 |
| 172 | Ga0157378_10399506 | 3300013297 | Bacteria | 1354 |
| 173 | Ga0163162_10154463 | 3300013306 | Bacteria | 2414 |
| 174 | Ga0163163_10095925 | 3300014325 | Bacteria | 2986 |
| 175 | Ga0163163_10344627 | 3300014325 | Bacteria | 1545 |
| 176 | Ga0182008_10003605 | 3300014497 | Bacteria | 9271 |
| 177 | Ga0182008_10022601 | 3300014497 | Bacteria | 3220 |
| 178 | Ga0182008_10054820 | 3300014497 | Bacteria | 1972 |
| 179 | Ga0182006_1000033 | 3300015261 | Bacteria | 238180 |
| 180 | Ga0182006_1000080 | 3300015261 | Bacteria | 122163 |
| 181 | Ga0182006_1005060 | 3300015261 | Bacteria | 6338 |
| 182 | Ga0182006_1012892 | 3300015261 | Bacteria | 3648 |
| 183 | Ga0182006_1082631 | 3300015261 | Bacteria | 1169 |
| 184 | Ga0182007_10000042 | 3300015262 | Bacteria | 111840 |
| 185 | Ga0182007_10003815 | 3300015262 | Bacteria | 7019 |
| 186 | Ga0182007_10006803 | 3300015262 | Bacteria | 4866 |
| 187 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 188 | Ga0182005_1000024 | 3300015265 | Bacteria | 238256 |
| 189 | Ga0182005_1001434 | 3300015265 | Bacteria | 9601 |
| 190 | Ga0163161_10012023 | 3300017792 | Bacteria | 6004 |
| 191 | Ga0163161_10056209 | 3300017792 | Bacteria | 2858 |
| 192 | Ga0163161_10095458 | 3300017792 | Bacteria | 2206 |
| 193 | Ga0197907_10734725 | 3300020069 | Bacteria | 1446 |
| 194 | Ga0206355_1336031 | 3300020076 | Bacteria | 1834 |
| 195 | Ga0206350_11154362 | 3300020080 | Bacteria | 4713 |
| 196 | Ga0206354_10998826 | 3300020081 | Bacteria | 1461 |
| 197 | Ga0206353_10779650 | 3300020082 | Bacteria | 1651 |
| 198 | Ga0213872_10000430 | 3300021361 | Bacteria | 34377 |
| 199 | Ga0213872_10004434 | 3300021361 | Bacteria | 7457 |
| 200 | Ga0213872_10004797 | 3300021361 | Bacteria | 7060 |
| 201 | Ga0213872_10011815 | 3300021361 | Bacteria | 4126 |
| 202 | Ga0213872_10128204 | 3300021361 | Bacteria | 1119 |
| 203 | Ga0224712_10003485 | 3300022467 | Bacteria | 4098 |
| 204 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 205 | Ga0209436_101663 | 3300025208 | Bacteria | 7403 |
| 206 | Ga0209436_102178 | 3300025208 | Bacteria | 6116 |
| 207 | Ga0209436_104811 | 3300025208 | Bacteria | 3247 |
| 208 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 209 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 210 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 211 | Ga0209566_100119 | 3300025225 | Bacteria | 105312 |
| 212 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 213 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 214 | Ga0209674_100259 | 3300025226 | Bacteria | 42956 |
| 215 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 216 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 217 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 218 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 219 | Ga0207427_100759 | 3300025231 | Bacteria | 14690 |
| 220 | Ga0207427_100936 | 3300025231 | Bacteria | 12429 |
| 221 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 222 | Ga0209437_100332 | 3300025233 | Bacteria | 58796 |
| 223 | Ga0209437_105500 | 3300025233 | Bacteria | 2154 |
| 224 | Ga0209258_101277 | 3300025242 | Bacteria | 9457 |
| 225 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 226 | Ga0207425_1000829 | 3300025245 | Bacteria | 15420 |
| 227 | Ga0207425_1001943 | 3300025245 | Bacteria | 7781 |
| 228 | Ga0207425_1018992 | 3300025245 | Bacteria | 1486 |
| 229 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 230 | Ga0209646_1000107 | 3300025246 | Bacteria | 163112 |
| 231 | Ga0209646_1000190 | 3300025246 | Bacteria | 75772 |
| 232 | Ga0209026_1000063 | 3300025250 | Bacteria | 211324 |
| 233 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 234 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 235 | Ga0209677_101699 | 3300025253 | Bacteria | 9186 |
| 236 | Ga0209148_1000237 | 3300025254 | Bacteria | 88748 |
| 237 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 238 | Ga0209759_1000195 | 3300025256 | Bacteria | 96092 |
| 239 | Ga0209759_1000351 | 3300025256 | Bacteria | 59891 |
| 240 | Ga0209759_1003045 | 3300025256 | Bacteria | 6904 |
| 241 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 242 | Ga0209129_1014565 | 3300025258 | Bacteria | 1669 |
| 243 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 244 | Ga0209233_1000173 | 3300025261 | Bacteria | 145995 |
| 245 | Ga0209565_1000055 | 3300025263 | Bacteria | 201184 |
| 246 | Ga0209565_1000677 | 3300025263 | Bacteria | 21295 |
| 247 | Ga0209565_1002957 | 3300025263 | Bacteria | 5775 |
| 248 | Ga0209565_1003264 | 3300025263 | Bacteria | 5342 |
| 249 | Ga0209565_1010498 | 3300025263 | Bacteria | 2293 |
| 250 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 251 | Ga0209455_1004771 | 3300025272 | Bacteria | 4345 |
| 252 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 253 | Ga0209673_1003338 | 3300025273 | Bacteria | 9600 |
| 254 | Ga0209673_1053678 | 3300025273 | Bacteria | 1049 |
| 255 | Ga0209130_1000169 | 3300025284 | Bacteria | 95167 |
| 256 | Ga0209130_1002260 | 3300025284 | Bacteria | 9942 |
| 257 | Ga0209130_1003537 | 3300025284 | Bacteria | 6551 |
| 258 | Ga0209675_1000052 | 3300025291 | Bacteria | 201332 |
| 259 | Ga0209675_1007962 | 3300025291 | Bacteria | 3965 |
| 260 | Ga0209675_1008529 | 3300025291 | Bacteria | 3752 |
| 261 | Ga0209025_1001876 | 3300025294 | Bacteria | 24626 |
| 262 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 263 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 264 | Ga0209564_1000063 | 3300025295 | Bacteria | 318515 |
| 265 | Ga0209564_1000271 | 3300025295 | Bacteria | 108422 |
| 266 | Ga0209564_1001666 | 3300025295 | Bacteria | 21297 |
| 267 | Ga0209564_1022873 | 3300025295 | Bacteria | 2191 |
| 268 | Ga0209758_1000288 | 3300025297 | Bacteria | 99096 |
| 269 | Ga0209758_1000436 | 3300025297 | Bacteria | 70342 |
| 270 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 271 | Ga0209050_1005131 | 3300025298 | Bacteria | 8406 |
| 272 | Ga0209050_1006673 | 3300025298 | Bacteria | 6755 |
| 273 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 274 | Ga0209256_1000100 | 3300025299 | Bacteria | 201246 |
| 275 | Ga0209256_1000754 | 3300025299 | Bacteria | 42096 |
| 276 | Ga0209256_1004828 | 3300025299 | Bacteria | 8169 |
| 277 | Ga0209256_1005964 | 3300025299 | Bacteria | 6697 |
| 278 | Ga0207426_1003112 | 3300025302 | Bacteria | 9466 |
| 279 | Ga0207426_1036654 | 3300025302 | Bacteria | 1557 |
| 280 | Ga0209257_1006073 | 3300025304 | Bacteria | 8031 |
| 281 | Ga0209257_1009189 | 3300025304 | Bacteria | 5370 |
| 282 | Ga0207696_1021563 | 3300025711 | Bacteria | 2061 |
| 283 | Ga0207655_1001604 | 3300025728 | Bacteria | 20191 |
| 284 | Ga0207655_1001651 | 3300025728 | Bacteria | 19767 |
| 285 | Ga0207655_1004763 | 3300025728 | Bacteria | 9466 |
| 286 | Ga0207713_1002759 | 3300025735 | Bacteria | 12446 |
| 287 | Ga0207713_1002761 | 3300025735 | Bacteria | 12439 |
| 288 | Ga0207710_10000057 | 3300025900 | Bacteria | 177544 |
| 289 | Ga0207705_10009748 | 3300025909 | Bacteria | 6988 |
| 290 | Ga0207705_10121345 | 3300025909 | Bacteria | 1940 |
| 291 | Ga0207684_10025468 | 3300025910 | Bacteria | 5041 |
| 292 | Ga0207684_10103272 | 3300025910 | Bacteria | 2437 |
| 293 | Ga0207654_10112395 | 3300025911 | Bacteria | 1697 |
| 294 | Ga0207654_10146993 | 3300025911 | Bacteria | 1509 |
| 295 | Ga0207707_10070128 | 3300025912 | Bacteria | 3054 |
| 296 | Ga0207695_10007667 | 3300025913 | Bacteria | 13670 |
| 297 | Ga0207695_10008939 | 3300025913 | Bacteria | 12470 |
| 298 | Ga0207695_10012318 | 3300025913 | Bacteria | 10275 |
| 299 | Ga0207695_10060948 | 3300025913 | Bacteria | 3902 |
| 300 | Ga0207695_10100367 | 3300025913 | Bacteria | 2890 |
| 301 | Ga0207695_10135206 | 3300025913 | Bacteria | 2419 |
| 302 | Ga0207695_10209182 | 3300025913 | Bacteria | 1862 |
| 303 | Ga0207695_10393672 | 3300025913 | Bacteria | 1270 |
| 304 | Ga0207671_10004652 | 3300025914 | Bacteria | 12996 |
| 305 | Ga0207671_10069660 | 3300025914 | Bacteria | 2621 |
| 306 | Ga0207660_10317649 | 3300025917 | Bacteria | 1243 |
| 307 | Ga0207657_10012688 | 3300025919 | Bacteria | 8304 |
| 308 | Ga0207657_10027581 | 3300025919 | Bacteria | 5200 |
| 309 | Ga0207649_10009529 | 3300025920 | Bacteria | 5316 |
| 310 | Ga0207652_10454486 | 3300025921 | Bacteria | 1154 |
| 311 | Ga0207646_10014703 | 3300025922 | Bacteria | 7415 |
| 312 | Ga0207681_10002504 | 3300025923 | Bacteria | 11673 |
| 313 | Ga0207694_10013544 | 3300025924 | Bacteria | 6144 |
| 314 | Ga0207650_10046359 | 3300025925 | Bacteria | 3201 |
| 315 | Ga0207650_10262264 | 3300025925 | Bacteria | 1402 |
| 316 | Ga0207687_10042299 | 3300025927 | Bacteria | 3133 |
| 317 | Ga0207700_10078045 | 3300025928 | Bacteria | 2574 |
| 318 | Ga0207664_10023812 | 3300025929 | Bacteria | 4594 |
| 319 | Ga0207690_10000951 | 3300025932 | Bacteria | 18563 |
| 320 | Ga0207690_10013294 | 3300025932 | Bacteria | 4944 |
| 321 | Ga0207690_10214873 | 3300025932 | Bacteria | 1468 |
| 322 | Ga0207706_10110175 | 3300025933 | Bacteria | 2422 |
| 323 | Ga0207706_10111892 | 3300025933 | Bacteria | 2402 |
| 324 | Ga0207686_10034904 | 3300025934 | Bacteria | 3014 |
| 325 | Ga0207709_10000057 | 3300025935 | Bacteria | 216617 |
| 326 | Ga0207709_10277379 | 3300025935 | Bacteria | 1237 |
| 327 | Ga0207661_10557896 | 3300025944 | Bacteria | 1050 |
| 328 | Ga0207679_10010560 | 3300025945 | Bacteria | 5952 |
| 329 | Ga0207667_10000912 | 3300025949 | Bacteria | 37632 |
| 330 | Ga0207667_10020489 | 3300025949 | Bacteria | 7353 |
| 331 | Ga0207667_10145306 | 3300025949 | Bacteria | 2441 |
| 332 | Ga0207667_10502785 | 3300025949 | Bacteria | 1229 |
| 333 | Ga0207668_10035510 | 3300025972 | Bacteria | 3320 |
| 334 | Ga0207668_10270570 | 3300025972 | Bacteria | 1389 |
| 335 | Ga0207640_10064502 | 3300025981 | Bacteria | 2439 |
| 336 | Ga0207658_10028565 | 3300025986 | Bacteria | 3929 |
| 337 | Ga0207703_10052391 | 3300026035 | Bacteria | 3313 |
| 338 | Ga0207639_10550936 | 3300026041 | Bacteria | 1059 |
| 339 | Ga0207678_10021915 | 3300026067 | Bacteria | 5600 |
| 340 | Ga0207678_10097386 | 3300026067 | Bacteria | 2514 |
| 341 | Ga0207702_10363895 | 3300026078 | Bacteria | 1387 |
| 342 | Ga0207702_10539705 | 3300026078 | Bacteria | 1140 |
| 343 | Ga0207702_10887820 | 3300026078 | Bacteria | 883 |
| 344 | Ga0207641_10700557 | 3300026088 | Bacteria | 997 |
| 345 | Ga0207674_10204005 | 3300026116 | Bacteria | 1926 |
| 346 | Ga0207674_10632048 | 3300026116 | Bacteria | 1034 |
| 347 | Ga0207683_10369797 | 3300026121 | Bacteria | 1317 |
| 348 | Ga0207683_10680611 | 3300026121 | Bacteria | 953 |
| 349 | Ga0207698_10166721 | 3300026142 | Bacteria | 1934 |
| 350 | Ga0209281_1005141 | 3300027111 | Bacteria | 3702 |
| 351 | Ga0209371_1000074 | 3300027312 | Bacteria | 198823 |
| 352 | Ga0209371_1004235 | 3300027312 | Bacteria | 6376 |
| 353 | Ga0209970_1022343 | 3300027614 | Bacteria | 1074 |
| 354 | Ga0209983_1048630 | 3300027665 | Bacteria | 926 |
| 355 | Ga0209282_1000009 | 3300027666 | Bacteria | 233366 |
| 356 | Ga0209974_10034083 | 3300027876 | Bacteria | 1690 |
| 357 | Ga0207428_10037235 | 3300027907 | Bacteria | 3959 |
| 358 | Ga0207428_10146957 | 3300027907 | Bacteria | 1796 |
| 359 | Ga0268264_10064081 | 3300028381 | Bacteria | 3092 |
| 360 | Ga0265334_10037067 | 3300028573 | Bacteria | 1924 |
| 361 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 362 | Ga0307515_10001585 | 3300028794 | Bacteria | 50742 |
| 363 | Ga0307515_10002662 | 3300028794 | Bacteria | 38277 |
| 364 | Ga0307515_10120443 | 3300028794 | Bacteria | 2977 |
| 365 | Ga0268256_1000067 | 3300030500 | Bacteria | 198823 |
| 366 | Ga0268256_1003593 | 3300030500 | Bacteria | 6909 |
| 367 | Ga0316177_1056605 | 3300030731 | Bacteria | 1637 |
| 368 | Ga0316180_1139639 | 3300030736 | Bacteria | 1975 |
| 369 | Ga0316181_1015625 | 3300030744 | Bacteria | 3944 |
| 370 | Ga0265330_10007637 | 3300031235 | Bacteria | 5256 |
| 371 | Ga0265332_10000253 | 3300031238 | Bacteria | 42715 |
| 372 | Ga0265325_10056921 | 3300031241 | Bacteria | 1995 |
| 373 | Ga0265329_10001506 | 3300031242 | Bacteria | 11154 |
| 374 | Ga0265331_10004185 | 3300031250 | Bacteria | 9045 |
| 375 | Ga0265327_10016288 | 3300031251 | Bacteria | 4731 |
| 376 | Ga0265316_10004554 | 3300031344 | Bacteria | 13770 |
| 377 | Ga0307513_10004052 | 3300031456 | Bacteria | 19647 |
| 378 | Ga0307513_10405500 | 3300031456 | Bacteria | 1097 |
| 379 | Ga0307408_100000432 | 3300031548 | Bacteria | 37289 |
| 380 | Ga0307408_100002407 | 3300031548 | Bacteria | 13173 |
| 381 | Ga0307408_100009332 | 3300031548 | Bacteria | 6466 |
| 382 | Ga0307408_100042644 | 3300031548 | Bacteria | 3224 |
| 383 | Ga0265314_10036954 | 3300031711 | Bacteria | 3543 |
| 384 | Ga0307516_10001680 | 3300031730 | Bacteria | 30456 |
| 385 | Ga0307516_10078081 | 3300031730 | Bacteria | 3157 |
| 386 | Ga0307405_10570872 | 3300031731 | Bacteria | 919 |
| 387 | Ga0307518_10120389 | 3300031838 | Bacteria | 1858 |
| 388 | Ga0307410_10176546 | 3300031852 | Bacteria | 1614 |
| 389 | Ga0307406_10333007 | 3300031901 | Bacteria | 1179 |
| 390 | Ga0307412_10366015 | 3300031911 | Bacteria | 1163 |
| 391 | Ga0307416_100000975 | 3300032002 | Bacteria | 15137 |
| 392 | Ga0307414_10072470 | 3300032004 | Bacteria | 2488 |
| 393 | Ga0307414_10448523 | 3300032004 | Bacteria | 1131 |
| 394 | Ga0373953_0207558 | 3300035117 | Bacteria | 848 |
| 395 | Ga0373931_0201987 | 3300035691 | Bacteria | 1188 |
| 396 | Ga0373935_0188183 | 3300035692 | Bacteria | 1421 |
| 397 | Ga0373935_0413182 | 3300035692 | Bacteria | 970 |
| 398 | Ga0373927_0003380 | 3300035695 | Bacteria | 11492 |
| 399 | Ga0373927_0067197 | 3300035695 | Bacteria | 2320 |
| 400 | Ga0373927_0109525 | 3300035695 | Bacteria | 1799 |
| 401 | Ga0373933_0187494 | 3300035724 | Bacteria | 1321 |
| 402 | Ga0373947_0139128 | 3300035725 | Bacteria | 1556 |
| 403 | Ga0373937_0043911 | 3300036401 | Bacteria | 4082 |
| 404 | Ga0373937_0167163 | 3300036401 | Bacteria | 2063 |
| 405 | Ga0373937_0959462 | 3300036401 | Bacteria | 804 |
| 406 | Ga0373925_0021367 | 3300037068 | Bacteria | 4715 |
| 407 | Ga0373925_0485079 | 3300037068 | Bacteria | 1014 |
| 408 | Ga0373925_0690712 | 3300037068 | Bacteria | 841 |
| 409 | Ga0395899_0000521 | 3300037312 | Bacteria | 42304 |
| 410 | Ga0395899_0002806 | 3300037312 | Bacteria | 14038 |
| 411 | Ga0395899_0003830 | 3300037312 | Bacteria | 11871 |
| 412 | Ga0395899_0010327 | 3300037312 | Bacteria | 7157 |
| 413 | Ga0395899_0011850 | 3300037312 | Bacteria | 6675 |
| 414 | Ga0395899_0079948 | 3300037312 | Bacteria | 2380 |
| 415 | Ga0395899_0170770 | 3300037312 | Bacteria | 1531 |
| 416 | Ga0395900_0010081 | 3300037418 | Bacteria | 9664 |
| 417 | Ga0395900_0014022 | 3300037418 | Bacteria | 8184 |
| 418 | Ga0395900_0031672 | 3300037418 | Bacteria | 5435 |
| 419 | Ga0395900_0036395 | 3300037418 | Bacteria | 5074 |
| 420 | Ga0395900_0038700 | 3300037418 | Bacteria | 4915 |
| 421 | Ga0395900_0147914 | 3300037418 | Bacteria | 2401 |
| 422 | Ga0395898_0020590 | 3300037466 | Bacteria | 6699 |
| 423 | Ga0395898_0031143 | 3300037466 | Bacteria | 5333 |
| 424 | Ga0395898_0420563 | 3300037466 | Bacteria | 1273 |
| 425 | Ga0395905_0010442 | 3300037471 | Bacteria | 9034 |
| 426 | Ga0395905_0013127 | 3300037471 | Bacteria | 7952 |
| 427 | Ga0395905_0030081 | 3300037471 | Bacteria | 5118 |
| 428 | Ga0395905_0085053 | 3300037471 | Bacteria | 2964 |
| 429 | Ga0395905_0109483 | 3300037471 | Bacteria | 2594 |
| 430 | Ga0395905_0280476 | 3300037471 | Bacteria | 1552 |
| 431 | Ga0395901_0002710 | 3300038443 | Bacteria | 17843 |
| 432 | Ga0395901_0002897 | 3300038443 | Bacteria | 17321 |
| 433 | Ga0395901_0027008 | 3300038443 | Bacteria | 5895 |
| 434 | Ga0395901_0357208 | 3300038443 | Bacteria | 1507 |
| 435 | Ga0395901_0637442 | 3300038443 | Bacteria | 1070 |
| 436 | Ga0436365_0436116 | 3300039437 | Bacteria | 922 |
| 437 | Ga0436360_0123446 | 3300039438 | Bacteria | 2138 |
| 438 | Ga0436361_0009051 | 3300039447 | Bacteria | 7525 |
| 439 | Ga0436361_0013073 | 3300039447 | Bacteria | 17617 |
| 440 | Ga0436361_0039131 | 3300039447 | Bacteria | 6153 |
| 441 | Ga0436361_0167678 | 3300039447 | Bacteria | 2088 |
| 442 | Ga0436361_0389557 | 3300039447 | Bacteria | 1530 |
| 443 | Ga0436361_0558892 | 3300039447 | Bacteria | 1370 |
| 444 | Ga0436361_0930389 | 3300039447 | Bacteria | 10390 |
| 445 | Ga0436361_0959711 | 3300039447 | Bacteria | 1483 |
| 446 | Ga0436362_1188435 | 3300039453 | Bacteria | 1660 |
| 447 | Ga0439466_0015406 | 3300041411 | Bacteria | 2776 |
| 448 | Ga0451843_1496344 | 3300041509 | Bacteria | 1077 |
| 449 | Ga0439448_0031608 | 3300042005 | Bacteria | 1681 |
| 450 | Ga0439455_0005794 | 3300042012 | Bacteria | 2529 |
| 451 | Ga0439455_0016980 | 3300042012 | Bacteria | 1690 |
| 452 | Ga0450904_001582 | 3300042139 | Bacteria | 3095 |
| 453 | Ga0439458_0054788 | 3300042157 | Bacteria | 988 |
| 454 | Ga0450893_0019345 | 3300042532 | Bacteria | 1165 |
| 455 | Ga0451577_0000941 | 3300042876 | Bacteria | 42690 |
| 456 | Ga0451577_0003646 | 3300042876 | Bacteria | 16899 |
| 457 | Ga0451577_0090201 | 3300042876 | Bacteria | 2735 |
| 458 | Ga0466972_0000420 | 3300044658 | Bacteria | 22023 |
| 459 | Ga0466972_0024846 | 3300044658 | Bacteria | 2973 |
| 460 | Ga0466965_0019525 | 3300044683 | Bacteria | 3254 |
| 461 | Ga0466965_0091695 | 3300044683 | Bacteria | 1546 |
| 462 | Ga0466966_0013203 | 3300044684 | Bacteria | 5470 |
| 463 | Ga0466966_0122910 | 3300044684 | Bacteria | 1593 |
| 464 | Ga0466961_0119384 | 3300044693 | Bacteria | 1656 |
| 465 | Ga0466964_0029535 | 3300044706 | Bacteria | 2165 |
| 466 | Ga0453684_0208793 | 3300044712 | Bacteria | 2271 |
| 467 | Ga0466971_0144021 | 3300044719 | Bacteria | 1110 |
| 468 | Ga0466957_0001920 | 3300044842 | Bacteria | 11037 |
| 469 | Ga0466957_0005784 | 3300044842 | Bacteria | 6952 |
| 470 | Ga0466960_0324217 | 3300044901 | Bacteria | 873 |
| 471 | Ga0466960_0340141 | 3300044901 | Bacteria | 854 |
| 472 | Ga0466959_0219057 | 3300045049 | Bacteria | 1321 |
| 473 | Ga0451576_0241374 | 3300045051 | Bacteria | 1887 |
| 474 | Ga0451576_1102472 | 3300045051 | Bacteria | 831 |
| 475 | Ga0466967_0107630 | 3300045976 | Bacteria | 2557 |
| 476 | Ga0495617_000022 | 3300046452 | Bacteria | 185975 |
| 477 | Ga0495617_001209 | 3300046452 | Bacteria | 11631 |
| 478 | Ga0495617_056815 | 3300046452 | Bacteria | 1297 |
| 479 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 480 | Ga0495627_000398 | 3300046453 | Bacteria | 38966 |
| 481 | Ga0495627_028145 | 3300046453 | Bacteria | 1797 |
| 482 | Ga0495592_0002825 | 3300046454 | Bacteria | 12317 |
| 483 | Ga0495592_0006056 | 3300046454 | Bacteria | 8996 |
| 484 | Ga0495592_0158030 | 3300046454 | Bacteria | 1562 |
| 485 | Ga0495603_0039081 | 3300046455 | Bacteria | 2844 |
| 486 | Ga0495603_0039573 | 3300046455 | Bacteria | 2824 |
| 487 | Ga0495590_0000057 | 3300046457 | Bacteria | 93720 |
| 488 | Ga0495590_0000143 | 3300046457 | Bacteria | 43197 |
| 489 | Ga0495590_0109534 | 3300046457 | Bacteria | 985 |
| 490 | Ga0495591_001766 | 3300046458 | Bacteria | 12837 |
| 491 | Ga0495591_003364 | 3300046458 | Bacteria | 8313 |
| 492 | Ga0495629_0000309 | 3300046459 | Bacteria | 41866 |
| 493 | Ga0495629_0009192 | 3300046459 | Bacteria | 7235 |
| 494 | Ga0495629_0016157 | 3300046459 | Bacteria | 5357 |
| 495 | Ga0495629_0200043 | 3300046459 | Bacteria | 1381 |
| 496 | Ga0495638_0005569 | 3300046460 | Bacteria | 9312 |
| 497 | Ga0495638_0054252 | 3300046460 | Bacteria | 2492 |
| 498 | Ga0495638_0138239 | 3300046460 | Bacteria | 1424 |
| 499 | Ga0495651_0009905 | 3300046462 | Bacteria | 7329 |
| 500 | Ga0495651_0015762 | 3300046462 | Bacteria | 5853 |
| 501 | Ga0495651_0067759 | 3300046462 | Bacteria | 2722 |
| 502 | Ga0495651_0479253 | 3300046462 | Bacteria | 799 |
| 503 | Ga0495653_0000044 | 3300046463 | Bacteria | 115591 |
| 504 | Ga0495653_0001283 | 3300046463 | Bacteria | 19431 |
| 505 | Ga0495653_0010444 | 3300046463 | Bacteria | 7597 |
| 506 | Ga0495653_0030963 | 3300046463 | Bacteria | 4256 |
| 507 | Ga0495653_0046652 | 3300046463 | Bacteria | 3354 |
| 508 | Ga0495653_0091446 | 3300046463 | Bacteria | 2224 |
| 509 | Ga0495653_0126045 | 3300046463 | Bacteria | 1818 |
| 510 | Ga0495650_0000082 | 3300046471 | Bacteria | 239477 |
| 511 | Ga0495650_0000254 | 3300046471 | Bacteria | 103512 |
| 512 | Ga0495650_0001173 | 3300046471 | Bacteria | 27987 |
| 513 | Ga0495650_0001749 | 3300046471 | Bacteria | 19780 |
| 514 | Ga0495650_0003298 | 3300046471 | Bacteria | 11915 |
| 515 | Ga0495650_0004336 | 3300046471 | Bacteria | 9777 |
| 516 | Ga0495650_0005780 | 3300046471 | Bacteria | 7898 |
| 517 | Ga0495650_0039016 | 3300046471 | Bacteria | 2052 |
| 518 | Ga0495580_0007546 | 3300046472 | Bacteria | 8728 |
| 519 | Ga0495580_0011457 | 3300046472 | Bacteria | 6861 |
| 520 | Ga0495580_0045269 | 3300046472 | Bacteria | 3126 |
| 521 | Ga0495580_0055619 | 3300046472 | Bacteria | 2787 |
| 522 | Ga0495580_0137598 | 3300046472 | Bacteria | 1693 |
| 523 | Ga0495582_0039310 | 3300046473 | Bacteria | 2604 |
| 524 | Ga0495605_0000098 | 3300046474 | Bacteria | 109816 |
| 525 | Ga0495605_0000102 | 3300046474 | Bacteria | 107430 |
| 526 | Ga0495605_0000153 | 3300046474 | Bacteria | 88955 |
| 527 | Ga0495605_0014088 | 3300046474 | Bacteria | 4386 |
| 528 | Ga0495605_0025625 | 3300046474 | Bacteria | 3072 |
| 529 | Ga0495605_0044553 | 3300046474 | Bacteria | 2192 |
| 530 | Ga0495605_0050130 | 3300046474 | Bacteria | 2037 |
| 531 | Ga0495605_0055414 | 3300046474 | Bacteria | 1915 |
| 532 | Ga0495605_0129962 | 3300046474 | Bacteria | 1136 |
| 533 | Ga0495639_0090146 | 3300046475 | Bacteria | 1438 |
| 534 | Ga0495662_0013868 | 3300046476 | Bacteria | 3922 |
| 535 | Ga0495662_0163596 | 3300046476 | Bacteria | 1096 |
| 536 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 537 | Ga0495584_0000232 | 3300046491 | Bacteria | 40218 |
| 538 | Ga0495584_0000729 | 3300046491 | Bacteria | 21708 |
| 539 | Ga0495584_0008319 | 3300046491 | Bacteria | 5372 |
| 540 | Ga0495584_0010267 | 3300046491 | Bacteria | 4811 |
| 541 | Ga0495584_0037347 | 3300046491 | Bacteria | 2454 |
| 542 | Ga0495584_0045754 | 3300046491 | Bacteria | 2207 |
| 543 | Ga0495585_0000023 | 3300046492 | Bacteria | 149218 |
| 544 | Ga0495585_0004011 | 3300046492 | Bacteria | 9694 |
| 545 | Ga0495585_0004403 | 3300046492 | Bacteria | 9135 |
| 546 | Ga0495585_0007615 | 3300046492 | Bacteria | 6614 |
| 547 | Ga0495585_0011749 | 3300046492 | Bacteria | 5175 |
| 548 | Ga0495585_0011755 | 3300046492 | Bacteria | 5173 |
| 549 | Ga0495585_0024181 | 3300046492 | Bacteria | 3485 |
| 550 | Ga0495585_0031217 | 3300046492 | Bacteria | 3025 |
| 551 | Ga0495585_0041530 | 3300046492 | Bacteria | 2579 |
| 552 | Ga0495585_0051302 | 3300046492 | Bacteria | 2286 |
| 553 | Ga0495585_0125200 | 3300046492 | Bacteria | 1356 |
| 554 | Ga0495585_0129940 | 3300046492 | Bacteria | 1326 |
| 555 | Ga0495594_0047218 | 3300046499 | Bacteria | 2364 |
| 556 | Ga0495594_0172740 | 3300046499 | Bacteria | 1229 |
| 557 | Ga0495596_0002525 | 3300046500 | Bacteria | 9800 |
| 558 | Ga0495596_0002817 | 3300046500 | Bacteria | 9094 |
| 559 | Ga0495596_0003901 | 3300046500 | Bacteria | 7393 |
| 560 | Ga0495596_0005514 | 3300046500 | Bacteria | 5961 |
| 561 | Ga0495596_0008285 | 3300046500 | Bacteria | 4633 |
| 562 | Ga0495596_0009969 | 3300046500 | Bacteria | 4159 |
| 563 | Ga0495596_0014021 | 3300046500 | Bacteria | 3381 |
| 564 | Ga0495596_0069983 | 3300046500 | Bacteria | 1363 |
| 565 | Ga0495607_0005043 | 3300046501 | Bacteria | 9579 |
| 566 | Ga0495607_0012840 | 3300046501 | Bacteria | 5508 |
| 567 | Ga0495607_0018756 | 3300046501 | Bacteria | 4400 |
| 568 | Ga0495607_0039833 | 3300046501 | Bacteria | 2803 |
| 569 | Ga0495607_0046368 | 3300046501 | Bacteria | 2553 |
| 570 | Ga0495607_0087055 | 3300046501 | Bacteria | 1701 |
| 571 | Ga0495607_0092601 | 3300046501 | Bacteria | 1634 |
| 572 | Ga0495583_0000150 | 3300046506 | Bacteria | 117772 |
| 573 | Ga0495583_0000597 | 3300046506 | Bacteria | 49120 |
| 574 | Ga0495583_0001383 | 3300046506 | Bacteria | 24824 |
| 575 | Ga0495583_0001918 | 3300046506 | Bacteria | 19228 |
| 576 | Ga0495583_0007069 | 3300046506 | Bacteria | 7173 |
| 577 | Ga0495583_0021299 | 3300046506 | Bacteria | 3339 |
| 578 | Ga0495583_0023523 | 3300046506 | Bacteria | 3114 |
| 579 | Ga0495583_0030505 | 3300046506 | Bacteria | 2624 |
| 580 | Ga0495606_0000090 | 3300046507 | Bacteria | 154737 |
| 581 | Ga0495606_0000099 | 3300046507 | Bacteria | 150950 |
| 582 | Ga0495606_0000524 | 3300046507 | Bacteria | 62049 |
| 583 | Ga0495606_0002603 | 3300046507 | Bacteria | 20634 |
| 584 | Ga0495606_0002891 | 3300046507 | Bacteria | 18970 |
| 585 | Ga0495606_0003267 | 3300046507 | Bacteria | 17378 |
| 586 | Ga0495606_0009874 | 3300046507 | Bacteria | 8001 |
| 587 | Ga0495606_0015472 | 3300046507 | Bacteria | 5874 |
| 588 | Ga0495606_0036555 | 3300046507 | Bacteria | 3343 |
| 589 | Ga0495606_0085609 | 3300046507 | Bacteria | 1950 |
| 590 | Ga0495608_0024843 | 3300046511 | Bacteria | 4093 |
| 591 | Ga0495608_0033895 | 3300046511 | Bacteria | 3448 |
| 592 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 593 | Ga0495610_0000668 | 3300046512 | Bacteria | 33359 |
| 594 | Ga0495610_0007137 | 3300046512 | Bacteria | 7529 |
| 595 | Ga0495610_0007163 | 3300046512 | Bacteria | 7504 |
| 596 | Ga0495610_0017836 | 3300046512 | Bacteria | 4033 |
| 597 | Ga0495616_0004647 | 3300046513 | Bacteria | 8621 |
| 598 | Ga0495616_0028823 | 3300046513 | Bacteria | 2936 |
| 599 | Ga0495616_0031376 | 3300046513 | Bacteria | 2782 |
| 600 | Ga0495616_0040079 | 3300046513 | Bacteria | 2395 |
| 601 | Ga0495616_0090387 | 3300046513 | Bacteria | 1450 |
| 602 | Ga0495618_0018085 | 3300046514 | Bacteria | 4326 |
| 603 | Ga0495618_0038016 | 3300046514 | Bacteria | 3024 |
| 604 | Ga0495620_0062742 | 3300046515 | Bacteria | 1542 |
| 605 | Ga0495620_0207762 | 3300046515 | Bacteria | 752 |
| 606 | Ga0495628_0037325 | 3300046516 | Bacteria | 3895 |
| 607 | Ga0495628_0185811 | 3300046516 | Bacteria | 1570 |
| 608 | Ga0495628_0484651 | 3300046516 | Bacteria | 894 |
| 609 | Ga0495630_0016484 | 3300046517 | Bacteria | 5401 |
| 610 | Ga0495630_0067147 | 3300046517 | Bacteria | 2695 |
| 611 | Ga0495630_0104673 | 3300046517 | Bacteria | 2142 |
| 612 | Ga0495630_0564455 | 3300046517 | Bacteria | 873 |
| 613 | Ga0495631_0001332 | 3300046518 | Bacteria | 15128 |
| 614 | Ga0495631_0001436 | 3300046518 | Bacteria | 14479 |
| 615 | Ga0495631_0019040 | 3300046518 | Bacteria | 3224 |
| 616 | Ga0495631_0031266 | 3300046518 | Bacteria | 2409 |
| 617 | Ga0495631_0061086 | 3300046518 | Bacteria | 1634 |
| 618 | Ga0495631_0085211 | 3300046518 | Bacteria | 1361 |
| 619 | Ga0495632_0000052 | 3300046519 | Bacteria | 132992 |
| 620 | Ga0495632_0001555 | 3300046519 | Bacteria | 18930 |
| 621 | Ga0495632_0006741 | 3300046519 | Bacteria | 7342 |
| 622 | Ga0495632_0007457 | 3300046519 | Bacteria | 6871 |
| 623 | Ga0495632_0012494 | 3300046519 | Bacteria | 4897 |
| 624 | Ga0495632_0062533 | 3300046519 | Bacteria | 1804 |
| 625 | Ga0495632_0091401 | 3300046519 | Bacteria | 1442 |
| 626 | Ga0495637_0000018 | 3300046520 | Bacteria | 186671 |
| 627 | Ga0495637_0000195 | 3300046520 | Bacteria | 47191 |
| 628 | Ga0495643_0000109 | 3300046522 | Bacteria | 135859 |
| 629 | Ga0495643_0000250 | 3300046522 | Bacteria | 78905 |
| 630 | Ga0495643_0001163 | 3300046522 | Bacteria | 25714 |
| 631 | Ga0495643_0003256 | 3300046522 | Bacteria | 12009 |
| 632 | Ga0495643_0009083 | 3300046522 | Bacteria | 6228 |
| 633 | Ga0495643_0012298 | 3300046522 | Bacteria | 5168 |
| 634 | Ga0495643_0037303 | 3300046522 | Bacteria | 2667 |
| 635 | Ga0495644_0001139 | 3300046523 | Bacteria | 10903 |
| 636 | Ga0495644_0005133 | 3300046523 | Bacteria | 5126 |
| 637 | Ga0495644_0015724 | 3300046523 | Bacteria | 2900 |
| 638 | Ga0495644_0031603 | 3300046523 | Bacteria | 2000 |
| 639 | Ga0495644_0066258 | 3300046523 | Bacteria | 1356 |
| 640 | Ga0495648_0001296 | 3300046524 | Bacteria | 24870 |
| 641 | Ga0495648_0001297 | 3300046524 | Bacteria | 24870 |
| 642 | Ga0495648_0001425 | 3300046524 | Bacteria | 23386 |
| 643 | Ga0495648_0003753 | 3300046524 | Bacteria | 13223 |
| 644 | Ga0495648_0006123 | 3300046524 | Bacteria | 9862 |
| 645 | Ga0495648_0016758 | 3300046524 | Bacteria | 5270 |
| 646 | Ga0495648_0021171 | 3300046524 | Bacteria | 4511 |
| 647 | Ga0495648_0115771 | 3300046524 | Bacteria | 1449 |
| 648 | Ga0495663_0002215 | 3300046525 | Bacteria | 5914 |
| 649 | Ga0495666_0001817 | 3300046526 | Bacteria | 10541 |
| 650 | Ga0495666_0015331 | 3300046526 | Bacteria | 3815 |
| 651 | Ga0495666_0028531 | 3300046526 | Bacteria | 2746 |
| 652 | Ga0495666_0061855 | 3300046526 | Bacteria | 1788 |
| 653 | Ga0495666_0079786 | 3300046526 | Bacteria | 1549 |
| 654 | Ga0495642_0000529 | 3300046528 | Bacteria | 19421 |
| 655 | Ga0495642_0003891 | 3300046528 | Bacteria | 5852 |
| 656 | Ga0495642_0021798 | 3300046528 | Bacteria | 2521 |
| 657 | Ga0495642_0024066 | 3300046528 | Bacteria | 2407 |
| 658 | Ga0495642_0069033 | 3300046528 | Bacteria | 1475 |
| 659 | Ga0495652_0019566 | 3300046529 | Bacteria | 6026 |
| 660 | Ga0495652_0038115 | 3300046529 | Bacteria | 4166 |
| 661 | Ga0495652_0039668 | 3300046529 | Bacteria | 4071 |
| 662 | Ga0495654_0000030 | 3300046530 | Bacteria | 216715 |
| 663 | Ga0495665_0008461 | 3300046531 | Bacteria | 5582 |
| 664 | Ga0495665_0021613 | 3300046531 | Bacteria | 3458 |
| 665 | Ga0495640_0022469 | 3300046533 | Bacteria | 4609 |
| 666 | Ga0495586_0024085 | 3300046535 | Bacteria | 3251 |
| 667 | Ga0495586_0058801 | 3300046535 | Bacteria | 2088 |
| 668 | Ga0495586_0088469 | 3300046535 | Bacteria | 1709 |
| 669 | Ga0495587_0027154 | 3300046536 | Bacteria | 3486 |
| 670 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 671 | Ga0495609_0002820 | 3300046538 | Bacteria | 10412 |
| 672 | Ga0495609_0003952 | 3300046538 | Bacteria | 8301 |
| 673 | Ga0495609_0004429 | 3300046538 | Bacteria | 7680 |
| 674 | Ga0495609_0004923 | 3300046538 | Bacteria | 7170 |
| 675 | Ga0495609_0005405 | 3300046538 | Bacteria | 6723 |
| 676 | Ga0495609_0006790 | 3300046538 | Bacteria | 5791 |
| 677 | Ga0495609_0033240 | 3300046538 | Bacteria | 2341 |
| 678 | Ga0495621_0078893 | 3300046539 | Bacteria | 1225 |
| 679 | Ga0495597_0001285 | 3300046542 | Bacteria | 18457 |
| 680 | Ga0495597_0001411 | 3300046542 | Bacteria | 17326 |
| 681 | Ga0495597_0004502 | 3300046542 | Bacteria | 7634 |
| 682 | Ga0495597_0005863 | 3300046542 | Bacteria | 6420 |
| 683 | Ga0495597_0013491 | 3300046542 | Bacteria | 3910 |
| 684 | Ga0495597_0016066 | 3300046542 | Bacteria | 3539 |
| 685 | Ga0495597_0025847 | 3300046542 | Bacteria | 2701 |
| 686 | Ga0495597_0028495 | 3300046542 | Bacteria | 2556 |
| 687 | Ga0495645_0032325 | 3300046543 | Bacteria | 3816 |
| 688 | Ga0495622_0001323 | 3300046557 | Bacteria | 12700 |
| 689 | Ga0495622_0002393 | 3300046557 | Bacteria | 9126 |
| 690 | Ga0495622_0006213 | 3300046557 | Bacteria | 5545 |
| 691 | Ga0495622_0027424 | 3300046557 | Bacteria | 2658 |
| 692 | Ga0495633_0000917 | 3300046558 | Bacteria | 24985 |
| 693 | Ga0495633_0003343 | 3300046558 | Bacteria | 10770 |
| 694 | Ga0495633_0007909 | 3300046558 | Bacteria | 6063 |
| 695 | Ga0495633_0008903 | 3300046558 | Bacteria | 5597 |
| 696 | Ga0495633_0010820 | 3300046558 | Bacteria | 4962 |
| 697 | Ga0495633_0017263 | 3300046558 | Bacteria | 3696 |
| 698 | Ga0495633_0018510 | 3300046558 | Bacteria | 3537 |
| 699 | Ga0495633_0024206 | 3300046558 | Bacteria | 3002 |
| 700 | Ga0495633_0026061 | 3300046558 | Bacteria | 2871 |
| 701 | Ga0495633_0031949 | 3300046558 | Bacteria | 2546 |
| 702 | Ga0495656_0009431 | 3300046615 | Bacteria | 3509 |
| 703 | Ga0495656_0010160 | 3300046615 | Bacteria | 3412 |
| 704 | Ga0495668_0000035 | 3300046616 | Bacteria | 240241 |
| 705 | Ga0495668_0000211 | 3300046616 | Bacteria | 84615 |
| 706 | Ga0495668_0000286 | 3300046616 | Bacteria | 69771 |
| 707 | Ga0495668_0000939 | 3300046616 | Bacteria | 32535 |
| 708 | Ga0495668_0004452 | 3300046616 | Bacteria | 9939 |
| 709 | Ga0495668_0004959 | 3300046616 | Bacteria | 9225 |
| 710 | Ga0495668_0028649 | 3300046616 | Bacteria | 3149 |
| 711 | Ga0495668_0033106 | 3300046616 | Bacteria | 2905 |
| 712 | Ga0495668_0062448 | 3300046616 | Bacteria | 2052 |
| 713 | Ga0495668_0138067 | 3300046616 | Bacteria | 1334 |
| 714 | Ga0495634_0007428 | 3300046642 | Bacteria | 8236 |
| 715 | Ga0495634_0166313 | 3300046642 | Bacteria | 1388 |
| 716 | Ga0495634_0212852 | 3300046642 | Bacteria | 1195 |
| 717 | Ga0495611_0001030 | 3300046648 | Bacteria | 14761 |
| 718 | Ga0495611_0006926 | 3300046648 | Bacteria | 4818 |
| 719 | Ga0495611_0011215 | 3300046648 | Bacteria | 3799 |
| 720 | Ga0495611_0018089 | 3300046648 | Bacteria | 3020 |
| 721 | Ga0495611_0034137 | 3300046648 | Bacteria | 2248 |
| 722 | Ga0495611_0087296 | 3300046648 | Bacteria | 1439 |
| 723 | Ga0495611_0087994 | 3300046648 | Bacteria | 1433 |
| 724 | Ga0495625_0001765 | 3300046660 | Bacteria | 25007 |
| 725 | Ga0495625_0011811 | 3300046660 | Bacteria | 7094 |
| 726 | Ga0495625_0013440 | 3300046660 | Bacteria | 6580 |
| 727 | Ga0495625_0017244 | 3300046660 | Bacteria | 5654 |
| 728 | Ga0495625_0168901 | 3300046660 | Bacteria | 1461 |
| 729 | Ga0495635_0008609 | 3300046663 | Bacteria | 7123 |
| 730 | Ga0495635_0017174 | 3300046663 | Bacteria | 5053 |
| 731 | Ga0495659_0002549 | 3300046664 | Bacteria | 5876 |
| 732 | Ga0495659_0006857 | 3300046664 | Bacteria | 3601 |
| 733 | Ga0495661_0000074 | 3300046665 | Bacteria | 120402 |
| 734 | Ga0495661_0004739 | 3300046665 | Bacteria | 9770 |
| 735 | Ga0495661_0013502 | 3300046665 | Bacteria | 5484 |
| 736 | Ga0495661_0014184 | 3300046665 | Bacteria | 5338 |
| 737 | Ga0495661_0014749 | 3300046665 | Bacteria | 5231 |
| 738 | Ga0495661_0020025 | 3300046665 | Bacteria | 4375 |
| 739 | Ga0495661_0024133 | 3300046665 | Bacteria | 3937 |
| 740 | Ga0495661_0037951 | 3300046665 | Bacteria | 3004 |
| 741 | Ga0495661_0038019 | 3300046665 | Bacteria | 3002 |
| 742 | Ga0495661_0040241 | 3300046665 | Bacteria | 2900 |
| 743 | Ga0495661_0040415 | 3300046665 | Bacteria | 2892 |
| 744 | Ga0495661_0049980 | 3300046665 | Bacteria | 2533 |
| 745 | Ga0495661_0142641 | 3300046665 | Bacteria | 1301 |
| 746 | Ga0495661_0156620 | 3300046665 | Bacteria | 1226 |
| 747 | Ga0495661_0213376 | 3300046665 | Bacteria | 1003 |
| 748 | Ga0495588_0000451 | 3300046674 | Bacteria | 20713 |
| 749 | Ga0495588_0014692 | 3300046674 | Bacteria | 3754 |
| 750 | Ga0495588_0062365 | 3300046674 | Bacteria | 1932 |
| 751 | Ga0495588_0335857 | 3300046674 | Bacteria | 794 |
| 752 | Ga0495657_0056172 | 3300046675 | Bacteria | 2623 |
| 753 | Ga0495599_0094584 | 3300046678 | Bacteria | 1864 |
| 754 | Ga0495599_0103013 | 3300046678 | Bacteria | 1778 |
| 755 | Ga0495623_0012523 | 3300046679 | Bacteria | 5487 |
| 756 | Ga0495623_0027099 | 3300046679 | Bacteria | 3686 |
| 757 | Ga0495623_0027845 | 3300046679 | Bacteria | 3638 |
| 758 | Ga0495623_0046617 | 3300046679 | Bacteria | 2750 |
| 759 | Ga0495646_0005966 | 3300046680 | Bacteria | 7720 |
| 760 | Ga0495646_0032746 | 3300046680 | Bacteria | 3233 |
| 761 | Ga0495658_0140807 | 3300046683 | Bacteria | 1475 |
| 762 | Ga0495669_0000101 | 3300046684 | Bacteria | 53876 |
| 763 | Ga0495669_0000495 | 3300046684 | Bacteria | 18130 |
| 764 | Ga0495669_0001145 | 3300046684 | Bacteria | 10993 |
| 765 | Ga0495669_0004673 | 3300046684 | Bacteria | 5677 |
| 766 | Ga0495669_0043467 | 3300046684 | Bacteria | 2000 |
| 767 | Ga0495613_0061877 | 3300046689 | Bacteria | 2740 |
| 768 | Ga0495613_0067028 | 3300046689 | Bacteria | 2620 |
| 769 | Ga0495613_0171020 | 3300046689 | Bacteria | 1542 |
| 770 | Ga0495624_0003624 | 3300046690 | Bacteria | 11417 |
| 771 | Ga0495624_0004359 | 3300046690 | Bacteria | 10375 |
| 772 | Ga0495624_0034365 | 3300046690 | Bacteria | 3279 |
| 773 | Ga0495624_0063072 | 3300046690 | Bacteria | 2317 |
| 774 | Ga0495624_0116779 | 3300046690 | Bacteria | 1639 |
| 775 | Ga0495670_0000859 | 3300046691 | Bacteria | 14714 |
| 776 | Ga0495670_0011198 | 3300046691 | Bacteria | 4409 |
| 777 | Ga0495670_0017486 | 3300046691 | Bacteria | 3528 |
| 778 | Ga0495670_0025115 | 3300046691 | Bacteria | 2946 |
| 779 | Ga0495670_0040948 | 3300046691 | Bacteria | 2311 |
| 780 | Ga0495671_0000605 | 3300046692 | Bacteria | 26398 |
| 781 | Ga0495671_0007126 | 3300046692 | Bacteria | 6404 |
| 782 | Ga0495671_0031947 | 3300046692 | Bacteria | 2689 |
| 783 | Ga0495671_0062914 | 3300046692 | Bacteria | 1828 |
| 784 | Ga0495671_0087233 | 3300046692 | Bacteria | 1528 |
| 785 | Ga0495671_0107585 | 3300046692 | Bacteria | 1361 |
| 786 | Ga0495649_0006762 | 3300046694 | Bacteria | 7105 |
| 787 | Ga0495649_0008705 | 3300046694 | Bacteria | 6087 |
| 788 | Ga0495649_0008952 | 3300046694 | Bacteria | 5984 |
| 789 | Ga0495649_0066219 | 3300046694 | Bacteria | 1938 |
| 790 | Ga0495589_0000086 | 3300046794 | Bacteria | 86130 |
| 791 | Ga0495589_0000132 | 3300046794 | Bacteria | 68363 |
| 792 | Ga0495589_0004038 | 3300046794 | Bacteria | 7863 |
| 793 | Ga0495589_0006701 | 3300046794 | Bacteria | 6066 |
| 794 | Ga0495589_0008251 | 3300046794 | Bacteria | 5441 |
| 795 | Ga0495589_0025964 | 3300046794 | Bacteria | 2969 |
| 796 | Ga0495589_0043578 | 3300046794 | Bacteria | 2232 |
| 797 | Ga0495589_0057044 | 3300046794 | Bacteria | 1921 |
| 798 | Ga0495600_0015355 | 3300046809 | Bacteria | 4841 |
| 799 | Ga0495600_0020745 | 3300046809 | Bacteria | 4203 |
| 800 | Ga0495600_0036329 | 3300046809 | Bacteria | 3201 |
| 801 | Ga0495660_0004409 | 3300046810 | Bacteria | 8522 |
| 802 | Ga0495660_0007681 | 3300046810 | Bacteria | 6335 |
| 803 | Ga0495660_0008293 | 3300046810 | Bacteria | 6083 |
| 804 | Ga0495660_0008498 | 3300046810 | Bacteria | 6012 |
| 805 | Ga0495660_0014335 | 3300046810 | Bacteria | 4588 |
| 806 | Ga0495660_0024343 | 3300046810 | Bacteria | 3449 |
| 807 | Ga0495660_0026896 | 3300046810 | Bacteria | 3257 |
| 808 | Ga0495660_0057832 | 3300046810 | Bacteria | 2090 |
| 809 | Ga0495660_0069704 | 3300046810 | Bacteria | 1868 |
| 810 | Ga0495660_0084017 | 3300046810 | Bacteria | 1665 |
| 811 | Ga0495660_0084438 | 3300046810 | Bacteria | 1660 |
| 812 | Ga0495581_0022613 | 3300047315 | Bacteria | 3642 |
| 813 | Ga0495581_0027614 | 3300047315 | Bacteria | 3291 |
| 814 | Ga0495581_0047000 | 3300047315 | Bacteria | 2494 |
| 815 | Ga0495581_0204894 | 3300047315 | Bacteria | 1154 |
| 816 | Ga0495604_0003813 | 3300047317 | Bacteria | 12003 |
| 817 | Ga0495604_0012895 | 3300047317 | Bacteria | 6658 |
| 818 | Ga0495604_0018243 | 3300047317 | Bacteria | 5618 |
| 819 | Ga0495604_0032878 | 3300047317 | Bacteria | 4108 |
| 820 | Ga0495636_0040337 | 3300047318 | Bacteria | 1935 |
| 821 | Ga0495674_0011663 | 3300047319 | Bacteria | 8289 |
| 822 | Ga0495674_0026818 | 3300047319 | Bacteria | 5269 |
| 823 | Ga0495674_0039008 | 3300047319 | Bacteria | 4258 |
| 824 | Ga0495674_0053476 | 3300047319 | Bacteria | 3549 |
| 825 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 826 | Ga0495672_0000278 | 3300047320 | Bacteria | 71017 |
| 827 | Ga0495672_0001189 | 3300047320 | Bacteria | 26357 |
| 828 | Ga0495672_0006089 | 3300047320 | Bacteria | 9422 |
| 829 | Ga0495672_0006593 | 3300047320 | Bacteria | 8935 |
| 830 | Ga0495672_0007759 | 3300047320 | Bacteria | 8030 |
| 831 | Ga0495672_0008561 | 3300047320 | Bacteria | 7530 |
| 832 | Ga0495672_0021147 | 3300047320 | Bacteria | 4248 |
| 833 | Ga0495672_0096773 | 3300047320 | Bacteria | 1608 |
| 834 | Ga0495676_0000015 | 3300047321 | Bacteria | 199492 |
| 835 | Ga0495676_0089686 | 3300047321 | Bacteria | 2303 |
| 836 | Ga0495676_0110694 | 3300047321 | Bacteria | 2015 |
| 837 | Ga0495676_0134159 | 3300047321 | Bacteria | 1783 |
| 838 | Ga0495680_0019772 | 3300047322 | Bacteria | 5679 |
| 839 | Ga0495680_0070676 | 3300047322 | Bacteria | 2660 |
| 840 | Ga0495680_0080980 | 3300047322 | Bacteria | 2452 |
| 841 | Ga0495683_0000036 | 3300047323 | Bacteria | 144974 |
| 842 | Ga0495683_0003534 | 3300047323 | Bacteria | 9097 |
| 843 | Ga0495683_0003640 | 3300047323 | Bacteria | 8935 |
| 844 | Ga0495683_0006050 | 3300047323 | Bacteria | 6641 |
| 845 | Ga0495683_0006168 | 3300047323 | Bacteria | 6571 |
| 846 | Ga0495683_0013934 | 3300047323 | Bacteria | 4192 |
| 847 | Ga0495683_0015050 | 3300047323 | Bacteria | 4029 |
| 848 | Ga0495683_0019227 | 3300047323 | Bacteria | 3526 |
| 849 | Ga0495683_0047196 | 3300047323 | Bacteria | 2161 |
| 850 | Ga0495683_0090903 | 3300047323 | Bacteria | 1479 |
| 851 | Ga0495687_000038 | 3300047443 | Bacteria | 251616 |
| 852 | Ga0495687_000057 | 3300047443 | Bacteria | 186224 |
| 853 | Ga0495687_001055 | 3300047443 | Bacteria | 27247 |
| 854 | Ga0495687_001122 | 3300047443 | Bacteria | 26027 |
| 855 | Ga0495687_007401 | 3300047443 | Bacteria | 6469 |
| 856 | Ga0495687_008762 | 3300047443 | Bacteria | 5746 |
| 857 | Ga0495687_010094 | 3300047443 | Bacteria | 5206 |
| 858 | Ga0495687_017705 | 3300047443 | Bacteria | 3542 |
| 859 | Ga0495687_025518 | 3300047443 | Bacteria | 2792 |
| 860 | Ga0495687_028152 | 3300047443 | Bacteria | 2617 |
| 861 | Ga0495687_113151 | 3300047443 | Bacteria | 993 |
| 862 | Ga0495675_0019161 | 3300047444 | Bacteria | 4347 |
| 863 | Ga0495675_0077014 | 3300047444 | Bacteria | 2101 |
| 864 | Ga0495675_0091327 | 3300047444 | Bacteria | 1911 |
| 865 | Ga0495677_0000004 | 3300047445 | Bacteria | 248210 |
| 866 | Ga0495677_0000948 | 3300047445 | Bacteria | 11680 |
| 867 | Ga0495677_0005364 | 3300047445 | Bacteria | 4864 |
| 868 | Ga0495677_0017287 | 3300047445 | Bacteria | 2615 |
| 869 | Ga0495677_0022617 | 3300047445 | Bacteria | 2280 |
| 870 | Ga0495679_000271 | 3300047446 | Bacteria | 43383 |
| 871 | Ga0495679_001332 | 3300047446 | Bacteria | 14284 |
| 872 | Ga0495679_002051 | 3300047446 | Bacteria | 10639 |
| 873 | Ga0495679_010678 | 3300047446 | Bacteria | 3591 |
| 874 | Ga0495685_000299 | 3300047447 | Bacteria | 16305 |
| 875 | Ga0495685_029782 | 3300047447 | Bacteria | 1877 |
| 876 | Ga0495685_086303 | 3300047447 | Bacteria | 1042 |
| 877 | Ga0495673_0000069 | 3300047469 | Bacteria | 218170 |
| 878 | Ga0495673_0000203 | 3300047469 | Bacteria | 89918 |
| 879 | Ga0495673_0000236 | 3300047469 | Bacteria | 79618 |
| 880 | Ga0495673_0009876 | 3300047469 | Bacteria | 5239 |
| 881 | Ga0495673_0013406 | 3300047469 | Bacteria | 4306 |
| 882 | Ga0495673_0066045 | 3300047469 | Bacteria | 1535 |
| 883 | Ga0495681_0014222 | 3300047470 | Bacteria | 4577 |
| 884 | Ga0495681_0031624 | 3300047470 | Bacteria | 2675 |
| 885 | Ga0495681_0032950 | 3300047470 | Bacteria | 2601 |
| 886 | Ga0495681_0037197 | 3300047470 | Bacteria | 2400 |
| 887 | Ga0495681_0081584 | 3300047470 | Bacteria | 1442 |
| 888 | Ga0495686_0007873 | 3300047472 | Bacteria | 7916 |
| 889 | Ga0495686_0008513 | 3300047472 | Bacteria | 7519 |
| 890 | Ga0495686_0035881 | 3300047472 | Bacteria | 3183 |
| 891 | Ga0495686_0160983 | 3300047472 | Bacteria | 1311 |
| 892 | Ga0495593_0002329 | 3300047673 | Bacteria | 11410 |
| 893 | Ga0495593_0008400 | 3300047673 | Bacteria | 6005 |
| 894 | Ga0495593_0049839 | 3300047673 | Bacteria | 2220 |
| 895 | Ga0495602_0018389 | 3300048088 | Bacteria | 6983 |
| 896 | Ga0495602_0026740 | 3300048088 | Bacteria | 5560 |
| 897 | Ga0495602_0039345 | 3300048088 | Bacteria | 4355 |
| 898 | Ga0495602_0102875 | 3300048088 | Bacteria | 2339 |
| 899 | Ga0495614_0009542 | 3300048089 | Bacteria | 4290 |
| 900 | Ga0495614_0020278 | 3300048089 | Bacteria | 2875 |
| 901 | Ga0495614_0022236 | 3300048089 | Bacteria | 2737 |
| 902 | Ga0495615_0003471 | 3300048090 | Bacteria | 2645 |
| 903 | Ga0495626_0000048 | 3300048091 | Bacteria | 161634 |
| 904 | Ga0495626_0000279 | 3300048091 | Bacteria | 56185 |
| 905 | Ga0495626_0000998 | 3300048091 | Bacteria | 24336 |
| 906 | Ga0495626_0001757 | 3300048091 | Bacteria | 16497 |
| 907 | Ga0495626_0007693 | 3300048091 | Bacteria | 5971 |
| 908 | Ga0495626_0008828 | 3300048091 | Bacteria | 5481 |
| 909 | Ga0495626_0009702 | 3300048091 | Bacteria | 5189 |
| 910 | Ga0495626_0010181 | 3300048091 | Bacteria | 5042 |
| 911 | Ga0495626_0027137 | 3300048091 | Bacteria | 2785 |
| 912 | Ga0496100_0033511 | 3300048903 | Bacteria | 3214 |
| 913 | Ga0496100_0175340 | 3300048903 | Bacteria | 1547 |
| 914 | Ga0496101_0045775 | 3300048904 | Bacteria | 3135 |
| 915 | Ga0496101_0251187 | 3300048904 | Bacteria | 1378 |
| 916 | Ga0496101_0320679 | 3300048904 | Bacteria | 1216 |
| 917 | Ga0496102_0000478 | 3300048905 | Bacteria | 44372 |
| 918 | Ga0496102_0007956 | 3300048905 | Bacteria | 9059 |
| 919 | Ga0496102_0008640 | 3300048905 | Bacteria | 8741 |
| 920 | Ga0496102_0017344 | 3300048905 | Bacteria | 6306 |
| 921 | Ga0496102_0165543 | 3300048905 | Bacteria | 2080 |
| 922 | Ga0496102_0291127 | 3300048905 | Bacteria | 1539 |
| 923 | Ga0496103_0017663 | 3300048906 | Bacteria | 4270 |
| 924 | Ga0496103_0083968 | 3300048906 | Bacteria | 2005 |
| 925 | Ga0496103_0092200 | 3300048906 | Bacteria | 1912 |
| 926 | Ga0496106_0055391 | 3300048909 | Bacteria | 2997 |
| 927 | Ga0496109_0035631 | 3300048912 | Bacteria | 4490 |
| 928 | Ga0496109_0133006 | 3300048912 | Bacteria | 2323 |
| 929 | Ga0496109_0286482 | 3300048912 | Bacteria | 1553 |
| 930 | Ga0496110_0000092 | 3300048913 | Bacteria | 48035 |
| 931 | Ga0496110_0148346 | 3300048913 | Bacteria | 2122 |
| 932 | Ga0496110_0527297 | 3300048913 | Bacteria | 1074 |
| 933 | Ga0496111_0267910 | 3300048914 | Bacteria | 1267 |
| 934 | Ga0496111_0504127 | 3300048914 | Bacteria | 891 |
| 935 | Ga0496114_0007265 | 3300048917 | Bacteria | 8748 |
| 936 | Ga0496114_0068845 | 3300048917 | Bacteria | 2971 |
| 937 | Ga0496114_0072052 | 3300048917 | Bacteria | 2905 |
| 938 | Ga0496115_0019582 | 3300048918 | Bacteria | 5210 |
| 939 | Ga0496115_0125816 | 3300048918 | Bacteria | 2111 |
| 940 | Ga0496115_0526259 | 3300048918 | Bacteria | 948 |
| 941 | Ga0496116_0051271 | 3300048919 | Bacteria | 2742 |
| 942 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 943 | Ga0496117_0031619 | 3300048920 | Bacteria | 4036 |
| 944 | Ga0496117_0074896 | 3300048920 | Bacteria | 2251 |
| 945 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 946 | Ga0496118_0011234 | 3300048921 | Bacteria | 8767 |
| 947 | Ga0496118_0040491 | 3300048921 | Bacteria | 3704 |
| 948 | Ga0496121_0028888 | 3300048924 | Bacteria | 5149 |
| 949 | Ga0496121_0034811 | 3300048924 | Bacteria | 4526 |
| 950 | Ga0496121_0038335 | 3300048924 | Bacteria | 4247 |
| 951 | Ga0496122_0003525 | 3300048925 | Bacteria | 20479 |
| 952 | Ga0496123_0000084 | 3300048926 | Bacteria | 187479 |
| 953 | Ga0496123_0003683 | 3300048926 | Bacteria | 16896 |
| 954 | Ga0496124_0010436 | 3300048927 | Bacteria | 9401 |
| 955 | Ga0496124_0017631 | 3300048927 | Bacteria | 6723 |
| 956 | Ga0496124_0023504 | 3300048927 | Bacteria | 5625 |
| 957 | Ga0496124_0075273 | 3300048927 | Bacteria | 2789 |
| 958 | Ga0496124_0314938 | 3300048927 | Bacteria | 1123 |
| 959 | Ga0496125_0000368 | 3300048928 | Bacteria | 84924 |
| 960 | Ga0496125_0015656 | 3300048928 | Bacteria | 7317 |
| 961 | Ga0496125_0022691 | 3300048928 | Bacteria | 5820 |
| 962 | Ga0496125_0356719 | 3300048928 | Bacteria | 871 |
| 963 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 964 | Ga0495678_000034 | 3300049459 | Bacteria | 207827 |
| 965 | Ga0495678_000383 | 3300049459 | Bacteria | 44894 |
| 966 | Ga0495678_001376 | 3300049459 | Bacteria | 19384 |
| 967 | Ga0495678_004680 | 3300049459 | Bacteria | 7830 |
| 968 | Ga0495678_009666 | 3300049459 | Bacteria | 4744 |
| 969 | Ga0495682_0008734 | 3300049460 | Bacteria | 3986 |
| 970 | Ga0495682_0023768 | 3300049460 | Bacteria | 2286 |
| 971 | Ga0495682_0035992 | 3300049460 | Bacteria | 1822 |
| 972 | Ga0495682_0042554 | 3300049460 | Bacteria | 1664 |
| 973 | Ga0501313_011247 | 3300049529 | Bacteria | 1030 |
| 974 | Ga0501031_0007227 | 3300049568 | Bacteria | 7246 |
| 975 | Ga0501031_0023720 | 3300049568 | Bacteria | 3998 |
| 976 | Ga0501031_0047236 | 3300049568 | Bacteria | 2806 |
| 977 | Ga0501031_0083405 | 3300049568 | Bacteria | 2083 |
| 978 | Ga0501031_0233715 | 3300049568 | Bacteria | 1196 |
| 979 | Ga0501032_0000993 | 3300049569 | Bacteria | 22838 |
| 980 | Ga0501032_0003737 | 3300049569 | Bacteria | 11547 |
| 981 | Ga0501032_0008533 | 3300049569 | Bacteria | 7472 |
| 982 | Ga0501032_0009695 | 3300049569 | Bacteria | 6973 |
| 983 | Ga0501032_0010759 | 3300049569 | Bacteria | 6586 |
| 984 | Ga0501033_0001281 | 3300049570 | Bacteria | 22428 |
| 985 | Ga0501033_0003589 | 3300049570 | Bacteria | 12679 |
| 986 | Ga0501033_0094590 | 3300049570 | Bacteria | 2185 |
| 987 | Ga0501033_0097761 | 3300049570 | Bacteria | 2144 |
| 988 | Ga0501034_0010675 | 3300049571 | Bacteria | 9544 |
| 989 | Ga0501034_0047250 | 3300049571 | Bacteria | 4348 |
| 990 | Ga0501036_0004255 | 3300049572 | Bacteria | 11545 |
| 991 | Ga0501036_0007404 | 3300049572 | Bacteria | 8944 |
| 992 | Ga0501036_0023088 | 3300049572 | Bacteria | 5235 |
| 993 | Ga0501036_0041052 | 3300049572 | Bacteria | 3916 |
| 994 | Ga0501036_0532592 | 3300049572 | Bacteria | 976 |
| 995 | Ga0501037_0018199 | 3300049573 | Bacteria | 5176 |
| 996 | Ga0501037_0152888 | 3300049573 | Bacteria | 1648 |
| 997 | Ga0501038_0003012 | 3300049574 | Bacteria | 15712 |
| 998 | Ga0501038_0014124 | 3300049574 | Bacteria | 7275 |
| 999 | Ga0501038_0021009 | 3300049574 | Bacteria | 5865 |
| 1000 | Ga0501038_0022730 | 3300049574 | Bacteria | 5613 |
| 1001 | Ga0501038_0048365 | 3300049574 | Bacteria | 3681 |
| 1002 | Ga0501038_0064086 | 3300049574 | Bacteria | 3135 |
| 1003 | Ga0501038_0245046 | 3300049574 | Bacteria | 1421 |
| 1004 | Ga0501039_0070245 | 3300049575 | Bacteria | 2720 |
| 1005 | Ga0501039_0194977 | 3300049575 | Bacteria | 1592 |
| 1006 | Ga0501039_0205027 | 3300049575 | Bacteria | 1550 |
| 1007 | Ga0501040_0009384 | 3300049576 | Bacteria | 6374 |
| 1008 | Ga0501040_0036297 | 3300049576 | Bacteria | 3344 |
| 1009 | Ga0501041_0064783 | 3300049577 | Bacteria | 2238 |
| 1010 | Ga0501042_0095513 | 3300049578 | Bacteria | 2135 |
| 1011 | Ga0501043_0001204 | 3300049579 | Bacteria | 22765 |
| 1012 | Ga0501043_0003787 | 3300049579 | Bacteria | 12433 |
| 1013 | Ga0501043_0006411 | 3300049579 | Bacteria | 9451 |
| 1014 | Ga0501043_0074970 | 3300049579 | Bacteria | 2657 |
| 1015 | Ga0501043_0099085 | 3300049579 | Bacteria | 2291 |
| 1016 | Ga0501046_0000851 | 3300049580 | Bacteria | 29697 |
| 1017 | Ga0501046_0010292 | 3300049580 | Bacteria | 8047 |
| 1018 | Ga0501046_0025411 | 3300049580 | Bacteria | 4847 |
| 1019 | Ga0501047_0009059 | 3300049581 | Bacteria | 9398 |
| 1020 | Ga0501047_0013028 | 3300049581 | Bacteria | 7875 |
| 1021 | Ga0501047_0118332 | 3300049581 | Bacteria | 2531 |
| 1022 | Ga0501048_0006174 | 3300049582 | Bacteria | 9119 |
| 1023 | Ga0501048_0031474 | 3300049582 | Bacteria | 3838 |
| 1024 | Ga0501048_0511305 | 3300049582 | Bacteria | 861 |
| 1025 | Ga0501068_0007808 | 3300049584 | Bacteria | 5927 |
| 1026 | Ga0501069_0333703 | 3300049585 | Bacteria | 892 |
| 1027 | Ga0501071_0159016 | 3300049587 | Bacteria | 1688 |
| 1028 | Ga0501076_0099498 | 3300049592 | Bacteria | 2343 |
| 1029 | Ga0501077_0296754 | 3300049593 | Bacteria | 1029 |
| 1030 | Ga0501083_0190954 | 3300049744 | Bacteria | 1337 |
| 1031 | Ga0501269_000473 | 3300049766 | Bacteria | 8609 |
| 1032 | Ga0501035_0000450 | 3300049822 | Bacteria | 46029 |
| 1033 | Ga0501035_0001403 | 3300049822 | Bacteria | 24742 |
| 1034 | Ga0501035_0006010 | 3300049822 | Bacteria | 11433 |
| 1035 | Ga0501035_0039300 | 3300049822 | Bacteria | 4282 |
| 1036 | Ga0501035_0094400 | 3300049822 | Bacteria | 2630 |
| 1037 | Ga0501044_0000068 | 3300049823 | Bacteria | 126642 |
| 1038 | Ga0501044_0002232 | 3300049823 | Bacteria | 22168 |
| 1039 | Ga0501044_0003674 | 3300049823 | Bacteria | 17246 |
| 1040 | Ga0501044_0069533 | 3300049823 | Bacteria | 3584 |
| 1041 | Ga0501044_0151081 | 3300049823 | Bacteria | 2304 |
| 1042 | Ga0501044_0411021 | 3300049823 | Bacteria | 1264 |
| 1043 | Ga0501044_0479769 | 3300049823 | Bacteria | 1147 |
| 1044 | Ga0501045_0038488 | 3300049824 | Bacteria | 3478 |
| 1045 | Ga0501045_0084777 | 3300049824 | Bacteria | 2338 |
| 1046 | Ga0501045_0085123 | 3300049824 | Bacteria | 2333 |
| 1047 | nmdc:mga05p37_379775_c1 | 3300050507 | Bacteria | 1656 |
| 1048 | nmdc:mga06r32_493829_c1 | 3300050510 | Bacteria | 1201 |
| 1049 | nmdc:mga08y16_26878_c1 | 3300050511 | Bacteria | 6065 |
| 1050 | nmdc:mga08y16_41626_c1 | 3300050511 | Bacteria | 4812 |
| 1051 | nmdc:mga0rr50_21481_c1 | 3300050513 | Bacteria | 4407 |
| 1052 | nmdc:mga0a205_245298_c1 | 3300050515 | Bacteria | 1672 |
| 1053 | Ga0495601_0022528 | 3300053077 | Bacteria | 3867 |
| 1054 | Ga0495595_0068653 | 3300053084 | Bacteria | 1672 |
| 1055 | Ga0495619_0083858 | 3300053085 | Bacteria | 2150 |
| 1056 | Ga0495619_0195917 | 3300053085 | Bacteria | 1399 |
| 1057 | Ga0495619_0526661 | 3300053085 | Bacteria | 812 |
| 1058 | Ga0500618_000653 | 3300053125 | Bacteria | 20633 |
| 1059 | Ga0500574_000047 | 3300053141 | Bacteria | 14143 |
| 1060 | Ga0500619_001638 | 3300053154 | Bacteria | 4031 |
| 1061 | Ga0587084_000383 | 3300059477 | Bacteria | 3349 |
| 1062 | Ga0587066_022305 | 3300059490 | Bacteria | 1058 |
| 1063 | Ga0587080_001172 | 3300059503 | Bacteria | 2718 |
| 1064 | Ga0587082_041449 | 3300059504 | Bacteria | 845 |
| 1065 | Ga0587090_012266 | 3300059510 | Bacteria | 1220 |
| 1066 | Ga0587067_006197 | 3300059640 | Bacteria | 1657 |
| 1067 | Ga0587068_000998 | 3300059641 | Bacteria | 2980 |
| 1068 | Ga0587068_018470 | 3300059641 | Bacteria | 1123 |
| 1069 | Ga0587069_024441 | 3300059642 | Bacteria | 932 |
| 1070 | Ga0587078_010017 | 3300059646 | Bacteria | 1083 |
| 1071 | Ga0587079_020003 | 3300059647 | Bacteria | 1190 |
| 1072 | Ga0587111_0030375 | 3300060346 | Bacteria | 1100 |
| 1073 | Ga0501082_0397025 | 3300060353 | Bacteria | 1203 |
| 1074 | Ga0466962_0018529 | 3300061719 | Bacteria | 3348 |
| 1075 | 2509130720 | 2508501125 | Bacteria | 7208311 |
| 1076 | 2511250319 | 2511231003 | Bacteria | 5606035 |
| 1077 | 2511387575 | 2511231026 | Bacteria | 5225445 |
| 1078 | 2513962723 | 2513237151 | Bacteria | 6309801 |
| 1079 | 2521559825 | 2521172590 | Bacteria | 5047645 |
| 1080 | 2550693198 | 2548876994 | Bacteria | 4904866 |
| 1081 | 2553007041 | 2551306416 | Bacteria | 6152985 |
| 1082 | 2601672280 | 2600255292 | Bacteria | 6300551 |
| 1083 | 2643791751 | 2643221554 | Bacteria | 6603920 |
| 1084 | 2643796626 | 2643221556 | Bacteria | 7251154 |
| 1085 | 2644027062 | 2643221603 | Bacteria | 6147767 |
| 1086 | 2644216770 | 2643221638 | Bacteria | 6579467 |
| 1087 | 2644254520 | 2643221645 | Bacteria | 7207331 |
| 1088 | 2644360067 | 2643221664 | Bacteria | 7272945 |
| 1089 | 2644472748 | 2643221684 | Bacteria | 7145183 |
| 1090 | 2678229772 | 2675903507 | Bacteria | 3737791 |
| 1091 | 2723879546 | 2721755763 | Bacteria | 4464185 |
| 1092 | 2738742908 | 2738541280 | Bacteria | 6630198 |
| 1093 | 2738827059 | 2738541297 | Bacteria | 6549566 |
| 1094 | 2738845996 | 2738541300 | Bacteria | 6675882 |
| 1095 | 2739150856 | 2738541357 | Bacteria | 6549408 |
| 1096 | 2739192775 | 2738543003 | Bacteria | 6549560 |
| 1097 | 2739276904 | 2738543018 | Bacteria | 6718814 |
| 1098 | 2739319252 | 2738543026 | Bacteria | 6549408 |
| 1099 | 2739337493 | 2738543029 | Bacteria | 6549249 |
| 1100 | 2739345948 | 2738543030 | Bacteria | 6719714 |
| 1101 | 2746087352 | 2744054900 | Bacteria | 8399525 |
| 1102 | 2746093141 | 2744054901 | Bacteria | 8397047 |
| 1103 | 2765571081 | 2765235838 | Bacteria | 5445269 |
| 1104 | 2808984989 | 2808606386 | Bacteria | 4471946 |
| 1105 | 2809130121 | 2808606415 | Bacteria | 4576710 |
| 1106 | 2809145546 | 2808606418 | Bacteria | 6724496 |
| 1107 | 2809150402 | 2808606419 | Bacteria | 4576925 |
| 1108 | 2819544513 | 2818991436 | Bacteria | 5376622 |
| 1109 | 2819594072 | 2818991445 | Bacteria | 4955017 |
| 1110 | 2819618266 | 2818991449 | Bacteria | 5518009 |
| 1111 | 2821136479 | 2821131069 | Bacteria | 6108407 |
| 1112 | 2828308164 | 2828305725 | Bacteria | 4916900 |
| 1113 | 2839096677 | 2839094727 | Bacteria | 5534556 |
| 1114 | 2842713688 | 2842711865 | Bacteria | 7155354 |
| 1115 | 2846036739 | 2846033681 | Bacteria | 4377894 |
| 1116 | 2846042157 | 2846037992 | Bacteria | 4526407 |
| 1117 | 2852621374 | 2852618963 | Bacteria | 4577824 |
| 1118 | 2857549311 | 2857547612 | Bacteria | 6179999 |
| 1119 | 2857558528 | 2857553236 | Bacteria | 6166726 |
| 1120 | 2857562343 | 2857558681 | Bacteria | 6617694 |
| 1121 | 2857568296 | 2857564685 | Bacteria | 6290584 |
| 1122 | 2884815177 | 2884811622 | Bacteria | 5552861 |
| 1123 | 2884839899 | 2884836552 | Bacteria | 5219991 |
| 1124 | 2884856290 | 2884852848 | Bacteria | 5221161 |
| 1125 | 2885081343 | 2885080285 | Bacteria | 6355622 |
| 1126 | 2896158655 | 2896154374 | Bacteria | 5221518 |
| 1127 | 2900637200 | 2900634093 | Bacteria | 10263517 |
| 1128 | 2904428561 | 2904424332 | Bacteria | 7633521 |
| 1129 | 2904444391 | 2904439833 | Bacteria | 5931679 |
| 1130 | 2904490244 | 2904483920 | Bacteria | 7545285 |
| 1131 | 2904535544 | 2904530477 | Bacteria | 5876334 |
| 1132 | 2904588116 | 2904584206 | Bacteria | 6028872 |
| 1133 | 2904595152 | 2904589729 | Bacteria | 6113573 |
| 1134 | 2904606065 | 2904601388 | Bacteria | 5884906 |
| 1135 | 2916182549 | 2916178963 | Bacteria | 5265078 |
| 1136 | 2919051309 | 2919046199 | Bacteria | 5567169 |
| 1137 | 2919084263 | 2919079590 | Bacteria | 5946433 |
| 1138 | 2919477228 | 2919476304 | Bacteria | 5888696 |
| 1139 | 2919533414 | 2919527303 | Bacteria | 7718827 |
| 1140 | 2923513592 | 2923510766 | Bacteria | 5926163 |
| 1141 | 2928135291 | 2928130867 | Bacteria | 5467269 |
| 1142 | 2932416365 | 2932410948 | Bacteria | 6312192 |
| 1143 | 2932422242 | 2932416698 | Bacteria | 6315112 |
| 1144 | 642623073 | 642555113 | Bacteria | 8214658 |
| 1145 | 8047675699 | 8047673197 | Bacteria | 7395230 |
| 1146 | 8055307286 | 8055301274 | Bacteria | 8587385 |
| 1147 | Ga0105244_10006687 | |||
| 1148 | JGI25155J39150_1000864 | |||
| 1149 | JGI25156J39149_1008946 | |||
| 1150 | JGI25162J39368_1004179 | |||
| 1151 | JGI25162J39368_1013055 | |||
| 1152 | JGI25154J39366_1000845 | |||
| 1153 | JGI25158J39367_1000818 | |||
| 1154 | JGI25158J39367_1008485 | |||
| 1155 | JGI25158J39367_1024630 | |||
| 1156 | JGI25157J39369_1000372 | |||
| 1157 | JGI25152J39213_1001993 | |||
| 1158 | JGI25152J39213_1009823 | |||
| 1159 | JGI25150J39212_1000910 | |||
| 1160 | JGI25150J39212_1001503 | |||
| 1161 | JGI25159J45721_1005724 | |||
| 1162 | JGI25159J45721_1007426 | |||
| 1163 | JGI25159J45721_1015531 | |||
| 1164 | JGI25165J46597_1000713 | |||
| 1165 | JGI25165J46597_1001348 | |||
| 1166 | JGI25153J46596_10004223 | |||
| 1167 | JGI25160J50197_1003453 | |||
| 1168 | JGI25161J50226_1007576 | |||
| 1169 | Ga0007409J51694_1012308 | |||
| 1170 | Ga0007416J51690_1027150 | |||
| 1171 | Ga0032354_1062149 | |||
| 1172 | Ga0055538_1000062 | |||
| 1173 | Ga0055538_1000281 | |||
| 1174 | Ga0055539_1000093 | |||
| 1175 | Ga0055539_1000305 | |||
| 1176 | Ga0055533_1000105 | |||
| 1177 | Ga0055533_1000286 | |||
| 1178 | Ga0055533_1000737 | |||
| 1179 | Ga0055533_1002031 | |||
| 1180 | Ga0055532_1000034 | |||
| 1181 | Ga0055532_1000092 | |||
| 1182 | Ga0055525_1000018 | |||
| 1183 | Ga0055525_1000137 | |||
| 1184 | Ga0055525_1000405 | |||
| 1185 | Ga0055527_1000035 | |||
| 1186 | Ga0055535_1000050 | |||
| 1187 | Ga0055535_1013520 | |||
| 1188 | Ga0055542_1000120 | |||
| 1189 | Ga0055529_1000089 | |||
| 1190 | Ga0055529_1000152 | |||
| 1191 | Ga0055526_1001033 | |||
| 1192 | Ga0055526_1003235 | |||
| 1193 | Ga0055526_1004446 | |||
| 1194 | Ga0055526_1005708 | |||
| 1195 | Ga0055526_1007871 | |||
| 1196 | Ga0055537_1000580 | |||
| 1197 | Ga0055537_1012740 | |||
| 1198 | Ga0055524_1000899 | |||
| 1199 | Ga0055524_1002755 | |||
| 1200 | Ga0055524_1003183 | |||
| 1201 | Ga0055524_1003663 | |||
| 1202 | Ga0055524_1008827 | |||
| 1203 | Ga0055524_1010041 | |||
| 1204 | Ga0055524_1011926 | |||
| 1205 | Ga0055534_1000283 | |||
| 1206 | Ga0055534_1005190 | |||
| 1207 | Ga0055534_1022725 | |||
| 1208 | Ga0055528_1000495 | |||
| 1209 | Ga0055528_1006705 | |||
| 1210 | Ga0055530_10003928 | |||
| 1211 | Ga0055530_10008706 | |||
| 1212 | Ga0055530_10019894 | |||
| 1213 | Ga0055531_10021682 | |||
| 1214 | Ga0055531_10041167 | |||
| 1215 | Ga0055541_1000063 | |||
| 1216 | Ga0055541_1000198 | |||
| 1217 | Ga0058692_1000027 | |||
| 1218 | Ga0055543_1002300 | |||
| 1219 | Ga0055543_1010334 | |||
| 1220 | Ga0065165_1002857 | |||
| 1221 | Ga0065165_1004075 | |||
| 1222 | Ga0065165_1006132 | |||
| 1223 | Ga0065165_1013870 | |||
| 1224 | Ga0065165_1041906 | |||
| 1225 | Ga0065703_1000515 | |||
| 1226 | Ga0065714_10127055 | |||
| 1227 | Ga0070683_100267191 | |||
| 1228 | Ga0070670_100599001 | |||
| 1229 | Ga0070680_100334382 | |||
| 1230 | Ga0070680_100437688 | |||
| 1231 | Ga0070682_100022524 | |||
| 1232 | Ga0070660_100022139 | |||
| 1233 | Ga0070660_100044408 | |||
| 1234 | Ga0070661_100025891 | |||
| 1235 | Ga0070668_100419691 | |||
| 1236 | Ga0070669_100003722 | |||
| 1237 | Ga0070675_100605379 | |||
| 1238 | Ga0070674_100830540 | |||
| 1239 | Ga0070659_100001752 | |||
| 1240 | Ga0070659_100676594 | |||
| 1241 | Ga0070667_100131493 | |||
| 1242 | Ga0070714_100012283 | |||
| 1243 | Ga0070663_100011336 | |||
| 1244 | Ga0070663_100043195 | |||
| 1245 | Ga0070663_100205529 | |||
| 1246 | Ga0070663_100741381 | |||
| 1247 | Ga0070662_100036858 | |||
| 1248 | Ga0070662_100133362 | |||
| 1249 | Ga0070681_10467082 | |||
| 1250 | Ga0070706_100042249 | |||
| 1251 | Ga0070706_100074408 | |||
| 1252 | Ga0070707_100252943 | |||
| 1253 | Ga0070699_100795151 | |||
| 1254 | Ga0070679_100087655 | |||
| 1255 | Ga0070684_100840667 | |||
| 1256 | Ga0070697_100055245 | |||
| 1257 | Ga0070697_100064585 | |||
| 1258 | Ga0070697_100084697 | |||
| 1259 | Ga0068853_100127886 | |||
| 1260 | Ga0070695_100010846 | |||
| 1261 | Ga0070696_100389706 | |||
| 1262 | Ga0070665_100016024 | |||
| 1263 | Ga0070704_100322552 | |||
| 1264 | Ga0068855_100025280 | |||
| 1265 | Ga0068855_100035272 | |||
| 1266 | Ga0068855_100365494 | |||
| 1267 | Ga0068855_100459419 | |||
| 1268 | Ga0068854_100007632 | |||
| 1269 | Ga0068856_100165342 | |||
| 1270 | Ga0068856_100438406 | |||
| 1271 | Ga0068852_100004237 | |||
| 1272 | Ga0068859_100137698 | |||
| 1273 | Ga0068863_100349786 | |||
| 1274 | Ga0068860_100028951 | |||
| 1275 | Ga0068860_100205246 | |||
| 1276 | Ga0070717_10119390 | |||
| 1277 | Ga0070717_10186186 | |||
| 1278 | Ga0070717_10963357 | |||
| 1279 | Ga0070712_100003531 | |||
| 1280 | Ga0075434_100013297 | |||
| 1281 | Ga0097620_100137704 | |||
| 1282 | Ga0079104_1013403 | |||
| 1283 | Ga0099826_10000010 | |||
| 1284 | Ga0075435_100025552 | |||
| 1285 | Ga0105244_10002041 | |||
| 1286 | Ga0105244_10029464 | |||
| 1287 | Ga0105244_10065752 | |||
| 1288 | Ga0105244_10099021 | |||
| 1289 | Ga0105240_10001608 | |||
| 1290 | Ga0105240_10007637 | |||
| 1291 | Ga0105240_10016336 | |||
| 1292 | Ga0105240_10038235 | |||
| 1293 | Ga0105240_10070890 | |||
| 1294 | Ga0105240_10146806 | |||
| 1295 | Ga0111539_10029979 | |||
| 1296 | Ga0111539_10124601 | |||
| 1297 | Ga0105245_10711439 | |||
| 1298 | Ga0105247_10003833 | |||
| 1299 | Ga0114129_10241688 | |||
| 1300 | Ga0105243_10000343 | |||
| 1301 | Ga0105243_10280106 | |||
| 1302 | Ga0105241_10603550 | |||
| 1303 | Ga0105242_10046831 | |||
| 1304 | Ga0105237_10034417 | |||
| 1305 | Ga0105237_10099866 | |||
| 1306 | Ga0105238_10000763 | |||
| 1307 | Ga0105238_10183076 | |||
| 1308 | Ga0105249_10719777 | |||
| 1309 | Ga0105239_10010387 | |||
| 1310 | Ga0105239_10328870 | |||
| 1311 | Ga0105246_10178491 | |||
| 1312 | Ga0157371_10000018 | |||
| 1313 | Ga0157370_10247198 | |||
| 1314 | Ga0157370_10653786 | |||
| 1315 | Ga0157374_10202904 | |||
| 1316 | Ga0157374_10213758 | |||
| 1317 | Ga0157378_10271726 | |||
| 1318 | Ga0157378_10399506 | |||
| 1319 | Ga0163162_10154463 | |||
| 1320 | Ga0163163_10095925 | |||
| 1321 | Ga0163163_10344627 | |||
| 1322 | Ga0182008_10003605 | |||
| 1323 | Ga0182008_10022601 | |||
| 1324 | Ga0182008_10054820 | |||
| 1325 | Ga0182006_1000033 | |||
| 1326 | Ga0182006_1000080 | |||
| 1327 | Ga0182006_1005060 | |||
| 1328 | Ga0182006_1012892 | |||
| 1329 | Ga0182006_1082631 | |||
| 1330 | Ga0182007_10000042 | |||
| 1331 | Ga0182007_10003815 | |||
| 1332 | Ga0182007_10006803 | |||
| 1333 | Ga0182005_1000016 | |||
| 1334 | Ga0182005_1000024 | |||
| 1335 | Ga0182005_1001434 | |||
| 1336 | Ga0163161_10012023 | |||
| 1337 | Ga0163161_10056209 | |||
| 1338 | Ga0163161_10095458 | |||
| 1339 | Ga0197907_10734725 | |||
| 1340 | Ga0206355_1336031 | |||
| 1341 | Ga0206350_11154362 | |||
| 1342 | Ga0206354_10998826 | |||
| 1343 | Ga0206353_10779650 | |||
| 1344 | Ga0213872_10000430 | |||
| 1345 | Ga0213872_10004434 | |||
| 1346 | Ga0213872_10004797 | |||
| 1347 | Ga0213872_10011815 | |||
| 1348 | Ga0213872_10128204 | |||
| 1349 | Ga0224712_10003485 | |||
| 1350 | Ga0209435_100007 | |||
| 1351 | Ga0209436_101663 | |||
| 1352 | Ga0209436_102178 | |||
| 1353 | Ga0209436_104811 | |||
| 1354 | Ga0209784_100010 | |||
| 1355 | Ga0209784_100021 | |||
| 1356 | Ga0209566_100008 | |||
| 1357 | Ga0209566_100119 | |||
| 1358 | Ga0209674_100019 | |||
| 1359 | Ga0209674_100036 | |||
| 1360 | Ga0209674_100259 | |||
| 1361 | Ga0209147_100017 | |||
| 1362 | Ga0209563_100011 | |||
| 1363 | Ga0209563_100021 | |||
| 1364 | Ga0209563_100040 | |||
| 1365 | Ga0207427_100759 | |||
| 1366 | Ga0207427_100936 | |||
| 1367 | Ga0209437_100019 | |||
| 1368 | Ga0209437_100332 | |||
| 1369 | Ga0209437_105500 | |||
| 1370 | Ga0209258_101277 | |||
| 1371 | Ga0207425_1000021 | |||
| 1372 | Ga0207425_1000829 | |||
| 1373 | Ga0207425_1001943 | |||
| 1374 | Ga0207425_1018992 | |||
| 1375 | Ga0209646_1000044 | |||
| 1376 | Ga0209646_1000107 | |||
| 1377 | Ga0209646_1000190 | |||
| 1378 | Ga0209026_1000063 | |||
| 1379 | Ga0209677_100011 | |||
| 1380 | Ga0209677_100023 | |||
| 1381 | Ga0209677_101699 | |||
| 1382 | Ga0209148_1000237 | |||
| 1383 | Ga0209759_1000048 | |||
| 1384 | Ga0209759_1000195 | |||
| 1385 | Ga0209759_1000351 | |||
| 1386 | Ga0209759_1003045 | |||
| 1387 | Ga0209129_1000020 | |||
| 1388 | Ga0209129_1014565 | |||
| 1389 | Ga0209233_1000025 | |||
| 1390 | Ga0209233_1000173 | |||
| 1391 | Ga0209565_1000055 | |||
| 1392 | Ga0209565_1000677 | |||
| 1393 | Ga0209565_1002957 | |||
| 1394 | Ga0209565_1003264 | |||
| 1395 | Ga0209565_1010498 | |||
| 1396 | Ga0209455_1000070 | |||
| 1397 | Ga0209455_1004771 | |||
| 1398 | Ga0209673_1000040 | |||
| 1399 | Ga0209673_1003338 | |||
| 1400 | Ga0209673_1053678 | |||
| 1401 | Ga0209130_1000169 | |||
| 1402 | Ga0209130_1002260 | |||
| 1403 | Ga0209130_1003537 | |||
| 1404 | Ga0209675_1000052 | |||
| 1405 | Ga0209675_1007962 | |||
| 1406 | Ga0209675_1008529 | |||
| 1407 | Ga0209025_1001876 | |||
| 1408 | Ga0209564_1000027 | |||
| 1409 | Ga0209564_1000047 | |||
| 1410 | Ga0209564_1000063 | |||
| 1411 | Ga0209564_1000271 | |||
| 1412 | Ga0209564_1001666 | |||
| 1413 | Ga0209564_1022873 | |||
| 1414 | Ga0209758_1000288 | |||
| 1415 | Ga0209758_1000436 | |||
| 1416 | Ga0209050_1000050 | |||
| 1417 | Ga0209050_1005131 | |||
| 1418 | Ga0209050_1006673 | |||
| 1419 | Ga0209256_1000054 | |||
| 1420 | Ga0209256_1000100 | |||
| 1421 | Ga0209256_1000754 | |||
| 1422 | Ga0209256_1004828 | |||
| 1423 | Ga0209256_1005964 | |||
| 1424 | Ga0207426_1003112 | |||
| 1425 | Ga0207426_1036654 | |||
| 1426 | Ga0209257_1006073 | |||
| 1427 | Ga0209257_1009189 | |||
| 1428 | Ga0207696_1021563 | |||
| 1429 | Ga0207655_1001604 | |||
| 1430 | Ga0207655_1001651 | |||
| 1431 | Ga0207655_1004763 | |||
| 1432 | Ga0207713_1002759 | |||
| 1433 | Ga0207713_1002761 | |||
| 1434 | Ga0207710_10000057 | |||
| 1435 | Ga0207705_10009748 | |||
| 1436 | Ga0207705_10121345 | |||
| 1437 | Ga0207684_10025468 | |||
| 1438 | Ga0207684_10103272 | |||
| 1439 | Ga0207654_10112395 | |||
| 1440 | Ga0207654_10146993 | |||
| 1441 | Ga0207707_10070128 | |||
| 1442 | Ga0207695_10007667 | |||
| 1443 | Ga0207695_10008939 | |||
| 1444 | Ga0207695_10012318 | |||
| 1445 | Ga0207695_10060948 | |||
| 1446 | Ga0207695_10100367 | |||
| 1447 | Ga0207695_10135206 | |||
| 1448 | Ga0207695_10209182 | |||
| 1449 | Ga0207695_10393672 | |||
| 1450 | Ga0207671_10004652 | |||
| 1451 | Ga0207671_10069660 | |||
| 1452 | Ga0207660_10317649 | |||
| 1453 | Ga0207657_10012688 | |||
| 1454 | Ga0207657_10027581 | |||
| 1455 | Ga0207649_10009529 | |||
| 1456 | Ga0207652_10454486 | |||
| 1457 | Ga0207646_10014703 | |||
| 1458 | Ga0207681_10002504 | |||
| 1459 | Ga0207694_10013544 | |||
| 1460 | Ga0207650_10046359 | |||
| 1461 | Ga0207650_10262264 | |||
| 1462 | Ga0207687_10042299 | |||
| 1463 | Ga0207700_10078045 | |||
| 1464 | Ga0207664_10023812 | |||
| 1465 | Ga0207690_10000951 | |||
| 1466 | Ga0207690_10013294 | |||
| 1467 | Ga0207690_10214873 | |||
| 1468 | Ga0207706_10110175 | |||
| 1469 | Ga0207706_10111892 | |||
| 1470 | Ga0207686_10034904 | |||
| 1471 | Ga0207709_10000057 | |||
| 1472 | Ga0207709_10277379 | |||
| 1473 | Ga0207661_10557896 | |||
| 1474 | Ga0207679_10010560 | |||
| 1475 | Ga0207667_10000912 | |||
| 1476 | Ga0207667_10020489 | |||
| 1477 | Ga0207667_10145306 | |||
| 1478 | Ga0207667_10502785 | |||
| 1479 | Ga0207668_10035510 | |||
| 1480 | Ga0207668_10270570 | |||
| 1481 | Ga0207640_10064502 | |||
| 1482 | Ga0207658_10028565 | |||
| 1483 | Ga0207703_10052391 | |||
| 1484 | Ga0207639_10550936 | |||
| 1485 | Ga0207678_10021915 | |||
| 1486 | Ga0207678_10097386 | |||
| 1487 | Ga0207702_10363895 | |||
| 1488 | Ga0207702_10539705 | |||
| 1489 | Ga0207702_10887820 | |||
| 1490 | Ga0207641_10700557 | |||
| 1491 | Ga0207674_10204005 | |||
| 1492 | Ga0207674_10632048 | |||
| 1493 | Ga0207683_10369797 | |||
| 1494 | Ga0207683_10680611 | |||
| 1495 | Ga0207698_10166721 | |||
| 1496 | Ga0209281_1005141 | |||
| 1497 | Ga0209371_1000074 | |||
| 1498 | Ga0209371_1004235 | |||
| 1499 | Ga0209970_1022343 | |||
| 1500 | Ga0209983_1048630 | |||
| 1501 | Ga0209282_1000009 | |||
| 1502 | Ga0209974_10034083 | |||
| 1503 | Ga0207428_10037235 | |||
| 1504 | Ga0207428_10146957 | |||
| 1505 | Ga0268264_10064081 | |||
| 1506 | Ga0265334_10037067 | |||
| 1507 | Ga0307515_10000037 | |||
| 1508 | Ga0307515_10001585 | |||
| 1509 | Ga0307515_10002662 | |||
| 1510 | Ga0307515_10120443 | |||
| 1511 | Ga0268256_1000067 | |||
| 1512 | Ga0268256_1003593 | |||
| 1513 | Ga0316177_1056605 | |||
| 1514 | Ga0316180_1139639 | |||
| 1515 | Ga0316181_1015625 | |||
| 1516 | Ga0265330_10007637 | |||
| 1517 | Ga0265332_10000253 | |||
| 1518 | Ga0265325_10056921 | |||
| 1519 | Ga0265329_10001506 | |||
| 1520 | Ga0265331_10004185 | |||
| 1521 | Ga0265327_10016288 | |||
| 1522 | Ga0265316_10004554 | |||
| 1523 | Ga0307513_10004052 | |||
| 1524 | Ga0307513_10405500 | |||
| 1525 | Ga0307408_100000432 | |||
| 1526 | Ga0307408_100002407 | |||
| 1527 | Ga0307408_100009332 | |||
| 1528 | Ga0307408_100042644 | |||
| 1529 | Ga0265314_10036954 | |||
| 1530 | Ga0307516_10001680 | |||
| 1531 | Ga0307516_10078081 | |||
| 1532 | Ga0307405_10570872 | |||
| 1533 | Ga0307518_10120389 | |||
| 1534 | Ga0307410_10176546 | |||
| 1535 | Ga0307406_10333007 | |||
| 1536 | Ga0307412_10366015 | |||
| 1537 | Ga0307416_100000975 | |||
| 1538 | Ga0307414_10072470 | |||
| 1539 | Ga0307414_10448523 | |||
| 1540 | Ga0373953_0207558 | |||
| 1541 | Ga0373931_0201987 | |||
| 1542 | Ga0373935_0188183 | |||
| 1543 | Ga0373935_0413182 | |||
| 1544 | Ga0373927_0003380 | |||
| 1545 | Ga0373927_0067197 | |||
| 1546 | Ga0373927_0109525 | |||
| 1547 | Ga0373933_0187494 | |||
| 1548 | Ga0373947_0139128 | |||
| 1549 | Ga0373937_0043911 | |||
| 1550 | Ga0373937_0167163 | |||
| 1551 | Ga0373937_0959462 | |||
| 1552 | Ga0373925_0021367 | |||
| 1553 | Ga0373925_0485079 | |||
| 1554 | Ga0373925_0690712 | |||
| 1555 | Ga0395899_0000521 | |||
| 1556 | Ga0395899_0002806 | |||
| 1557 | Ga0395899_0003830 | |||
| 1558 | Ga0395899_0010327 | |||
| 1559 | Ga0395899_0011850 | |||
| 1560 | Ga0395899_0079948 | |||
| 1561 | Ga0395899_0170770 | |||
| 1562 | Ga0395900_0010081 | |||
| 1563 | Ga0395900_0014022 | |||
| 1564 | Ga0395900_0031672 | |||
| 1565 | Ga0395900_0036395 | |||
| 1566 | Ga0395900_0038700 | |||
| 1567 | Ga0395900_0147914 | |||
| 1568 | Ga0395898_0020590 | |||
| 1569 | Ga0395898_0031143 | |||
| 1570 | Ga0395898_0420563 | |||
| 1571 | Ga0395905_0010442 | |||
| 1572 | Ga0395905_0013127 | |||
| 1573 | Ga0395905_0030081 | |||
| 1574 | Ga0395905_0085053 | |||
| 1575 | Ga0395905_0109483 | |||
| 1576 | Ga0395905_0280476 | |||
| 1577 | Ga0395901_0002710 | |||
| 1578 | Ga0395901_0002897 | |||
| 1579 | Ga0395901_0027008 | |||
| 1580 | Ga0395901_0357208 | |||
| 1581 | Ga0395901_0637442 | |||
| 1582 | Ga0436365_0436116 | |||
| 1583 | Ga0436360_0123446 | |||
| 1584 | Ga0436361_0009051 | |||
| 1585 | Ga0436361_0013073 | |||
| 1586 | Ga0436361_0039131 | |||
| 1587 | Ga0436361_0167678 | |||
| 1588 | Ga0436361_0389557 | |||
| 1589 | Ga0436361_0558892 | |||
| 1590 | Ga0436361_0930389 | |||
| 1591 | Ga0436361_0959711 | |||
| 1592 | Ga0436362_1188435 | |||
| 1593 | Ga0439466_0015406 | |||
| 1594 | Ga0451843_1496344 | |||
| 1595 | Ga0439448_0031608 | |||
| 1596 | Ga0439455_0005794 | |||
| 1597 | Ga0439455_0016980 | |||
| 1598 | Ga0450904_001582 | |||
| 1599 | Ga0439458_0054788 | |||
| 1600 | Ga0450893_0019345 | |||
| 1601 | Ga0451577_0000941 | |||
| 1602 | Ga0451577_0003646 | |||
| 1603 | Ga0451577_0090201 | |||
| 1604 | Ga0466972_0000420 | |||
| 1605 | Ga0466972_0024846 | |||
| 1606 | Ga0466965_0019525 | |||
| 1607 | Ga0466965_0091695 | |||
| 1608 | Ga0466966_0013203 | |||
| 1609 | Ga0466966_0122910 | |||
| 1610 | Ga0466961_0119384 | |||
| 1611 | Ga0466964_0029535 | |||
| 1612 | Ga0453684_0208793 | |||
| 1613 | Ga0466971_0144021 | |||
| 1614 | Ga0466957_0001920 | |||
| 1615 | Ga0466957_0005784 | |||
| 1616 | Ga0466960_0324217 | |||
| 1617 | Ga0466960_0340141 | |||
| 1618 | Ga0466959_0219057 | |||
| 1619 | Ga0451576_0241374 | |||
| 1620 | Ga0451576_1102472 | |||
| 1621 | Ga0466967_0107630 | |||
| 1622 | Ga0495617_000022 | |||
| 1623 | Ga0495617_001209 | |||
| 1624 | Ga0495617_056815 | |||
| 1625 | Ga0495627_000011 | |||
| 1626 | Ga0495627_000398 | |||
| 1627 | Ga0495627_028145 | |||
| 1628 | Ga0495592_0002825 | |||
| 1629 | Ga0495592_0006056 | |||
| 1630 | Ga0495592_0158030 | |||
| 1631 | Ga0495603_0039081 | |||
| 1632 | Ga0495603_0039573 | |||
| 1633 | Ga0495590_0000057 | |||
| 1634 | Ga0495590_0000143 | |||
| 1635 | Ga0495590_0109534 | |||
| 1636 | Ga0495591_001766 | |||
| 1637 | Ga0495591_003364 | |||
| 1638 | Ga0495629_0000309 | |||
| 1639 | Ga0495629_0009192 | |||
| 1640 | Ga0495629_0016157 | |||
| 1641 | Ga0495629_0200043 | |||
| 1642 | Ga0495638_0005569 | |||
| 1643 | Ga0495638_0054252 | |||
| 1644 | Ga0495638_0138239 | |||
| 1645 | Ga0495651_0009905 | |||
| 1646 | Ga0495651_0015762 | |||
| 1647 | Ga0495651_0067759 | |||
| 1648 | Ga0495651_0479253 | |||
| 1649 | Ga0495653_0000044 | |||
| 1650 | Ga0495653_0001283 | |||
| 1651 | Ga0495653_0010444 | |||
| 1652 | Ga0495653_0030963 | |||
| 1653 | Ga0495653_0046652 | |||
| 1654 | Ga0495653_0091446 | |||
| 1655 | Ga0495653_0126045 | |||
| 1656 | Ga0495650_0000082 | |||
| 1657 | Ga0495650_0000254 | |||
| 1658 | Ga0495650_0001173 | |||
| 1659 | Ga0495650_0001749 | |||
| 1660 | Ga0495650_0003298 | |||
| 1661 | Ga0495650_0004336 | |||
| 1662 | Ga0495650_0005780 | |||
| 1663 | Ga0495650_0039016 | |||
| 1664 | Ga0495580_0007546 | |||
| 1665 | Ga0495580_0011457 | |||
| 1666 | Ga0495580_0045269 | |||
| 1667 | Ga0495580_0055619 | |||
| 1668 | Ga0495580_0137598 | |||
| 1669 | Ga0495582_0039310 | |||
| 1670 | Ga0495605_0000098 | |||
| 1671 | Ga0495605_0000102 | |||
| 1672 | Ga0495605_0000153 | |||
| 1673 | Ga0495605_0014088 | |||
| 1674 | Ga0495605_0025625 | |||
| 1675 | Ga0495605_0044553 | |||
| 1676 | Ga0495605_0050130 | |||
| 1677 | Ga0495605_0055414 | |||
| 1678 | Ga0495605_0129962 | |||
| 1679 | Ga0495639_0090146 | |||
| 1680 | Ga0495662_0013868 | |||
| 1681 | Ga0495662_0163596 | |||
| 1682 | Ga0495584_0000005 | |||
| 1683 | Ga0495584_0000232 | |||
| 1684 | Ga0495584_0000729 | |||
| 1685 | Ga0495584_0008319 | |||
| 1686 | Ga0495584_0010267 | |||
| 1687 | Ga0495584_0037347 | |||
| 1688 | Ga0495584_0045754 | |||
| 1689 | Ga0495585_0000023 | |||
| 1690 | Ga0495585_0004011 | |||
| 1691 | Ga0495585_0004403 | |||
| 1692 | Ga0495585_0007615 | |||
| 1693 | Ga0495585_0011749 | |||
| 1694 | Ga0495585_0011755 | |||
| 1695 | Ga0495585_0024181 | |||
| 1696 | Ga0495585_0031217 | |||
| 1697 | Ga0495585_0041530 | |||
| 1698 | Ga0495585_0051302 | |||
| 1699 | Ga0495585_0125200 | |||
| 1700 | Ga0495585_0129940 | |||
| 1701 | Ga0495594_0047218 | |||
| 1702 | Ga0495594_0172740 | |||
| 1703 | Ga0495596_0002525 | |||
| 1704 | Ga0495596_0002817 | |||
| 1705 | Ga0495596_0003901 | |||
| 1706 | Ga0495596_0005514 | |||
| 1707 | Ga0495596_0008285 | |||
| 1708 | Ga0495596_0009969 | |||
| 1709 | Ga0495596_0014021 | |||
| 1710 | Ga0495596_0069983 | |||
| 1711 | Ga0495607_0005043 | |||
| 1712 | Ga0495607_0012840 | |||
| 1713 | Ga0495607_0018756 | |||
| 1714 | Ga0495607_0039833 | |||
| 1715 | Ga0495607_0046368 | |||
| 1716 | Ga0495607_0087055 | |||
| 1717 | Ga0495607_0092601 | |||
| 1718 | Ga0495583_0000150 | |||
| 1719 | Ga0495583_0000597 | |||
| 1720 | Ga0495583_0001383 | |||
| 1721 | Ga0495583_0001918 | |||
| 1722 | Ga0495583_0007069 | |||
| 1723 | Ga0495583_0021299 | |||
| 1724 | Ga0495583_0023523 | |||
| 1725 | Ga0495583_0030505 | |||
| 1726 | Ga0495606_0000090 | |||
| 1727 | Ga0495606_0000099 | |||
| 1728 | Ga0495606_0000524 | |||
| 1729 | Ga0495606_0002603 | |||
| 1730 | Ga0495606_0002891 | |||
| 1731 | Ga0495606_0003267 | |||
| 1732 | Ga0495606_0009874 | |||
| 1733 | Ga0495606_0015472 | |||
| 1734 | Ga0495606_0036555 | |||
| 1735 | Ga0495606_0085609 | |||
| 1736 | Ga0495608_0024843 | |||
| 1737 | Ga0495608_0033895 | |||
| 1738 | Ga0495610_0000017 | |||
| 1739 | Ga0495610_0000668 | |||
| 1740 | Ga0495610_0007137 | |||
| 1741 | Ga0495610_0007163 | |||
| 1742 | Ga0495610_0017836 | |||
| 1743 | Ga0495616_0004647 | |||
| 1744 | Ga0495616_0028823 | |||
| 1745 | Ga0495616_0031376 | |||
| 1746 | Ga0495616_0040079 | |||
| 1747 | Ga0495616_0090387 | |||
| 1748 | Ga0495618_0018085 | |||
| 1749 | Ga0495618_0038016 | |||
| 1750 | Ga0495620_0062742 | |||
| 1751 | Ga0495620_0207762 | |||
| 1752 | Ga0495628_0037325 | |||
| 1753 | Ga0495628_0185811 | |||
| 1754 | Ga0495628_0484651 | |||
| 1755 | Ga0495630_0016484 | |||
| 1756 | Ga0495630_0067147 | |||
| 1757 | Ga0495630_0104673 | |||
| 1758 | Ga0495630_0564455 | |||
| 1759 | Ga0495631_0001332 | |||
| 1760 | Ga0495631_0001436 | |||
| 1761 | Ga0495631_0019040 | |||
| 1762 | Ga0495631_0031266 | |||
| 1763 | Ga0495631_0061086 | |||
| 1764 | Ga0495631_0085211 | |||
| 1765 | Ga0495632_0000052 | |||
| 1766 | Ga0495632_0001555 | |||
| 1767 | Ga0495632_0006741 | |||
| 1768 | Ga0495632_0007457 | |||
| 1769 | Ga0495632_0012494 | |||
| 1770 | Ga0495632_0062533 | |||
| 1771 | Ga0495632_0091401 | |||
| 1772 | Ga0495637_0000018 | |||
| 1773 | Ga0495637_0000195 | |||
| 1774 | Ga0495643_0000109 | |||
| 1775 | Ga0495643_0000250 | |||
| 1776 | Ga0495643_0001163 | |||
| 1777 | Ga0495643_0003256 | |||
| 1778 | Ga0495643_0009083 | |||
| 1779 | Ga0495643_0012298 | |||
| 1780 | Ga0495643_0037303 | |||
| 1781 | Ga0495644_0001139 | |||
| 1782 | Ga0495644_0005133 | |||
| 1783 | Ga0495644_0015724 | |||
| 1784 | Ga0495644_0031603 | |||
| 1785 | Ga0495644_0066258 | |||
| 1786 | Ga0495648_0001296 | |||
| 1787 | Ga0495648_0001297 | |||
| 1788 | Ga0495648_0001425 | |||
| 1789 | Ga0495648_0003753 | |||
| 1790 | Ga0495648_0006123 | |||
| 1791 | Ga0495648_0016758 | |||
| 1792 | Ga0495648_0021171 | |||
| 1793 | Ga0495648_0115771 | |||
| 1794 | Ga0495663_0002215 | |||
| 1795 | Ga0495666_0001817 | |||
| 1796 | Ga0495666_0015331 | |||
| 1797 | Ga0495666_0028531 | |||
| 1798 | Ga0495666_0061855 | |||
| 1799 | Ga0495666_0079786 | |||
| 1800 | Ga0495642_0000529 | |||
| 1801 | Ga0495642_0003891 | |||
| 1802 | Ga0495642_0021798 | |||
| 1803 | Ga0495642_0024066 | |||
| 1804 | Ga0495642_0069033 | |||
| 1805 | Ga0495652_0019566 | |||
| 1806 | Ga0495652_0038115 | |||
| 1807 | Ga0495652_0039668 | |||
| 1808 | Ga0495654_0000030 | |||
| 1809 | Ga0495665_0008461 | |||
| 1810 | Ga0495665_0021613 | |||
| 1811 | Ga0495640_0022469 | |||
| 1812 | Ga0495586_0024085 | |||
| 1813 | Ga0495586_0058801 | |||
| 1814 | Ga0495586_0088469 | |||
| 1815 | Ga0495587_0027154 | |||
| 1816 | Ga0495609_0000007 | |||
| 1817 | Ga0495609_0002820 | |||
| 1818 | Ga0495609_0003952 | |||
| 1819 | Ga0495609_0004429 | |||
| 1820 | Ga0495609_0004923 | |||
| 1821 | Ga0495609_0005405 | |||
| 1822 | Ga0495609_0006790 | |||
| 1823 | Ga0495609_0033240 | |||
| 1824 | Ga0495621_0078893 | |||
| 1825 | Ga0495597_0001285 | |||
| 1826 | Ga0495597_0001411 | |||
| 1827 | Ga0495597_0004502 | |||
| 1828 | Ga0495597_0005863 | |||
| 1829 | Ga0495597_0013491 | |||
| 1830 | Ga0495597_0016066 | |||
| 1831 | Ga0495597_0025847 | |||
| 1832 | Ga0495597_0028495 | |||
| 1833 | Ga0495645_0032325 | |||
| 1834 | Ga0495622_0001323 | |||
| 1835 | Ga0495622_0002393 | |||
| 1836 | Ga0495622_0006213 | |||
| 1837 | Ga0495622_0027424 | |||
| 1838 | Ga0495633_0000917 | |||
| 1839 | Ga0495633_0003343 | |||
| 1840 | Ga0495633_0007909 | |||
| 1841 | Ga0495633_0008903 | |||
| 1842 | Ga0495633_0010820 | |||
| 1843 | Ga0495633_0017263 | |||
| 1844 | Ga0495633_0018510 | |||
| 1845 | Ga0495633_0024206 | |||
| 1846 | Ga0495633_0026061 | |||
| 1847 | Ga0495633_0031949 | |||
| 1848 | Ga0495656_0009431 | |||
| 1849 | Ga0495656_0010160 | |||
| 1850 | Ga0495668_0000035 | |||
| 1851 | Ga0495668_0000211 | |||
| 1852 | Ga0495668_0000286 | |||
| 1853 | Ga0495668_0000939 | |||
| 1854 | Ga0495668_0004452 | |||
| 1855 | Ga0495668_0004959 | |||
| 1856 | Ga0495668_0028649 | |||
| 1857 | Ga0495668_0033106 | |||
| 1858 | Ga0495668_0062448 | |||
| 1859 | Ga0495668_0138067 | |||
| 1860 | Ga0495634_0007428 | |||
| 1861 | Ga0495634_0166313 | |||
| 1862 | Ga0495634_0212852 | |||
| 1863 | Ga0495611_0001030 | |||
| 1864 | Ga0495611_0006926 | |||
| 1865 | Ga0495611_0011215 | |||
| 1866 | Ga0495611_0018089 | |||
| 1867 | Ga0495611_0034137 | |||
| 1868 | Ga0495611_0087296 | |||
| 1869 | Ga0495611_0087994 | |||
| 1870 | Ga0495625_0001765 | |||
| 1871 | Ga0495625_0011811 | |||
| 1872 | Ga0495625_0013440 | |||
| 1873 | Ga0495625_0017244 | |||
| 1874 | Ga0495625_0168901 | |||
| 1875 | Ga0495635_0008609 | |||
| 1876 | Ga0495635_0017174 | |||
| 1877 | Ga0495659_0002549 | |||
| 1878 | Ga0495659_0006857 | |||
| 1879 | Ga0495661_0000074 | |||
| 1880 | Ga0495661_0004739 | |||
| 1881 | Ga0495661_0013502 | |||
| 1882 | Ga0495661_0014184 | |||
| 1883 | Ga0495661_0014749 | |||
| 1884 | Ga0495661_0020025 | |||
| 1885 | Ga0495661_0024133 | |||
| 1886 | Ga0495661_0037951 | |||
| 1887 | Ga0495661_0038019 | |||
| 1888 | Ga0495661_0040241 | |||
| 1889 | Ga0495661_0040415 | |||
| 1890 | Ga0495661_0049980 | |||
| 1891 | Ga0495661_0142641 | |||
| 1892 | Ga0495661_0156620 | |||
| 1893 | Ga0495661_0213376 | |||
| 1894 | Ga0495588_0000451 | |||
| 1895 | Ga0495588_0014692 | |||
| 1896 | Ga0495588_0062365 | |||
| 1897 | Ga0495588_0335857 | |||
| 1898 | Ga0495657_0056172 | |||
| 1899 | Ga0495599_0094584 | |||
| 1900 | Ga0495599_0103013 | |||
| 1901 | Ga0495623_0012523 | |||
| 1902 | Ga0495623_0027099 | |||
| 1903 | Ga0495623_0027845 | |||
| 1904 | Ga0495623_0046617 | |||
| 1905 | Ga0495646_0005966 | |||
| 1906 | Ga0495646_0032746 | |||
| 1907 | Ga0495658_0140807 | |||
| 1908 | Ga0495669_0000101 | |||
| 1909 | Ga0495669_0000495 | |||
| 1910 | Ga0495669_0001145 | |||
| 1911 | Ga0495669_0004673 | |||
| 1912 | Ga0495669_0043467 | |||
| 1913 | Ga0495613_0061877 | |||
| 1914 | Ga0495613_0067028 | |||
| 1915 | Ga0495613_0171020 | |||
| 1916 | Ga0495624_0003624 | |||
| 1917 | Ga0495624_0004359 | |||
| 1918 | Ga0495624_0034365 | |||
| 1919 | Ga0495624_0063072 | |||
| 1920 | Ga0495624_0116779 | |||
| 1921 | Ga0495670_0000859 | |||
| 1922 | Ga0495670_0011198 | |||
| 1923 | Ga0495670_0017486 | |||
| 1924 | Ga0495670_0025115 | |||
| 1925 | Ga0495670_0040948 | |||
| 1926 | Ga0495671_0000605 | |||
| 1927 | Ga0495671_0007126 | |||
| 1928 | Ga0495671_0031947 | |||
| 1929 | Ga0495671_0062914 | |||
| 1930 | Ga0495671_0087233 | |||
| 1931 | Ga0495671_0107585 | |||
| 1932 | Ga0495649_0006762 | |||
| 1933 | Ga0495649_0008705 | |||
| 1934 | Ga0495649_0008952 | |||
| 1935 | Ga0495649_0066219 | |||
| 1936 | Ga0495589_0000086 | |||
| 1937 | Ga0495589_0000132 | |||
| 1938 | Ga0495589_0004038 | |||
| 1939 | Ga0495589_0006701 | |||
| 1940 | Ga0495589_0008251 | |||
| 1941 | Ga0495589_0025964 | |||
| 1942 | Ga0495589_0043578 | |||
| 1943 | Ga0495589_0057044 | |||
| 1944 | Ga0495600_0015355 | |||
| 1945 | Ga0495600_0020745 | |||
| 1946 | Ga0495600_0036329 | |||
| 1947 | Ga0495660_0004409 | |||
| 1948 | Ga0495660_0007681 | |||
| 1949 | Ga0495660_0008293 | |||
| 1950 | Ga0495660_0008498 | |||
| 1951 | Ga0495660_0014335 | |||
| 1952 | Ga0495660_0024343 | |||
| 1953 | Ga0495660_0026896 | |||
| 1954 | Ga0495660_0057832 | |||
| 1955 | Ga0495660_0069704 | |||
| 1956 | Ga0495660_0084017 | |||
| 1957 | Ga0495660_0084438 | |||
| 1958 | Ga0495581_0022613 | |||
| 1959 | Ga0495581_0027614 | |||
| 1960 | Ga0495581_0047000 | |||
| 1961 | Ga0495581_0204894 | |||
| 1962 | Ga0495604_0003813 | |||
| 1963 | Ga0495604_0012895 | |||
| 1964 | Ga0495604_0018243 | |||
| 1965 | Ga0495604_0032878 | |||
| 1966 | Ga0495636_0040337 | |||
| 1967 | Ga0495674_0011663 | |||
| 1968 | Ga0495674_0026818 | |||
| 1969 | Ga0495674_0039008 | |||
| 1970 | Ga0495674_0053476 | |||
| 1971 | Ga0495672_0000013 | |||
| 1972 | Ga0495672_0000278 | |||
| 1973 | Ga0495672_0001189 | |||
| 1974 | Ga0495672_0006089 | |||
| 1975 | Ga0495672_0006593 | |||
| 1976 | Ga0495672_0007759 | |||
| 1977 | Ga0495672_0008561 | |||
| 1978 | Ga0495672_0021147 | |||
| 1979 | Ga0495672_0096773 | |||
| 1980 | Ga0495676_0000015 | |||
| 1981 | Ga0495676_0089686 | |||
| 1982 | Ga0495676_0110694 | |||
| 1983 | Ga0495676_0134159 | |||
| 1984 | Ga0495680_0019772 | |||
| 1985 | Ga0495680_0070676 | |||
| 1986 | Ga0495680_0080980 | |||
| 1987 | Ga0495683_0000036 | |||
| 1988 | Ga0495683_0003534 | |||
| 1989 | Ga0495683_0003640 | |||
| 1990 | Ga0495683_0006050 | |||
| 1991 | Ga0495683_0006168 | |||
| 1992 | Ga0495683_0013934 | |||
| 1993 | Ga0495683_0015050 | |||
| 1994 | Ga0495683_0019227 | |||
| 1995 | Ga0495683_0047196 | |||
| 1996 | Ga0495683_0090903 | |||
| 1997 | Ga0495687_000038 | |||
| 1998 | Ga0495687_000057 | |||
| 1999 | Ga0495687_001055 | |||
| 2000 | Ga0495687_001122 | |||
| 2001 | Ga0495687_007401 | |||
| 2002 | Ga0495687_008762 | |||
| 2003 | Ga0495687_010094 | |||
| 2004 | Ga0495687_017705 | |||
| 2005 | Ga0495687_025518 | |||
| 2006 | Ga0495687_028152 | |||
| 2007 | Ga0495687_113151 | |||
| 2008 | Ga0495675_0019161 | |||
| 2009 | Ga0495675_0077014 | |||
| 2010 | Ga0495675_0091327 | |||
| 2011 | Ga0495677_0000004 | |||
| 2012 | Ga0495677_0000948 | |||
| 2013 | Ga0495677_0005364 | |||
| 2014 | Ga0495677_0017287 | |||
| 2015 | Ga0495677_0022617 | |||
| 2016 | Ga0495679_000271 | |||
| 2017 | Ga0495679_001332 | |||
| 2018 | Ga0495679_002051 | |||
| 2019 | Ga0495679_010678 | |||
| 2020 | Ga0495685_000299 | |||
| 2021 | Ga0495685_029782 | |||
| 2022 | Ga0495685_086303 | |||
| 2023 | Ga0495673_0000069 | |||
| 2024 | Ga0495673_0000203 | |||
| 2025 | Ga0495673_0000236 | |||
| 2026 | Ga0495673_0009876 | |||
| 2027 | Ga0495673_0013406 | |||
| 2028 | Ga0495673_0066045 | |||
| 2029 | Ga0495681_0014222 | |||
| 2030 | Ga0495681_0031624 | |||
| 2031 | Ga0495681_0032950 | |||
| 2032 | Ga0495681_0037197 | |||
| 2033 | Ga0495681_0081584 | |||
| 2034 | Ga0495686_0007873 | |||
| 2035 | Ga0495686_0008513 | |||
| 2036 | Ga0495686_0035881 | |||
| 2037 | Ga0495686_0160983 | |||
| 2038 | Ga0495593_0002329 | |||
| 2039 | Ga0495593_0008400 | |||
| 2040 | Ga0495593_0049839 | |||
| 2041 | Ga0495602_0018389 | |||
| 2042 | Ga0495602_0026740 | |||
| 2043 | Ga0495602_0039345 | |||
| 2044 | Ga0495602_0102875 | |||
| 2045 | Ga0495614_0009542 | |||
| 2046 | Ga0495614_0020278 | |||
| 2047 | Ga0495614_0022236 | |||
| 2048 | Ga0495615_0003471 | |||
| 2049 | Ga0495626_0000048 | |||
| 2050 | Ga0495626_0000279 | |||
| 2051 | Ga0495626_0000998 | |||
| 2052 | Ga0495626_0001757 | |||
| 2053 | Ga0495626_0007693 | |||
| 2054 | Ga0495626_0008828 | |||
| 2055 | Ga0495626_0009702 | |||
| 2056 | Ga0495626_0010181 | |||
| 2057 | Ga0495626_0027137 | |||
| 2058 | Ga0496100_0033511 | |||
| 2059 | Ga0496100_0175340 | |||
| 2060 | Ga0496101_0045775 | |||
| 2061 | Ga0496101_0251187 | |||
| 2062 | Ga0496101_0320679 | |||
| 2063 | Ga0496102_0000478 | |||
| 2064 | Ga0496102_0007956 | |||
| 2065 | Ga0496102_0008640 | |||
| 2066 | Ga0496102_0017344 | |||
| 2067 | Ga0496102_0165543 | |||
| 2068 | Ga0496102_0291127 | |||
| 2069 | Ga0496103_0017663 | |||
| 2070 | Ga0496103_0083968 | |||
| 2071 | Ga0496103_0092200 | |||
| 2072 | Ga0496106_0055391 | |||
| 2073 | Ga0496109_0035631 | |||
| 2074 | Ga0496109_0133006 | |||
| 2075 | Ga0496109_0286482 | |||
| 2076 | Ga0496110_0000092 | |||
| 2077 | Ga0496110_0148346 | |||
| 2078 | Ga0496110_0527297 | |||
| 2079 | Ga0496111_0267910 | |||
| 2080 | Ga0496111_0504127 | |||
| 2081 | Ga0496114_0007265 | |||
| 2082 | Ga0496114_0068845 | |||
| 2083 | Ga0496114_0072052 | |||
| 2084 | Ga0496115_0019582 | |||
| 2085 | Ga0496115_0125816 | |||
| 2086 | Ga0496115_0526259 | |||
| 2087 | Ga0496116_0051271 | |||
| 2088 | Ga0496117_0000005 | |||
| 2089 | Ga0496117_0031619 | |||
| 2090 | Ga0496117_0074896 | |||
| 2091 | Ga0496118_0000031 | |||
| 2092 | Ga0496118_0011234 | |||
| 2093 | Ga0496118_0040491 | |||
| 2094 | Ga0496121_0028888 | |||
| 2095 | Ga0496121_0034811 | |||
| 2096 | Ga0496121_0038335 | |||
| 2097 | Ga0496122_0003525 | |||
| 2098 | Ga0496123_0000084 | |||
| 2099 | Ga0496123_0003683 | |||
| 2100 | Ga0496124_0010436 | |||
| 2101 | Ga0496124_0017631 | |||
| 2102 | Ga0496124_0023504 | |||
| 2103 | Ga0496124_0075273 | |||
| 2104 | Ga0496124_0314938 | |||
| 2105 | Ga0496125_0000368 | |||
| 2106 | Ga0496125_0015656 | |||
| 2107 | Ga0496125_0022691 | |||
| 2108 | Ga0496125_0356719 | |||
| 2109 | Ga0495678_000010 | |||
| 2110 | Ga0495678_000034 | |||
| 2111 | Ga0495678_000383 | |||
| 2112 | Ga0495678_001376 | |||
| 2113 | Ga0495678_004680 | |||
| 2114 | Ga0495678_009666 | |||
| 2115 | Ga0495682_0008734 | |||
| 2116 | Ga0495682_0023768 | |||
| 2117 | Ga0495682_0035992 | |||
| 2118 | Ga0495682_0042554 | |||
| 2119 | Ga0501313_011247 | |||
| 2120 | Ga0501031_0007227 | |||
| 2121 | Ga0501031_0023720 | |||
| 2122 | Ga0501031_0047236 | |||
| 2123 | Ga0501031_0083405 | |||
| 2124 | Ga0501031_0233715 | |||
| 2125 | Ga0501032_0000993 | |||
| 2126 | Ga0501032_0003737 | |||
| 2127 | Ga0501032_0008533 | |||
| 2128 | Ga0501032_0009695 | |||
| 2129 | Ga0501032_0010759 | |||
| 2130 | Ga0501033_0001281 | |||
| 2131 | Ga0501033_0003589 | |||
| 2132 | Ga0501033_0094590 | |||
| 2133 | Ga0501033_0097761 | |||
| 2134 | Ga0501034_0010675 | |||
| 2135 | Ga0501034_0047250 | |||
| 2136 | Ga0501036_0004255 | |||
| 2137 | Ga0501036_0007404 | |||
| 2138 | Ga0501036_0023088 | |||
| 2139 | Ga0501036_0041052 | |||
| 2140 | Ga0501036_0532592 | |||
| 2141 | Ga0501037_0018199 | |||
| 2142 | Ga0501037_0152888 | |||
| 2143 | Ga0501038_0003012 | |||
| 2144 | Ga0501038_0014124 | |||
| 2145 | Ga0501038_0021009 | |||
| 2146 | Ga0501038_0022730 | |||
| 2147 | Ga0501038_0048365 | |||
| 2148 | Ga0501038_0064086 | |||
| 2149 | Ga0501038_0245046 | |||
| 2150 | Ga0501039_0070245 | |||
| 2151 | Ga0501039_0194977 | |||
| 2152 | Ga0501039_0205027 | |||
| 2153 | Ga0501040_0009384 | |||
| 2154 | Ga0501040_0036297 | |||
| 2155 | Ga0501041_0064783 | |||
| 2156 | Ga0501042_0095513 | |||
| 2157 | Ga0501043_0001204 | |||
| 2158 | Ga0501043_0003787 | |||
| 2159 | Ga0501043_0006411 | |||
| 2160 | Ga0501043_0074970 | |||
| 2161 | Ga0501043_0099085 | |||
| 2162 | Ga0501046_0000851 | |||
| 2163 | Ga0501046_0010292 | |||
| 2164 | Ga0501046_0025411 | |||
| 2165 | Ga0501047_0009059 | |||
| 2166 | Ga0501047_0013028 | |||
| 2167 | Ga0501047_0118332 | |||
| 2168 | Ga0501048_0006174 | |||
| 2169 | Ga0501048_0031474 | |||
| 2170 | Ga0501048_0511305 | |||
| 2171 | Ga0501068_0007808 | |||
| 2172 | Ga0501069_0333703 | |||
| 2173 | Ga0501071_0159016 | |||
| 2174 | Ga0501076_0099498 | |||
| 2175 | Ga0501077_0296754 | |||
| 2176 | Ga0501083_0190954 | |||
| 2177 | Ga0501269_000473 | |||
| 2178 | Ga0501035_0000450 | |||
| 2179 | Ga0501035_0001403 | |||
| 2180 | Ga0501035_0006010 | |||
| 2181 | Ga0501035_0039300 | |||
| 2182 | Ga0501035_0094400 | |||
| 2183 | Ga0501044_0000068 | |||
| 2184 | Ga0501044_0002232 | |||
| 2185 | Ga0501044_0003674 | |||
| 2186 | Ga0501044_0069533 | |||
| 2187 | Ga0501044_0151081 | |||
| 2188 | Ga0501044_0411021 | |||
| 2189 | Ga0501044_0479769 | |||
| 2190 | Ga0501045_0038488 | |||
| 2191 | Ga0501045_0084777 | |||
| 2192 | Ga0501045_0085123 | |||
| 2193 | nmdc:mga05p37_379775_c1 | |||
| 2194 | nmdc:mga06r32_493829_c1 | |||
| 2195 | nmdc:mga08y16_26878_c1 | |||
| 2196 | nmdc:mga08y16_41626_c1 | |||
| 2197 | nmdc:mga0rr50_21481_c1 | |||
| 2198 | nmdc:mga0a205_245298_c1 | |||
| 2199 | Ga0495601_0022528 | |||
| 2200 | Ga0495595_0068653 | |||
| 2201 | Ga0495619_0083858 | |||
| 2202 | Ga0495619_0195917 | |||
| 2203 | Ga0495619_0526661 | |||
| 2204 | Ga0500618_000653 | |||
| 2205 | Ga0500574_000047 | |||
| 2206 | Ga0500619_001638 | |||
| 2207 | Ga0587084_000383 | |||
| 2208 | Ga0587066_022305 | |||
| 2209 | Ga0587080_001172 | |||
| 2210 | Ga0587082_041449 | |||
| 2211 | Ga0587090_012266 | |||
| 2212 | Ga0587067_006197 | |||
| 2213 | Ga0587068_000998 | |||
| 2214 | Ga0587068_018470 | |||
| 2215 | Ga0587069_024441 | |||
| 2216 | Ga0587078_010017 | |||
| 2217 | Ga0587079_020003 | |||
| 2218 | Ga0587111_0030375 | |||
| 2219 | Ga0501082_0397025 | |||
| 2220 | Ga0466962_0018529 | |||
| 2221 | 2509130720 | |||
| 2222 | 2511250319 | |||
| 2223 | 2511387575 | |||
| 2224 | 2513962723 | |||
| 2225 | 2521559825 | |||
| 2226 | 2550693198 | |||
| 2227 | 2553007041 | |||
| 2228 | 2601672280 | |||
| 2229 | 2643791751 | |||
| 2230 | 2643796626 | |||
| 2231 | 2644027062 | |||
| 2232 | 2644216770 | |||
| 2233 | 2644254520 | |||
| 2234 | 2644360067 | |||
| 2235 | 2644472748 | |||
| 2236 | 2678229772 | |||
| 2237 | 2723879546 | |||
| 2238 | 2738742908 | |||
| 2239 | 2738827059 | |||
| 2240 | 2738845996 | |||
| 2241 | 2739150856 | |||
| 2242 | 2739192775 | |||
| 2243 | 2739276904 | |||
| 2244 | 2739319252 | |||
| 2245 | 2739337493 | |||
| 2246 | 2739345948 | |||
| 2247 | 2746087352 | |||
| 2248 | 2746093141 | |||
| 2249 | 2765571081 | |||
| 2250 | 2808984989 | |||
| 2251 | 2809130121 | |||
| 2252 | 2809145546 | |||
| 2253 | 2809150402 | |||
| 2254 | 2819544513 | |||
| 2255 | 2819594072 | |||
| 2256 | 2819618266 | |||
| 2257 | 2821136479 | |||
| 2258 | 2828308164 | |||
| 2259 | 2839096677 | |||
| 2260 | 2842713688 | |||
| 2261 | 2846036739 | |||
| 2262 | 2846042157 | |||
| 2263 | 2852621374 | |||
| 2264 | 2857549311 | |||
| 2265 | 2857558528 | |||
| 2266 | 2857562343 | |||
| 2267 | 2857568296 | |||
| 2268 | 2884815177 | |||
| 2269 | 2884839899 | |||
| 2270 | 2884856290 | |||
| 2271 | 2885081343 | |||
| 2272 | 2896158655 | |||
| 2273 | 2900637200 | |||
| 2274 | 2904428561 | |||
| 2275 | 2904444391 | |||
| 2276 | 2904490244 | |||
| 2277 | 2904535544 | |||
| 2278 | 2904588116 | |||
| 2279 | 2904595152 | |||
| 2280 | 2904606065 | |||
| 2281 | 2916182549 | |||
| 2282 | 2919051309 | |||
| 2283 | 2919084263 | |||
| 2284 | 2919477228 | |||
| 2285 | 2919533414 | |||
| 2286 | 2923513592 | |||
| 2287 | 2928135291 | |||
| 2288 | 2932416365 | |||
| 2289 | 2932422242 | |||
| 2290 | 642623073 | |||
| 2291 | 8047675699 | |||
| 2292 | 8055307286 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umf-assembly1.cif.gz_C | crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate | 0.9566 | 4 | 219 |
| 7sbj-assembly1.cif.gz_C | crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a | 0.9548 | 5 | 219 |
| 3inp-assembly1.cif.gz_A | 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. | 0.9532 | 4 | 219 |
| 7u5y-assembly1.cif.gz_E | crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa | 0.949 | 1 | 219 |
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9464 | 4 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9593 | 1 | 220 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9551 | 1 | 220 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9465 | 3 | 220 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9441 | 4 | 219 | 3.20.20.70 |
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9381 | 3 | 220 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1CNY9-F1-model_v4 | deleted | 0.9841 | 55 | 219 |
|
| AF-A0A661INI8-F1-model_v4 | Ribulose-phosphate 3-epimerase | 0.9788 | 56 | 218 |
GO:0005975
GO:0016857 |
| AF-A0A7C2L3C1-F1-model_v4 | Ribulose-phosphate 3-epimerase | 0.9631 | 50 | 218 |
GO:0005975
GO:0016857 |
| AF-A0A376PPY3-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9627 | 1 | 220 |
GO:0004750
GO:0006098 GO:0006298 GO:0009007 GO:0009307 GO:0019323 GO:0032259 GO:0043565 GO:0046872 GO:1904047 |
| AF-A0A3C0I162-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9622 | 1 | 220 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |