F490794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1146 | 542 | 1060 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300025228|Ga0209672_100025|Ga0209672_100025308 |
| Length | 470 |
| Sequence | MRNCVGKFGPRKFARVIELVRIVHRRNAGFALHGRETLLEIFVIQHLKKSKPMEAQLEIAKQVRDTVEQIIADVAANGDAAVREYSMRFDKWNPASFRLTDAEISACVATLSERELDDIKFAQQQVRRFALAQKDALRDVEVETLPGVVLGHRNIPVNSVGCYIPGGKYPLLASAHMSVLTAKVAGVKRVVAVAPPFDGKPHPAIVTAMHLAGADEIYCVGGVQAIAALALGTDQFEPVDMIVGPGNAYVAEAKRQLFGKIGIDLIAGPTETLVIADDSSDVEIVAADLLGQAEHGVNSPVVFLTNSARLADGLPAEIERQLAVLPTAAVASVAWRDYGEIILCDTVDEMVEEADRIASEHVQVMTRDPLYFLEHMTNYGALFLGDRTNVSYGDKVIGTNHTLPTTKAARYTGGLWVGKFIKTCTYQRVLTDEASAMLGEYCSRLCAMEGFAGHKEQADIRVRRFGKRAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 3 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 4 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 5 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 6 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 9 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 10 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 11 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 12 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 13 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 14 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 15 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 16 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 17 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 18 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 19 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 20 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 21 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 22 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 23 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 24 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 25 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 26 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 27 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 28 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 29 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 30 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 31 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 32 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 33 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 34 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 35 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 36 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 37 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 38 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 39 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 40 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 41 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 42 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 43 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 44 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 45 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 46 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 47 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 48 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 49 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 50 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 51 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 52 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 53 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 54 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 55 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 56 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 57 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 58 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 59 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 60 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 61 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 62 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 63 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 64 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 65 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 66 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 67 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 68 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 69 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 70 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 71 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 72 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 73 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 74 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 75 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 76 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 77 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 78 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 79 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 80 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 81 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 82 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 83 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 86 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 87 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 88 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 89 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 90 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 91 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 92 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 93 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 94 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 96 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 99 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 101 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 102 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 104 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 105 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 106 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 112 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 114 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 123 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 133 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 134 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 142 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 146 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 147 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 149 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 150 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 151 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 152 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 153 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 154 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 155 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 156 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 157 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 158 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 159 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 160 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 161 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 162 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 163 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 164 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 166 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 168 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 170 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 171 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 172 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 173 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 174 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 175 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 176 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 178 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 179 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 180 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 208 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 211 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 212 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 213 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 214 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 215 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 216 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 217 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 223 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 226 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 287 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 288 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 292 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 293 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 294 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 295 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 296 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 298 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 299 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 300 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 301 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 302 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 303 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 304 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 305 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 306 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 307 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 308 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 309 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 310 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 311 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 312 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 313 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 314 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 315 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 316 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 317 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 318 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 319 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 320 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 321 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 322 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 323 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 324 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 325 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 327 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 328 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 329 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 330 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 331 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 332 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 333 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 334 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 335 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 336 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 337 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 338 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 339 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 340 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 341 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 342 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 343 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 344 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 345 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 346 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 347 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 348 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 349 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 350 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 351 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 352 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 353 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 354 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 355 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 356 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 357 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 358 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 359 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 360 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 361 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 362 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 363 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 364 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 365 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 366 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 367 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 368 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 369 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 370 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 371 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 372 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 468 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 469 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 470 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 471 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 472 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 473 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 474 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 476 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 477 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 478 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 479 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 480 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 481 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 482 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 483 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 484 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 485 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 486 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 487 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 488 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 489 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 490 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 491 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 492 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 493 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 496 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 522 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 523 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 535 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 537 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 538 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 539 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 540 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 541 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 542 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.41 |
| Metatranscriptomes | 0.09 |
| Isolates | 7.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.84 |
| Nodule | 4.54 |
| Rhizoplane | 7.33 |
| Rhizosphere | 78.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1664813 | 2162886007 | Bacteria | 51394 |
| 2 | ARcpr5oldR_c000037 | 3300000041 | Bacteria | 26008 |
| 3 | ARcpr5yngRDRAFT_c000014 | 3300000043 | Bacteria | 31433 |
| 4 | ARSoilOldRDRAFT_c000005 | 3300000044 | Bacteria | 61735 |
| 5 | ARCol0yngRDRAFT_1000099 | 3300000652 | Bacteria | 16028 |
| 6 | JGI24737J22298_10003080 | 3300001990 | Bacteria | 5906 |
| 7 | JGI25156J39149_1001315 | 3300002705 | Bacteria | 10757 |
| 8 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 9 | JGI25151J46595_10000019 | 3300003187 | Bacteria | 236340 |
| 10 | JGI25151J46595_10001080 | 3300003187 | Bacteria | 20266 |
| 11 | rootL2_10152113 | 3300003322 | Bacteria | 1570 |
| 12 | Ga0055532_1000249 | 3300003758 | Bacteria | 38537 |
| 13 | Ga0055527_1000207 | 3300003760 | Bacteria | 38453 |
| 14 | Ga0055535_1000052 | 3300003761 | Bacteria | 132513 |
| 15 | Ga0055535_1000437 | 3300003761 | Bacteria | 38537 |
| 16 | Ga0055542_1000457 | 3300003762 | Bacteria | 38537 |
| 17 | Ga0055529_1000239 | 3300003763 | Bacteria | 68765 |
| 18 | Ga0055529_1000395 | 3300003763 | Bacteria | 46388 |
| 19 | Ga0055537_1001658 | 3300003773 | Bacteria | 8310 |
| 20 | Ga0055536_1000524 | 3300003781 | Bacteria | 26496 |
| 21 | Ga0055530_10004363 | 3300003791 | Bacteria | 7333 |
| 22 | Ga0055530_10008875 | 3300003791 | Bacteria | 3957 |
| 23 | Ga0055540_1000054 | 3300003792 | Bacteria | 142505 |
| 24 | Ga0055531_10000037 | 3300003794 | Bacteria | 144244 |
| 25 | Ga0065714_10065580 | 3300005288 | Bacteria | 9295 |
| 26 | Ga0065704_10000208 | 3300005289 | Bacteria | 101850 |
| 27 | Ga0065712_10074695 | 3300005290 | Bacteria | 4031 |
| 28 | Ga0065707_10169157 | 3300005295 | Bacteria | 1498 |
| 29 | Ga0070676_10145783 | 3300005328 | Unclassified | 1511 |
| 30 | Ga0070683_100066175 | 3300005329 | Bacteria | 3366 |
| 31 | Ga0070683_100233527 | 3300005329 | Bacteria | 1748 |
| 32 | Ga0070666_10006171 | 3300005335 | Bacteria | 7371 |
| 33 | Ga0070680_100008502 | 3300005336 | Bacteria | 7862 |
| 34 | Ga0070680_100019478 | 3300005336 | Bacteria | 5376 |
| 35 | Ga0070682_100019858 | 3300005337 | Bacteria | 3946 |
| 36 | Ga0070682_100051802 | 3300005337 | Bacteria | 2567 |
| 37 | Ga0070682_100099984 | 3300005337 | Bacteria | 1913 |
| 38 | Ga0068868_100122270 | 3300005338 | Unclassified | 2124 |
| 39 | Ga0070660_100035891 | 3300005339 | Bacteria | 3753 |
| 40 | Ga0070689_100039107 | 3300005340 | Bacteria | 3631 |
| 41 | Ga0070689_100146936 | 3300005340 | Bacteria | 1899 |
| 42 | Ga0070661_100080147 | 3300005344 | Bacteria | 2409 |
| 43 | Ga0070661_100132427 | 3300005344 | Bacteria | 1874 |
| 44 | Ga0070692_10040657 | 3300005345 | Bacteria | 2379 |
| 45 | Ga0070668_100077272 | 3300005347 | Bacteria | 2602 |
| 46 | Ga0070668_100101014 | 3300005347 | Bacteria | 2285 |
| 47 | Ga0070668_100159462 | 3300005347 | Bacteria | 1830 |
| 48 | Ga0070669_100003120 | 3300005353 | Bacteria | 11928 |
| 49 | Ga0070675_100014385 | 3300005354 | Bacteria | 6240 |
| 50 | Ga0070671_100006278 | 3300005355 | Bacteria | 9471 |
| 51 | Ga0070674_100119544 | 3300005356 | Bacteria | 1949 |
| 52 | Ga0070674_100135465 | 3300005356 | Bacteria | 1841 |
| 53 | Ga0070673_100104548 | 3300005364 | Bacteria | 2338 |
| 54 | Ga0070673_100300593 | 3300005364 | Bacteria | 1413 |
| 55 | Ga0070688_100009296 | 3300005365 | Bacteria | 5369 |
| 56 | Ga0070667_100041355 | 3300005367 | Bacteria | 3867 |
| 57 | Ga0070709_10005000 | 3300005434 | Bacteria | 7160 |
| 58 | Ga0070714_100018509 | 3300005435 | Bacteria | 5660 |
| 59 | Ga0070714_100031780 | 3300005435 | Bacteria | 4406 |
| 60 | Ga0070701_10018964 | 3300005438 | Bacteria | 3242 |
| 61 | Ga0070705_100011668 | 3300005440 | Bacteria | 4441 |
| 62 | Ga0070700_100039252 | 3300005441 | Bacteria | 2891 |
| 63 | Ga0070708_100089217 | 3300005445 | Bacteria | 2805 |
| 64 | Ga0070708_100129160 | 3300005445 | Bacteria | 2338 |
| 65 | Ga0070663_100102357 | 3300005455 | Bacteria | 2139 |
| 66 | Ga0070663_100135042 | 3300005455 | Bacteria | 1878 |
| 67 | Ga0070662_100034622 | 3300005457 | Bacteria | 3563 |
| 68 | Ga0070662_100132035 | 3300005457 | Bacteria | 1926 |
| 69 | Ga0070681_10031256 | 3300005458 | Bacteria | 5344 |
| 70 | Ga0070681_10075350 | 3300005458 | Bacteria | 3334 |
| 71 | Ga0068867_100077272 | 3300005459 | Bacteria | 2501 |
| 72 | Ga0070685_10039064 | 3300005466 | Bacteria | 2695 |
| 73 | Ga0070707_100038824 | 3300005468 | Bacteria | 4549 |
| 74 | Ga0070707_100108705 | 3300005468 | Bacteria | 2690 |
| 75 | Ga0070707_100260423 | 3300005468 | Bacteria | 1687 |
| 76 | Ga0070698_100000484 | 3300005471 | Bacteria | 42229 |
| 77 | Ga0070698_100175054 | 3300005471 | Bacteria | 2085 |
| 78 | Ga0070699_100009192 | 3300005518 | Bacteria | 8569 |
| 79 | Ga0070699_100079622 | 3300005518 | Bacteria | 2854 |
| 80 | Ga0070699_100272913 | 3300005518 | Bacteria | 1514 |
| 81 | Ga0070679_100038534 | 3300005530 | Bacteria | 4752 |
| 82 | Ga0070679_100056647 | 3300005530 | Bacteria | 3905 |
| 83 | Ga0070684_100060876 | 3300005535 | Bacteria | 3303 |
| 84 | Ga0070684_100090907 | 3300005535 | Bacteria | 2715 |
| 85 | Ga0070697_100017134 | 3300005536 | Bacteria | 5699 |
| 86 | Ga0070686_100004150 | 3300005544 | Bacteria | 7972 |
| 87 | Ga0070686_100015298 | 3300005544 | Bacteria | 4440 |
| 88 | Ga0070686_100075541 | 3300005544 | Bacteria | 2217 |
| 89 | Ga0070695_100007796 | 3300005545 | Bacteria | 6343 |
| 90 | Ga0070695_100062465 | 3300005545 | Bacteria | 2419 |
| 91 | Ga0070693_100018861 | 3300005547 | Bacteria | 3609 |
| 92 | Ga0070665_100000052 | 3300005548 | Bacteria | 245694 |
| 93 | Ga0070665_100006016 | 3300005548 | Bacteria | 12404 |
| 94 | Ga0070704_100155599 | 3300005549 | Bacteria | 1802 |
| 95 | Ga0070704_100183339 | 3300005549 | Bacteria | 1676 |
| 96 | Ga0068855_100003325 | 3300005563 | Bacteria | 19675 |
| 97 | Ga0068855_100189121 | 3300005563 | Bacteria | 2323 |
| 98 | Ga0070664_100264754 | 3300005564 | Bacteria | 1547 |
| 99 | Ga0068857_100002263 | 3300005577 | Bacteria | 15653 |
| 100 | Ga0068854_100003405 | 3300005578 | Bacteria | 9911 |
| 101 | Ga0068856_100123520 | 3300005614 | Bacteria | 2591 |
| 102 | Ga0068856_100228329 | 3300005614 | Bacteria | 1877 |
| 103 | Ga0068856_100229555 | 3300005614 | Bacteria | 1871 |
| 104 | Ga0068856_100238857 | 3300005614 | Bacteria | 1832 |
| 105 | Ga0068852_100002286 | 3300005616 | Bacteria | 13174 |
| 106 | Ga0068859_100020736 | 3300005617 | Bacteria | 6595 |
| 107 | Ga0068859_100050191 | 3300005617 | Bacteria | 4191 |
| 108 | Ga0068859_100191161 | 3300005617 | Bacteria | 2131 |
| 109 | Ga0068864_100015042 | 3300005618 | Bacteria | 6431 |
| 110 | Ga0068866_10001011 | 3300005718 | Bacteria | 12363 |
| 111 | Ga0068861_100027831 | 3300005719 | Bacteria | 4121 |
| 112 | Ga0068851_10023722 | 3300005834 | Bacteria | 3000 |
| 113 | Ga0068863_100086154 | 3300005841 | Bacteria | 2976 |
| 114 | Ga0068858_100286665 | 3300005842 | Bacteria | 1569 |
| 115 | Ga0068860_100015244 | 3300005843 | Bacteria | 7507 |
| 116 | Ga0068860_100060789 | 3300005843 | Bacteria | 3590 |
| 117 | Ga0068860_100063199 | 3300005843 | Bacteria | 3517 |
| 118 | Ga0068862_100020156 | 3300005844 | Bacteria | 5569 |
| 119 | Ga0068862_100200403 | 3300005844 | Bacteria | 1799 |
| 120 | Ga0081538_10007210 | 3300005981 | Bacteria | 9653 |
| 121 | Ga0081540_1006707 | 3300005983 | Bacteria | 8324 |
| 122 | Ga0081539_10006712 | 3300005985 | Bacteria | 10849 |
| 123 | Ga0081539_10071117 | 3300005985 | Bacteria | 1865 |
| 124 | Ga0070717_10000643 | 3300006028 | Bacteria | 22445 |
| 125 | Ga0070717_10002130 | 3300006028 | Bacteria | 13875 |
| 126 | Ga0070717_10016626 | 3300006028 | Bacteria | 5708 |
| 127 | Ga0070717_10074020 | 3300006028 | Bacteria | 2847 |
| 128 | Ga0070717_10185058 | 3300006028 | Bacteria | 1817 |
| 129 | Ga0075432_10000834 | 3300006058 | Bacteria | 9666 |
| 130 | Ga0075432_10005043 | 3300006058 | Bacteria | 4495 |
| 131 | Ga0070716_100004647 | 3300006173 | Bacteria | 6580 |
| 132 | Ga0075366_10033239 | 3300006195 | Unclassified | 3038 |
| 133 | Ga0097621_100034759 | 3300006237 | Bacteria | 4022 |
| 134 | Ga0068871_100012612 | 3300006358 | Bacteria | 6240 |
| 135 | Ga0075428_100002012 | 3300006844 | Bacteria | 21927 |
| 136 | Ga0075428_100006970 | 3300006844 | Bacteria | 12535 |
| 137 | Ga0075428_100058917 | 3300006844 | Bacteria | 4205 |
| 138 | Ga0075433_10105330 | 3300006852 | Bacteria | 2499 |
| 139 | Ga0075434_100003524 | 3300006871 | Bacteria | 13977 |
| 140 | Ga0075434_100057099 | 3300006871 | Bacteria | 3880 |
| 141 | Ga0075429_100004649 | 3300006880 | Bacteria | 11807 |
| 142 | Ga0075429_100025409 | 3300006880 | Bacteria | 5140 |
| 143 | Ga0068865_100147416 | 3300006881 | Bacteria | 1781 |
| 144 | Ga0075436_100005727 | 3300006914 | Bacteria | 8536 |
| 145 | Ga0097620_100020735 | 3300006931 | Bacteria | 6595 |
| 146 | Ga0097620_100050189 | 3300006931 | Bacteria | 4191 |
| 147 | Ga0097620_100191165 | 3300006931 | Bacteria | 2131 |
| 148 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 149 | Ga0075435_100062925 | 3300007076 | Bacteria | 3012 |
| 150 | Ga0099795_10032322 | 3300007788 | Bacteria | 1809 |
| 151 | Ga0105251_10001687 | 3300009011 | Bacteria | 18559 |
| 152 | Ga0105251_10002207 | 3300009011 | Bacteria | 15558 |
| 153 | Ga0105251_10002240 | 3300009011 | Bacteria | 15414 |
| 154 | Ga0105244_10000345 | 3300009036 | Bacteria | 43661 |
| 155 | Ga0105250_10000221 | 3300009092 | Bacteria | 47509 |
| 156 | Ga0105240_10015342 | 3300009093 | Bacteria | 10420 |
| 157 | Ga0105240_10071601 | 3300009093 | Bacteria | 4287 |
| 158 | Ga0105240_10099949 | 3300009093 | Bacteria | 3530 |
| 159 | Ga0105240_10377453 | 3300009093 | Bacteria | 1602 |
| 160 | Ga0105240_10525843 | 3300009093 | Bacteria | 1312 |
| 161 | Ga0111539_10001696 | 3300009094 | Bacteria | 29343 |
| 162 | Ga0111539_10035440 | 3300009094 | Bacteria | 6041 |
| 163 | Ga0105245_10342855 | 3300009098 | Bacteria | 1478 |
| 164 | Ga0114129_10040105 | 3300009147 | Bacteria | 6602 |
| 165 | Ga0114129_10055090 | 3300009147 | Bacteria | 5574 |
| 166 | Ga0105243_10000106 | 3300009148 | Bacteria | 95432 |
| 167 | Ga0105243_10008728 | 3300009148 | Bacteria | 7768 |
| 168 | Ga0105243_10026218 | 3300009148 | Bacteria | 4461 |
| 169 | Ga0105243_10055460 | 3300009148 | Bacteria | 3149 |
| 170 | Ga0105241_10015984 | 3300009174 | Bacteria | 5499 |
| 171 | Ga0105241_10048375 | 3300009174 | Bacteria | 3236 |
| 172 | Ga0105242_10038782 | 3300009176 | Bacteria | 3833 |
| 173 | Ga0105242_10040216 | 3300009176 | Bacteria | 3767 |
| 174 | Ga0105242_10051662 | 3300009176 | Bacteria | 3351 |
| 175 | Ga0105248_10003289 | 3300009177 | Bacteria | 17935 |
| 176 | Ga0105248_10030891 | 3300009177 | Bacteria | 5984 |
| 177 | Ga0105248_10109102 | 3300009177 | Bacteria | 3120 |
| 178 | Ga0105237_10061430 | 3300009545 | Bacteria | 3757 |
| 179 | Ga0105238_10000980 | 3300009551 | Bacteria | 29183 |
| 180 | Ga0105238_10081230 | 3300009551 | Bacteria | 3231 |
| 181 | Ga0105238_10196612 | 3300009551 | Bacteria | 1992 |
| 182 | Ga0105238_10287239 | 3300009551 | Bacteria | 1627 |
| 183 | Ga0105249_10099006 | 3300009553 | Bacteria | 2740 |
| 184 | Ga0105239_10001049 | 3300010375 | Bacteria | 38505 |
| 185 | Ga0105239_10059456 | 3300010375 | Bacteria | 4195 |
| 186 | Ga0105239_10065751 | 3300010375 | Bacteria | 3983 |
| 187 | Ga0105246_10081362 | 3300011119 | Bacteria | 2308 |
| 188 | Ga0105246_10106436 | 3300011119 | Bacteria | 2052 |
| 189 | Ga0157373_10000064 | 3300013100 | Bacteria | 94176 |
| 190 | Ga0157373_10069946 | 3300013100 | Bacteria | 2480 |
| 191 | Ga0157371_10001420 | 3300013102 | Bacteria | 24898 |
| 192 | Ga0157371_10102296 | 3300013102 | Bacteria | 2033 |
| 193 | Ga0157370_10002043 | 3300013104 | Bacteria | 24786 |
| 194 | Ga0157370_10019032 | 3300013104 | Bacteria | 6903 |
| 195 | Ga0157369_10003853 | 3300013105 | Bacteria | 17827 |
| 196 | Ga0157374_10001916 | 3300013296 | Bacteria | 17440 |
| 197 | Ga0157378_10006718 | 3300013297 | Bacteria | 10049 |
| 198 | Ga0157378_10044269 | 3300013297 | Bacteria | 3953 |
| 199 | Ga0163162_10017826 | 3300013306 | Bacteria | 6947 |
| 200 | Ga0163162_10304973 | 3300013306 | Unclassified | 1725 |
| 201 | Ga0157372_10000305 | 3300013307 | Bacteria | 54763 |
| 202 | Ga0157372_10049397 | 3300013307 | Bacteria | 4678 |
| 203 | Ga0157372_10058064 | 3300013307 | Unclassified | 4325 |
| 204 | Ga0157372_10263098 | 3300013307 | Bacteria | 2003 |
| 205 | Ga0157375_10014341 | 3300013308 | Bacteria | 7067 |
| 206 | Ga0157375_10027352 | 3300013308 | Bacteria | 5330 |
| 207 | Ga0157375_10325809 | 3300013308 | Bacteria | 1701 |
| 208 | Ga0163163_10037843 | 3300014325 | Bacteria | 4695 |
| 209 | Ga0163163_10062965 | 3300014325 | Bacteria | 3677 |
| 210 | Ga0157380_10058688 | 3300014326 | Bacteria | 3068 |
| 211 | Ga0157380_10078710 | 3300014326 | Unclassified | 2690 |
| 212 | Ga0157380_10087627 | 3300014326 | Bacteria | 2560 |
| 213 | Ga0182008_10000813 | 3300014497 | Bacteria | 21786 |
| 214 | Ga0157377_10068217 | 3300014745 | Bacteria | 2049 |
| 215 | Ga0157379_10086758 | 3300014968 | Bacteria | 2806 |
| 216 | Ga0182006_1000562 | 3300015261 | Bacteria | 27817 |
| 217 | Ga0182006_1003241 | 3300015261 | Bacteria | 8442 |
| 218 | Ga0182006_1009535 | 3300015261 | Bacteria | 4347 |
| 219 | Ga0182007_10000152 | 3300015262 | Bacteria | 46887 |
| 220 | Ga0182005_1000181 | 3300015265 | Bacteria | 43402 |
| 221 | Ga0182005_1000857 | 3300015265 | Bacteria | 13521 |
| 222 | Ga0182005_1005618 | 3300015265 | Bacteria | 3903 |
| 223 | Ga0213874_10005916 | 3300021377 | Bacteria | 2870 |
| 224 | Ga0213876_10112985 | 3300021384 | Bacteria | 1441 |
| 225 | Ga0213875_10000271 | 3300021388 | Bacteria | 51315 |
| 226 | Ga0213875_10058761 | 3300021388 | Bacteria | 1800 |
| 227 | Ga0213871_10015002 | 3300021441 | Bacteria | 1846 |
| 228 | Ga0209672_100025 | 3300025228 | Bacteria | 350006 |
| 229 | Ga0209147_100032 | 3300025229 | Bacteria | 350006 |
| 230 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 231 | Ga0209258_100050 | 3300025242 | Bacteria | 350006 |
| 232 | Ga0209258_100074 | 3300025242 | Bacteria | 271062 |
| 233 | Ga0209148_1000060 | 3300025254 | Bacteria | 350006 |
| 234 | Ga0209148_1002491 | 3300025254 | Bacteria | 6243 |
| 235 | Ga0209759_1000123 | 3300025256 | Bacteria | 137819 |
| 236 | Ga0209759_1007857 | 3300025256 | Bacteria | 3378 |
| 237 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 238 | Ga0209455_1000055 | 3300025272 | Bacteria | 350006 |
| 239 | Ga0209455_1000066 | 3300025272 | Bacteria | 316811 |
| 240 | Ga0209673_1025730 | 3300025273 | Bacteria | 1950 |
| 241 | Ga0209676_1000105 | 3300025292 | Bacteria | 224151 |
| 242 | Ga0209676_1002918 | 3300025292 | Bacteria | 11180 |
| 243 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 244 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 245 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 246 | Ga0209564_1000452 | 3300025295 | Bacteria | 69505 |
| 247 | Ga0209758_1018729 | 3300025297 | Bacteria | 3377 |
| 248 | Ga0209050_1001242 | 3300025298 | Bacteria | 29500 |
| 249 | Ga0209050_1001283 | 3300025298 | Bacteria | 28639 |
| 250 | Ga0209256_1001235 | 3300025299 | Bacteria | 28367 |
| 251 | Ga0207426_1000345 | 3300025302 | Bacteria | 85840 |
| 252 | Ga0209051_1000064 | 3300025303 | Bacteria | 231735 |
| 253 | Ga0209257_1000109 | 3300025304 | Bacteria | 239439 |
| 254 | Ga0207696_1000349 | 3300025711 | Bacteria | 47521 |
| 255 | Ga0207655_1002880 | 3300025728 | Bacteria | 13283 |
| 256 | Ga0207713_1001485 | 3300025735 | Bacteria | 18548 |
| 257 | Ga0207713_1001516 | 3300025735 | Bacteria | 18323 |
| 258 | Ga0207713_1010220 | 3300025735 | Bacteria | 5211 |
| 259 | Ga0207710_10001303 | 3300025900 | Bacteria | 12616 |
| 260 | Ga0207710_10073733 | 3300025900 | Bacteria | 1570 |
| 261 | Ga0207680_10004104 | 3300025903 | Bacteria | 6890 |
| 262 | Ga0207647_10033715 | 3300025904 | Bacteria | 3275 |
| 263 | Ga0207699_10019885 | 3300025906 | Bacteria | 3590 |
| 264 | Ga0207684_10050199 | 3300025910 | Bacteria | 3539 |
| 265 | Ga0207654_10025322 | 3300025911 | Bacteria | 3199 |
| 266 | Ga0207654_10053538 | 3300025911 | Bacteria | 2330 |
| 267 | Ga0207707_10003517 | 3300025912 | Bacteria | 13869 |
| 268 | Ga0207707_10070443 | 3300025912 | Bacteria | 3047 |
| 269 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 270 | Ga0207695_10003264 | 3300025913 | Bacteria | 23061 |
| 271 | Ga0207695_10095188 | 3300025913 | Bacteria | 2983 |
| 272 | Ga0207695_10146268 | 3300025913 | Bacteria | 2307 |
| 273 | Ga0207671_10013327 | 3300025914 | Bacteria | 6554 |
| 274 | Ga0207671_10128845 | 3300025914 | Bacteria | 1941 |
| 275 | Ga0207693_10005142 | 3300025915 | Bacteria | 10960 |
| 276 | Ga0207693_10041339 | 3300025915 | Bacteria | 3629 |
| 277 | Ga0207693_10144071 | 3300025915 | Bacteria | 1873 |
| 278 | Ga0207663_10123804 | 3300025916 | Bacteria | 1775 |
| 279 | Ga0207663_10160386 | 3300025916 | Bacteria | 1587 |
| 280 | Ga0207660_10052743 | 3300025917 | Bacteria | 2896 |
| 281 | Ga0207662_10000171 | 3300025918 | Bacteria | 30909 |
| 282 | Ga0207662_10093455 | 3300025918 | Bacteria | 1853 |
| 283 | Ga0207657_10035391 | 3300025919 | Bacteria | 4478 |
| 284 | Ga0207652_10148747 | 3300025921 | Bacteria | 2096 |
| 285 | Ga0207646_10007712 | 3300025922 | Bacteria | 10895 |
| 286 | Ga0207646_10036647 | 3300025922 | Bacteria | 4426 |
| 287 | Ga0207646_10051439 | 3300025922 | Bacteria | 3686 |
| 288 | Ga0207646_10140776 | 3300025922 | Bacteria | 2172 |
| 289 | Ga0207646_10214928 | 3300025922 | Bacteria | 1736 |
| 290 | Ga0207659_10045953 | 3300025926 | Bacteria | 3081 |
| 291 | Ga0207659_10260242 | 3300025926 | Unclassified | 1411 |
| 292 | Ga0207687_10006965 | 3300025927 | Bacteria | 7450 |
| 293 | Ga0207687_10097740 | 3300025927 | Bacteria | 2154 |
| 294 | Ga0207700_10016809 | 3300025928 | Bacteria | 4871 |
| 295 | Ga0207700_10091916 | 3300025928 | Bacteria | 2398 |
| 296 | Ga0207700_10108110 | 3300025928 | Bacteria | 2233 |
| 297 | Ga0207664_10055962 | 3300025929 | Bacteria | 3131 |
| 298 | Ga0207664_10064776 | 3300025929 | Bacteria | 2924 |
| 299 | Ga0207644_10003326 | 3300025931 | Bacteria | 10373 |
| 300 | Ga0207644_10110972 | 3300025931 | Bacteria | 2074 |
| 301 | Ga0207690_10020395 | 3300025932 | Bacteria | 4095 |
| 302 | Ga0207706_10016073 | 3300025933 | Bacteria | 6764 |
| 303 | Ga0207706_10026104 | 3300025933 | Bacteria | 5229 |
| 304 | Ga0207686_10005874 | 3300025934 | Bacteria | 6586 |
| 305 | Ga0207686_10009011 | 3300025934 | Bacteria | 5402 |
| 306 | Ga0207709_10113678 | 3300025935 | Bacteria | 1815 |
| 307 | Ga0207704_10052906 | 3300025938 | Bacteria | 2464 |
| 308 | Ga0207704_10065272 | 3300025938 | Bacteria | 2278 |
| 309 | Ga0207691_10008491 | 3300025940 | Bacteria | 9865 |
| 310 | Ga0207691_10026254 | 3300025940 | Bacteria | 5466 |
| 311 | Ga0207711_10001071 | 3300025941 | Bacteria | 26139 |
| 312 | Ga0207711_10012903 | 3300025941 | Bacteria | 6939 |
| 313 | Ga0207711_10020061 | 3300025941 | Bacteria | 5571 |
| 314 | Ga0207689_10001391 | 3300025942 | Bacteria | 23137 |
| 315 | Ga0207689_10028039 | 3300025942 | Bacteria | 4711 |
| 316 | Ga0207689_10128941 | 3300025942 | Bacteria | 2081 |
| 317 | Ga0207679_10044133 | 3300025945 | Bacteria | 3215 |
| 318 | Ga0207667_10000968 | 3300025949 | Bacteria | 36617 |
| 319 | Ga0207651_10055124 | 3300025960 | Bacteria | 2728 |
| 320 | Ga0207651_10286558 | 3300025960 | Bacteria | 1364 |
| 321 | Ga0207668_10013857 | 3300025972 | Bacteria | 4979 |
| 322 | Ga0207640_10036117 | 3300025981 | Bacteria | 3099 |
| 323 | Ga0207658_10015729 | 3300025986 | Bacteria | 5194 |
| 324 | Ga0207703_10006798 | 3300026035 | Bacteria | 9117 |
| 325 | Ga0207678_10044253 | 3300026067 | Bacteria | 3851 |
| 326 | Ga0207678_10064848 | 3300026067 | Bacteria | 3138 |
| 327 | Ga0207678_10188047 | 3300026067 | Bacteria | 1764 |
| 328 | Ga0207708_10003464 | 3300026075 | Bacteria | 11631 |
| 329 | Ga0207708_10006349 | 3300026075 | Bacteria | 8761 |
| 330 | Ga0207702_10079134 | 3300026078 | Bacteria | 2848 |
| 331 | Ga0207702_10184944 | 3300026078 | Bacteria | 1921 |
| 332 | Ga0207641_10072572 | 3300026088 | Bacteria | 2964 |
| 333 | Ga0207648_10002207 | 3300026089 | Bacteria | 21115 |
| 334 | Ga0207648_10018847 | 3300026089 | Bacteria | 6237 |
| 335 | Ga0207676_10014002 | 3300026095 | Bacteria | 5758 |
| 336 | Ga0207676_10107019 | 3300026095 | Bacteria | 2331 |
| 337 | Ga0207674_10000629 | 3300026116 | Bacteria | 46056 |
| 338 | Ga0207674_10073309 | 3300026116 | Bacteria | 3437 |
| 339 | Ga0207675_100001449 | 3300026118 | Bacteria | 23775 |
| 340 | Ga0207675_100004866 | 3300026118 | Bacteria | 12942 |
| 341 | Ga0207675_100008588 | 3300026118 | Bacteria | 9607 |
| 342 | Ga0207683_10010051 | 3300026121 | Bacteria | 8075 |
| 343 | Ga0207698_10047152 | 3300026142 | Bacteria | 3261 |
| 344 | Ga0210000_1004378 | 3300027462 | Bacteria | 2042 |
| 345 | Ga0209968_1009597 | 3300027526 | Bacteria | 1482 |
| 346 | Ga0209282_1000290 | 3300027666 | Bacteria | 24803 |
| 347 | Ga0207428_10001108 | 3300027907 | Bacteria | 29314 |
| 348 | Ga0207428_10014412 | 3300027907 | Bacteria | 6870 |
| 349 | Ga0207428_10028695 | 3300027907 | Bacteria | 4620 |
| 350 | Ga0207428_10121168 | 3300027907 | Unclassified | 2005 |
| 351 | Ga0268266_10000070 | 3300028379 | Bacteria | 235423 |
| 352 | Ga0268266_10002016 | 3300028379 | Bacteria | 22644 |
| 353 | Ga0268265_10010915 | 3300028380 | Bacteria | 6135 |
| 354 | Ga0268265_10015675 | 3300028380 | Bacteria | 5191 |
| 355 | Ga0268265_10042398 | 3300028380 | Bacteria | 3377 |
| 356 | Ga0268264_10062188 | 3300028381 | Bacteria | 3134 |
| 357 | Ga0268264_10163497 | 3300028381 | Bacteria | 2007 |
| 358 | Ga0265336_10000029 | 3300028666 | Bacteria | 178897 |
| 359 | Ga0307517_10003354 | 3300028786 | Bacteria | 24920 |
| 360 | Ga0307515_10000378 | 3300028794 | Bacteria | 108916 |
| 361 | Ga0307515_10000734 | 3300028794 | Bacteria | 75701 |
| 362 | Ga0307515_10048368 | 3300028794 | Bacteria | 6431 |
| 363 | Ga0265338_10009351 | 3300028800 | Bacteria | 11710 |
| 364 | Ga0265338_10042081 | 3300028800 | Bacteria | 4261 |
| 365 | Ga0265324_10000372 | 3300029957 | Bacteria | 32416 |
| 366 | Ga0265760_10020075 | 3300031090 | Bacteria | 1927 |
| 367 | Ga0265325_10031398 | 3300031241 | Bacteria | 2843 |
| 368 | Ga0265340_10056728 | 3300031247 | Bacteria | 1883 |
| 369 | Ga0265327_10000108 | 3300031251 | Bacteria | 183209 |
| 370 | Ga0307513_10016290 | 3300031456 | Bacteria | 8972 |
| 371 | Ga0307513_10070494 | 3300031456 | Bacteria | 3653 |
| 372 | Ga0307408_100232538 | 3300031548 | Bacteria | 1510 |
| 373 | Ga0307514_10000827 | 3300031649 | Bacteria | 50048 |
| 374 | Ga0316575_10028247 | 3300031665 | Bacteria | 2187 |
| 375 | Ga0316576_10232137 | 3300031727 | Bacteria | 1387 |
| 376 | Ga0307405_10000100 | 3300031731 | Bacteria | 35488 |
| 377 | Ga0307413_10102439 | 3300031824 | Bacteria | 1895 |
| 378 | Ga0307413_10202401 | 3300031824 | Bacteria | 1435 |
| 379 | Ga0307410_10156890 | 3300031852 | Bacteria | 1701 |
| 380 | Ga0307407_10037805 | 3300031903 | Bacteria | 2670 |
| 381 | Ga0307412_10000009 | 3300031911 | Bacteria | 445987 |
| 382 | Ga0307412_10000323 | 3300031911 | Bacteria | 30222 |
| 383 | Ga0307409_100037524 | 3300031995 | Bacteria | 3573 |
| 384 | Ga0307416_100166651 | 3300032002 | Bacteria | 2044 |
| 385 | Ga0307414_10000440 | 3300032004 | Bacteria | 22028 |
| 386 | Ga0307414_10185375 | 3300032004 | Bacteria | 1678 |
| 387 | Ga0307411_10020413 | 3300032005 | Bacteria | 3853 |
| 388 | Ga0307411_10103951 | 3300032005 | Bacteria | 2016 |
| 389 | Ga0307415_100137738 | 3300032126 | Bacteria | 1859 |
| 390 | Ga0307510_10068787 | 3300033180 | Bacteria | 3551 |
| 391 | Ga0373930_0000713 | 3300034816 | Bacteria | 4686 |
| 392 | Ga0373958_0000992 | 3300034819 | Bacteria | 3699 |
| 393 | Ga0373959_0000111 | 3300034820 | Bacteria | 18330 |
| 394 | Ga0373938_0000386 | 3300034957 | Bacteria | 7080 |
| 395 | Ga0373928_0000045 | 3300035084 | Bacteria | 21176 |
| 396 | Ga0373929_0010706 | 3300035085 | Bacteria | 1718 |
| 397 | Ga0373940_0007169 | 3300035088 | Bacteria | 2504 |
| 398 | Ga0373944_0009265 | 3300035089 | Bacteria | 2667 |
| 399 | Ga0373944_0011427 | 3300035089 | Bacteria | 2433 |
| 400 | Ga0373949_0003496 | 3300035090 | Bacteria | 3722 |
| 401 | Ga0373949_0004030 | 3300035090 | Bacteria | 3407 |
| 402 | Ga0373951_0000335 | 3300035091 | Bacteria | 14582 |
| 403 | Ga0373952_0000179 | 3300035092 | Bacteria | 9804 |
| 404 | Ga0373952_0020885 | 3300035092 | Bacteria | 1377 |
| 405 | Ga0373923_0000978 | 3300035111 | Bacteria | 7693 |
| 406 | Ga0373923_0004485 | 3300035111 | Bacteria | 4637 |
| 407 | Ga0373932_0000271 | 3300035112 | Bacteria | 15633 |
| 408 | Ga0373932_0010265 | 3300035112 | Bacteria | 2264 |
| 409 | Ga0373936_0002402 | 3300035113 | Bacteria | 7011 |
| 410 | Ga0373939_0001296 | 3300035114 | Bacteria | 6082 |
| 411 | Ga0373939_0006400 | 3300035114 | Bacteria | 2836 |
| 412 | Ga0373941_0024709 | 3300035115 | Bacteria | 1728 |
| 413 | Ga0373945_0020517 | 3300035116 | Bacteria | 2262 |
| 414 | Ga0373953_0004302 | 3300035117 | Bacteria | 4527 |
| 415 | Ga0373953_0008474 | 3300035117 | Bacteria | 3494 |
| 416 | Ga0373953_0010836 | 3300035117 | Bacteria | 3184 |
| 417 | Ga0373953_0028595 | 3300035117 | Bacteria | 2151 |
| 418 | Ga0373954_0000707 | 3300035118 | Bacteria | 12831 |
| 419 | Ga0373943_0007851 | 3300035170 | Bacteria | 4791 |
| 420 | Ga0373946_0007584 | 3300035171 | Bacteria | 3970 |
| 421 | Ga0373955_0001092 | 3300035172 | Bacteria | 11522 |
| 422 | Ga0373955_0005439 | 3300035172 | Bacteria | 5722 |
| 423 | Ga0373955_0086564 | 3300035172 | Bacteria | 1780 |
| 424 | Ga0373961_0000592 | 3300035241 | Bacteria | 13503 |
| 425 | Ga0373962_0000848 | 3300035242 | Bacteria | 6984 |
| 426 | Ga0373962_0026107 | 3300035242 | Bacteria | 1572 |
| 427 | Ga0373924_0018420 | 3300035410 | Bacteria | 2690 |
| 428 | Ga0373924_0035685 | 3300035410 | Bacteria | 2017 |
| 429 | Ga0373931_0004514 | 3300035691 | Bacteria | 6366 |
| 430 | Ga0373931_0064214 | 3300035691 | Bacteria | 1986 |
| 431 | Ga0373931_0073717 | 3300035691 | Bacteria | 1869 |
| 432 | Ga0373931_0092016 | 3300035691 | Bacteria | 1691 |
| 433 | Ga0373935_0000377 | 3300035692 | Bacteria | 22883 |
| 434 | Ga0373935_0003956 | 3300035692 | Bacteria | 8651 |
| 435 | Ga0373927_0008962 | 3300035695 | Bacteria | 6718 |
| 436 | Ga0373927_0021648 | 3300035695 | Bacteria | 4214 |
| 437 | Ga0373927_0033526 | 3300035695 | Bacteria | 3343 |
| 438 | Ga0373933_0002035 | 3300035724 | Bacteria | 11627 |
| 439 | Ga0373933_0002410 | 3300035724 | Bacteria | 10543 |
| 440 | Ga0373947_0000280 | 3300035725 | Bacteria | 28900 |
| 441 | Ga0373947_0047961 | 3300035725 | Bacteria | 2561 |
| 442 | Ga0373937_0001849 | 3300036401 | Bacteria | 17776 |
| 443 | Ga0373937_0003772 | 3300036401 | Bacteria | 12811 |
| 444 | Ga0373937_0030178 | 3300036401 | Bacteria | 4911 |
| 445 | Ga0373937_0031620 | 3300036401 | Bacteria | 4797 |
| 446 | Ga0373925_0000075 | 3300037068 | Bacteria | 105395 |
| 447 | Ga0373925_0001434 | 3300037068 | Bacteria | 20657 |
| 448 | Ga0373925_0013932 | 3300037068 | Bacteria | 5820 |
| 449 | Ga0373925_0028128 | 3300037068 | Bacteria | 4118 |
| 450 | Ga0395900_0010459 | 3300037418 | Bacteria | 9488 |
| 451 | Ga0395900_0096654 | 3300037418 | Bacteria | 3035 |
| 452 | Ga0395898_0003614 | 3300037466 | Bacteria | 17214 |
| 453 | Ga0395898_0208029 | 3300037466 | Bacteria | 1867 |
| 454 | Ga0395905_0000160 | 3300037471 | Bacteria | 111265 |
| 455 | Ga0395905_0000312 | 3300037471 | Bacteria | 70621 |
| 456 | Ga0395905_0005282 | 3300037471 | Bacteria | 13207 |
| 457 | Ga0395905_0011507 | 3300037471 | Bacteria | 8549 |
| 458 | Ga0395905_0036400 | 3300037471 | Bacteria | 4622 |
| 459 | Ga0436364_0140072 | 3300037853 | Bacteria | 2167 |
| 460 | Ga0436364_0191954 | 3300037853 | Bacteria | 66423 |
| 461 | Ga0436364_0623699 | 3300037853 | Bacteria | 7969 |
| 462 | Ga0436364_0881244 | 3300037853 | Bacteria | 28600 |
| 463 | Ga0436364_1510300 | 3300037853 | Bacteria | 30483 |
| 464 | Ga0395901_0006291 | 3300038443 | Bacteria | 12027 |
| 465 | Ga0436365_0313432 | 3300039437 | Bacteria | 3021 |
| 466 | Ga0436365_1386178 | 3300039437 | Bacteria | 5179 |
| 467 | Ga0436365_1644591 | 3300039437 | Bacteria | 5160 |
| 468 | Ga0436360_1211585 | 3300039438 | Bacteria | 1830 |
| 469 | Ga0436360_1267658 | 3300039438 | Bacteria | 1803 |
| 470 | Ga0436363_0568637 | 3300039450 | Bacteria | 7962 |
| 471 | Ga0436362_0755809 | 3300039453 | Bacteria | 1863 |
| 472 | Ga0439465_0003630 | 3300041413 | Bacteria | 5032 |
| 473 | Ga0439441_010185 | 3300042001 | Bacteria | 1571 |
| 474 | Ga0450923_013215 | 3300042125 | Bacteria | 1515 |
| 475 | Ga0450907_006652 | 3300042146 | Bacteria | 1931 |
| 476 | Ga0439435_0007814 | 3300042436 | Bacteria | 2463 |
| 477 | Ga0439460_0000006 | 3300042461 | Bacteria | 38075 |
| 478 | Ga0451577_0024385 | 3300042876 | Bacteria | 5503 |
| 479 | Ga0466969_0003234 | 3300044656 | Bacteria | 8666 |
| 480 | Ga0466972_0021056 | 3300044658 | Bacteria | 3255 |
| 481 | Ga0466966_0022455 | 3300044684 | Bacteria | 4140 |
| 482 | Ga0466961_0000259 | 3300044693 | Bacteria | 35409 |
| 483 | Ga0466968_0021887 | 3300044735 | Bacteria | 2592 |
| 484 | Ga0466957_0038538 | 3300044842 | Bacteria | 2880 |
| 485 | Ga0451576_0006479 | 3300045051 | Bacteria | 14344 |
| 486 | Ga0466967_0008760 | 3300045976 | Bacteria | 7453 |
| 487 | Ga0466967_0015127 | 3300045976 | Bacteria | 6040 |
| 488 | Ga0495617_000254 | 3300046452 | Bacteria | 31339 |
| 489 | Ga0495617_023056 | 3300046452 | Bacteria | 2103 |
| 490 | Ga0495627_004049 | 3300046453 | Bacteria | 6247 |
| 491 | Ga0495627_006396 | 3300046453 | Bacteria | 4620 |
| 492 | Ga0495592_0000060 | 3300046454 | Bacteria | 100113 |
| 493 | Ga0495592_0005925 | 3300046454 | Bacteria | 9075 |
| 494 | Ga0495592_0034343 | 3300046454 | Bacteria | 3823 |
| 495 | Ga0495603_0004025 | 3300046455 | Bacteria | 8751 |
| 496 | Ga0495603_0004739 | 3300046455 | Bacteria | 8122 |
| 497 | Ga0495603_0023263 | 3300046455 | Bacteria | 3751 |
| 498 | Ga0495603_0028911 | 3300046455 | Bacteria | 3344 |
| 499 | Ga0495590_0000100 | 3300046457 | Bacteria | 52320 |
| 500 | Ga0495591_000008 | 3300046458 | Bacteria | 353558 |
| 501 | Ga0495591_000981 | 3300046458 | Bacteria | 19446 |
| 502 | Ga0495629_0000139 | 3300046459 | Bacteria | 63649 |
| 503 | Ga0495629_0001903 | 3300046459 | Bacteria | 16256 |
| 504 | Ga0495629_0058038 | 3300046459 | Bacteria | 2705 |
| 505 | Ga0495629_0114205 | 3300046459 | Bacteria | 1882 |
| 506 | Ga0495638_0000125 | 3300046460 | Bacteria | 125288 |
| 507 | Ga0495638_0000827 | 3300046460 | Bacteria | 32493 |
| 508 | Ga0495638_0000830 | 3300046460 | Bacteria | 32408 |
| 509 | Ga0495638_0078656 | 3300046460 | Bacteria | 2006 |
| 510 | Ga0495641_0015170 | 3300046461 | Bacteria | 4131 |
| 511 | Ga0495651_0000181 | 3300046462 | Bacteria | 46803 |
| 512 | Ga0495651_0000347 | 3300046462 | Bacteria | 35746 |
| 513 | Ga0495651_0000971 | 3300046462 | Bacteria | 22205 |
| 514 | Ga0495651_0001419 | 3300046462 | Bacteria | 18593 |
| 515 | Ga0495651_0004794 | 3300046462 | Bacteria | 10354 |
| 516 | Ga0495651_0059889 | 3300046462 | Bacteria | 2918 |
| 517 | Ga0495653_0000442 | 3300046463 | Bacteria | 32578 |
| 518 | Ga0495653_0000740 | 3300046463 | Bacteria | 24927 |
| 519 | Ga0495653_0001990 | 3300046463 | Bacteria | 16063 |
| 520 | Ga0495653_0007581 | 3300046463 | Bacteria | 8872 |
| 521 | Ga0495653_0013957 | 3300046463 | Bacteria | 6551 |
| 522 | Ga0495653_0085474 | 3300046463 | Bacteria | 2320 |
| 523 | Ga0495653_0130937 | 3300046463 | Bacteria | 1776 |
| 524 | Ga0495650_0000101 | 3300046471 | Bacteria | 212903 |
| 525 | Ga0495650_0000793 | 3300046471 | Bacteria | 38715 |
| 526 | Ga0495650_0023178 | 3300046471 | Bacteria | 2959 |
| 527 | Ga0495580_0002473 | 3300046472 | Bacteria | 16117 |
| 528 | Ga0495580_0013053 | 3300046472 | Bacteria | 6358 |
| 529 | Ga0495582_0001586 | 3300046473 | Bacteria | 12828 |
| 530 | Ga0495582_0036443 | 3300046473 | Bacteria | 2706 |
| 531 | Ga0495582_0036839 | 3300046473 | Bacteria | 2691 |
| 532 | Ga0495605_0000002 | 3300046474 | Bacteria | 522417 |
| 533 | Ga0495605_0000170 | 3300046474 | Bacteria | 82318 |
| 534 | Ga0495605_0001103 | 3300046474 | Bacteria | 17970 |
| 535 | Ga0495605_0001149 | 3300046474 | Bacteria | 17565 |
| 536 | Ga0495605_0001490 | 3300046474 | Bacteria | 15289 |
| 537 | Ga0495605_0007792 | 3300046474 | Bacteria | 6068 |
| 538 | Ga0495605_0031950 | 3300046474 | Bacteria | 2684 |
| 539 | Ga0495605_0045784 | 3300046474 | Bacteria | 2154 |
| 540 | Ga0495639_0005719 | 3300046475 | Bacteria | 5349 |
| 541 | Ga0495639_0025290 | 3300046475 | Bacteria | 2618 |
| 542 | Ga0495662_0001139 | 3300046476 | Bacteria | 13118 |
| 543 | Ga0495662_0044168 | 3300046476 | Bacteria | 2151 |
| 544 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 545 | Ga0495664_0032446 | 3300046477 | Bacteria | 3064 |
| 546 | Ga0495664_0055449 | 3300046477 | Bacteria | 2358 |
| 547 | Ga0495584_0000012 | 3300046491 | Bacteria | 189225 |
| 548 | Ga0495584_0000332 | 3300046491 | Bacteria | 32909 |
| 549 | Ga0495584_0008448 | 3300046491 | Bacteria | 5334 |
| 550 | Ga0495585_0000056 | 3300046492 | Bacteria | 113739 |
| 551 | Ga0495585_0000105 | 3300046492 | Bacteria | 89432 |
| 552 | Ga0495585_0001030 | 3300046492 | Bacteria | 23180 |
| 553 | Ga0495585_0023883 | 3300046492 | Bacteria | 3507 |
| 554 | Ga0495594_0002129 | 3300046499 | Bacteria | 10306 |
| 555 | Ga0495594_0009963 | 3300046499 | Bacteria | 4920 |
| 556 | Ga0495594_0015379 | 3300046499 | Bacteria | 4019 |
| 557 | Ga0495594_0054388 | 3300046499 | Bacteria | 2206 |
| 558 | Ga0495596_0000024 | 3300046500 | Bacteria | 108222 |
| 559 | Ga0495596_0000161 | 3300046500 | Bacteria | 46832 |
| 560 | Ga0495596_0010487 | 3300046500 | Bacteria | 4032 |
| 561 | Ga0495607_0000194 | 3300046501 | Bacteria | 64377 |
| 562 | Ga0495607_0002405 | 3300046501 | Bacteria | 15273 |
| 563 | Ga0495607_0003246 | 3300046501 | Bacteria | 12529 |
| 564 | Ga0495607_0008052 | 3300046501 | Bacteria | 7237 |
| 565 | Ga0495607_0011382 | 3300046501 | Bacteria | 5924 |
| 566 | Ga0495607_0025635 | 3300046501 | Bacteria | 3665 |
| 567 | Ga0495607_0063589 | 3300046501 | Bacteria | 2087 |
| 568 | Ga0495607_0079125 | 3300046501 | Bacteria | 1811 |
| 569 | Ga0495583_0000012 | 3300046506 | Bacteria | 324839 |
| 570 | Ga0495583_0000354 | 3300046506 | Bacteria | 72235 |
| 571 | Ga0495583_0000715 | 3300046506 | Bacteria | 42513 |
| 572 | Ga0495583_0000875 | 3300046506 | Bacteria | 36501 |
| 573 | Ga0495583_0011078 | 3300046506 | Bacteria | 5197 |
| 574 | Ga0495606_0000354 | 3300046507 | Bacteria | 78470 |
| 575 | Ga0495606_0020057 | 3300046507 | Bacteria | 4943 |
| 576 | Ga0495606_0053092 | 3300046507 | Bacteria | 2631 |
| 577 | Ga0495606_0065969 | 3300046507 | Bacteria | 2298 |
| 578 | Ga0495608_0000011 | 3300046511 | Bacteria | 248514 |
| 579 | Ga0495608_0020720 | 3300046511 | Bacteria | 4517 |
| 580 | Ga0495608_0036267 | 3300046511 | Bacteria | 3320 |
| 581 | Ga0495610_0000399 | 3300046512 | Bacteria | 45092 |
| 582 | Ga0495610_0001011 | 3300046512 | Bacteria | 25894 |
| 583 | Ga0495610_0002250 | 3300046512 | Bacteria | 16324 |
| 584 | Ga0495610_0014593 | 3300046512 | Bacteria | 4606 |
| 585 | Ga0495610_0093855 | 3300046512 | Bacteria | 1355 |
| 586 | Ga0495616_0000455 | 3300046513 | Bacteria | 31233 |
| 587 | Ga0495616_0001164 | 3300046513 | Bacteria | 18609 |
| 588 | Ga0495616_0001464 | 3300046513 | Bacteria | 16385 |
| 589 | Ga0495616_0003793 | 3300046513 | Bacteria | 9637 |
| 590 | Ga0495616_0006071 | 3300046513 | Bacteria | 7360 |
| 591 | Ga0495616_0006725 | 3300046513 | Bacteria | 6934 |
| 592 | Ga0495616_0037377 | 3300046513 | Bacteria | 2498 |
| 593 | Ga0495618_0000044 | 3300046514 | Bacteria | 95526 |
| 594 | Ga0495618_0017292 | 3300046514 | Bacteria | 4419 |
| 595 | Ga0495618_0058276 | 3300046514 | Bacteria | 2446 |
| 596 | Ga0495618_0087980 | 3300046514 | Bacteria | 1987 |
| 597 | Ga0495620_0000010 | 3300046515 | Bacteria | 173604 |
| 598 | Ga0495620_0000367 | 3300046515 | Bacteria | 31046 |
| 599 | Ga0495620_0002382 | 3300046515 | Bacteria | 10897 |
| 600 | Ga0495620_0002511 | 3300046515 | Bacteria | 10633 |
| 601 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 602 | Ga0495628_0000133 | 3300046516 | Bacteria | 63350 |
| 603 | Ga0495628_0015643 | 3300046516 | Bacteria | 6334 |
| 604 | Ga0495628_0107478 | 3300046516 | Bacteria | 2148 |
| 605 | Ga0495630_0000574 | 3300046517 | Bacteria | 26824 |
| 606 | Ga0495630_0001474 | 3300046517 | Bacteria | 16277 |
| 607 | Ga0495630_0011656 | 3300046517 | Bacteria | 6370 |
| 608 | Ga0495630_0021901 | 3300046517 | Bacteria | 4720 |
| 609 | Ga0495631_0018055 | 3300046518 | Bacteria | 3325 |
| 610 | Ga0495631_0021492 | 3300046518 | Bacteria | 3005 |
| 611 | Ga0495632_0000298 | 3300046519 | Bacteria | 48057 |
| 612 | Ga0495632_0001005 | 3300046519 | Bacteria | 24459 |
| 613 | Ga0495632_0001671 | 3300046519 | Bacteria | 18178 |
| 614 | Ga0495632_0004399 | 3300046519 | Bacteria | 9577 |
| 615 | Ga0495632_0023482 | 3300046519 | Bacteria | 3293 |
| 616 | Ga0495637_0014377 | 3300046520 | Bacteria | 3734 |
| 617 | Ga0495637_0031287 | 3300046520 | Bacteria | 2355 |
| 618 | Ga0495643_0000849 | 3300046522 | Bacteria | 32986 |
| 619 | Ga0495643_0001779 | 3300046522 | Bacteria | 18477 |
| 620 | Ga0495643_0008509 | 3300046522 | Bacteria | 6487 |
| 621 | Ga0495643_0009432 | 3300046522 | Bacteria | 6067 |
| 622 | Ga0495644_0000089 | 3300046523 | Bacteria | 45629 |
| 623 | Ga0495644_0000122 | 3300046523 | Bacteria | 36964 |
| 624 | Ga0495644_0004763 | 3300046523 | Bacteria | 5329 |
| 625 | Ga0495644_0020303 | 3300046523 | Bacteria | 2535 |
| 626 | Ga0495648_0000471 | 3300046524 | Bacteria | 43369 |
| 627 | Ga0495648_0000779 | 3300046524 | Bacteria | 33991 |
| 628 | Ga0495648_0002321 | 3300046524 | Bacteria | 17712 |
| 629 | Ga0495648_0004234 | 3300046524 | Bacteria | 12314 |
| 630 | Ga0495648_0012924 | 3300046524 | Bacteria | 6200 |
| 631 | Ga0495648_0029882 | 3300046524 | Bacteria | 3611 |
| 632 | Ga0495648_0064997 | 3300046524 | Bacteria | 2147 |
| 633 | Ga0495666_0002030 | 3300046526 | Bacteria | 10010 |
| 634 | Ga0495666_0031579 | 3300046526 | Bacteria | 2594 |
| 635 | Ga0495642_0000015 | 3300046528 | Bacteria | 121192 |
| 636 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 637 | Ga0495652_0017402 | 3300046529 | Bacteria | 6414 |
| 638 | Ga0495652_0032084 | 3300046529 | Bacteria | 4595 |
| 639 | Ga0495652_0061574 | 3300046529 | Bacteria | 3167 |
| 640 | Ga0495652_0209455 | 3300046529 | Bacteria | 1473 |
| 641 | Ga0495654_0000333 | 3300046530 | Bacteria | 41443 |
| 642 | Ga0495654_0000780 | 3300046530 | Bacteria | 24559 |
| 643 | Ga0495654_0001049 | 3300046530 | Bacteria | 20229 |
| 644 | Ga0495654_0011507 | 3300046530 | Bacteria | 4784 |
| 645 | Ga0495654_0039974 | 3300046530 | Bacteria | 2339 |
| 646 | Ga0495665_0000217 | 3300046531 | Bacteria | 29018 |
| 647 | Ga0495665_0004686 | 3300046531 | Bacteria | 7373 |
| 648 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 649 | Ga0495640_0000544 | 3300046533 | Bacteria | 27687 |
| 650 | Ga0495640_0035698 | 3300046533 | Bacteria | 3518 |
| 651 | Ga0495586_0004363 | 3300046535 | Bacteria | 7563 |
| 652 | Ga0495586_0006035 | 3300046535 | Bacteria | 6477 |
| 653 | Ga0495586_0037010 | 3300046535 | Bacteria | 2620 |
| 654 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 655 | Ga0495587_0000387 | 3300046536 | Bacteria | 31427 |
| 656 | Ga0495587_0000458 | 3300046536 | Bacteria | 28539 |
| 657 | Ga0495587_0000606 | 3300046536 | Bacteria | 24416 |
| 658 | Ga0495587_0003798 | 3300046536 | Bacteria | 10023 |
| 659 | Ga0495609_0000008 | 3300046538 | Bacteria | 383025 |
| 660 | Ga0495609_0000016 | 3300046538 | Bacteria | 312882 |
| 661 | Ga0495609_0000026 | 3300046538 | Bacteria | 251973 |
| 662 | Ga0495609_0002455 | 3300046538 | Bacteria | 11400 |
| 663 | Ga0495609_0025539 | 3300046538 | Bacteria | 2708 |
| 664 | Ga0495597_0002701 | 3300046542 | Bacteria | 10948 |
| 665 | Ga0495597_0003192 | 3300046542 | Bacteria | 9775 |
| 666 | Ga0495597_0017128 | 3300046542 | Bacteria | 3415 |
| 667 | Ga0495597_0022648 | 3300046542 | Bacteria | 2912 |
| 668 | Ga0495597_0024152 | 3300046542 | Bacteria | 2807 |
| 669 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 670 | Ga0495645_0002303 | 3300046543 | Bacteria | 12969 |
| 671 | Ga0495645_0021849 | 3300046543 | Bacteria | 4626 |
| 672 | Ga0495622_0001383 | 3300046557 | Bacteria | 12371 |
| 673 | Ga0495622_0001895 | 3300046557 | Bacteria | 10293 |
| 674 | Ga0495633_0000009 | 3300046558 | Bacteria | 293183 |
| 675 | Ga0495633_0004113 | 3300046558 | Bacteria | 9379 |
| 676 | Ga0495667_0000039 | 3300046559 | Bacteria | 131308 |
| 677 | Ga0495667_0008755 | 3300046559 | Bacteria | 6878 |
| 678 | Ga0495667_0009304 | 3300046559 | Bacteria | 6661 |
| 679 | Ga0495667_0011473 | 3300046559 | Bacteria | 5999 |
| 680 | Ga0495667_0023899 | 3300046559 | Bacteria | 4116 |
| 681 | Ga0495667_0119386 | 3300046559 | Bacteria | 1703 |
| 682 | Ga0495656_0002001 | 3300046615 | Bacteria | 6713 |
| 683 | Ga0495656_0013793 | 3300046615 | Bacteria | 3014 |
| 684 | Ga0495668_0001168 | 3300046616 | Bacteria | 26730 |
| 685 | Ga0495668_0035276 | 3300046616 | Bacteria | 2803 |
| 686 | Ga0495634_0000010 | 3300046642 | Bacteria | 143792 |
| 687 | Ga0495634_0138578 | 3300046642 | Bacteria | 1546 |
| 688 | Ga0495611_0003046 | 3300046648 | Bacteria | 7465 |
| 689 | Ga0495611_0007603 | 3300046648 | Bacteria | 4598 |
| 690 | Ga0495611_0055828 | 3300046648 | Bacteria | 1787 |
| 691 | Ga0495625_0000012 | 3300046660 | Bacteria | 363006 |
| 692 | Ga0495625_0001308 | 3300046660 | Bacteria | 31077 |
| 693 | Ga0495625_0002329 | 3300046660 | Bacteria | 20762 |
| 694 | Ga0495625_0006644 | 3300046660 | Bacteria | 10264 |
| 695 | Ga0495625_0010875 | 3300046660 | Bacteria | 7479 |
| 696 | Ga0495625_0030346 | 3300046660 | Bacteria | 4035 |
| 697 | Ga0495625_0088501 | 3300046660 | Bacteria | 2145 |
| 698 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 699 | Ga0495635_0000159 | 3300046663 | Bacteria | 41596 |
| 700 | Ga0495635_0008273 | 3300046663 | Bacteria | 7258 |
| 701 | Ga0495635_0024486 | 3300046663 | Bacteria | 4207 |
| 702 | Ga0495635_0137614 | 3300046663 | Bacteria | 1664 |
| 703 | Ga0495659_0001555 | 3300046664 | Bacteria | 7730 |
| 704 | Ga0495661_0000029 | 3300046665 | Bacteria | 173899 |
| 705 | Ga0495661_0000043 | 3300046665 | Bacteria | 149067 |
| 706 | Ga0495661_0000152 | 3300046665 | Bacteria | 81192 |
| 707 | Ga0495661_0000850 | 3300046665 | Bacteria | 28430 |
| 708 | Ga0495661_0032511 | 3300046665 | Bacteria | 3297 |
| 709 | Ga0495588_0001377 | 3300046674 | Bacteria | 10379 |
| 710 | Ga0495588_0005052 | 3300046674 | Bacteria | 5858 |
| 711 | Ga0495588_0010028 | 3300046674 | Bacteria | 4391 |
| 712 | Ga0495588_0033132 | 3300046674 | Bacteria | 2608 |
| 713 | Ga0495588_0035338 | 3300046674 | Bacteria | 2532 |
| 714 | Ga0495588_0050625 | 3300046674 | Bacteria | 2137 |
| 715 | Ga0495657_0000042 | 3300046675 | Bacteria | 114669 |
| 716 | Ga0495657_0001028 | 3300046675 | Bacteria | 24494 |
| 717 | Ga0495657_0001942 | 3300046675 | Bacteria | 17644 |
| 718 | Ga0495599_0000013 | 3300046678 | Bacteria | 179828 |
| 719 | Ga0495599_0010519 | 3300046678 | Bacteria | 5661 |
| 720 | Ga0495599_0010539 | 3300046678 | Bacteria | 5656 |
| 721 | Ga0495599_0055667 | 3300046678 | Bacteria | 2476 |
| 722 | Ga0495599_0070773 | 3300046678 | Bacteria | 2177 |
| 723 | Ga0495623_0000050 | 3300046679 | Bacteria | 72959 |
| 724 | Ga0495623_0016199 | 3300046679 | Bacteria | 4815 |
| 725 | Ga0495646_0000009 | 3300046680 | Bacteria | 200698 |
| 726 | Ga0495646_0000197 | 3300046680 | Bacteria | 30139 |
| 727 | Ga0495646_0010033 | 3300046680 | Bacteria | 6021 |
| 728 | Ga0495647_0006801 | 3300046681 | Bacteria | 3807 |
| 729 | Ga0495658_0000065 | 3300046683 | Bacteria | 52835 |
| 730 | Ga0495658_0003618 | 3300046683 | Bacteria | 7651 |
| 731 | Ga0495669_0006270 | 3300046684 | Bacteria | 4965 |
| 732 | Ga0495613_0000403 | 3300046689 | Bacteria | 37100 |
| 733 | Ga0495613_0006292 | 3300046689 | Bacteria | 8882 |
| 734 | Ga0495624_0000130 | 3300046690 | Bacteria | 53133 |
| 735 | Ga0495624_0011107 | 3300046690 | Bacteria | 6196 |
| 736 | Ga0495624_0029667 | 3300046690 | Bacteria | 3567 |
| 737 | Ga0495624_0043247 | 3300046690 | Bacteria | 2874 |
| 738 | Ga0495671_0000410 | 3300046692 | Bacteria | 34465 |
| 739 | Ga0495671_0001099 | 3300046692 | Bacteria | 18677 |
| 740 | Ga0495671_0001111 | 3300046692 | Bacteria | 18606 |
| 741 | Ga0495671_0002075 | 3300046692 | Bacteria | 12853 |
| 742 | Ga0495671_0005269 | 3300046692 | Bacteria | 7593 |
| 743 | Ga0495671_0041177 | 3300046692 | Bacteria | 2327 |
| 744 | Ga0495671_0051736 | 3300046692 | Bacteria | 2042 |
| 745 | Ga0495671_0053015 | 3300046692 | Bacteria | 2014 |
| 746 | Ga0495649_0001219 | 3300046694 | Bacteria | 19807 |
| 747 | Ga0495649_0006023 | 3300046694 | Bacteria | 7586 |
| 748 | Ga0495649_0009751 | 3300046694 | Bacteria | 5687 |
| 749 | Ga0495649_0011341 | 3300046694 | Bacteria | 5232 |
| 750 | Ga0495649_0029987 | 3300046694 | Bacteria | 3005 |
| 751 | Ga0495649_0045548 | 3300046694 | Bacteria | 2391 |
| 752 | Ga0495589_0000101 | 3300046794 | Bacteria | 82583 |
| 753 | Ga0495589_0000251 | 3300046794 | Bacteria | 43879 |
| 754 | Ga0495589_0001783 | 3300046794 | Bacteria | 12244 |
| 755 | Ga0495589_0001792 | 3300046794 | Bacteria | 12217 |
| 756 | Ga0495589_0004826 | 3300046794 | Bacteria | 7164 |
| 757 | Ga0495589_0042126 | 3300046794 | Bacteria | 2276 |
| 758 | Ga0495600_0000209 | 3300046809 | Bacteria | 33688 |
| 759 | Ga0495600_0000561 | 3300046809 | Bacteria | 19318 |
| 760 | Ga0495600_0013607 | 3300046809 | Bacteria | 5117 |
| 761 | Ga0495600_0039972 | 3300046809 | Bacteria | 3054 |
| 762 | Ga0495600_0184861 | 3300046809 | Bacteria | 1342 |
| 763 | Ga0495660_0000151 | 3300046810 | Bacteria | 74982 |
| 764 | Ga0495660_0000276 | 3300046810 | Bacteria | 48147 |
| 765 | Ga0495660_0000561 | 3300046810 | Bacteria | 30321 |
| 766 | Ga0495660_0000926 | 3300046810 | Bacteria | 21613 |
| 767 | Ga0495660_0001106 | 3300046810 | Bacteria | 19273 |
| 768 | Ga0495660_0001193 | 3300046810 | Bacteria | 18236 |
| 769 | Ga0495660_0015344 | 3300046810 | Bacteria | 4426 |
| 770 | Ga0495581_0007122 | 3300047315 | Bacteria | 6478 |
| 771 | Ga0495581_0020331 | 3300047315 | Bacteria | 3854 |
| 772 | Ga0495581_0045174 | 3300047315 | Bacteria | 2547 |
| 773 | Ga0495604_0000069 | 3300047317 | Bacteria | 89935 |
| 774 | Ga0495604_0007076 | 3300047317 | Bacteria | 8897 |
| 775 | Ga0495604_0027675 | 3300047317 | Bacteria | 4507 |
| 776 | Ga0495604_0029121 | 3300047317 | Bacteria | 4394 |
| 777 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 778 | Ga0495674_0000732 | 3300047319 | Bacteria | 30989 |
| 779 | Ga0495674_0003006 | 3300047319 | Bacteria | 16427 |
| 780 | Ga0495674_0042484 | 3300047319 | Bacteria | 4055 |
| 781 | Ga0495674_0053964 | 3300047319 | Bacteria | 3531 |
| 782 | Ga0495674_0066199 | 3300047319 | Bacteria | 3136 |
| 783 | Ga0495674_0069865 | 3300047319 | Bacteria | 3036 |
| 784 | Ga0495674_0070948 | 3300047319 | Bacteria | 3009 |
| 785 | Ga0495672_0000671 | 3300047320 | Bacteria | 37991 |
| 786 | Ga0495672_0000828 | 3300047320 | Bacteria | 33069 |
| 787 | Ga0495672_0000860 | 3300047320 | Bacteria | 32038 |
| 788 | Ga0495672_0004493 | 3300047320 | Bacteria | 11407 |
| 789 | Ga0495672_0010948 | 3300047320 | Bacteria | 6431 |
| 790 | Ga0495672_0123707 | 3300047320 | Bacteria | 1371 |
| 791 | Ga0495676_0000001 | 3300047321 | Bacteria | 624167 |
| 792 | Ga0495676_0006417 | 3300047321 | Bacteria | 10834 |
| 793 | Ga0495676_0179997 | 3300047321 | Bacteria | 1482 |
| 794 | Ga0495680_0000036 | 3300047322 | Bacteria | 103310 |
| 795 | Ga0495680_0000079 | 3300047322 | Bacteria | 86013 |
| 796 | Ga0495680_0000328 | 3300047322 | Bacteria | 53287 |
| 797 | Ga0495680_0001052 | 3300047322 | Bacteria | 30524 |
| 798 | Ga0495680_0002410 | 3300047322 | Bacteria | 19153 |
| 799 | Ga0495680_0014348 | 3300047322 | Bacteria | 6867 |
| 800 | Ga0495680_0029091 | 3300047322 | Bacteria | 4527 |
| 801 | Ga0495680_0032116 | 3300047322 | Bacteria | 4266 |
| 802 | Ga0495680_0036061 | 3300047322 | Bacteria | 3975 |
| 803 | Ga0495680_0054503 | 3300047322 | Bacteria | 3104 |
| 804 | Ga0495680_0085468 | 3300047322 | Bacteria | 2375 |
| 805 | Ga0495683_0000022 | 3300047323 | Bacteria | 163268 |
| 806 | Ga0495683_0000042 | 3300047323 | Bacteria | 137528 |
| 807 | Ga0495683_0000300 | 3300047323 | Bacteria | 42071 |
| 808 | Ga0495683_0012140 | 3300047323 | Bacteria | 4527 |
| 809 | Ga0495687_000037 | 3300047443 | Bacteria | 252363 |
| 810 | Ga0495675_0000200 | 3300047444 | Bacteria | 43734 |
| 811 | Ga0495675_0000245 | 3300047444 | Bacteria | 39142 |
| 812 | Ga0495675_0000527 | 3300047444 | Bacteria | 24798 |
| 813 | Ga0495675_0019046 | 3300047444 | Bacteria | 4359 |
| 814 | Ga0495677_0000014 | 3300047445 | Bacteria | 136236 |
| 815 | Ga0495677_0001369 | 3300047445 | Bacteria | 9750 |
| 816 | Ga0495679_000042 | 3300047446 | Bacteria | 143151 |
| 817 | Ga0495679_000060 | 3300047446 | Bacteria | 109240 |
| 818 | Ga0495673_0000142 | 3300047469 | Bacteria | 128538 |
| 819 | Ga0495673_0000824 | 3300047469 | Bacteria | 29082 |
| 820 | Ga0495673_0000849 | 3300047469 | Bacteria | 28392 |
| 821 | Ga0495673_0001705 | 3300047469 | Bacteria | 16832 |
| 822 | Ga0495673_0004583 | 3300047469 | Bacteria | 8611 |
| 823 | Ga0495673_0017928 | 3300047469 | Bacteria | 3581 |
| 824 | Ga0495681_0001555 | 3300047470 | Bacteria | 17121 |
| 825 | Ga0495681_0001678 | 3300047470 | Bacteria | 16420 |
| 826 | Ga0495681_0003122 | 3300047470 | Bacteria | 11623 |
| 827 | Ga0495681_0012199 | 3300047470 | Bacteria | 5063 |
| 828 | Ga0495684_0000016 | 3300047471 | Bacteria | 169338 |
| 829 | Ga0495684_0001073 | 3300047471 | Bacteria | 22129 |
| 830 | Ga0495684_0001328 | 3300047471 | Bacteria | 19903 |
| 831 | Ga0495684_0001824 | 3300047471 | Bacteria | 17119 |
| 832 | Ga0495684_0004613 | 3300047471 | Bacteria | 10756 |
| 833 | Ga0495684_0095899 | 3300047471 | Bacteria | 2245 |
| 834 | Ga0495684_0177015 | 3300047471 | Bacteria | 1583 |
| 835 | Ga0495686_0001995 | 3300047472 | Bacteria | 20251 |
| 836 | Ga0495686_0011831 | 3300047472 | Bacteria | 6137 |
| 837 | Ga0495686_0037241 | 3300047472 | Bacteria | 3117 |
| 838 | Ga0495593_0001060 | 3300047673 | Bacteria | 16072 |
| 839 | Ga0495593_0001500 | 3300047673 | Bacteria | 13713 |
| 840 | Ga0495593_0001523 | 3300047673 | Bacteria | 13634 |
| 841 | Ga0495593_0018915 | 3300047673 | Bacteria | 3865 |
| 842 | Ga0495593_0062137 | 3300047673 | Bacteria | 1952 |
| 843 | Ga0495602_0000024 | 3300048088 | Bacteria | 151162 |
| 844 | Ga0495602_0003267 | 3300048088 | Bacteria | 16748 |
| 845 | Ga0495614_0003207 | 3300048089 | Bacteria | 7303 |
| 846 | Ga0495626_0000002 | 3300048091 | Bacteria | 436012 |
| 847 | Ga0495626_0000049 | 3300048091 | Bacteria | 161052 |
| 848 | Ga0495626_0000243 | 3300048091 | Bacteria | 63145 |
| 849 | Ga0495626_0000289 | 3300048091 | Bacteria | 54458 |
| 850 | Ga0496100_0002405 | 3300048903 | Bacteria | 9481 |
| 851 | Ga0496100_0003748 | 3300048903 | Bacteria | 7959 |
| 852 | Ga0496100_0020498 | 3300048903 | Bacteria | 3964 |
| 853 | Ga0496100_0077569 | 3300048903 | Bacteria | 2234 |
| 854 | Ga0496100_0100760 | 3300048903 | Bacteria | 1990 |
| 855 | Ga0496101_0001763 | 3300048904 | Bacteria | 12984 |
| 856 | Ga0496101_0002134 | 3300048904 | Bacteria | 12066 |
| 857 | Ga0496101_0005234 | 3300048904 | Bacteria | 8254 |
| 858 | Ga0496101_0049568 | 3300048904 | Bacteria | 3021 |
| 859 | Ga0496101_0095338 | 3300048904 | Bacteria | 2219 |
| 860 | Ga0496102_0000130 | 3300048905 | Bacteria | 104052 |
| 861 | Ga0496102_0005532 | 3300048905 | Bacteria | 10730 |
| 862 | Ga0496102_0011817 | 3300048905 | Bacteria | 7536 |
| 863 | Ga0496102_0018808 | 3300048905 | Bacteria | 6077 |
| 864 | Ga0496102_0229335 | 3300048905 | Bacteria | 1751 |
| 865 | Ga0496103_0000419 | 3300048906 | Bacteria | 37226 |
| 866 | Ga0496103_0003142 | 3300048906 | Bacteria | 10157 |
| 867 | Ga0496104_0002323 | 3300048907 | Bacteria | 16428 |
| 868 | Ga0496104_0002943 | 3300048907 | Bacteria | 14673 |
| 869 | Ga0496104_0017455 | 3300048907 | Bacteria | 6535 |
| 870 | Ga0496104_0041528 | 3300048907 | Bacteria | 4313 |
| 871 | Ga0496104_0106764 | 3300048907 | Bacteria | 2683 |
| 872 | Ga0496104_0146255 | 3300048907 | Bacteria | 2269 |
| 873 | Ga0496104_0203393 | 3300048907 | Bacteria | 1892 |
| 874 | Ga0496104_0277861 | 3300048907 | Bacteria | 1588 |
| 875 | Ga0496105_0017486 | 3300048908 | Bacteria | 5750 |
| 876 | Ga0496105_0020488 | 3300048908 | Bacteria | 5344 |
| 877 | Ga0496105_0032692 | 3300048908 | Bacteria | 4270 |
| 878 | Ga0496105_0073963 | 3300048908 | Bacteria | 2815 |
| 879 | Ga0496105_0099626 | 3300048908 | Bacteria | 2400 |
| 880 | Ga0496105_0229312 | 3300048908 | Bacteria | 1509 |
| 881 | Ga0496106_0008421 | 3300048909 | Bacteria | 7629 |
| 882 | Ga0496106_0015311 | 3300048909 | Bacteria | 5674 |
| 883 | Ga0496106_0033756 | 3300048909 | Bacteria | 3819 |
| 884 | Ga0496106_0094117 | 3300048909 | Bacteria | 2316 |
| 885 | Ga0496106_0147435 | 3300048909 | Bacteria | 1854 |
| 886 | Ga0496107_0010740 | 3300048910 | Bacteria | 6369 |
| 887 | Ga0496107_0019213 | 3300048910 | Bacteria | 4821 |
| 888 | Ga0496108_0010986 | 3300048911 | Bacteria | 7354 |
| 889 | Ga0496108_0014948 | 3300048911 | Bacteria | 6335 |
| 890 | Ga0496108_0027735 | 3300048911 | Bacteria | 4680 |
| 891 | Ga0496108_0034543 | 3300048911 | Bacteria | 4202 |
| 892 | Ga0496108_0043531 | 3300048911 | Bacteria | 3749 |
| 893 | Ga0496108_0180073 | 3300048911 | Bacteria | 1830 |
| 894 | Ga0496109_0002420 | 3300048912 | Bacteria | 15629 |
| 895 | Ga0496109_0013194 | 3300048912 | Bacteria | 7151 |
| 896 | Ga0496109_0014820 | 3300048912 | Bacteria | 6784 |
| 897 | Ga0496109_0016348 | 3300048912 | Bacteria | 6484 |
| 898 | Ga0496109_0098338 | 3300048912 | Bacteria | 2713 |
| 899 | Ga0496109_0131477 | 3300048912 | Bacteria | 2336 |
| 900 | Ga0496110_0002430 | 3300048913 | Bacteria | 13955 |
| 901 | Ga0496110_0005366 | 3300048913 | Bacteria | 10043 |
| 902 | Ga0496110_0014024 | 3300048913 | Bacteria | 6642 |
| 903 | Ga0496110_0034472 | 3300048913 | Bacteria | 4384 |
| 904 | Ga0496110_0034753 | 3300048913 | Bacteria | 4369 |
| 905 | Ga0496110_0053532 | 3300048913 | Bacteria | 3549 |
| 906 | Ga0496111_0002323 | 3300048914 | Bacteria | 11453 |
| 907 | Ga0496111_0003314 | 3300048914 | Bacteria | 9963 |
| 908 | Ga0496111_0003533 | 3300048914 | Bacteria | 9672 |
| 909 | Ga0496111_0017099 | 3300048914 | Bacteria | 5008 |
| 910 | Ga0496111_0038133 | 3300048914 | Bacteria | 3442 |
| 911 | Ga0496111_0043228 | 3300048914 | Bacteria | 3238 |
| 912 | Ga0496112_0001155 | 3300048915 | Bacteria | 19707 |
| 913 | Ga0496112_0007606 | 3300048915 | Bacteria | 9629 |
| 914 | Ga0496112_0008924 | 3300048915 | Bacteria | 8999 |
| 915 | Ga0496112_0072427 | 3300048915 | Bacteria | 3406 |
| 916 | Ga0496112_0109353 | 3300048915 | Bacteria | 2734 |
| 917 | Ga0496112_0191113 | 3300048915 | Bacteria | 2009 |
| 918 | Ga0496113_0001528 | 3300048916 | Bacteria | 12957 |
| 919 | Ga0496113_0008099 | 3300048916 | Bacteria | 6824 |
| 920 | Ga0496113_0011117 | 3300048916 | Bacteria | 5989 |
| 921 | Ga0496113_0015597 | 3300048916 | Bacteria | 5229 |
| 922 | Ga0496114_0001306 | 3300048917 | Bacteria | 18867 |
| 923 | Ga0496114_0014735 | 3300048917 | Bacteria | 6283 |
| 924 | Ga0496115_0031578 | 3300048918 | Bacteria | 4173 |
| 925 | Ga0496115_0074356 | 3300048918 | Bacteria | 2759 |
| 926 | Ga0496116_0002711 | 3300048919 | Bacteria | 18241 |
| 927 | Ga0496116_0043572 | 3300048919 | Bacteria | 3056 |
| 928 | Ga0496116_0053591 | 3300048919 | Bacteria | 2663 |
| 929 | Ga0496117_0002642 | 3300048920 | Bacteria | 22219 |
| 930 | Ga0496117_0024264 | 3300048920 | Bacteria | 4802 |
| 931 | Ga0496118_0003017 | 3300048921 | Bacteria | 21741 |
| 932 | Ga0496118_0005276 | 3300048921 | Bacteria | 14752 |
| 933 | Ga0496119_0003545 | 3300048922 | Bacteria | 16111 |
| 934 | Ga0496120_0094270 | 3300048923 | Bacteria | 1594 |
| 935 | Ga0496121_0000197 | 3300048924 | Bacteria | 135555 |
| 936 | Ga0496121_0007804 | 3300048924 | Bacteria | 12815 |
| 937 | Ga0496121_0009668 | 3300048924 | Bacteria | 11046 |
| 938 | Ga0496122_0000963 | 3300048925 | Bacteria | 51691 |
| 939 | Ga0496122_0001032 | 3300048925 | Bacteria | 48968 |
| 940 | Ga0496122_0007096 | 3300048925 | Bacteria | 12585 |
| 941 | Ga0496123_0000608 | 3300048926 | Bacteria | 60350 |
| 942 | Ga0496123_0000806 | 3300048926 | Bacteria | 50579 |
| 943 | Ga0496124_0017736 | 3300048927 | Bacteria | 6697 |
| 944 | Ga0496125_0005258 | 3300048928 | Bacteria | 14494 |
| 945 | Ga0496125_0084236 | 3300048928 | Bacteria | 2415 |
| 946 | Ga0496126_0000612 | 3300048929 | Bacteria | 67231 |
| 947 | Ga0496126_0020582 | 3300048929 | Bacteria | 6461 |
| 948 | Ga0496126_0104849 | 3300048929 | Bacteria | 2470 |
| 949 | Ga0495678_000011 | 3300049459 | Bacteria | 335512 |
| 950 | Ga0495678_000873 | 3300049459 | Bacteria | 26824 |
| 951 | Ga0495678_008279 | 3300049459 | Bacteria | 5266 |
| 952 | Ga0495682_0000322 | 3300049460 | Bacteria | 35481 |
| 953 | Ga0501298_010528 | 3300049521 | Bacteria | 1593 |
| 954 | Ga0501031_0015894 | 3300049568 | Bacteria | 4887 |
| 955 | Ga0501031_0043820 | 3300049568 | Bacteria | 2919 |
| 956 | Ga0501031_0106923 | 3300049568 | Bacteria | 1826 |
| 957 | Ga0501032_0111256 | 3300049569 | Bacteria | 1812 |
| 958 | Ga0501034_0249591 | 3300049571 | Bacteria | 1719 |
| 959 | Ga0501036_0001202 | 3300049572 | Bacteria | 19754 |
| 960 | Ga0501036_0011773 | 3300049572 | Bacteria | 7249 |
| 961 | Ga0501039_0004199 | 3300049575 | Bacteria | 10844 |
| 962 | Ga0501039_0007339 | 3300049575 | Bacteria | 8397 |
| 963 | Ga0501039_0032753 | 3300049575 | Bacteria | 4008 |
| 964 | Ga0501039_0046794 | 3300049575 | Bacteria | 3343 |
| 965 | Ga0501040_0005453 | 3300049576 | Bacteria | 8229 |
| 966 | Ga0501040_0109292 | 3300049576 | Bacteria | 1933 |
| 967 | Ga0501041_0001526 | 3300049577 | Bacteria | 12855 |
| 968 | Ga0501041_0011429 | 3300049577 | Bacteria | 5246 |
| 969 | Ga0501041_0058997 | 3300049577 | Bacteria | 2349 |
| 970 | Ga0501042_0005162 | 3300049578 | Bacteria | 8387 |
| 971 | Ga0501042_0088860 | 3300049578 | Bacteria | 2217 |
| 972 | Ga0501046_0051523 | 3300049580 | Bacteria | 3248 |
| 973 | Ga0501046_0176088 | 3300049580 | Bacteria | 1602 |
| 974 | Ga0501048_0060290 | 3300049582 | Bacteria | 2689 |
| 975 | Ga0501048_0130659 | 3300049582 | Bacteria | 1776 |
| 976 | Ga0501068_0034841 | 3300049584 | Bacteria | 3004 |
| 977 | Ga0501068_0142391 | 3300049584 | Bacteria | 1503 |
| 978 | Ga0501069_0055149 | 3300049585 | Bacteria | 2214 |
| 979 | Ga0501071_0000122 | 3300049587 | Bacteria | 31193 |
| 980 | Ga0501071_0158636 | 3300049587 | Bacteria | 1690 |
| 981 | Ga0501071_0167558 | 3300049587 | Bacteria | 1644 |
| 982 | Ga0501072_0001662 | 3300049588 | Bacteria | 16579 |
| 983 | Ga0501072_0001697 | 3300049588 | Bacteria | 16409 |
| 984 | Ga0501072_0169706 | 3300049588 | Bacteria | 1741 |
| 985 | Ga0501073_0163880 | 3300049589 | Bacteria | 1540 |
| 986 | Ga0501074_0001550 | 3300049590 | Bacteria | 15533 |
| 987 | Ga0501074_0077578 | 3300049590 | Bacteria | 2384 |
| 988 | Ga0501074_0090080 | 3300049590 | Bacteria | 2197 |
| 989 | Ga0501075_0000366 | 3300049591 | Bacteria | 25923 |
| 990 | Ga0501075_0001616 | 3300049591 | Bacteria | 14762 |
| 991 | Ga0501075_0015017 | 3300049591 | Bacteria | 5556 |
| 992 | Ga0501075_0048774 | 3300049591 | Bacteria | 3182 |
| 993 | Ga0501075_0068951 | 3300049591 | Bacteria | 2672 |
| 994 | Ga0501075_0070250 | 3300049591 | Bacteria | 2646 |
| 995 | Ga0501076_0003741 | 3300049592 | Bacteria | 10699 |
| 996 | Ga0501076_0005033 | 3300049592 | Bacteria | 9458 |
| 997 | Ga0501076_0008353 | 3300049592 | Bacteria | 7587 |
| 998 | Ga0501076_0008894 | 3300049592 | Bacteria | 7387 |
| 999 | Ga0501076_0166013 | 3300049592 | Bacteria | 1799 |
| 1000 | Ga0501076_0194302 | 3300049592 | Bacteria | 1656 |
| 1001 | Ga0501077_0042661 | 3300049593 | Bacteria | 2884 |
| 1002 | Ga0501079_0023807 | 3300049741 | Bacteria | 4698 |
| 1003 | Ga0501079_0104511 | 3300049741 | Bacteria | 2197 |
| 1004 | Ga0501079_0112499 | 3300049741 | Bacteria | 2116 |
| 1005 | Ga0501079_0140996 | 3300049741 | Bacteria | 1878 |
| 1006 | Ga0501080_0022865 | 3300049742 | Bacteria | 5796 |
| 1007 | Ga0501080_0302855 | 3300049742 | Bacteria | 1449 |
| 1008 | Ga0501081_0001904 | 3300049743 | Bacteria | 12947 |
| 1009 | Ga0501081_0010162 | 3300049743 | Bacteria | 6142 |
| 1010 | Ga0501081_0010538 | 3300049743 | Bacteria | 6033 |
| 1011 | Ga0501081_0018805 | 3300049743 | Bacteria | 4590 |
| 1012 | Ga0501081_0241506 | 3300049743 | Bacteria | 1317 |
| 1013 | Ga0501035_0111751 | 3300049822 | Bacteria | 2394 |
| 1014 | Ga0501044_0107645 | 3300049823 | Bacteria | 2799 |
| 1015 | Ga0501045_0011349 | 3300049824 | Bacteria | 6255 |
| 1016 | Ga0501045_0019906 | 3300049824 | Bacteria | 4790 |
| 1017 | Ga0501045_0031928 | 3300049824 | Bacteria | 3814 |
| 1018 | Ga0501045_0059322 | 3300049824 | Bacteria | 2803 |
| 1019 | nmdc:mga00v17_527_c1 | 3300050491 | Bacteria | 21481 |
| 1020 | nmdc:mga0k408_155_c2 | 3300050493 | Bacteria | 16666 |
| 1021 | nmdc:mga05p37_19658_c1 | 3300050507 | Bacteria | 8171 |
| 1022 | nmdc:mga05p37_213844_c1 | 3300050507 | Bacteria | 2329 |
| 1023 | nmdc:mga05p37_7272_c1 | 3300050507 | Bacteria | 13063 |
| 1024 | nmdc:mga09592_14450_c1 | 3300050508 | Bacteria | 6444 |
| 1025 | nmdc:mga08y16_113485_c1 | 3300050511 | Bacteria | 2821 |
| 1026 | nmdc:mga08y16_16965_c1 | 3300050511 | Bacteria | 7667 |
| 1027 | nmdc:mga08y16_30808_c1 | 3300050511 | Bacteria | 5642 |
| 1028 | nmdc:mga08y16_72164_c1 | 3300050511 | Bacteria | 3598 |
| 1029 | nmdc:mga0n895_1531_c1 | 3300050512 | Bacteria | 17366 |
| 1030 | nmdc:mga0n895_172665_c1 | 3300050512 | Bacteria | 2193 |
| 1031 | nmdc:mga0n895_65468_c1 | 3300050512 | Bacteria | 3597 |
| 1032 | nmdc:mga0n895_78359_c1 | 3300050512 | Bacteria | 3289 |
| 1033 | nmdc:mga0rr50_40898_c1 | 3300050513 | Bacteria | 3373 |
| 1034 | nmdc:mga08x19_13632_c1 | 3300050514 | Bacteria | 4918 |
| 1035 | nmdc:mga08x19_96017_c1 | 3300050514 | Bacteria | 1962 |
| 1036 | nmdc:mga0a205_280561_c1 | 3300050515 | Bacteria | 1541 |
| 1037 | nmdc:mga0a205_65894_c1 | 3300050515 | Bacteria | 3500 |
| 1038 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 1039 | Ga0495612_0000017 | 3300053078 | Bacteria | 152112 |
| 1040 | Ga0495612_0005030 | 3300053078 | Bacteria | 5474 |
| 1041 | Ga0495595_0000010 | 3300053084 | Bacteria | 178819 |
| 1042 | Ga0495595_0002115 | 3300053084 | Bacteria | 7710 |
| 1043 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 1044 | Ga0495619_0000256 | 3300053085 | Bacteria | 38697 |
| 1045 | Ga0495619_0046064 | 3300053085 | Bacteria | 2866 |
| 1046 | Ga0495619_0047360 | 3300053085 | Bacteria | 2830 |
| 1047 | Ga0495619_0133506 | 3300053085 | Bacteria | 1707 |
| 1048 | Ga0500616_0051832 | 3300053153 | Bacteria | 2160 |
| 1049 | Ga0501084_0001586 | 3300054114 | Bacteria | 17999 |
| 1050 | Ga0501084_0069416 | 3300054114 | Bacteria | 2950 |
| 1051 | Ga0501084_0074699 | 3300054114 | Bacteria | 2839 |
| 1052 | Ga0501084_0087457 | 3300054114 | Bacteria | 2616 |
| 1053 | Ga0501084_0248081 | 3300054114 | Bacteria | 1503 |
| 1054 | Ga0501082_0010569 | 3300060353 | Bacteria | 7944 |
| 1055 | Ga0501082_0044116 | 3300060353 | Bacteria | 3846 |
| 1056 | Ga0501082_0076312 | 3300060353 | Bacteria | 2889 |
| 1057 | Ga0501082_0082809 | 3300060353 | Bacteria | 2768 |
| 1058 | Ga0530510_0002303 | 3300061734 | Bacteria | 13086 |
| 1059 | Ga0530510_0031828 | 3300061734 | Bacteria | 3793 |
| 1060 | Ga0530510_0034963 | 3300061734 | Bacteria | 3621 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0167558 | Ga0501071_0167558_463_1599 | 373 |
| 2 | 3300049591 | Ga0501075_0070250 | Ga0501075_0070250_1487_2623 | 373 |
| 3 | 3300053085 | Ga0495619_0047360 | Ga0495619_0047360_1475_2611 | 376 |
| 4 | 3300047319 | Ga0495674_0070948 | Ga0495674_0070948_1241_2380 | 377 |
| 5 | iso_pu_bacteria | 2889016732 | 2889020876 | 378 |
| 6 | 3300009093 | Ga0105240_10525843 | Ga0105240_105258431 | 382 |
| 7 | 3300005337 | Ga0070682_100099984 | Ga0070682_1000999842 | 386 |
| 8 | 3300048912 | Ga0496109_0098338 | Ga0496109_0098338_1375_2547 | 387 |
| 9 | 3300025942 | Ga0207689_10128941 | Ga0207689_101289412 | 390 |
| 10 | 3300044842 | Ga0466957_0038538 | Ga0466957_0038538_877_2184 | 392 |
| 11 | iso_pu_bacteria | 2961136820 | 2961144484 | 392 |
| 12 | 3300031824 | Ga0307413_10102439 | Ga0307413_101024391 | 394 |
| 13 | 3300032002 | Ga0307416_100166651 | Ga0307416_1001666512 | 394 |
| 14 | 3300032004 | Ga0307414_10185375 | Ga0307414_101853751 | 394 |
| 15 | 3300032005 | Ga0307411_10103951 | Ga0307411_101039512 | 394 |
| 16 | 3300053153 | Ga0500616_0051832 | Ga0500616_0051832_811_2094 | 397 |
| 17 | 3300049584 | Ga0501068_0034841 | Ga0501068_0034841_1739_2950 | 398 |
| 18 | 3300005434 | Ga0070709_10005000 | Ga0070709_100050004 | 399 |
| 19 | 3300005985 | Ga0081539_10071117 | Ga0081539_100711172 | 399 |
| 20 | 3300013296 | Ga0157374_10001916 | Ga0157374_100019169 | 399 |
| 21 | 3300025928 | Ga0207700_10108110 | Ga0207700_101081102 | 399 |
| 22 | 3300037853 | Ga0436364_0140072 | Ga0436364_0140072_615_1892 | 401 |
| 23 | 3300042876 | Ga0451577_0024385 | Ga0451577_0024385_3973_5274 | 401 |
| 24 | 3300031995 | Ga0307409_100037524 | Ga0307409_1000375242 | 402 |
| 25 | 3300032126 | Ga0307415_100137738 | Ga0307415_1001377382 | 402 |
| 26 | 3300049568 | Ga0501031_0043820 | Ga0501031_0043820_1469_2755 | 403 |
| 27 | 3300049572 | Ga0501036_0011773 | Ga0501036_0011773_261_1547 | 403 |
| 28 | 3300049575 | Ga0501039_0004199 | Ga0501039_0004199_2417_3703 | 403 |
| 29 | 3300049576 | Ga0501040_0005453 | Ga0501040_0005453_4067_5353 | 403 |
| 30 | 3300049577 | Ga0501041_0001526 | Ga0501041_0001526_8764_10050 | 403 |
| 31 | 3300049578 | Ga0501042_0005162 | Ga0501042_0005162_2849_4135 | 403 |
| 32 | 3300049580 | Ga0501046_0051523 | Ga0501046_0051523_125_1411 | 403 |
| 33 | 3300049584 | Ga0501068_0142391 | Ga0501068_0142391_11_1237 | 403 |
| 34 | 3300049587 | Ga0501071_0000122 | Ga0501071_0000122_29239_30525 | 403 |
| 35 | 3300049588 | Ga0501072_0001697 | Ga0501072_0001697_8338_9624 | 403 |
| 36 | 3300049590 | Ga0501074_0077578 | Ga0501074_0077578_404_1690 | 403 |
| 37 | 3300049591 | Ga0501075_0000366 | Ga0501075_0000366_17124_18410 | 403 |
| 38 | 3300049592 | Ga0501076_0003741 | Ga0501076_0003741_7210_8496 | 403 |
| 39 | 3300049741 | Ga0501079_0023807 | Ga0501079_0023807_623_1909 | 403 |
| 40 | 3300049742 | Ga0501080_0022865 | Ga0501080_0022865_3679_4965 | 403 |
| 41 | 3300049743 | Ga0501081_0001904 | Ga0501081_0001904_2417_3703 | 403 |
| 42 | 3300049823 | Ga0501044_0107645 | Ga0501044_0107645_703_1989 | 403 |
| 43 | 3300049824 | Ga0501045_0031928 | Ga0501045_0031928_161_1447 | 403 |
| 44 | 3300054114 | Ga0501084_0001586 | Ga0501084_0001586_10572_11858 | 403 |
| 45 | 3300054114 | Ga0501084_0074699 | Ga0501084_0074699_560_1849 | 403 |
| 46 | 3300061734 | Ga0530510_0034963 | Ga0530510_0034963_1214_2500 | 403 |
| 47 | 3300031903 | Ga0307407_10037805 | Ga0307407_100378052 | 404 |
| 48 | iso_pu_bacteria | 2977915119 | 2977922119 | 404 |
| 49 | 3300003781 | Ga0055536_1000524 | Ga0055536_10005246 | 406 |
| 50 | 3300003791 | Ga0055530_10004363 | Ga0055530_100043637 | 406 |
| 51 | 3300003792 | Ga0055540_1000054 | Ga0055540_1000054115 | 406 |
| 52 | 3300003794 | Ga0055531_10000037 | Ga0055531_1000003725 | 406 |
| 53 | 3300015261 | Ga0182006_1003241 | Ga0182006_10032412 | 406 |
| 54 | 3300025292 | Ga0209676_1000105 | Ga0209676_1000105102 | 406 |
| 55 | 3300025298 | Ga0209050_1001283 | Ga0209050_100128322 | 406 |
| 56 | 3300025303 | Ga0209051_1000064 | Ga0209051_1000064119 | 406 |
| 57 | 3300025304 | Ga0209257_1000109 | Ga0209257_1000109119 | 406 |
| 58 | 3300031852 | Ga0307410_10156890 | Ga0307410_101568902 | 406 |
| 59 | 3300035092 | Ga0373952_0020885 | Ga0373952_0020885_140_1363 | 406 |
| 60 | 3300046477 | Ga0495664_0032446 | Ga0495664_0032446_1225_2544 | 406 |
| 61 | 3300046517 | Ga0495630_0011656 | Ga0495630_0011656_2981_4264 | 406 |
| 62 | 3300046533 | Ga0495640_0000544 | Ga0495640_0000544_2943_4226 | 406 |
| 63 | 3300046543 | Ga0495645_0021849 | Ga0495645_0021849_1818_3137 | 406 |
| 64 | 3300046660 | Ga0495625_0000012 | Ga0495625_0000012_80202_81485 | 406 |
| 65 | 3300047471 | Ga0495684_0001824 | Ga0495684_0001824_2196_3479 | 406 |
| 66 | 3300060353 | Ga0501082_0010569 | Ga0501082_0010569_2936_4252 | 406 |
| 67 | 3300046520 | Ga0495637_0014377 | Ga0495637_0014377_2128_3411 | 408 |
| 68 | 3300005445 | Ga0070708_100089217 | Ga0070708_1000892172 | 409 |
| 69 | 3300005471 | Ga0070698_100000484 | Ga0070698_10000048420 | 409 |
| 70 | 3300005518 | Ga0070699_100009192 | Ga0070699_1000091927 | 409 |
| 71 | 3300006028 | Ga0070717_10002130 | Ga0070717_100021307 | 409 |
| 72 | 3300041413 | Ga0439465_0003630 | Ga0439465_0003630_389_1735 | 409 |
| 73 | 3300049580 | Ga0501046_0176088 | Ga0501046_0176088_35_1279 | 409 |
| 74 | 3300011119 | Ga0105246_10081362 | Ga0105246_100813622 | 410 |
| 75 | 3300046524 | Ga0495648_0012924 | Ga0495648_0012924_4846_6129 | 410 |
| 76 | 3300046694 | Ga0495649_0029987 | Ga0495649_0029987_523_1806 | 410 |
| 77 | 3300002705 | JGI25156J39149_1001315 | JGI25156J39149_10013157 | 411 |
| 78 | 3300009011 | Ga0105251_10001687 | Ga0105251_1000168716 | 411 |
| 79 | 3300009092 | Ga0105250_10000221 | Ga0105250_100002213 | 411 |
| 80 | 3300021388 | Ga0213875_10058761 | Ga0213875_100587612 | 411 |
| 81 | 3300025256 | Ga0209759_1000123 | Ga0209759_100012343 | 411 |
| 82 | 3300025711 | Ga0207696_1000349 | Ga0207696_100034937 | 411 |
| 83 | 3300025735 | Ga0207713_1001485 | Ga0207713_10014854 | 411 |
| 84 | 3300025302 | Ga0207426_1000345 | Ga0207426_100034560 | 412 |
| 85 | 3300049585 | Ga0501069_0055149 | Ga0501069_0055149_577_1896 | 412 |
| 86 | 3300005458 | Ga0070681_10031256 | Ga0070681_100312565 | 413 |
| 87 | 3300025912 | Ga0207707_10003517 | Ga0207707_1000351716 | 413 |
| 88 | 3300048924 | Ga0496121_0000197 | Ga0496121_0000197_67263_68582 | 413 |
| 89 | 3300049590 | Ga0501074_0090080 | Ga0501074_0090080_923_2173 | 413 |
| 90 | 3300049743 | Ga0501081_0241506 | Ga0501081_0241506_19_1275 | 413 |
| 91 | 3300009551 | Ga0105238_10081230 | Ga0105238_100812301 | 414 |
| 92 | 3300013307 | Ga0157372_10049397 | Ga0157372_100493974 | 414 |
| 93 | 3300044658 | Ga0466972_0021056 | Ga0466972_0021056_396_1679 | 414 |
| 94 | 3300044735 | Ga0466968_0021887 | Ga0466968_0021887_269_1552 | 414 |
| 95 | 3300046459 | Ga0495629_0001903 | Ga0495629_0001903_4722_6041 | 414 |
| 96 | 3300046463 | Ga0495653_0001990 | Ga0495653_0001990_4861_6180 | 414 |
| 97 | 3300046471 | Ga0495650_0023178 | Ga0495650_0023178_178_1491 | 414 |
| 98 | 3300046472 | Ga0495580_0002473 | Ga0495580_0002473_10153_11472 | 414 |
| 99 | 3300046473 | Ga0495582_0036839 | Ga0495582_0036839_1055_2374 | 414 |
| 100 | 3300046690 | Ga0495624_0000130 | Ga0495624_0000130_47105_48424 | 414 |
| 101 | 3300047319 | Ga0495674_0003006 | Ga0495674_0003006_4642_5961 | 414 |
| 102 | 3300047673 | Ga0495593_0001523 | Ga0495593_0001523_5684_7003 | 414 |
| 103 | 3300048922 | Ga0496119_0003545 | Ga0496119_0003545_45_1295 | 414 |
| 104 | 3300005329 | Ga0070683_100066175 | Ga0070683_1000661753 | 415 |
| 105 | 3300005340 | Ga0070689_100146936 | Ga0070689_1001469361 | 415 |
| 106 | 3300005344 | Ga0070661_100132427 | Ga0070661_1001324272 | 415 |
| 107 | 3300005345 | Ga0070692_10040657 | Ga0070692_100406571 | 415 |
| 108 | 3300005347 | Ga0070668_100101014 | Ga0070668_1001010141 | 415 |
| 109 | 3300005356 | Ga0070674_100135465 | Ga0070674_1001354651 | 415 |
| 110 | 3300005364 | Ga0070673_100104548 | Ga0070673_1001045482 | 415 |
| 111 | 3300005440 | Ga0070705_100011668 | Ga0070705_1000116683 | 415 |
| 112 | 3300005455 | Ga0070663_100135042 | Ga0070663_1001350422 | 415 |
| 113 | 3300005457 | Ga0070662_100132035 | Ga0070662_1001320352 | 415 |
| 114 | 3300005459 | Ga0068867_100077272 | Ga0068867_1000772721 | 415 |
| 115 | 3300005518 | Ga0070699_100272913 | Ga0070699_1002729132 | 415 |
| 116 | 3300005535 | Ga0070684_100060876 | Ga0070684_1000608763 | 415 |
| 117 | 3300005544 | Ga0070686_100015298 | Ga0070686_1000152983 | 415 |
| 118 | 3300005563 | Ga0068855_100189121 | Ga0068855_1001891212 | 415 |
| 119 | 3300005618 | Ga0068864_100015042 | Ga0068864_1000150422 | 415 |
| 120 | 3300005834 | Ga0068851_10023722 | Ga0068851_100237223 | 415 |
| 121 | 3300005841 | Ga0068863_100086154 | Ga0068863_1000861542 | 415 |
| 122 | 3300005843 | Ga0068860_100015244 | Ga0068860_1000152442 | 415 |
| 123 | 3300006881 | Ga0068865_100147416 | Ga0068865_1001474162 | 415 |
| 124 | 3300009148 | Ga0105243_10055460 | Ga0105243_100554603 | 415 |
| 125 | 3300009176 | Ga0105242_10051662 | Ga0105242_100516622 | 415 |
| 126 | 3300009177 | Ga0105248_10109102 | Ga0105248_101091021 | 415 |
| 127 | 3300009553 | Ga0105249_10099006 | Ga0105249_100990063 | 415 |
| 128 | 3300014326 | Ga0157380_10087627 | Ga0157380_100876271 | 415 |
| 129 | 3300014968 | Ga0157379_10086758 | Ga0157379_100867583 | 415 |
| 130 | 3300025900 | Ga0207710_10073733 | Ga0207710_100737331 | 415 |
| 131 | 3300025918 | Ga0207662_10093455 | Ga0207662_100934552 | 415 |
| 132 | 3300025919 | Ga0207657_10035391 | Ga0207657_100353914 | 415 |
| 133 | 3300025921 | Ga0207652_10148747 | Ga0207652_101487472 | 415 |
| 134 | 3300025926 | Ga0207659_10045953 | Ga0207659_100459532 | 415 |
| 135 | 3300025931 | Ga0207644_10110972 | Ga0207644_101109722 | 415 |
| 136 | 3300025933 | Ga0207706_10016073 | Ga0207706_100160734 | 415 |
| 137 | 3300025940 | Ga0207691_10008491 | Ga0207691_100084913 | 415 |
| 138 | 3300025942 | Ga0207689_10028039 | Ga0207689_100280392 | 415 |
| 139 | 3300026067 | Ga0207678_10044253 | Ga0207678_100442533 | 415 |
| 140 | 3300026075 | Ga0207708_10006349 | Ga0207708_100063492 | 415 |
| 141 | 3300026089 | Ga0207648_10018847 | Ga0207648_100188473 | 415 |
| 142 | 3300026095 | Ga0207676_10107019 | Ga0207676_101070192 | 415 |
| 143 | 3300026118 | Ga0207675_100008588 | Ga0207675_1000085887 | 415 |
| 144 | 3300035090 | Ga0373949_0004030 | Ga0373949_0004030_819_2102 | 415 |
| 145 | 3300035112 | Ga0373932_0010265 | Ga0373932_0010265_702_1985 | 415 |
| 146 | 3300035114 | Ga0373939_0006400 | Ga0373939_0006400_222_1505 | 415 |
| 147 | 3300035115 | Ga0373941_0024709 | Ga0373941_0024709_284_1567 | 415 |
| 148 | 3300035242 | Ga0373962_0026107 | Ga0373962_0026107_141_1424 | 415 |
| 149 | 3300035691 | Ga0373931_0064214 | Ga0373931_0064214_29_1312 | 415 |
| 150 | 3300048903 | Ga0496100_0100760 | Ga0496100_0100760_534_1817 | 415 |
| 151 | 3300048904 | Ga0496101_0049568 | Ga0496101_0049568_425_1708 | 415 |
| 152 | 3300048905 | Ga0496102_0229335 | Ga0496102_0229335_327_1610 | 415 |
| 153 | 3300048907 | Ga0496104_0017455 | Ga0496104_0017455_2317_3636 | 415 |
| 154 | 3300048907 | Ga0496104_0041528 | Ga0496104_0041528_1515_2798 | 415 |
| 155 | 3300048909 | Ga0496106_0094117 | Ga0496106_0094117_458_1741 | 415 |
| 156 | 3300048911 | Ga0496108_0027735 | Ga0496108_0027735_1807_3090 | 415 |
| 157 | 3300048913 | Ga0496110_0034753 | Ga0496110_0034753_1515_2798 | 415 |
| 158 | 3300048923 | Ga0496120_0094270 | Ga0496120_0094270_105_1424 | 415 |
| 159 | 3300050511 | nmdc:mga08y16_113485_c1 | nmdc:mga08y16_113485_c1_165_1448 | 415 |
| 160 | 3300005329 | Ga0070683_100233527 | Ga0070683_1002335272 | 416 |
| 161 | 3300009551 | Ga0105238_10196612 | Ga0105238_101966122 | 416 |
| 162 | 3300026116 | Ga0207674_10073309 | Ga0207674_100733093 | 416 |
| 163 | 3300046463 | Ga0495653_0007581 | Ga0495653_0007581_5323_6642 | 416 |
| 164 | 3300046507 | Ga0495606_0053092 | Ga0495606_0053092_116_1435 | 416 |
| 165 | 3300046516 | Ga0495628_0015643 | Ga0495628_0015643_417_1736 | 416 |
| 166 | 3300046517 | Ga0495630_0021901 | Ga0495630_0021901_3301_4620 | 416 |
| 167 | 3300046529 | Ga0495652_0061574 | Ga0495652_0061574_958_2277 | 416 |
| 168 | 3300046531 | Ga0495665_0000217 | Ga0495665_0000217_27535_28854 | 416 |
| 169 | 3300046663 | Ga0495635_0024486 | Ga0495635_0024486_184_1503 | 416 |
| 170 | 3300046679 | Ga0495623_0016199 | Ga0495623_0016199_3312_4631 | 416 |
| 171 | 3300046680 | Ga0495646_0010033 | Ga0495646_0010033_2245_3564 | 416 |
| 172 | 3300046690 | Ga0495624_0029667 | Ga0495624_0029667_451_1770 | 416 |
| 173 | 3300047317 | Ga0495604_0027675 | Ga0495604_0027675_1527_2846 | 416 |
| 174 | 3300047322 | Ga0495680_0014348 | Ga0495680_0014348_761_2080 | 416 |
| 175 | 3300048088 | Ga0495602_0003267 | Ga0495602_0003267_7627_8946 | 416 |
| 176 | 3300005468 | Ga0070707_100038824 | Ga0070707_1000388243 | 417 |
| 177 | 3300005545 | Ga0070695_100062465 | Ga0070695_1000624653 | 417 |
| 178 | 3300005549 | Ga0070704_100155599 | Ga0070704_1001555991 | 417 |
| 179 | 3300013307 | Ga0157372_10263098 | Ga0157372_102630982 | 417 |
| 180 | 3300025960 | Ga0207651_10286558 | Ga0207651_102865581 | 417 |
| 181 | 3300028380 | Ga0268265_10042398 | Ga0268265_100423982 | 417 |
| 182 | 3300046460 | Ga0495638_0000125 | Ga0495638_0000125_84489_85772 | 417 |
| 183 | 3300046513 | Ga0495616_0037377 | Ga0495616_0037377_792_2075 | 417 |
| 184 | 3300046519 | Ga0495632_0023482 | Ga0495632_0023482_885_2168 | 417 |
| 185 | 3300046530 | Ga0495654_0011507 | Ga0495654_0011507_424_1707 | 417 |
| 186 | 3300046542 | Ga0495597_0003192 | Ga0495597_0003192_2094_3377 | 417 |
| 187 | 3300047320 | Ga0495672_0004493 | Ga0495672_0004493_3078_4361 | 417 |
| 188 | 3300050515 | nmdc:mga0a205_280561_c1 | nmdc:mga0a205_280561_c1_147_1430 | 417 |
| 189 | 3300005290 | Ga0065712_10074695 | Ga0065712_100746955 | 418 |
| 190 | 3300005544 | Ga0070686_100075541 | Ga0070686_1000755412 | 418 |
| 191 | 3300005842 | Ga0068858_100286665 | Ga0068858_1002866652 | 418 |
| 192 | 3300009036 | Ga0105244_10000345 | Ga0105244_1000034522 | 418 |
| 193 | 3300025728 | Ga0207655_1002880 | Ga0207655_10028806 | 418 |
| 194 | 3300039438 | Ga0436360_1211585 | Ga0436360_1211585_524_1816 | 418 |
| 195 | 3300044656 | Ga0466969_0003234 | Ga0466969_0003234_3085_4386 | 418 |
| 196 | 3300044684 | Ga0466966_0022455 | Ga0466966_0022455_988_2289 | 418 |
| 197 | 3300046542 | Ga0495597_0022648 | Ga0495597_0022648_202_1461 | 418 |
| 198 | 3300048908 | Ga0496105_0099626 | Ga0496105_0099626_1052_2359 | 418 |
| 199 | 3300048912 | Ga0496109_0002420 | Ga0496109_0002420_13199_14506 | 418 |
| 200 | 3300048914 | Ga0496111_0043228 | Ga0496111_0043228_945_2252 | 418 |
| 201 | 3300048916 | Ga0496113_0001528 | Ga0496113_0001528_1335_2642 | 418 |
| 202 | 3300039437 | Ga0436365_0313432 | Ga0436365_0313432_1477_2760 | 419 |
| 203 | 3300005981 | Ga0081538_10007210 | Ga0081538_100072103 | 420 |
| 204 | 3300010375 | Ga0105239_10059456 | Ga0105239_100594563 | 420 |
| 205 | 3300013308 | Ga0157375_10014341 | Ga0157375_100143413 | 420 |
| 206 | 3300021377 | Ga0213874_10005916 | Ga0213874_100059162 | 420 |
| 207 | 3300026067 | Ga0207678_10188047 | Ga0207678_101880472 | 420 |
| 208 | 3300035118 | Ga0373954_0000707 | Ga0373954_0000707_10908_12173 | 420 |
| 209 | 3300039437 | Ga0436365_1386178 | Ga0436365_1386178_988_2295 | 420 |
| 210 | 3300039450 | Ga0436363_0568637 | Ga0436363_0568637_1254_2561 | 420 |
| 211 | 3300047323 | Ga0495683_0000300 | Ga0495683_0000300_4767_6050 | 420 |
| 212 | 3300003322 | rootL2_10152113 | rootL2_101521131 | 421 |
| 213 | 3300005445 | Ga0070708_100129160 | Ga0070708_1001291601 | 421 |
| 214 | 3300005563 | Ga0068855_100003325 | Ga0068855_10000332512 | 421 |
| 215 | 3300005577 | Ga0068857_100002263 | Ga0068857_1000022633 | 421 |
| 216 | 3300005578 | Ga0068854_100003405 | Ga0068854_1000034052 | 421 |
| 217 | 3300005616 | Ga0068852_100002286 | Ga0068852_1000022867 | 421 |
| 218 | 3300009093 | Ga0105240_10099949 | Ga0105240_100999492 | 421 |
| 219 | 3300009094 | Ga0111539_10001696 | Ga0111539_1000169612 | 421 |
| 220 | 3300009176 | Ga0105242_10040216 | Ga0105242_100402163 | 421 |
| 221 | 3300009177 | Ga0105248_10030891 | Ga0105248_100308915 | 421 |
| 222 | 3300011119 | Ga0105246_10106436 | Ga0105246_101064362 | 421 |
| 223 | 3300013102 | Ga0157371_10102296 | Ga0157371_101022962 | 421 |
| 224 | 3300013104 | Ga0157370_10002043 | Ga0157370_1000204310 | 421 |
| 225 | 3300013307 | Ga0157372_10000305 | Ga0157372_1000030542 | 421 |
| 226 | 3300013308 | Ga0157375_10325809 | Ga0157375_103258092 | 421 |
| 227 | 3300021388 | Ga0213875_10000271 | Ga0213875_1000027143 | 421 |
| 228 | 3300025904 | Ga0207647_10033715 | Ga0207647_100337153 | 421 |
| 229 | 3300025913 | Ga0207695_10095188 | Ga0207695_100951882 | 421 |
| 230 | 3300025949 | Ga0207667_10000968 | Ga0207667_100009683 | 421 |
| 231 | 3300025981 | Ga0207640_10036117 | Ga0207640_100361172 | 421 |
| 232 | 3300026116 | Ga0207674_10000629 | Ga0207674_1000062915 | 421 |
| 233 | 3300026142 | Ga0207698_10047152 | Ga0207698_100471522 | 421 |
| 234 | 3300034816 | Ga0373930_0000713 | Ga0373930_0000713_2355_3638 | 421 |
| 235 | 3300034819 | Ga0373958_0000992 | Ga0373958_0000992_593_1876 | 421 |
| 236 | 3300034820 | Ga0373959_0000111 | Ga0373959_0000111_9606_10889 | 421 |
| 237 | 3300034957 | Ga0373938_0000386 | Ga0373938_0000386_4860_6143 | 421 |
| 238 | 3300035084 | Ga0373928_0000045 | Ga0373928_0000045_8135_9418 | 421 |
| 239 | 3300035085 | Ga0373929_0010706 | Ga0373929_0010706_308_1591 | 421 |
| 240 | 3300035089 | Ga0373944_0011427 | Ga0373944_0011427_913_2196 | 421 |
| 241 | 3300035090 | Ga0373949_0003496 | Ga0373949_0003496_553_1836 | 421 |
| 242 | 3300035091 | Ga0373951_0000335 | Ga0373951_0000335_6927_8210 | 421 |
| 243 | 3300035092 | Ga0373952_0000179 | Ga0373952_0000179_4985_6268 | 421 |
| 244 | 3300035111 | Ga0373923_0000978 | Ga0373923_0000978_3547_4830 | 421 |
| 245 | 3300035111 | Ga0373923_0004485 | Ga0373923_0004485_3332_4615 | 421 |
| 246 | 3300035112 | Ga0373932_0000271 | Ga0373932_0000271_7218_8501 | 421 |
| 247 | 3300035113 | Ga0373936_0002402 | Ga0373936_0002402_4972_6255 | 421 |
| 248 | 3300035114 | Ga0373939_0001296 | Ga0373939_0001296_3537_4820 | 421 |
| 249 | 3300035116 | Ga0373945_0020517 | Ga0373945_0020517_198_1481 | 421 |
| 250 | 3300035117 | Ga0373953_0004302 | Ga0373953_0004302_2240_3523 | 421 |
| 251 | 3300035117 | Ga0373953_0008474 | Ga0373953_0008474_1693_2976 | 421 |
| 252 | 3300035172 | Ga0373955_0001092 | Ga0373955_0001092_7920_9203 | 421 |
| 253 | 3300035241 | Ga0373961_0000592 | Ga0373961_0000592_10499_11782 | 421 |
| 254 | 3300035242 | Ga0373962_0000848 | Ga0373962_0000848_5646_6929 | 421 |
| 255 | 3300035410 | Ga0373924_0018420 | Ga0373924_0018420_792_2075 | 421 |
| 256 | 3300035691 | Ga0373931_0004514 | Ga0373931_0004514_1537_2820 | 421 |
| 257 | 3300035691 | Ga0373931_0092016 | Ga0373931_0092016_269_1552 | 421 |
| 258 | 3300035692 | Ga0373935_0000377 | Ga0373935_0000377_16641_17924 | 421 |
| 259 | 3300035692 | Ga0373935_0003956 | Ga0373935_0003956_909_2192 | 421 |
| 260 | 3300035695 | Ga0373927_0021648 | Ga0373927_0021648_1289_2572 | 421 |
| 261 | 3300035724 | Ga0373933_0002410 | Ga0373933_0002410_7839_9122 | 421 |
| 262 | 3300035725 | Ga0373947_0000280 | Ga0373947_0000280_1110_2393 | 421 |
| 263 | 3300036401 | Ga0373937_0001849 | Ga0373937_0001849_10004_11287 | 421 |
| 264 | 3300037068 | Ga0373925_0000075 | Ga0373925_0000075_26416_27699 | 421 |
| 265 | 3300037068 | Ga0373925_0001434 | Ga0373925_0001434_8635_9918 | 421 |
| 266 | 3300037853 | Ga0436364_1510300 | Ga0436364_1510300_8496_9821 | 421 |
| 267 | 3300045051 | Ga0451576_0006479 | Ga0451576_0006479_1175_2458 | 421 |
| 268 | 3300046454 | Ga0495592_0000060 | Ga0495592_0000060_22330_23613 | 421 |
| 269 | 3300046454 | Ga0495592_0005925 | Ga0495592_0005925_285_1568 | 421 |
| 270 | 3300046455 | Ga0495603_0004025 | Ga0495603_0004025_6262_7545 | 421 |
| 271 | 3300046459 | Ga0495629_0000139 | Ga0495629_0000139_40869_42152 | 421 |
| 272 | 3300046459 | Ga0495629_0114205 | Ga0495629_0114205_394_1677 | 421 |
| 273 | 3300046461 | Ga0495641_0015170 | Ga0495641_0015170_1004_2287 | 421 |
| 274 | 3300046462 | Ga0495651_0000181 | Ga0495651_0000181_23250_24533 | 421 |
| 275 | 3300046462 | Ga0495651_0004794 | Ga0495651_0004794_5782_7065 | 421 |
| 276 | 3300046463 | Ga0495653_0000740 | Ga0495653_0000740_1312_2595 | 421 |
| 277 | 3300046473 | Ga0495582_0001586 | Ga0495582_0001586_8166_9449 | 421 |
| 278 | 3300046476 | Ga0495662_0001139 | Ga0495662_0001139_7622_8905 | 421 |
| 279 | 3300046476 | Ga0495662_0044168 | Ga0495662_0044168_387_1670 | 421 |
| 280 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_60120_61403 | 421 |
| 281 | 3300046499 | Ga0495594_0002129 | Ga0495594_0002129_6304_7587 | 421 |
| 282 | 3300046511 | Ga0495608_0000011 | Ga0495608_0000011_6124_7407 | 421 |
| 283 | 3300046514 | Ga0495618_0000044 | Ga0495618_0000044_71953_73236 | 421 |
| 284 | 3300046514 | Ga0495618_0087980 | Ga0495618_0087980_50_1333 | 421 |
| 285 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_549521_550804 | 421 |
| 286 | 3300046517 | Ga0495630_0000574 | Ga0495630_0000574_930_2213 | 421 |
| 287 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_764055_765338 | 421 |
| 288 | 3300046529 | Ga0495652_0032084 | Ga0495652_0032084_1309_2592 | 421 |
| 289 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_4384_5667 | 421 |
| 290 | 3300046535 | Ga0495586_0037010 | Ga0495586_0037010_68_1351 | 421 |
| 291 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_76790_78073 | 421 |
| 292 | 3300046538 | Ga0495609_0025539 | Ga0495609_0025539_19_1302 | 421 |
| 293 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_549534_550817 | 421 |
| 294 | 3300046559 | Ga0495667_0000039 | Ga0495667_0000039_107679_108962 | 421 |
| 295 | 3300046642 | Ga0495634_0000010 | Ga0495634_0000010_91678_92961 | 421 |
| 296 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_62614_63897 | 421 |
| 297 | 3300046674 | Ga0495588_0033132 | Ga0495588_0033132_1135_2418 | 421 |
| 298 | 3300046675 | Ga0495657_0000042 | Ga0495657_0000042_91200_92483 | 421 |
| 299 | 3300046675 | Ga0495657_0001942 | Ga0495657_0001942_11865_13148 | 421 |
| 300 | 3300046678 | Ga0495599_0000013 | Ga0495599_0000013_100809_102092 | 421 |
| 301 | 3300046679 | Ga0495623_0000050 | Ga0495623_0000050_7060_8343 | 421 |
| 302 | 3300046680 | Ga0495646_0000009 | Ga0495646_0000009_77623_78906 | 421 |
| 303 | 3300046681 | Ga0495647_0006801 | Ga0495647_0006801_2018_3301 | 421 |
| 304 | 3300046683 | Ga0495658_0000065 | Ga0495658_0000065_30897_32180 | 421 |
| 305 | 3300046689 | Ga0495613_0006292 | Ga0495613_0006292_5800_7083 | 421 |
| 306 | 3300046690 | Ga0495624_0043247 | Ga0495624_0043247_61_1344 | 421 |
| 307 | 3300046809 | Ga0495600_0000209 | Ga0495600_0000209_614_1897 | 421 |
| 308 | 3300047315 | Ga0495581_0007122 | Ga0495581_0007122_2193_3476 | 421 |
| 309 | 3300047315 | Ga0495581_0020331 | Ga0495581_0020331_1375_2658 | 421 |
| 310 | 3300047317 | Ga0495604_0000069 | Ga0495604_0000069_51539_52822 | 421 |
| 311 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_549522_550805 | 421 |
| 312 | 3300047321 | Ga0495676_0006417 | Ga0495676_0006417_9145_10428 | 421 |
| 313 | 3300047321 | Ga0495676_0179997 | Ga0495676_0179997_47_1330 | 421 |
| 314 | 3300047322 | Ga0495680_0000328 | Ga0495680_0000328_29642_30925 | 421 |
| 315 | 3300047322 | Ga0495680_0036061 | Ga0495680_0036061_2450_3733 | 421 |
| 316 | 3300047444 | Ga0495675_0000245 | Ga0495675_0000245_26403_27686 | 421 |
| 317 | 3300047471 | Ga0495684_0000016 | Ga0495684_0000016_141238_142521 | 421 |
| 318 | 3300047673 | Ga0495593_0001500 | Ga0495593_0001500_1045_2328 | 421 |
| 319 | 3300047673 | Ga0495593_0018915 | Ga0495593_0018915_750_2033 | 421 |
| 320 | 3300047673 | Ga0495593_0062137 | Ga0495593_0062137_414_1697 | 421 |
| 321 | 3300048088 | Ga0495602_0000024 | Ga0495602_0000024_138442_139725 | 421 |
| 322 | 3300048903 | Ga0496100_0002405 | Ga0496100_0002405_3813_5096 | 421 |
| 323 | 3300048903 | Ga0496100_0003748 | Ga0496100_0003748_4534_5817 | 421 |
| 324 | 3300048903 | Ga0496100_0020498 | Ga0496100_0020498_837_2120 | 421 |
| 325 | 3300048904 | Ga0496101_0001763 | Ga0496101_0001763_3663_4946 | 421 |
| 326 | 3300048904 | Ga0496101_0002134 | Ga0496101_0002134_9938_11221 | 421 |
| 327 | 3300048904 | Ga0496101_0005234 | Ga0496101_0005234_51_1334 | 421 |
| 328 | 3300048905 | Ga0496102_0005532 | Ga0496102_0005532_1818_3101 | 421 |
| 329 | 3300048905 | Ga0496102_0011817 | Ga0496102_0011817_4054_5337 | 421 |
| 330 | 3300048905 | Ga0496102_0018808 | Ga0496102_0018808_4403_5686 | 421 |
| 331 | 3300048906 | Ga0496103_0003142 | Ga0496103_0003142_4322_5605 | 421 |
| 332 | 3300048907 | Ga0496104_0002323 | Ga0496104_0002323_1604_2887 | 421 |
| 333 | 3300048907 | Ga0496104_0106764 | Ga0496104_0106764_1227_2510 | 421 |
| 334 | 3300048907 | Ga0496104_0146255 | Ga0496104_0146255_392_1675 | 421 |
| 335 | 3300048908 | Ga0496105_0017486 | Ga0496105_0017486_2102_3385 | 421 |
| 336 | 3300048908 | Ga0496105_0032692 | Ga0496105_0032692_923_2206 | 421 |
| 337 | 3300048908 | Ga0496105_0073963 | Ga0496105_0073963_909_2192 | 421 |
| 338 | 3300048908 | Ga0496105_0229312 | Ga0496105_0229312_44_1327 | 421 |
| 339 | 3300048909 | Ga0496106_0008421 | Ga0496106_0008421_3290_4573 | 421 |
| 340 | 3300048909 | Ga0496106_0033756 | Ga0496106_0033756_1029_2312 | 421 |
| 341 | 3300048909 | Ga0496106_0147435 | Ga0496106_0147435_51_1334 | 421 |
| 342 | 3300048910 | Ga0496107_0010740 | Ga0496107_0010740_1342_2625 | 421 |
| 343 | 3300048911 | Ga0496108_0010986 | Ga0496108_0010986_2687_3970 | 421 |
| 344 | 3300048911 | Ga0496108_0014948 | Ga0496108_0014948_904_2187 | 421 |
| 345 | 3300048911 | Ga0496108_0034543 | Ga0496108_0034543_1396_2679 | 421 |
| 346 | 3300048912 | Ga0496109_0014820 | Ga0496109_0014820_886_2169 | 421 |
| 347 | 3300048912 | Ga0496109_0016348 | Ga0496109_0016348_2912_4195 | 421 |
| 348 | 3300048912 | Ga0496109_0131477 | Ga0496109_0131477_848_2131 | 421 |
| 349 | 3300048913 | Ga0496110_0002430 | Ga0496110_0002430_9248_10531 | 421 |
| 350 | 3300048913 | Ga0496110_0005366 | Ga0496110_0005366_1281_2564 | 421 |
| 351 | 3300048913 | Ga0496110_0053532 | Ga0496110_0053532_1293_2576 | 421 |
| 352 | 3300048914 | Ga0496111_0003314 | Ga0496111_0003314_3358_4641 | 421 |
| 353 | 3300048914 | Ga0496111_0003533 | Ga0496111_0003533_866_2149 | 421 |
| 354 | 3300048914 | Ga0496111_0017099 | Ga0496111_0017099_669_1952 | 421 |
| 355 | 3300048914 | Ga0496111_0038133 | Ga0496111_0038133_690_1973 | 421 |
| 356 | 3300048915 | Ga0496112_0008924 | Ga0496112_0008924_6221_7504 | 421 |
| 357 | 3300048915 | Ga0496112_0109353 | Ga0496112_0109353_617_1900 | 421 |
| 358 | 3300048915 | Ga0496112_0191113 | Ga0496112_0191113_662_1945 | 421 |
| 359 | 3300048916 | Ga0496113_0008099 | Ga0496113_0008099_51_1334 | 421 |
| 360 | 3300048916 | Ga0496113_0011117 | Ga0496113_0011117_748_2031 | 421 |
| 361 | 3300048917 | Ga0496114_0001306 | Ga0496114_0001306_4161_5444 | 421 |
| 362 | 3300048917 | Ga0496114_0014735 | Ga0496114_0014735_1187_2470 | 421 |
| 363 | 3300048918 | Ga0496115_0031578 | Ga0496115_0031578_863_2146 | 421 |
| 364 | 3300049741 | Ga0501079_0112499 | Ga0501079_0112499_288_1571 | 421 |
| 365 | 3300050507 | nmdc:mga05p37_7272_c1 | nmdc:mga05p37_7272_c1_1125_2408 | 421 |
| 366 | 3300050512 | nmdc:mga0n895_78359_c1 | nmdc:mga0n895_78359_c1_545_1828 | 421 |
| 367 | 3300050515 | nmdc:mga0a205_65894_c1 | nmdc:mga0a205_65894_c1_1528_2811 | 421 |
| 368 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_481522_482805 | 421 |
| 369 | 3300053078 | Ga0495612_0000017 | Ga0495612_0000017_73307_74590 | 421 |
| 370 | 3300053084 | Ga0495595_0000010 | Ga0495595_0000010_100785_102068 | 421 |
| 371 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_481559_482842 | 421 |
| 372 | 3300053085 | Ga0495619_0000256 | Ga0495619_0000256_26316_27599 | 421 |
| 373 | iso_pu_bacteria | 2857465823 | 2857467614 | 421 |
| 374 | iso_pu_bacteria | 2857591370 | 2857594872 | 421 |
| 375 | iso_pu_bacteria | 2929177148 | 2929179756 | 421 |
| 376 | iso_pu_bacteria | 2945977869 | 2945982178 | 421 |
| 377 | iso_pu_bacteria | 2946013367 | 2946018431 | 421 |
| 378 | iso_pu_bacteria | 2970627176 | 2970630301 | 421 |
| 379 | 3300013297 | Ga0157378_10006718 | Ga0157378_100067184 | 422 |
| 380 | 3300025927 | Ga0207687_10097740 | Ga0207687_100977402 | 422 |
| 381 | 3300035691 | Ga0373931_0073717 | Ga0373931_0073717_39_1358 | 422 |
| 382 | 3300037418 | Ga0395900_0096654 | Ga0395900_0096654_253_1530 | 422 |
| 383 | 3300037466 | Ga0395898_0208029 | Ga0395898_0208029_426_1703 | 422 |
| 384 | 3300048907 | Ga0496104_0277861 | Ga0496104_0277861_62_1354 | 422 |
| 385 | iso_pu_bacteria | 2511231008 | 2511276579 | 422 |
| 386 | iso_pu_bacteria | 2511231012 | 2511301797 | 422 |
| 387 | iso_pu_bacteria | 2511231015 | 2511319118 | 422 |
| 388 | iso_pu_bacteria | 2511231021 | 2511358085 | 422 |
| 389 | iso_pu_bacteria | 2511231156 | 2511822812 | 422 |
| 390 | iso_pu_bacteria | 2599185248 | 2599768580 | 422 |
| 391 | iso_pu_bacteria | 2599185289 | 2599889663 | 422 |
| 392 | iso_pu_bacteria | 2599185291 | 2599901288 | 422 |
| 393 | iso_pu_bacteria | 2599185315 | 2600019745 | 422 |
| 394 | iso_pu_bacteria | 2599185318 | 2600036228 | 422 |
| 395 | iso_pu_bacteria | 2599185321 | 2600054255 | 422 |
| 396 | iso_pu_bacteria | 2667528170 | 2671094015 | 422 |
| 397 | iso_pu_bacteria | 2667528176 | 2671126807 | 422 |
| 398 | iso_pu_bacteria | 2765235841 | 2765584748 | 422 |
| 399 | iso_pu_bacteria | 2773857670 | 2774120070 | 422 |
| 400 | iso_pu_bacteria | 2784132072 | 2784311999 | 422 |
| 401 | iso_pu_bacteria | 2900634093 | 2900638987 | 422 |
| 402 | iso_pu_bacteria | 2904434214 | 2904436230 | 422 |
| 403 | iso_pu_bacteria | 2919481497 | 2919483553 | 422 |
| 404 | 3300005435 | Ga0070714_100018509 | Ga0070714_1000185094 | 423 |
| 405 | 3300006028 | Ga0070717_10016626 | Ga0070717_100166265 | 423 |
| 406 | 3300006844 | Ga0075428_100058917 | Ga0075428_1000589172 | 423 |
| 407 | 3300031727 | Ga0316576_10232137 | Ga0316576_102321372 | 423 |
| 408 | 3300045976 | Ga0466967_0008760 | Ga0466967_0008760_4976_6298 | 423 |
| 409 | 3300049568 | Ga0501031_0106923 | Ga0501031_0106923_243_1529 | 423 |
| 410 | 3300049575 | Ga0501039_0046794 | Ga0501039_0046794_35_1321 | 423 |
| 411 | 3300049577 | Ga0501041_0058997 | Ga0501041_0058997_906_2192 | 423 |
| 412 | 3300049582 | Ga0501048_0060290 | Ga0501048_0060290_1025_2311 | 423 |
| 413 | 3300049591 | Ga0501075_0068951 | Ga0501075_0068951_125_1411 | 423 |
| 414 | 3300049592 | Ga0501076_0008353 | Ga0501076_0008353_4367_5653 | 423 |
| 415 | 3300049741 | Ga0501079_0104511 | Ga0501079_0104511_139_1425 | 423 |
| 416 | 3300049743 | Ga0501081_0010162 | Ga0501081_0010162_4633_5919 | 423 |
| 417 | 3300049824 | Ga0501045_0059322 | Ga0501045_0059322_1271_2557 | 423 |
| 418 | 3300054114 | Ga0501084_0087457 | Ga0501084_0087457_712_1998 | 423 |
| 419 | 3300060353 | Ga0501082_0076312 | Ga0501082_0076312_791_2077 | 423 |
| 420 | iso_pu_bacteria | 2687453737 | 2689963826 | 423 |
| 421 | iso_pu_bacteria | 2956897341 | 2956902667 | 423 |
| 422 | 3300033180 | Ga0307510_10068787 | Ga0307510_100687871 | 424 |
| 423 | 3300042461 | Ga0439460_0000006 | Ga0439460_0000006_17926_19203 | 424 |
| 424 | 3300046453 | Ga0495627_006396 | Ga0495627_006396_1913_3190 | 424 |
| 425 | 3300046471 | Ga0495650_0000101 | Ga0495650_0000101_33163_34440 | 424 |
| 426 | 3300046474 | Ga0495605_0000002 | Ga0495605_0000002_148393_149670 | 424 |
| 427 | 3300046474 | Ga0495605_0001149 | Ga0495605_0001149_9867_11144 | 424 |
| 428 | 3300046474 | Ga0495605_0007792 | Ga0495605_0007792_3308_4585 | 424 |
| 429 | 3300046491 | Ga0495584_0008448 | Ga0495584_0008448_3040_4317 | 424 |
| 430 | 3300046492 | Ga0495585_0023883 | Ga0495585_0023883_195_1472 | 424 |
| 431 | 3300046499 | Ga0495594_0009963 | Ga0495594_0009963_1319_2596 | 424 |
| 432 | 3300046500 | Ga0495596_0010487 | Ga0495596_0010487_2360_3637 | 424 |
| 433 | 3300046501 | Ga0495607_0025635 | Ga0495607_0025635_354_1631 | 424 |
| 434 | 3300046506 | Ga0495583_0000012 | Ga0495583_0000012_283149_284426 | 424 |
| 435 | 3300046507 | Ga0495606_0020057 | Ga0495606_0020057_720_1997 | 424 |
| 436 | 3300046512 | Ga0495610_0002250 | Ga0495610_0002250_5938_7215 | 424 |
| 437 | 3300046513 | Ga0495616_0006071 | Ga0495616_0006071_4360_5637 | 424 |
| 438 | 3300046515 | Ga0495620_0000010 | Ga0495620_0000010_52667_53944 | 424 |
| 439 | 3300046515 | Ga0495620_0002511 | Ga0495620_0002511_5248_6525 | 424 |
| 440 | 3300046518 | Ga0495631_0018055 | Ga0495631_0018055_1889_3166 | 424 |
| 441 | 3300046518 | Ga0495631_0021492 | Ga0495631_0021492_1297_2574 | 424 |
| 442 | 3300046519 | Ga0495632_0004399 | Ga0495632_0004399_868_2145 | 424 |
| 443 | 3300046522 | Ga0495643_0001779 | Ga0495643_0001779_8721_9998 | 424 |
| 444 | 3300046523 | Ga0495644_0004763 | Ga0495644_0004763_1388_2665 | 424 |
| 445 | 3300046524 | Ga0495648_0002321 | Ga0495648_0002321_4542_5819 | 424 |
| 446 | 3300046524 | Ga0495648_0004234 | Ga0495648_0004234_2924_4201 | 424 |
| 447 | 3300046530 | Ga0495654_0000333 | Ga0495654_0000333_25081_26358 | 424 |
| 448 | 3300046538 | Ga0495609_0000008 | Ga0495609_0000008_109680_110957 | 424 |
| 449 | 3300046538 | Ga0495609_0000016 | Ga0495609_0000016_123793_125070 | 424 |
| 450 | 3300046557 | Ga0495622_0001895 | Ga0495622_0001895_6838_8115 | 424 |
| 451 | 3300046558 | Ga0495633_0000009 | Ga0495633_0000009_130483_131760 | 424 |
| 452 | 3300046616 | Ga0495668_0001168 | Ga0495668_0001168_14269_15546 | 424 |
| 453 | 3300046648 | Ga0495611_0003046 | Ga0495611_0003046_3185_4462 | 424 |
| 454 | 3300046648 | Ga0495611_0055828 | Ga0495611_0055828_142_1419 | 424 |
| 455 | 3300046660 | Ga0495625_0006644 | Ga0495625_0006644_7433_8710 | 424 |
| 456 | 3300046665 | Ga0495661_0000029 | Ga0495661_0000029_149138_150415 | 424 |
| 457 | 3300046692 | Ga0495671_0005269 | Ga0495671_0005269_4236_5513 | 424 |
| 458 | 3300046692 | Ga0495671_0051736 | Ga0495671_0051736_45_1322 | 424 |
| 459 | 3300046694 | Ga0495649_0011341 | Ga0495649_0011341_232_1509 | 424 |
| 460 | 3300046794 | Ga0495589_0000251 | Ga0495589_0000251_38818_40095 | 424 |
| 461 | 3300046810 | Ga0495660_0000926 | Ga0495660_0000926_11999_13276 | 424 |
| 462 | 3300046810 | Ga0495660_0001193 | Ga0495660_0001193_244_1521 | 424 |
| 463 | 3300047321 | Ga0495676_0000001 | Ga0495676_0000001_136909_138186 | 424 |
| 464 | 3300047323 | Ga0495683_0000042 | Ga0495683_0000042_68990_70267 | 424 |
| 465 | 3300047323 | Ga0495683_0012140 | Ga0495683_0012140_1992_3269 | 424 |
| 466 | 3300047446 | Ga0495679_000042 | Ga0495679_000042_72631_73908 | 424 |
| 467 | 3300047446 | Ga0495679_000060 | Ga0495679_000060_68134_69411 | 424 |
| 468 | 3300047469 | Ga0495673_0001705 | Ga0495673_0001705_13196_14473 | 424 |
| 469 | 3300047469 | Ga0495673_0017928 | Ga0495673_0017928_1431_2708 | 424 |
| 470 | 3300047472 | Ga0495686_0037241 | Ga0495686_0037241_139_1416 | 424 |
| 471 | 3300048091 | Ga0495626_0000002 | Ga0495626_0000002_181938_183215 | 424 |
| 472 | 3300048925 | Ga0496122_0007096 | Ga0496122_0007096_10222_11499 | 424 |
| 473 | 3300049459 | Ga0495678_000011 | Ga0495678_000011_118653_119930 | 424 |
| 474 | 3300049459 | Ga0495678_008279 | Ga0495678_008279_3619_4896 | 424 |
| 475 | iso_pu_bacteria | 2857453340 | 2857454870 | 424 |
| 476 | iso_pu_bacteria | 2883291878 | 2883295589 | 424 |
| 477 | 3300048915 | Ga0496112_0001155 | Ga0496112_0001155_12427_13707 | 425 |
| 478 | iso_pu_bacteria | 2513237094 | 2513639871 | 425 |
| 479 | iso_pu_bacteria | 2643221629 | 2644168612 | 425 |
| 480 | iso_pu_bacteria | 2643221662 | 2644346509 | 425 |
| 481 | iso_pu_bacteria | 2849560528 | 2849563501 | 425 |
| 482 | iso_pu_bacteria | 2856328259 | 2856332302 | 425 |
| 483 | iso_pu_bacteria | 2869169390 | 2869175115 | 425 |
| 484 | iso_pu_bacteria | 2869242130 | 2869246688 | 425 |
| 485 | iso_pu_bacteria | 2869249662 | 2869250476 | 425 |
| 486 | iso_pu_bacteria | 2869264136 | 2869269098 | 425 |
| 487 | iso_pu_bacteria | 2869271264 | 2869273829 | 425 |
| 488 | iso_pu_bacteria | 2871435913 | 2871439557 | 425 |
| 489 | iso_pu_bacteria | 2871481445 | 2871481824 | 425 |
| 490 | iso_pu_bacteria | 2874116593 | 2874122728 | 425 |
| 491 | iso_pu_bacteria | 2874131515 | 2874138946 | 425 |
| 492 | iso_pu_bacteria | 2876386047 | 2876389416 | 425 |
| 493 | iso_pu_bacteria | 2876399893 | 2876400758 | 425 |
| 494 | iso_pu_bacteria | 2876420981 | 2876423143 | 425 |
| 495 | iso_pu_bacteria | 2881412998 | 2881413395 | 425 |
| 496 | iso_pu_bacteria | 2885270888 | 2885276973 | 425 |
| 497 | iso_pu_bacteria | 2898329390 | 2898330641 | 425 |
| 498 | iso_pu_bacteria | 2904541872 | 2904542756 | 425 |
| 499 | iso_pu_bacteria | 2906363423 | 2906365484 | 425 |
| 500 | iso_pu_bacteria | 2906370794 | 2906373358 | 425 |
| 501 | iso_pu_bacteria | 2906393657 | 2906400299 | 425 |
| 502 | iso_pu_bacteria | 2906401398 | 2906403281 | 425 |
| 503 | iso_pu_bacteria | 2924710171 | 2924712672 | 425 |
| 504 | iso_pu_bacteria | 2924741084 | 2924741819 | 425 |
| 505 | iso_pu_bacteria | 2929160207 | 2929168005 | 425 |
| 506 | iso_pu_bacteria | 2929199973 | 2929201684 | 425 |
| 507 | iso_pu_bacteria | 2937861824 | 2937862810 | 425 |
| 508 | iso_pu_bacteria | 2937868953 | 2937874559 | 425 |
| 509 | iso_pu_bacteria | 2937980651 | 2937982078 | 425 |
| 510 | iso_pu_bacteria | 2958108152 | 2958114586 | 425 |
| 511 | iso_pu_bacteria | 2961183825 | 2961190464 | 425 |
| 512 | iso_pu_bacteria | 2965025482 | 2965028230 | 425 |
| 513 | iso_pu_bacteria | 2965040258 | 2965041911 | 425 |
| 514 | iso_pu_bacteria | 2965089291 | 2965092394 | 425 |
| 515 | iso_pu_bacteria | 2970547951 | 2970551477 | 425 |
| 516 | iso_pu_bacteria | 2977851361 | 2977853770 | 425 |
| 517 | iso_pu_bacteria | 2977907340 | 2977912884 | 425 |
| 518 | iso_pu_bacteria | 2977950692 | 2977950817 | 425 |
| 519 | iso_pu_bacteria | 2979764755 | 2979768989 | 425 |
| 520 | iso_pu_bacteria | 2979772303 | 2979772962 | 425 |
| 521 | iso_pu_bacteria | 2996386984 | 2996388653 | 425 |
| 522 | iso_pu_bacteria | 3004195979 | 3004202362 | 425 |
| 523 | iso_pu_bacteria | 3004248173 | 3004250009 | 425 |
| 524 | iso_pu_bacteria | 8004312739 | 8004320055 | 425 |
| 525 | iso_pu_bacteria | 8004361976 | 8004362416 | 425 |
| 526 | iso_pu_bacteria | 8004727605 | 8004730486 | 425 |
| 527 | iso_pu_bacteria | 8055909800 | 8055915880 | 425 |
| 528 | 3300003761 | Ga0055535_1000052 | Ga0055535_100005292 | 426 |
| 529 | 3300003763 | Ga0055529_1000239 | Ga0055529_100023948 | 426 |
| 530 | 3300003791 | Ga0055530_10008875 | Ga0055530_100088753 | 426 |
| 531 | 3300005288 | Ga0065714_10065580 | Ga0065714_100655802 | 426 |
| 532 | 3300005364 | Ga0070673_100300593 | Ga0070673_1003005931 | 426 |
| 533 | 3300005441 | Ga0070700_100039252 | Ga0070700_1000392521 | 426 |
| 534 | 3300005535 | Ga0070684_100090907 | Ga0070684_1000909072 | 426 |
| 535 | 3300005536 | Ga0070697_100017134 | Ga0070697_1000171345 | 426 |
| 536 | 3300006058 | Ga0075432_10000834 | Ga0075432_100008343 | 426 |
| 537 | 3300006914 | Ga0075436_100005727 | Ga0075436_1000057272 | 426 |
| 538 | 3300009011 | Ga0105251_10002240 | Ga0105251_100022404 | 426 |
| 539 | 3300009098 | Ga0105245_10342855 | Ga0105245_103428551 | 426 |
| 540 | 3300009148 | Ga0105243_10026218 | Ga0105243_100262184 | 426 |
| 541 | 3300009176 | Ga0105242_10038782 | Ga0105242_100387823 | 426 |
| 542 | 3300014325 | Ga0163163_10062965 | Ga0163163_100629652 | 426 |
| 543 | 3300014326 | Ga0157380_10058688 | Ga0157380_100586881 | 426 |
| 544 | 3300014497 | Ga0182008_10000813 | Ga0182008_100008139 | 426 |
| 545 | 3300015261 | Ga0182006_1000562 | Ga0182006_10005627 | 426 |
| 546 | 3300015261 | Ga0182006_1009535 | Ga0182006_10095352 | 426 |
| 547 | 3300015262 | Ga0182007_10000152 | Ga0182007_1000015213 | 426 |
| 548 | 3300015265 | Ga0182005_1000181 | Ga0182005_100018128 | 426 |
| 549 | 3300015265 | Ga0182005_1000857 | Ga0182005_10008578 | 426 |
| 550 | 3300015265 | Ga0182005_1005618 | Ga0182005_10056182 | 426 |
| 551 | 3300021384 | Ga0213876_10112985 | Ga0213876_101129851 | 426 |
| 552 | 3300025242 | Ga0209258_100074 | Ga0209258_100074200 | 426 |
| 553 | 3300025254 | Ga0209148_1002491 | Ga0209148_10024912 | 426 |
| 554 | 3300025256 | Ga0209759_1007857 | Ga0209759_10078573 | 426 |
| 555 | 3300025272 | Ga0209455_1000066 | Ga0209455_1000066240 | 426 |
| 556 | 3300025292 | Ga0209676_1002918 | Ga0209676_10029188 | 426 |
| 557 | 3300025298 | Ga0209050_1001242 | Ga0209050_10012424 | 426 |
| 558 | 3300025735 | Ga0207713_1010220 | Ga0207713_10102203 | 426 |
| 559 | 3300025922 | Ga0207646_10036647 | Ga0207646_100366473 | 426 |
| 560 | 3300025938 | Ga0207704_10065272 | Ga0207704_100652722 | 426 |
| 561 | 3300025940 | Ga0207691_10026254 | Ga0207691_100262544 | 426 |
| 562 | 3300027907 | Ga0207428_10014412 | Ga0207428_100144123 | 426 |
| 563 | 3300028381 | Ga0268264_10062188 | Ga0268264_100621882 | 426 |
| 564 | 3300028666 | Ga0265336_10000029 | Ga0265336_100000298 | 426 |
| 565 | 3300028794 | Ga0307515_10000378 | Ga0307515_10000378100 | 426 |
| 566 | 3300029957 | Ga0265324_10000372 | Ga0265324_1000037222 | 426 |
| 567 | 3300031456 | Ga0307513_10016290 | Ga0307513_100162905 | 426 |
| 568 | 3300031548 | Ga0307408_100232538 | Ga0307408_1002325381 | 426 |
| 569 | 3300031649 | Ga0307514_10000827 | Ga0307514_1000082712 | 426 |
| 570 | 3300031731 | Ga0307405_10000100 | Ga0307405_1000010027 | 426 |
| 571 | 3300031911 | Ga0307412_10000323 | Ga0307412_1000032310 | 426 |
| 572 | 3300032005 | Ga0307411_10020413 | Ga0307411_100204132 | 426 |
| 573 | 3300039437 | Ga0436365_1644591 | Ga0436365_1644591_1111_2433 | 426 |
| 574 | 3300039453 | Ga0436362_0755809 | Ga0436362_0755809_29_1351 | 426 |
| 575 | 3300046452 | Ga0495617_000254 | Ga0495617_000254_14483_15766 | 426 |
| 576 | 3300046452 | Ga0495617_023056 | Ga0495617_023056_620_1960 | 426 |
| 577 | 3300046453 | Ga0495627_004049 | Ga0495627_004049_637_1977 | 426 |
| 578 | 3300046455 | Ga0495603_0004739 | Ga0495603_0004739_1738_3021 | 426 |
| 579 | 3300046457 | Ga0495590_0000100 | Ga0495590_0000100_35746_37029 | 426 |
| 580 | 3300046458 | Ga0495591_000008 | Ga0495591_000008_55124_56407 | 426 |
| 581 | 3300046458 | Ga0495591_000981 | Ga0495591_000981_17605_18945 | 426 |
| 582 | 3300046460 | Ga0495638_0000827 | Ga0495638_0000827_30295_31578 | 426 |
| 583 | 3300046460 | Ga0495638_0000830 | Ga0495638_0000830_16171_17454 | 426 |
| 584 | 3300046460 | Ga0495638_0078656 | Ga0495638_0078656_342_1625 | 426 |
| 585 | 3300046463 | Ga0495653_0000442 | Ga0495653_0000442_20997_22337 | 426 |
| 586 | 3300046463 | Ga0495653_0085474 | Ga0495653_0085474_311_1594 | 426 |
| 587 | 3300046471 | Ga0495650_0000793 | Ga0495650_0000793_8527_9810 | 426 |
| 588 | 3300046473 | Ga0495582_0036443 | Ga0495582_0036443_1210_2550 | 426 |
| 589 | 3300046474 | Ga0495605_0000170 | Ga0495605_0000170_34474_35757 | 426 |
| 590 | 3300046474 | Ga0495605_0001103 | Ga0495605_0001103_4381_5664 | 426 |
| 591 | 3300046474 | Ga0495605_0001490 | Ga0495605_0001490_4245_5528 | 426 |
| 592 | 3300046474 | Ga0495605_0045784 | Ga0495605_0045784_288_1571 | 426 |
| 593 | 3300046491 | Ga0495584_0000012 | Ga0495584_0000012_49911_51194 | 426 |
| 594 | 3300046491 | Ga0495584_0000332 | Ga0495584_0000332_25303_26586 | 426 |
| 595 | 3300046492 | Ga0495585_0000056 | Ga0495585_0000056_49009_50292 | 426 |
| 596 | 3300046492 | Ga0495585_0000105 | Ga0495585_0000105_20130_21413 | 426 |
| 597 | 3300046499 | Ga0495594_0054388 | Ga0495594_0054388_102_1442 | 426 |
| 598 | 3300046500 | Ga0495596_0000161 | Ga0495596_0000161_39434_40717 | 426 |
| 599 | 3300046501 | Ga0495607_0000194 | Ga0495607_0000194_57219_58505 | 426 |
| 600 | 3300046501 | Ga0495607_0002405 | Ga0495607_0002405_2862_4145 | 426 |
| 601 | 3300046501 | Ga0495607_0003246 | Ga0495607_0003246_4652_5935 | 426 |
| 602 | 3300046501 | Ga0495607_0008052 | Ga0495607_0008052_2851_4191 | 426 |
| 603 | 3300046501 | Ga0495607_0079125 | Ga0495607_0079125_26_1366 | 426 |
| 604 | 3300046506 | Ga0495583_0000354 | Ga0495583_0000354_52250_53533 | 426 |
| 605 | 3300046506 | Ga0495583_0000715 | Ga0495583_0000715_35212_36495 | 426 |
| 606 | 3300046506 | Ga0495583_0000875 | Ga0495583_0000875_34873_36213 | 426 |
| 607 | 3300046506 | Ga0495583_0011078 | Ga0495583_0011078_877_2160 | 426 |
| 608 | 3300046507 | Ga0495606_0000354 | Ga0495606_0000354_55417_56757 | 426 |
| 609 | 3300046507 | Ga0495606_0065969 | Ga0495606_0065969_920_2260 | 426 |
| 610 | 3300046512 | Ga0495610_0001011 | Ga0495610_0001011_8977_10260 | 426 |
| 611 | 3300046512 | Ga0495610_0014593 | Ga0495610_0014593_323_1606 | 426 |
| 612 | 3300046512 | Ga0495610_0093855 | Ga0495610_0093855_31_1314 | 426 |
| 613 | 3300046513 | Ga0495616_0000455 | Ga0495616_0000455_9840_11123 | 426 |
| 614 | 3300046513 | Ga0495616_0001464 | Ga0495616_0001464_5718_7058 | 426 |
| 615 | 3300046513 | Ga0495616_0003793 | Ga0495616_0003793_3770_5053 | 426 |
| 616 | 3300046513 | Ga0495616_0006725 | Ga0495616_0006725_1011_2297 | 426 |
| 617 | 3300046515 | Ga0495620_0000367 | Ga0495620_0000367_4908_6248 | 426 |
| 618 | 3300046515 | Ga0495620_0002382 | Ga0495620_0002382_5600_6940 | 426 |
| 619 | 3300046517 | Ga0495630_0001474 | Ga0495630_0001474_10950_12233 | 426 |
| 620 | 3300046519 | Ga0495632_0000298 | Ga0495632_0000298_4784_6067 | 426 |
| 621 | 3300046519 | Ga0495632_0001005 | Ga0495632_0001005_299_1582 | 426 |
| 622 | 3300046519 | Ga0495632_0001671 | Ga0495632_0001671_16255_17595 | 426 |
| 623 | 3300046520 | Ga0495637_0031287 | Ga0495637_0031287_683_1966 | 426 |
| 624 | 3300046522 | Ga0495643_0000849 | Ga0495643_0000849_4599_5882 | 426 |
| 625 | 3300046522 | Ga0495643_0008509 | Ga0495643_0008509_2888_4171 | 426 |
| 626 | 3300046522 | Ga0495643_0009432 | Ga0495643_0009432_3840_5180 | 426 |
| 627 | 3300046523 | Ga0495644_0000089 | Ga0495644_0000089_25084_26367 | 426 |
| 628 | 3300046523 | Ga0495644_0000122 | Ga0495644_0000122_9326_10666 | 426 |
| 629 | 3300046523 | Ga0495644_0020303 | Ga0495644_0020303_1056_2339 | 426 |
| 630 | 3300046524 | Ga0495648_0000471 | Ga0495648_0000471_22714_24054 | 426 |
| 631 | 3300046524 | Ga0495648_0000779 | Ga0495648_0000779_5082_6365 | 426 |
| 632 | 3300046524 | Ga0495648_0029882 | Ga0495648_0029882_328_1611 | 426 |
| 633 | 3300046524 | Ga0495648_0064997 | Ga0495648_0064997_796_2136 | 426 |
| 634 | 3300046528 | Ga0495642_0000015 | Ga0495642_0000015_89560_90843 | 426 |
| 635 | 3300046529 | Ga0495652_0209455 | Ga0495652_0209455_168_1451 | 426 |
| 636 | 3300046530 | Ga0495654_0000780 | Ga0495654_0000780_5717_7057 | 426 |
| 637 | 3300046530 | Ga0495654_0001049 | Ga0495654_0001049_338_1621 | 426 |
| 638 | 3300046530 | Ga0495654_0039974 | Ga0495654_0039974_342_1625 | 426 |
| 639 | 3300046535 | Ga0495586_0004363 | Ga0495586_0004363_3934_5274 | 426 |
| 640 | 3300046536 | Ga0495587_0000458 | Ga0495587_0000458_10250_11590 | 426 |
| 641 | 3300046536 | Ga0495587_0000606 | Ga0495587_0000606_9148_10431 | 426 |
| 642 | 3300046538 | Ga0495609_0000026 | Ga0495609_0000026_5873_7159 | 426 |
| 643 | 3300046542 | Ga0495597_0002701 | Ga0495597_0002701_9366_10649 | 426 |
| 644 | 3300046542 | Ga0495597_0024152 | Ga0495597_0024152_98_1381 | 426 |
| 645 | 3300046557 | Ga0495622_0001383 | Ga0495622_0001383_5707_6990 | 426 |
| 646 | 3300046615 | Ga0495656_0002001 | Ga0495656_0002001_5143_6426 | 426 |
| 647 | 3300046615 | Ga0495656_0013793 | Ga0495656_0013793_296_1582 | 426 |
| 648 | 3300046616 | Ga0495668_0035276 | Ga0495668_0035276_648_1931 | 426 |
| 649 | 3300046660 | Ga0495625_0001308 | Ga0495625_0001308_9771_11054 | 426 |
| 650 | 3300046660 | Ga0495625_0002329 | Ga0495625_0002329_4667_5950 | 426 |
| 651 | 3300046660 | Ga0495625_0030346 | Ga0495625_0030346_2578_3918 | 426 |
| 652 | 3300046660 | Ga0495625_0088501 | Ga0495625_0088501_758_2041 | 426 |
| 653 | 3300046663 | Ga0495635_0000159 | Ga0495635_0000159_27635_28975 | 426 |
| 654 | 3300046665 | Ga0495661_0000043 | Ga0495661_0000043_84559_85899 | 426 |
| 655 | 3300046665 | Ga0495661_0000152 | Ga0495661_0000152_5855_7141 | 426 |
| 656 | 3300046665 | Ga0495661_0000850 | Ga0495661_0000850_10727_12067 | 426 |
| 657 | 3300046665 | Ga0495661_0032511 | Ga0495661_0032511_213_1553 | 426 |
| 658 | 3300046674 | Ga0495588_0001377 | Ga0495588_0001377_290_1573 | 426 |
| 659 | 3300046674 | Ga0495588_0005052 | Ga0495588_0005052_3057_4340 | 426 |
| 660 | 3300046674 | Ga0495588_0050625 | Ga0495588_0050625_657_1940 | 426 |
| 661 | 3300046678 | Ga0495599_0070773 | Ga0495599_0070773_182_1465 | 426 |
| 662 | 3300046680 | Ga0495646_0000197 | Ga0495646_0000197_23099_24382 | 426 |
| 663 | 3300046684 | Ga0495669_0006270 | Ga0495669_0006270_1936_3219 | 426 |
| 664 | 3300046689 | Ga0495613_0000403 | Ga0495613_0000403_10686_11969 | 426 |
| 665 | 3300046692 | Ga0495671_0000410 | Ga0495671_0000410_6761_8044 | 426 |
| 666 | 3300046692 | Ga0495671_0001111 | Ga0495671_0001111_3899_5239 | 426 |
| 667 | 3300046692 | Ga0495671_0002075 | Ga0495671_0002075_5442_6725 | 426 |
| 668 | 3300046692 | Ga0495671_0053015 | Ga0495671_0053015_427_1710 | 426 |
| 669 | 3300046694 | Ga0495649_0001219 | Ga0495649_0001219_10031_11314 | 426 |
| 670 | 3300046694 | Ga0495649_0006023 | Ga0495649_0006023_5803_7143 | 426 |
| 671 | 3300046694 | Ga0495649_0009751 | Ga0495649_0009751_1788_3071 | 426 |
| 672 | 3300046694 | Ga0495649_0045548 | Ga0495649_0045548_698_1981 | 426 |
| 673 | 3300046794 | Ga0495589_0000101 | Ga0495589_0000101_75425_76711 | 426 |
| 674 | 3300046794 | Ga0495589_0001783 | Ga0495589_0001783_9811_11094 | 426 |
| 675 | 3300046794 | Ga0495589_0001792 | Ga0495589_0001792_9418_10758 | 426 |
| 676 | 3300046794 | Ga0495589_0004826 | Ga0495589_0004826_4181_5521 | 426 |
| 677 | 3300046809 | Ga0495600_0000561 | Ga0495600_0000561_15674_16957 | 426 |
| 678 | 3300046809 | Ga0495600_0013607 | Ga0495600_0013607_1343_2683 | 426 |
| 679 | 3300046810 | Ga0495660_0000151 | Ga0495660_0000151_52250_53533 | 426 |
| 680 | 3300046810 | Ga0495660_0000276 | Ga0495660_0000276_3100_4383 | 426 |
| 681 | 3300046810 | Ga0495660_0000561 | Ga0495660_0000561_551_1834 | 426 |
| 682 | 3300046810 | Ga0495660_0001106 | Ga0495660_0001106_12319_13602 | 426 |
| 683 | 3300046810 | Ga0495660_0015344 | Ga0495660_0015344_266_1549 | 426 |
| 684 | 3300047319 | Ga0495674_0042484 | Ga0495674_0042484_2559_3842 | 426 |
| 685 | 3300047320 | Ga0495672_0000671 | Ga0495672_0000671_16602_17885 | 426 |
| 686 | 3300047320 | Ga0495672_0000828 | Ga0495672_0000828_31510_32850 | 426 |
| 687 | 3300047320 | Ga0495672_0000860 | Ga0495672_0000860_20481_21764 | 426 |
| 688 | 3300047322 | Ga0495680_0000079 | Ga0495680_0000079_19103_20443 | 426 |
| 689 | 3300047322 | Ga0495680_0001052 | Ga0495680_0001052_5834_7117 | 426 |
| 690 | 3300047322 | Ga0495680_0002410 | Ga0495680_0002410_15096_16379 | 426 |
| 691 | 3300047323 | Ga0495683_0000022 | Ga0495683_0000022_53533_54873 | 426 |
| 692 | 3300047443 | Ga0495687_000037 | Ga0495687_000037_5873_7159 | 426 |
| 693 | 3300047444 | Ga0495675_0000527 | Ga0495675_0000527_13709_14992 | 426 |
| 694 | 3300047445 | Ga0495677_0000014 | Ga0495677_0000014_129078_130364 | 426 |
| 695 | 3300047445 | Ga0495677_0001369 | Ga0495677_0001369_3727_5010 | 426 |
| 696 | 3300047469 | Ga0495673_0000142 | Ga0495673_0000142_92564_93847 | 426 |
| 697 | 3300047469 | Ga0495673_0000824 | Ga0495673_0000824_2489_3772 | 426 |
| 698 | 3300047469 | Ga0495673_0000849 | Ga0495673_0000849_10726_12009 | 426 |
| 699 | 3300047469 | Ga0495673_0004583 | Ga0495673_0004583_5122_6405 | 426 |
| 700 | 3300047470 | Ga0495681_0001555 | Ga0495681_0001555_568_1908 | 426 |
| 701 | 3300047470 | Ga0495681_0001678 | Ga0495681_0001678_2888_4171 | 426 |
| 702 | 3300047470 | Ga0495681_0003122 | Ga0495681_0003122_5466_6806 | 426 |
| 703 | 3300047470 | Ga0495681_0012199 | Ga0495681_0012199_3407_4747 | 426 |
| 704 | 3300047472 | Ga0495686_0001995 | Ga0495686_0001995_13477_14760 | 426 |
| 705 | 3300047673 | Ga0495593_0001060 | Ga0495593_0001060_9630_10913 | 426 |
| 706 | 3300048091 | Ga0495626_0000049 | Ga0495626_0000049_82126_83409 | 426 |
| 707 | 3300048091 | Ga0495626_0000243 | Ga0495626_0000243_14375_15658 | 426 |
| 708 | 3300048091 | Ga0495626_0000289 | Ga0495626_0000289_47300_48586 | 426 |
| 709 | 3300048905 | Ga0496102_0000130 | Ga0496102_0000130_78089_79372 | 426 |
| 710 | 3300048906 | Ga0496103_0000419 | Ga0496103_0000419_24885_26168 | 426 |
| 711 | 3300048907 | Ga0496104_0203393 | Ga0496104_0203393_53_1336 | 426 |
| 712 | 3300048911 | Ga0496108_0180073 | Ga0496108_0180073_333_1616 | 426 |
| 713 | 3300048918 | Ga0496115_0074356 | Ga0496115_0074356_1403_2686 | 426 |
| 714 | 3300048919 | Ga0496116_0043572 | Ga0496116_0043572_32_1315 | 426 |
| 715 | 3300048920 | Ga0496117_0002642 | Ga0496117_0002642_16407_17690 | 426 |
| 716 | 3300048920 | Ga0496117_0024264 | Ga0496117_0024264_882_2222 | 426 |
| 717 | 3300048921 | Ga0496118_0003017 | Ga0496118_0003017_15907_17190 | 426 |
| 718 | 3300048921 | Ga0496118_0005276 | Ga0496118_0005276_9661_11001 | 426 |
| 719 | 3300048927 | Ga0496124_0017736 | Ga0496124_0017736_4763_6103 | 426 |
| 720 | 3300048929 | Ga0496126_0020582 | Ga0496126_0020582_1061_2344 | 426 |
| 721 | 3300049459 | Ga0495678_000873 | Ga0495678_000873_25137_26420 | 426 |
| 722 | 3300049460 | Ga0495682_0000322 | Ga0495682_0000322_19869_21152 | 426 |
| 723 | 3300049575 | Ga0501039_0032753 | Ga0501039_0032753_1918_3207 | 426 |
| 724 | 3300049577 | Ga0501041_0011429 | Ga0501041_0011429_3573_4862 | 426 |
| 725 | 3300049582 | Ga0501048_0130659 | Ga0501048_0130659_154_1443 | 426 |
| 726 | 3300049588 | Ga0501072_0001662 | Ga0501072_0001662_12276_13565 | 426 |
| 727 | 3300049591 | Ga0501075_0001616 | Ga0501075_0001616_6660_7949 | 426 |
| 728 | 3300049824 | Ga0501045_0011349 | Ga0501045_0011349_3048_4337 | 426 |
| 729 | 3300050514 | nmdc:mga08x19_96017_c1 | nmdc:mga08x19_96017_c1_410_1750 | 426 |
| 730 | 3300061734 | Ga0530510_0002303 | Ga0530510_0002303_10326_11615 | 426 |
| 731 | iso_pu_bacteria | 2791355137 | 2792833816 | 426 |
| 732 | iso_pu_bacteria | 2842854478 | 2842857996 | 426 |
| 733 | iso_pu_bacteria | 2857357740 | 2857365366 | 426 |
| 734 | iso_pu_bacteria | 642555112 | 642599031 | 426 |
| 735 | 3300003758 | Ga0055532_1000249 | Ga0055532_100024924 | 427 |
| 736 | 3300003760 | Ga0055527_1000207 | Ga0055527_100020712 | 427 |
| 737 | 3300003761 | Ga0055535_1000437 | Ga0055535_100043712 | 427 |
| 738 | 3300003762 | Ga0055542_1000457 | Ga0055542_100045712 | 427 |
| 739 | 3300003763 | Ga0055529_1000395 | Ga0055529_100039510 | 427 |
| 740 | 3300005295 | Ga0065707_10169157 | Ga0065707_101691571 | 427 |
| 741 | 3300005336 | Ga0070680_100008502 | Ga0070680_1000085028 | 427 |
| 742 | 3300005337 | Ga0070682_100019858 | Ga0070682_1000198582 | 427 |
| 743 | 3300005438 | Ga0070701_10018964 | Ga0070701_100189641 | 427 |
| 744 | 3300005530 | Ga0070679_100056647 | Ga0070679_1000566471 | 427 |
| 745 | 3300005544 | Ga0070686_100004150 | Ga0070686_1000041504 | 427 |
| 746 | 3300005545 | Ga0070695_100007796 | Ga0070695_1000077962 | 427 |
| 747 | 3300005547 | Ga0070693_100018861 | Ga0070693_1000188612 | 427 |
| 748 | 3300005614 | Ga0068856_100229555 | Ga0068856_1002295553 | 427 |
| 749 | 3300005614 | Ga0068856_100238857 | Ga0068856_1002388572 | 427 |
| 750 | 3300005617 | Ga0068859_100050191 | Ga0068859_1000501915 | 427 |
| 751 | 3300005718 | Ga0068866_10001011 | Ga0068866_100010119 | 427 |
| 752 | 3300006237 | Ga0097621_100034759 | Ga0097621_1000347592 | 427 |
| 753 | 3300006844 | Ga0075428_100006970 | Ga0075428_1000069706 | 427 |
| 754 | 3300006871 | Ga0075434_100003524 | Ga0075434_10000352415 | 427 |
| 755 | 3300006880 | Ga0075429_100004649 | Ga0075429_1000046499 | 427 |
| 756 | 3300006931 | Ga0097620_100050189 | Ga0097620_1000501892 | 427 |
| 757 | 3300009093 | Ga0105240_10015342 | Ga0105240_100153425 | 427 |
| 758 | 3300009093 | Ga0105240_10071601 | Ga0105240_100716013 | 427 |
| 759 | 3300009148 | Ga0105243_10008728 | Ga0105243_100087284 | 427 |
| 760 | 3300013104 | Ga0157370_10019032 | Ga0157370_100190323 | 427 |
| 761 | 3300013297 | Ga0157378_10044269 | Ga0157378_100442694 | 427 |
| 762 | 3300014325 | Ga0163163_10037843 | Ga0163163_100378434 | 427 |
| 763 | 3300025228 | Ga0209672_100025 | Ga0209672_100025308 | 427 |
| 764 | 3300025229 | Ga0209147_100032 | Ga0209147_100032308 | 427 |
| 765 | 3300025242 | Ga0209258_100050 | Ga0209258_100050308 | 427 |
| 766 | 3300025254 | Ga0209148_1000060 | Ga0209148_1000060308 | 427 |
| 767 | 3300025272 | Ga0209455_1000055 | Ga0209455_1000055308 | 427 |
| 768 | 3300025911 | Ga0207654_10053538 | Ga0207654_100535382 | 427 |
| 769 | 3300025913 | Ga0207695_10146268 | Ga0207695_101462682 | 427 |
| 770 | 3300025916 | Ga0207663_10123804 | Ga0207663_101238042 | 427 |
| 771 | 3300025918 | Ga0207662_10000171 | Ga0207662_1000017114 | 427 |
| 772 | 3300025928 | Ga0207700_10091916 | Ga0207700_100919162 | 427 |
| 773 | 3300025934 | Ga0207686_10009011 | Ga0207686_100090113 | 427 |
| 774 | 3300025938 | Ga0207704_10052906 | Ga0207704_100529063 | 427 |
| 775 | 3300025942 | Ga0207689_10001391 | Ga0207689_1000139122 | 427 |
| 776 | 3300026075 | Ga0207708_10003464 | Ga0207708_100034645 | 427 |
| 777 | 3300026089 | Ga0207648_10002207 | Ga0207648_1000220713 | 427 |
| 778 | 3300026118 | Ga0207675_100001449 | Ga0207675_1000014493 | 427 |
| 779 | 3300027462 | Ga0210000_1004378 | Ga0210000_10043781 | 427 |
| 780 | 3300027526 | Ga0209968_1009597 | Ga0209968_10095971 | 427 |
| 781 | 3300028786 | Ga0307517_10003354 | Ga0307517_100033548 | 427 |
| 782 | 3300028800 | Ga0265338_10042081 | Ga0265338_100420816 | 427 |
| 783 | 3300031456 | Ga0307513_10070494 | Ga0307513_100704943 | 427 |
| 784 | 3300035088 | Ga0373940_0007169 | Ga0373940_0007169_569_1861 | 427 |
| 785 | 3300035089 | Ga0373944_0009265 | Ga0373944_0009265_1257_2549 | 427 |
| 786 | 3300035172 | Ga0373955_0086564 | Ga0373955_0086564_469_1755 | 427 |
| 787 | 3300035410 | Ga0373924_0035685 | Ga0373924_0035685_629_1915 | 427 |
| 788 | 3300035695 | Ga0373927_0033526 | Ga0373927_0033526_121_1413 | 427 |
| 789 | 3300035725 | Ga0373947_0047961 | Ga0373947_0047961_711_2003 | 427 |
| 790 | 3300036401 | Ga0373937_0031620 | Ga0373937_0031620_1173_2459 | 427 |
| 791 | 3300037068 | Ga0373925_0028128 | Ga0373925_0028128_2663_3949 | 427 |
| 792 | 3300042125 | Ga0450923_013215 | Ga0450923_013215_183_1484 | 427 |
| 793 | 3300042146 | Ga0450907_006652 | Ga0450907_006652_400_1704 | 427 |
| 794 | 3300042436 | Ga0439435_0007814 | Ga0439435_0007814_693_1985 | 427 |
| 795 | 3300044693 | Ga0466961_0000259 | Ga0466961_0000259_9728_11095 | 427 |
| 796 | 3300045976 | Ga0466967_0015127 | Ga0466967_0015127_1251_2564 | 427 |
| 797 | 3300046455 | Ga0495603_0028911 | Ga0495603_0028911_581_1873 | 427 |
| 798 | 3300046462 | Ga0495651_0059889 | Ga0495651_0059889_96_1382 | 427 |
| 799 | 3300046472 | Ga0495580_0013053 | Ga0495580_0013053_3683_4975 | 427 |
| 800 | 3300046475 | Ga0495639_0025290 | Ga0495639_0025290_1140_2432 | 427 |
| 801 | 3300046526 | Ga0495666_0031579 | Ga0495666_0031579_1172_2464 | 427 |
| 802 | 3300046535 | Ga0495586_0006035 | Ga0495586_0006035_3442_4734 | 427 |
| 803 | 3300046559 | Ga0495667_0119386 | Ga0495667_0119386_281_1567 | 427 |
| 804 | 3300046674 | Ga0495588_0035338 | Ga0495588_0035338_749_2041 | 427 |
| 805 | 3300046678 | Ga0495599_0010539 | Ga0495599_0010539_1743_3029 | 427 |
| 806 | 3300046683 | Ga0495658_0003618 | Ga0495658_0003618_1168_2460 | 427 |
| 807 | 3300047315 | Ga0495581_0045174 | Ga0495581_0045174_41_1333 | 427 |
| 808 | 3300047319 | Ga0495674_0053964 | Ga0495674_0053964_1743_3029 | 427 |
| 809 | 3300047471 | Ga0495684_0095899 | Ga0495684_0095899_585_1871 | 427 |
| 810 | 3300047471 | Ga0495684_0177015 | Ga0495684_0177015_239_1525 | 427 |
| 811 | 3300049521 | Ga0501298_010528 | Ga0501298_010528_87_1400 | 427 |
| 812 | 3300049568 | Ga0501031_0015894 | Ga0501031_0015894_1515_2822 | 427 |
| 813 | 3300049569 | Ga0501032_0111256 | Ga0501032_0111256_327_1634 | 427 |
| 814 | 3300049572 | Ga0501036_0001202 | Ga0501036_0001202_1424_2731 | 427 |
| 815 | 3300049575 | Ga0501039_0007339 | Ga0501039_0007339_1479_2786 | 427 |
| 816 | 3300049576 | Ga0501040_0109292 | Ga0501040_0109292_93_1418 | 427 |
| 817 | 3300049578 | Ga0501042_0088860 | Ga0501042_0088860_305_1612 | 427 |
| 818 | 3300049587 | Ga0501071_0158636 | Ga0501071_0158636_189_1496 | 427 |
| 819 | 3300049588 | Ga0501072_0169706 | Ga0501072_0169706_119_1426 | 427 |
| 820 | 3300049589 | Ga0501073_0163880 | Ga0501073_0163880_232_1518 | 427 |
| 821 | 3300049590 | Ga0501074_0001550 | Ga0501074_0001550_9397_10704 | 427 |
| 822 | 3300049591 | Ga0501075_0015017 | Ga0501075_0015017_2110_3441 | 427 |
| 823 | 3300049591 | Ga0501075_0048774 | Ga0501075_0048774_537_1844 | 427 |
| 824 | 3300049592 | Ga0501076_0005033 | Ga0501076_0005033_7849_9156 | 427 |
| 825 | 3300049592 | Ga0501076_0008894 | Ga0501076_0008894_3850_5157 | 427 |
| 826 | 3300049592 | Ga0501076_0166013 | Ga0501076_0166013_235_1542 | 427 |
| 827 | 3300049592 | Ga0501076_0194302 | Ga0501076_0194302_15_1346 | 427 |
| 828 | 3300049593 | Ga0501077_0042661 | Ga0501077_0042661_1316_2623 | 427 |
| 829 | 3300049741 | Ga0501079_0140996 | Ga0501079_0140996_293_1600 | 427 |
| 830 | 3300049742 | Ga0501080_0302855 | Ga0501080_0302855_72_1379 | 427 |
| 831 | 3300049743 | Ga0501081_0010538 | Ga0501081_0010538_3231_4538 | 427 |
| 832 | 3300049743 | Ga0501081_0018805 | Ga0501081_0018805_1229_2536 | 427 |
| 833 | 3300049822 | Ga0501035_0111751 | Ga0501035_0111751_606_1913 | 427 |
| 834 | 3300049824 | Ga0501045_0019906 | Ga0501045_0019906_82_1389 | 427 |
| 835 | 3300050508 | nmdc:mga09592_14450_c1 | nmdc:mga09592_14450_c1_812_2104 | 427 |
| 836 | 3300050512 | nmdc:mga0n895_1531_c1 | nmdc:mga0n895_1531_c1_15875_17188 | 427 |
| 837 | 3300050513 | nmdc:mga0rr50_40898_c1 | nmdc:mga0rr50_40898_c1_2009_3322 | 427 |
| 838 | 3300054114 | Ga0501084_0069416 | Ga0501084_0069416_148_1455 | 427 |
| 839 | 3300054114 | Ga0501084_0248081 | Ga0501084_0248081_56_1351 | 427 |
| 840 | 3300060353 | Ga0501082_0044116 | Ga0501082_0044116_582_1889 | 427 |
| 841 | 3300060353 | Ga0501082_0082809 | Ga0501082_0082809_419_1726 | 427 |
| 842 | 3300061734 | Ga0530510_0031828 | Ga0530510_0031828_1242_2549 | 427 |
| 843 | 3300005843 | Ga0068860_100063199 | Ga0068860_1000631993 | 428 |
| 844 | 3300006058 | Ga0075432_10005043 | Ga0075432_100050432 | 428 |
| 845 | 3300009093 | Ga0105240_10377453 | Ga0105240_103774532 | 428 |
| 846 | 3300027907 | Ga0207428_10028695 | Ga0207428_100286952 | 428 |
| 847 | 3300028800 | Ga0265338_10009351 | Ga0265338_100093514 | 428 |
| 848 | 3300031090 | Ga0265760_10020075 | Ga0265760_100200752 | 428 |
| 849 | 3300031247 | Ga0265340_10056728 | Ga0265340_100567281 | 428 |
| 850 | 3300037471 | Ga0395905_0036400 | Ga0395905_0036400_1215_2510 | 428 |
| 851 | 3300046462 | Ga0495651_0000971 | Ga0495651_0000971_1591_2880 | 428 |
| 852 | 3300046463 | Ga0495653_0130937 | Ga0495653_0130937_419_1708 | 428 |
| 853 | 3300046501 | Ga0495607_0063589 | Ga0495607_0063589_585_1874 | 428 |
| 854 | 3300046511 | Ga0495608_0020720 | Ga0495608_0020720_3080_4369 | 428 |
| 855 | 3300046516 | Ga0495628_0107478 | Ga0495628_0107478_567_1856 | 428 |
| 856 | 3300046533 | Ga0495640_0035698 | Ga0495640_0035698_2102_3415 | 428 |
| 857 | 3300046559 | Ga0495667_0008755 | Ga0495667_0008755_4415_5704 | 428 |
| 858 | 3300046663 | Ga0495635_0137614 | Ga0495635_0137614_151_1464 | 428 |
| 859 | 3300046692 | Ga0495671_0041177 | Ga0495671_0041177_301_1590 | 428 |
| 860 | 3300046809 | Ga0495600_0184861 | Ga0495600_0184861_19_1308 | 428 |
| 861 | 3300047319 | Ga0495674_0069865 | Ga0495674_0069865_1652_2941 | 428 |
| 862 | 3300047322 | Ga0495680_0000036 | Ga0495680_0000036_82479_83768 | 428 |
| 863 | 3300047322 | Ga0495680_0085468 | Ga0495680_0085468_1070_2359 | 428 |
| 864 | 3300047444 | Ga0495675_0019046 | Ga0495675_0019046_1471_2760 | 428 |
| 865 | 3300047471 | Ga0495684_0004613 | Ga0495684_0004613_9218_10507 | 428 |
| 866 | 2162886007 | SwRhRL2b_contig_1664813 | SwRhRL2b_0282.00001350 | 429 |
| 867 | 3300000041 | ARcpr5oldR_c000037 | ARcpr5oldR_00003713 | 429 |
| 868 | 3300000043 | ARcpr5yngRDRAFT_c000014 | ARcpr5yngRDRAFT_00001413 | 429 |
| 869 | 3300000044 | ARSoilOldRDRAFT_c000005 | ARSoilOldRDRAFT_00000513 | 429 |
| 870 | 3300000652 | ARCol0yngRDRAFT_1000099 | ARCol0yngRDRAFT_100009913 | 429 |
| 871 | 3300001990 | JGI24737J22298_10003080 | JGI24737J22298_100030805 | 429 |
| 872 | 3300002737 | JGI25162J39368_1000011 | JGI25162J39368_1000011180 | 429 |
| 873 | 3300003187 | JGI25151J46595_10000019 | JGI25151J46595_10000019101 | 429 |
| 874 | 3300003187 | JGI25151J46595_10001080 | JGI25151J46595_1000108013 | 429 |
| 875 | 3300003773 | Ga0055537_1001658 | Ga0055537_10016582 | 429 |
| 876 | 3300005289 | Ga0065704_10000208 | Ga0065704_1000020846 | 429 |
| 877 | 3300005328 | Ga0070676_10145783 | Ga0070676_101457831 | 429 |
| 878 | 3300005335 | Ga0070666_10006171 | Ga0070666_100061716 | 429 |
| 879 | 3300005336 | Ga0070680_100019478 | Ga0070680_1000194783 | 429 |
| 880 | 3300005337 | Ga0070682_100051802 | Ga0070682_1000518022 | 429 |
| 881 | 3300005338 | Ga0068868_100122270 | Ga0068868_1001222702 | 429 |
| 882 | 3300005339 | Ga0070660_100035891 | Ga0070660_1000358912 | 429 |
| 883 | 3300005340 | Ga0070689_100039107 | Ga0070689_1000391073 | 429 |
| 884 | 3300005344 | Ga0070661_100080147 | Ga0070661_1000801473 | 429 |
| 885 | 3300005347 | Ga0070668_100077272 | Ga0070668_1000772722 | 429 |
| 886 | 3300005347 | Ga0070668_100159462 | Ga0070668_1001594621 | 429 |
| 887 | 3300005353 | Ga0070669_100003120 | Ga0070669_1000031207 | 429 |
| 888 | 3300005354 | Ga0070675_100014385 | Ga0070675_1000143853 | 429 |
| 889 | 3300005355 | Ga0070671_100006278 | Ga0070671_1000062785 | 429 |
| 890 | 3300005356 | Ga0070674_100119544 | Ga0070674_1001195441 | 429 |
| 891 | 3300005365 | Ga0070688_100009296 | Ga0070688_1000092961 | 429 |
| 892 | 3300005367 | Ga0070667_100041355 | Ga0070667_1000413551 | 429 |
| 893 | 3300005435 | Ga0070714_100031780 | Ga0070714_1000317803 | 429 |
| 894 | 3300005455 | Ga0070663_100102357 | Ga0070663_1001023572 | 429 |
| 895 | 3300005457 | Ga0070662_100034622 | Ga0070662_1000346222 | 429 |
| 896 | 3300005458 | Ga0070681_10075350 | Ga0070681_100753502 | 429 |
| 897 | 3300005466 | Ga0070685_10039064 | Ga0070685_100390643 | 429 |
| 898 | 3300005468 | Ga0070707_100108705 | Ga0070707_1001087053 | 429 |
| 899 | 3300005468 | Ga0070707_100260423 | Ga0070707_1002604232 | 429 |
| 900 | 3300005471 | Ga0070698_100175054 | Ga0070698_1001750543 | 429 |
| 901 | 3300005518 | Ga0070699_100079622 | Ga0070699_1000796223 | 429 |
| 902 | 3300005530 | Ga0070679_100038534 | Ga0070679_1000385342 | 429 |
| 903 | 3300005548 | Ga0070665_100000052 | Ga0070665_10000005218 | 429 |
| 904 | 3300005548 | Ga0070665_100006016 | Ga0070665_1000060166 | 429 |
| 905 | 3300005549 | Ga0070704_100183339 | Ga0070704_1001833392 | 429 |
| 906 | 3300005564 | Ga0070664_100264754 | Ga0070664_1002647542 | 429 |
| 907 | 3300005614 | Ga0068856_100123520 | Ga0068856_1001235202 | 429 |
| 908 | 3300005614 | Ga0068856_100228329 | Ga0068856_1002283291 | 429 |
| 909 | 3300005617 | Ga0068859_100020736 | Ga0068859_1000207363 | 429 |
| 910 | 3300005617 | Ga0068859_100191161 | Ga0068859_1001911613 | 429 |
| 911 | 3300005719 | Ga0068861_100027831 | Ga0068861_1000278313 | 429 |
| 912 | 3300005843 | Ga0068860_100060789 | Ga0068860_1000607892 | 429 |
| 913 | 3300005844 | Ga0068862_100020156 | Ga0068862_1000201563 | 429 |
| 914 | 3300005844 | Ga0068862_100200403 | Ga0068862_1002004032 | 429 |
| 915 | 3300005983 | Ga0081540_1006707 | Ga0081540_10067074 | 429 |
| 916 | 3300005985 | Ga0081539_10006712 | Ga0081539_1000671216 | 429 |
| 917 | 3300006028 | Ga0070717_10000643 | Ga0070717_1000064321 | 429 |
| 918 | 3300006028 | Ga0070717_10074020 | Ga0070717_100740202 | 429 |
| 919 | 3300006028 | Ga0070717_10185058 | Ga0070717_101850582 | 429 |
| 920 | 3300006173 | Ga0070716_100004647 | Ga0070716_1000046472 | 429 |
| 921 | 3300006195 | Ga0075366_10033239 | Ga0075366_100332392 | 429 |
| 922 | 3300006358 | Ga0068871_100012612 | Ga0068871_1000126122 | 429 |
| 923 | 3300006844 | Ga0075428_100002012 | Ga0075428_10000201214 | 429 |
| 924 | 3300006852 | Ga0075433_10105330 | Ga0075433_101053303 | 429 |
| 925 | 3300006871 | Ga0075434_100057099 | Ga0075434_1000570993 | 429 |
| 926 | 3300006880 | Ga0075429_100025409 | Ga0075429_1000254093 | 429 |
| 927 | 3300006931 | Ga0097620_100020735 | Ga0097620_1000207353 | 429 |
| 928 | 3300006931 | Ga0097620_100191165 | Ga0097620_1001911653 | 429 |
| 929 | 3300006948 | Ga0099826_10000004 | Ga0099826_10000004233 | 429 |
| 930 | 3300007076 | Ga0075435_100062925 | Ga0075435_1000629252 | 429 |
| 931 | 3300007788 | Ga0099795_10032322 | Ga0099795_100323222 | 429 |
| 932 | 3300009011 | Ga0105251_10002207 | Ga0105251_100022075 | 429 |
| 933 | 3300009094 | Ga0111539_10035440 | Ga0111539_100354404 | 429 |
| 934 | 3300009147 | Ga0114129_10040105 | Ga0114129_100401054 | 429 |
| 935 | 3300009147 | Ga0114129_10055090 | Ga0114129_100550904 | 429 |
| 936 | 3300009148 | Ga0105243_10000106 | Ga0105243_100001067 | 429 |
| 937 | 3300009174 | Ga0105241_10015984 | Ga0105241_100159842 | 429 |
| 938 | 3300009174 | Ga0105241_10048375 | Ga0105241_100483752 | 429 |
| 939 | 3300009177 | Ga0105248_10003289 | Ga0105248_100032897 | 429 |
| 940 | 3300009545 | Ga0105237_10061430 | Ga0105237_100614302 | 429 |
| 941 | 3300009551 | Ga0105238_10000980 | Ga0105238_1000098014 | 429 |
| 942 | 3300009551 | Ga0105238_10287239 | Ga0105238_102872392 | 429 |
| 943 | 3300010375 | Ga0105239_10001049 | Ga0105239_1000104910 | 429 |
| 944 | 3300010375 | Ga0105239_10065751 | Ga0105239_100657512 | 429 |
| 945 | 3300013100 | Ga0157373_10000064 | Ga0157373_1000006431 | 429 |
| 946 | 3300013100 | Ga0157373_10069946 | Ga0157373_100699462 | 429 |
| 947 | 3300013102 | Ga0157371_10001420 | Ga0157371_1000142016 | 429 |
| 948 | 3300013105 | Ga0157369_10003853 | Ga0157369_100038533 | 429 |
| 949 | 3300013306 | Ga0163162_10017826 | Ga0163162_100178262 | 429 |
| 950 | 3300013306 | Ga0163162_10304973 | Ga0163162_103049732 | 429 |
| 951 | 3300013307 | Ga0157372_10058064 | Ga0157372_100580642 | 429 |
| 952 | 3300013308 | Ga0157375_10027352 | Ga0157375_100273525 | 429 |
| 953 | 3300014326 | Ga0157380_10078710 | Ga0157380_100787102 | 429 |
| 954 | 3300014745 | Ga0157377_10068217 | Ga0157377_100682171 | 429 |
| 955 | 3300021441 | Ga0213871_10015002 | Ga0213871_100150022 | 429 |
| 956 | 3300025233 | Ga0209437_100017 | Ga0209437_100017344 | 429 |
| 957 | 3300025263 | Ga0209565_1000021 | Ga0209565_1000021120 | 429 |
| 958 | 3300025273 | Ga0209673_1025730 | Ga0209673_10257302 | 429 |
| 959 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008396 | 429 |
| 960 | 3300025294 | Ga0209025_1000018 | Ga0209025_1000018232 | 429 |
| 961 | 3300025294 | Ga0209025_1000029 | Ga0209025_1000029401 | 429 |
| 962 | 3300025295 | Ga0209564_1000452 | Ga0209564_10004528 | 429 |
| 963 | 3300025297 | Ga0209758_1018729 | Ga0209758_10187293 | 429 |
| 964 | 3300025299 | Ga0209256_1001235 | Ga0209256_100123511 | 429 |
| 965 | 3300025735 | Ga0207713_1001516 | Ga0207713_10015166 | 429 |
| 966 | 3300025900 | Ga0207710_10001303 | Ga0207710_100013039 | 429 |
| 967 | 3300025903 | Ga0207680_10004104 | Ga0207680_100041046 | 429 |
| 968 | 3300025906 | Ga0207699_10019885 | Ga0207699_100198852 | 429 |
| 969 | 3300025910 | Ga0207684_10050199 | Ga0207684_100501992 | 429 |
| 970 | 3300025911 | Ga0207654_10025322 | Ga0207654_100253222 | 429 |
| 971 | 3300025912 | Ga0207707_10070443 | Ga0207707_100704431 | 429 |
| 972 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013668 | 429 |
| 973 | 3300025913 | Ga0207695_10003264 | Ga0207695_100032648 | 429 |
| 974 | 3300025914 | Ga0207671_10013327 | Ga0207671_100133273 | 429 |
| 975 | 3300025914 | Ga0207671_10128845 | Ga0207671_101288452 | 429 |
| 976 | 3300025915 | Ga0207693_10005142 | Ga0207693_100051425 | 429 |
| 977 | 3300025915 | Ga0207693_10041339 | Ga0207693_100413392 | 429 |
| 978 | 3300025915 | Ga0207693_10144071 | Ga0207693_101440712 | 429 |
| 979 | 3300025916 | Ga0207663_10160386 | Ga0207663_101603861 | 429 |
| 980 | 3300025917 | Ga0207660_10052743 | Ga0207660_100527431 | 429 |
| 981 | 3300025922 | Ga0207646_10007712 | Ga0207646_100077129 | 429 |
| 982 | 3300025922 | Ga0207646_10051439 | Ga0207646_100514393 | 429 |
| 983 | 3300025922 | Ga0207646_10140776 | Ga0207646_101407761 | 429 |
| 984 | 3300025922 | Ga0207646_10214928 | Ga0207646_102149281 | 429 |
| 985 | 3300025926 | Ga0207659_10260242 | Ga0207659_102602421 | 429 |
| 986 | 3300025927 | Ga0207687_10006965 | Ga0207687_100069652 | 429 |
| 987 | 3300025928 | Ga0207700_10016809 | Ga0207700_100168093 | 429 |
| 988 | 3300025929 | Ga0207664_10055962 | Ga0207664_100559622 | 429 |
| 989 | 3300025929 | Ga0207664_10064776 | Ga0207664_100647762 | 429 |
| 990 | 3300025931 | Ga0207644_10003326 | Ga0207644_100033265 | 429 |
| 991 | 3300025932 | Ga0207690_10020395 | Ga0207690_100203952 | 429 |
| 992 | 3300025933 | Ga0207706_10026104 | Ga0207706_100261043 | 429 |
| 993 | 3300025934 | Ga0207686_10005874 | Ga0207686_100058746 | 429 |
| 994 | 3300025935 | Ga0207709_10113678 | Ga0207709_101136782 | 429 |
| 995 | 3300025941 | Ga0207711_10001071 | Ga0207711_1000107114 | 429 |
| 996 | 3300025941 | Ga0207711_10012903 | Ga0207711_100129036 | 429 |
| 997 | 3300025941 | Ga0207711_10020061 | Ga0207711_100200613 | 429 |
| 998 | 3300025945 | Ga0207679_10044133 | Ga0207679_100441332 | 429 |
| 999 | 3300025960 | Ga0207651_10055124 | Ga0207651_100551242 | 429 |
| 1000 | 3300025972 | Ga0207668_10013857 | Ga0207668_100138573 | 429 |
| 1001 | 3300025986 | Ga0207658_10015729 | Ga0207658_100157292 | 429 |
| 1002 | 3300026035 | Ga0207703_10006798 | Ga0207703_100067988 | 429 |
| 1003 | 3300026067 | Ga0207678_10064848 | Ga0207678_100648482 | 429 |
| 1004 | 3300026078 | Ga0207702_10079134 | Ga0207702_100791342 | 429 |
| 1005 | 3300026078 | Ga0207702_10184944 | Ga0207702_101849441 | 429 |
| 1006 | 3300026088 | Ga0207641_10072572 | Ga0207641_100725722 | 429 |
| 1007 | 3300026095 | Ga0207676_10014002 | Ga0207676_100140025 | 429 |
| 1008 | 3300026118 | Ga0207675_100004866 | Ga0207675_1000048668 | 429 |
| 1009 | 3300026121 | Ga0207683_10010051 | Ga0207683_100100516 | 429 |
| 1010 | 3300027666 | Ga0209282_1000290 | Ga0209282_100029018 | 429 |
| 1011 | 3300027907 | Ga0207428_10001108 | Ga0207428_1000110818 | 429 |
| 1012 | 3300027907 | Ga0207428_10121168 | Ga0207428_101211682 | 429 |
| 1013 | 3300028379 | Ga0268266_10000070 | Ga0268266_10000070163 | 429 |
| 1014 | 3300028379 | Ga0268266_10002016 | Ga0268266_1000201613 | 429 |
| 1015 | 3300028380 | Ga0268265_10010915 | Ga0268265_100109154 | 429 |
| 1016 | 3300028380 | Ga0268265_10015675 | Ga0268265_100156752 | 429 |
| 1017 | 3300028381 | Ga0268264_10163497 | Ga0268264_101634971 | 429 |
| 1018 | 3300028794 | Ga0307515_10000734 | Ga0307515_1000073441 | 429 |
| 1019 | 3300028794 | Ga0307515_10048368 | Ga0307515_100483682 | 429 |
| 1020 | 3300031241 | Ga0265325_10031398 | Ga0265325_100313982 | 429 |
| 1021 | 3300031251 | Ga0265327_10000108 | Ga0265327_1000010839 | 429 |
| 1022 | 3300031665 | Ga0316575_10028247 | Ga0316575_100282472 | 429 |
| 1023 | 3300031824 | Ga0307413_10202401 | Ga0307413_102024011 | 429 |
| 1024 | 3300031911 | Ga0307412_10000009 | Ga0307412_10000009132 | 429 |
| 1025 | 3300032004 | Ga0307414_10000440 | Ga0307414_100004406 | 429 |
| 1026 | 3300035117 | Ga0373953_0010836 | Ga0373953_0010836_1457_2749 | 429 |
| 1027 | 3300035117 | Ga0373953_0028595 | Ga0373953_0028595_720_2129 | 429 |
| 1028 | 3300035170 | Ga0373943_0007851 | Ga0373943_0007851_1111_2520 | 429 |
| 1029 | 3300035171 | Ga0373946_0007584 | Ga0373946_0007584_2340_3749 | 429 |
| 1030 | 3300035172 | Ga0373955_0005439 | Ga0373955_0005439_1343_2752 | 429 |
| 1031 | 3300035695 | Ga0373927_0008962 | Ga0373927_0008962_5312_6691 | 429 |
| 1032 | 3300035724 | Ga0373933_0002035 | Ga0373933_0002035_2763_4055 | 429 |
| 1033 | 3300036401 | Ga0373937_0003772 | Ga0373937_0003772_1836_3128 | 429 |
| 1034 | 3300036401 | Ga0373937_0030178 | Ga0373937_0030178_2342_3634 | 429 |
| 1035 | 3300037068 | Ga0373925_0013932 | Ga0373925_0013932_2222_3631 | 429 |
| 1036 | 3300037418 | Ga0395900_0010459 | Ga0395900_0010459_5610_6917 | 429 |
| 1037 | 3300037466 | Ga0395898_0003614 | Ga0395898_0003614_9404_10711 | 429 |
| 1038 | 3300037471 | Ga0395905_0000160 | Ga0395905_0000160_94333_95634 | 429 |
| 1039 | 3300037471 | Ga0395905_0000312 | Ga0395905_0000312_23972_25279 | 429 |
| 1040 | 3300037471 | Ga0395905_0005282 | Ga0395905_0005282_11367_12674 | 429 |
| 1041 | 3300037471 | Ga0395905_0011507 | Ga0395905_0011507_239_1546 | 429 |
| 1042 | 3300037853 | Ga0436364_0191954 | Ga0436364_0191954_35735_37027 | 429 |
| 1043 | 3300037853 | Ga0436364_0623699 | Ga0436364_0623699_2040_3332 | 429 |
| 1044 | 3300037853 | Ga0436364_0881244 | Ga0436364_0881244_1561_2853 | 429 |
| 1045 | 3300038443 | Ga0395901_0006291 | Ga0395901_0006291_1151_2458 | 429 |
| 1046 | 3300039438 | Ga0436360_1267658 | Ga0436360_1267658_126_1418 | 429 |
| 1047 | 3300042001 | Ga0439441_010185 | Ga0439441_010185_251_1558 | 429 |
| 1048 | 3300046454 | Ga0495592_0034343 | Ga0495592_0034343_2212_3504 | 429 |
| 1049 | 3300046455 | Ga0495603_0023263 | Ga0495603_0023263_1550_2959 | 429 |
| 1050 | 3300046459 | Ga0495629_0058038 | Ga0495629_0058038_223_1602 | 429 |
| 1051 | 3300046462 | Ga0495651_0000347 | Ga0495651_0000347_1290_2582 | 429 |
| 1052 | 3300046462 | Ga0495651_0001419 | Ga0495651_0001419_7393_8733 | 429 |
| 1053 | 3300046463 | Ga0495653_0013957 | Ga0495653_0013957_4746_6038 | 429 |
| 1054 | 3300046474 | Ga0495605_0031950 | Ga0495605_0031950_608_1930 | 429 |
| 1055 | 3300046475 | Ga0495639_0005719 | Ga0495639_0005719_1775_3184 | 429 |
| 1056 | 3300046477 | Ga0495664_0055449 | Ga0495664_0055449_50_1342 | 429 |
| 1057 | 3300046492 | Ga0495585_0001030 | Ga0495585_0001030_15467_16876 | 429 |
| 1058 | 3300046499 | Ga0495594_0015379 | Ga0495594_0015379_1156_2565 | 429 |
| 1059 | 3300046500 | Ga0495596_0000024 | Ga0495596_0000024_43540_44862 | 429 |
| 1060 | 3300046501 | Ga0495607_0011382 | Ga0495607_0011382_3494_4816 | 429 |
| 1061 | 3300046511 | Ga0495608_0036267 | Ga0495608_0036267_567_1907 | 429 |
| 1062 | 3300046512 | Ga0495610_0000399 | Ga0495610_0000399_41445_42767 | 429 |
| 1063 | 3300046513 | Ga0495616_0001164 | Ga0495616_0001164_8319_9641 | 429 |
| 1064 | 3300046514 | Ga0495618_0017292 | Ga0495618_0017292_2218_3627 | 429 |
| 1065 | 3300046514 | Ga0495618_0058276 | Ga0495618_0058276_1143_2435 | 429 |
| 1066 | 3300046516 | Ga0495628_0000133 | Ga0495628_0000133_47981_49273 | 429 |
| 1067 | 3300046526 | Ga0495666_0002030 | Ga0495666_0002030_6196_7605 | 429 |
| 1068 | 3300046529 | Ga0495652_0017402 | Ga0495652_0017402_1390_2682 | 429 |
| 1069 | 3300046531 | Ga0495665_0004686 | Ga0495665_0004686_3364_4662 | 429 |
| 1070 | 3300046536 | Ga0495587_0000387 | Ga0495587_0000387_27616_28908 | 429 |
| 1071 | 3300046536 | Ga0495587_0003798 | Ga0495587_0003798_3991_5370 | 429 |
| 1072 | 3300046538 | Ga0495609_0002455 | Ga0495609_0002455_263_1585 | 429 |
| 1073 | 3300046542 | Ga0495597_0017128 | Ga0495597_0017128_1916_3238 | 429 |
| 1074 | 3300046543 | Ga0495645_0002303 | Ga0495645_0002303_7031_8362 | 429 |
| 1075 | 3300046558 | Ga0495633_0004113 | Ga0495633_0004113_1787_3196 | 429 |
| 1076 | 3300046559 | Ga0495667_0009304 | Ga0495667_0009304_4341_5633 | 429 |
| 1077 | 3300046559 | Ga0495667_0011473 | Ga0495667_0011473_4317_5609 | 429 |
| 1078 | 3300046559 | Ga0495667_0023899 | Ga0495667_0023899_1340_2680 | 429 |
| 1079 | 3300046642 | Ga0495634_0138578 | Ga0495634_0138578_212_1504 | 429 |
| 1080 | 3300046648 | Ga0495611_0007603 | Ga0495611_0007603_2863_4272 | 429 |
| 1081 | 3300046660 | Ga0495625_0010875 | Ga0495625_0010875_5035_6333 | 429 |
| 1082 | 3300046663 | Ga0495635_0008273 | Ga0495635_0008273_925_2217 | 429 |
| 1083 | 3300046664 | Ga0495659_0001555 | Ga0495659_0001555_495_1904 | 429 |
| 1084 | 3300046674 | Ga0495588_0010028 | Ga0495588_0010028_2482_3891 | 429 |
| 1085 | 3300046675 | Ga0495657_0001028 | Ga0495657_0001028_2234_3526 | 429 |
| 1086 | 3300046678 | Ga0495599_0010519 | Ga0495599_0010519_2779_4071 | 429 |
| 1087 | 3300046678 | Ga0495599_0055667 | Ga0495599_0055667_665_1996 | 429 |
| 1088 | 3300046690 | Ga0495624_0011107 | Ga0495624_0011107_2346_3755 | 429 |
| 1089 | 3300046692 | Ga0495671_0001099 | Ga0495671_0001099_2533_3855 | 429 |
| 1090 | 3300046794 | Ga0495589_0042126 | Ga0495589_0042126_529_1938 | 429 |
| 1091 | 3300046809 | Ga0495600_0039972 | Ga0495600_0039972_1230_2522 | 429 |
| 1092 | 3300047317 | Ga0495604_0007076 | Ga0495604_0007076_1057_2349 | 429 |
| 1093 | 3300047317 | Ga0495604_0029121 | Ga0495604_0029121_568_1908 | 429 |
| 1094 | 3300047319 | Ga0495674_0000732 | Ga0495674_0000732_28131_29423 | 429 |
| 1095 | 3300047319 | Ga0495674_0066199 | Ga0495674_0066199_1321_2652 | 429 |
| 1096 | 3300047320 | Ga0495672_0010948 | Ga0495672_0010948_1970_3292 | 429 |
| 1097 | 3300047320 | Ga0495672_0123707 | Ga0495672_0123707_44_1351 | 429 |
| 1098 | 3300047322 | Ga0495680_0029091 | Ga0495680_0029091_1236_2528 | 429 |
| 1099 | 3300047322 | Ga0495680_0032116 | Ga0495680_0032116_2844_4136 | 429 |
| 1100 | 3300047322 | Ga0495680_0054503 | Ga0495680_0054503_327_1667 | 429 |
| 1101 | 3300047444 | Ga0495675_0000200 | Ga0495675_0000200_29559_30851 | 429 |
| 1102 | 3300047471 | Ga0495684_0001073 | Ga0495684_0001073_19353_20693 | 429 |
| 1103 | 3300047471 | Ga0495684_0001328 | Ga0495684_0001328_956_2248 | 429 |
| 1104 | 3300047472 | Ga0495686_0011831 | Ga0495686_0011831_4439_5752 | 429 |
| 1105 | 3300048089 | Ga0495614_0003207 | Ga0495614_0003207_1112_2521 | 429 |
| 1106 | 3300048903 | Ga0496100_0077569 | Ga0496100_0077569_411_1718 | 429 |
| 1107 | 3300048904 | Ga0496101_0095338 | Ga0496101_0095338_487_1794 | 429 |
| 1108 | 3300048907 | Ga0496104_0002943 | Ga0496104_0002943_397_1704 | 429 |
| 1109 | 3300048908 | Ga0496105_0020488 | Ga0496105_0020488_3706_5013 | 429 |
| 1110 | 3300048909 | Ga0496106_0015311 | Ga0496106_0015311_3113_4420 | 429 |
| 1111 | 3300048910 | Ga0496107_0019213 | Ga0496107_0019213_3090_4397 | 429 |
| 1112 | 3300048911 | Ga0496108_0043531 | Ga0496108_0043531_1964_3271 | 429 |
| 1113 | 3300048912 | Ga0496109_0013194 | Ga0496109_0013194_2128_3435 | 429 |
| 1114 | 3300048913 | Ga0496110_0014024 | Ga0496110_0014024_3082_4389 | 429 |
| 1115 | 3300048913 | Ga0496110_0034472 | Ga0496110_0034472_1724_3031 | 429 |
| 1116 | 3300048914 | Ga0496111_0002323 | Ga0496111_0002323_8854_10161 | 429 |
| 1117 | 3300048915 | Ga0496112_0007606 | Ga0496112_0007606_607_1914 | 429 |
| 1118 | 3300048915 | Ga0496112_0072427 | Ga0496112_0072427_841_2133 | 429 |
| 1119 | 3300048916 | Ga0496113_0015597 | Ga0496113_0015597_3543_4850 | 429 |
| 1120 | 3300048919 | Ga0496116_0002711 | Ga0496116_0002711_16300_17622 | 429 |
| 1121 | 3300048919 | Ga0496116_0053591 | Ga0496116_0053591_637_1950 | 429 |
| 1122 | 3300048924 | Ga0496121_0007804 | Ga0496121_0007804_3537_4856 | 429 |
| 1123 | 3300048924 | Ga0496121_0009668 | Ga0496121_0009668_7165_8487 | 429 |
| 1124 | 3300048925 | Ga0496122_0000963 | Ga0496122_0000963_9276_10598 | 429 |
| 1125 | 3300048925 | Ga0496122_0001032 | Ga0496122_0001032_45565_46881 | 429 |
| 1126 | 3300048926 | Ga0496123_0000608 | Ga0496123_0000608_17692_19014 | 429 |
| 1127 | 3300048926 | Ga0496123_0000806 | Ga0496123_0000806_45401_46717 | 429 |
| 1128 | 3300048928 | Ga0496125_0005258 | Ga0496125_0005258_4437_5732 | 429 |
| 1129 | 3300048928 | Ga0496125_0084236 | Ga0496125_0084236_830_2152 | 429 |
| 1130 | 3300048929 | Ga0496126_0000612 | Ga0496126_0000612_52122_53519 | 429 |
| 1131 | 3300048929 | Ga0496126_0104849 | Ga0496126_0104849_210_1532 | 429 |
| 1132 | 3300049571 | Ga0501034_0249591 | Ga0501034_0249591_136_1449 | 429 |
| 1133 | 3300050491 | nmdc:mga00v17_527_c1 | nmdc:mga00v17_527_c1_15602_16921 | 429 |
| 1134 | 3300050493 | nmdc:mga0k408_155_c2 | nmdc:mga0k408_155_c2_13214_14509 | 429 |
| 1135 | 3300050507 | nmdc:mga05p37_19658_c1 | nmdc:mga05p37_19658_c1_5017_6324 | 429 |
| 1136 | 3300050507 | nmdc:mga05p37_213844_c1 | nmdc:mga05p37_213844_c1_866_2185 | 429 |
| 1137 | 3300050511 | nmdc:mga08y16_16965_c1 | nmdc:mga08y16_16965_c1_5095_6402 | 429 |
| 1138 | 3300050511 | nmdc:mga08y16_30808_c1 | nmdc:mga08y16_30808_c1_3195_4490 | 429 |
| 1139 | 3300050511 | nmdc:mga08y16_72164_c1 | nmdc:mga08y16_72164_c1_1408_2718 | 429 |
| 1140 | 3300050512 | nmdc:mga0n895_172665_c1 | nmdc:mga0n895_172665_c1_446_1753 | 429 |
| 1141 | 3300050512 | nmdc:mga0n895_65468_c1 | nmdc:mga0n895_65468_c1_1228_2541 | 429 |
| 1142 | 3300050514 | nmdc:mga08x19_13632_c1 | nmdc:mga08x19_13632_c1_1286_2578 | 429 |
| 1143 | 3300053078 | Ga0495612_0005030 | Ga0495612_0005030_1452_2792 | 429 |
| 1144 | 3300053084 | Ga0495595_0002115 | Ga0495595_0002115_5709_7049 | 429 |
| 1145 | 3300053085 | Ga0495619_0046064 | Ga0495619_0046064_1273_2565 | 429 |
| 1146 | 3300053085 | Ga0495619_0133506 | Ga0495619_0133506_311_1603 | 429 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vld-assembly1.cif.gz_A | crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidine and nad+ | 0.9446 | 18 | 423 |
| 5vlc-assembly2.cif.gz_D | crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol | 0.9386 | 18 | 423 |
| 5vlc-assembly3.cif.gz_E | crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol | 0.9343 | 18 | 424 |
| 1vh6-assembly1.cif.gz_B | crystal structure of a flagellar protein | 0.9326 | 389 | 427 |
| 4g09-assembly1.cif.gz_A-2 | the crystal structure of the c366s mutant of hdh from brucella suis in complex with a substituted benzyl ketone | 0.9324 | 21 | 429 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNW9_250_396_3.40.50.1980 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9742 | 225 | 370 | 3.40.50.1980 |
| 4gicB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9718 | 226 | 341 | 3.40.50.1980 |
| af_Q2FUT8_220_366_3.40.50.1980 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9714 | 225 | 370 | 3.40.50.1980 |
| 4g07A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9657 | 226 | 370 | 3.40.50.1980 |
| 1k75B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9639 | 227 | 369 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349SFH3-F1-model_v4 | Histidinol dehydrogenase | 0.9892 | 1 | 370 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A349SFH3-F1-model_v4 | Histidinol dehydrogenase | 0.9865 | 1 | 370 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A5N5PHA1-F1-model_v4 | histidinol dehydrogenase (EC 1.1.1.23) | 0.9837 | 135 | 424 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A257KSF9-F1-model_v4 | Histidinol dehydrogenase | 0.982 | 41 | 424 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
| AF-A0A7C7HN34-F1-model_v4 | Histidinol dehydrogenase (EC 1.1.1.23) | 0.9817 | 243 | 424 |
GO:0000105
GO:0004399 GO:0005829 GO:0046872 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar