F490794

General Info

Members Datasets Scaffolds Average Seq Length
1146 542 1060 429

Family's Representative Sequence

Representative Sequence 3300025228|Ga0209672_100025|Ga0209672_100025308
Length 470
Sequence MRNCVGKFGPRKFARVIELVRIVHRRNAGFALHGRETLLEIFVIQHLKKSKPMEAQLEIAKQVRDTVEQIIADVAANGDAAVREYSMRFDKWNPASFRLTDAEISACVATLSERELDDIKFAQQQVRRFALAQKDALRDVEVETLPGVVLGHRNIPVNSVGCYIPGGKYPLLASAHMSVLTAKVAGVKRVVAVAPPFDGKPHPAIVTAMHLAGADEIYCVGGVQAIAALALGTDQFEPVDMIVGPGNAYVAEAKRQLFGKIGIDLIAGPTETLVIADDSSDVEIVAADLLGQAEHGVNSPVVFLTNSARLADGLPAEIERQLAVLPTAAVASVAWRDYGEIILCDTVDEMVEEADRIASEHVQVMTRDPLYFLEHMTNYGALFLGDRTNVSYGDKVIGTNHTLPTTKAARYTGGLWVGKFIKTCTYQRVLTDEASAMLGEYCSRLCAMEGFAGHKEQADIRVRRFGKRAD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231008 Pseudomonas sp. GM21 Isolate Nodule
3 2511231012 Pseudomonas sp. GM33 Isolate Nodule
4 2511231015 Pseudomonas sp. GM49 Isolate Nodule
5 2511231021 Pseudomonas sp. GM78 Isolate Nodule
6 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
9 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
10 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
11 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
12 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
13 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
14 2643221629 Devosia sp. Root105 Isolate Unclassified
15 2643221662 Devosia sp. Root413D1 Isolate Unclassified
16 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
17 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
18 2687453737 Frankia sp. BMG5.36 Isolate Nodule
19 2765235841 Pseudomonas putida AA7 Isolate Unclassified
20 2773857670 Pseudomonas sp. 478 Isolate Unclassified
21 2784132072 Pseudomonas sp. 460 Isolate Unclassified
22 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
23 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
26 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
27 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
28 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
29 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
30 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
31 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
32 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
33 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
34 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
35 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
36 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
37 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
38 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
39 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
40 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
41 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
42 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
43 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
44 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
45 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
46 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
47 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
48 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
49 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
50 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
51 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
52 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
53 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
54 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
55 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
56 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
57 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
58 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
59 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
60 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
61 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
62 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
63 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
64 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
65 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
66 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
67 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
68 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
69 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
70 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
71 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
72 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
73 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
74 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
75 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
76 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
77 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
78 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
79 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
80 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
81 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
82 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
83 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
84 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
85 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
86 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
87 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
88 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
91 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
94 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
95 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
96 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
97 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
98 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
99 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
100 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
101 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
104 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
105 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
106 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
107 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
108 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
109 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
110 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
111 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
116 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
117 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
118 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
119 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
122 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
123 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
124 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
125 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
126 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
127 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
128 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
129 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
130 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
131 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
132 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
135 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
136 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
137 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
141 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
142 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
143 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
144 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
145 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
148 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
149 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
150 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
151 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
152 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
153 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
154 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
155 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
158 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
159 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
160 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
161 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
162 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
163 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
164 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
165 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
166 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
167 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
168 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
169 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
170 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
171 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
172 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
173 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
174 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
175 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
176 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
178 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
179 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
180 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
181 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
182 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
183 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
184 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
186 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
187 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
188 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
189 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
190 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
191 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
192 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
193 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
194 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
195 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
196 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
197 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
198 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
199 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
200 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
201 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
202 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
203 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
204 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
205 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
206 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
207 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
208 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
209 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
210 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
211 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
212 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
213 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
214 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
215 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
216 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
217 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
220 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
223 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
228 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
230 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
233 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
287 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
292 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
293 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
294 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
295 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
296 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
298 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
299 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
303 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
304 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
305 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
306 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
307 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
308 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
309 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
310 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
311 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
312 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
313 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
314 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
315 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
316 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
317 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
318 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
319 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
320 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
321 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
322 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
323 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
324 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
325 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
326 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
327 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
328 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
329 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
330 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
331 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
332 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
333 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
334 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
335 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
336 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
337 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
338 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
339 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
340 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
341 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
342 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
343 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
344 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
345 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
346 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
352 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
353 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
354 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
355 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
356 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
357 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
358 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
359 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
360 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
361 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
362 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
363 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
364 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
365 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
366 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
367 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
368 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
369 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
370 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
373 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
374 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
375 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
376 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
377 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
378 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
379 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
380 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
381 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
382 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
383 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
384 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
385 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
386 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
387 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
388 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
389 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
390 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
391 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
392 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
393 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
394 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
395 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
398 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
399 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
400 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
401 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
402 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
403 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
404 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
405 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
406 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
407 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
408 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
409 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
410 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
411 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
412 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
413 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
414 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
415 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
416 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
417 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
418 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
419 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
420 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
421 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
422 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
423 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
424 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
425 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
426 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
427 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
428 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
429 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
430 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
431 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
434 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
435 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
436 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
437 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
438 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
439 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
440 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
441 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
442 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
443 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
444 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
445 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
446 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
447 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
448 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
449 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
450 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
451 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
452 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
453 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
454 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
455 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
456 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
457 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
458 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
459 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
460 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
461 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
462 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
463 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
464 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
465 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
466 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
467 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
468 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
469 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
470 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
471 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
472 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
473 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
474 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
475 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
476 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
477 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
478 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
479 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
480 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
481 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
482 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
483 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
484 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
485 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
486 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
487 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
488 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
489 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
490 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
491 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
492 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
493 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
494 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
495 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
496 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
506 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
507 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
508 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
509 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
510 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
511 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
512 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
513 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
514 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
515 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
516 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
517 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
518 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
521 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
522 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
523 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
524 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
525 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
526 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
527 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
528 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
529 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
530 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
531 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
532 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
533 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
534 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
537 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
538 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
539 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
540 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
541 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
542 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 0.09
Isolates 7.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.84
Nodule 4.54
Rhizoplane 7.33
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1664813 2162886007 Bacteria 51394
2 ARcpr5oldR_c000037 3300000041 Bacteria 26008
3 ARcpr5yngRDRAFT_c000014 3300000043 Bacteria 31433
4 ARSoilOldRDRAFT_c000005 3300000044 Bacteria 61735
5 ARCol0yngRDRAFT_1000099 3300000652 Bacteria 16028
6 JGI24737J22298_10003080 3300001990 Bacteria 5906
7 JGI25156J39149_1001315 3300002705 Bacteria 10757
8 JGI25162J39368_1000011 3300002737 Bacteria 379156
9 JGI25151J46595_10000019 3300003187 Bacteria 236340
10 JGI25151J46595_10001080 3300003187 Bacteria 20266
11 rootL2_10152113 3300003322 Bacteria 1570
12 Ga0055532_1000249 3300003758 Bacteria 38537
13 Ga0055527_1000207 3300003760 Bacteria 38453
14 Ga0055535_1000052 3300003761 Bacteria 132513
15 Ga0055535_1000437 3300003761 Bacteria 38537
16 Ga0055542_1000457 3300003762 Bacteria 38537
17 Ga0055529_1000239 3300003763 Bacteria 68765
18 Ga0055529_1000395 3300003763 Bacteria 46388
19 Ga0055537_1001658 3300003773 Bacteria 8310
20 Ga0055536_1000524 3300003781 Bacteria 26496
21 Ga0055530_10004363 3300003791 Bacteria 7333
22 Ga0055530_10008875 3300003791 Bacteria 3957
23 Ga0055540_1000054 3300003792 Bacteria 142505
24 Ga0055531_10000037 3300003794 Bacteria 144244
25 Ga0065714_10065580 3300005288 Bacteria 9295
26 Ga0065704_10000208 3300005289 Bacteria 101850
27 Ga0065712_10074695 3300005290 Bacteria 4031
28 Ga0065707_10169157 3300005295 Bacteria 1498
29 Ga0070676_10145783 3300005328 Unclassified 1511
30 Ga0070683_100066175 3300005329 Bacteria 3366
31 Ga0070683_100233527 3300005329 Bacteria 1748
32 Ga0070666_10006171 3300005335 Bacteria 7371
33 Ga0070680_100008502 3300005336 Bacteria 7862
34 Ga0070680_100019478 3300005336 Bacteria 5376
35 Ga0070682_100019858 3300005337 Bacteria 3946
36 Ga0070682_100051802 3300005337 Bacteria 2567
37 Ga0070682_100099984 3300005337 Bacteria 1913
38 Ga0068868_100122270 3300005338 Unclassified 2124
39 Ga0070660_100035891 3300005339 Bacteria 3753
40 Ga0070689_100039107 3300005340 Bacteria 3631
41 Ga0070689_100146936 3300005340 Bacteria 1899
42 Ga0070661_100080147 3300005344 Bacteria 2409
43 Ga0070661_100132427 3300005344 Bacteria 1874
44 Ga0070692_10040657 3300005345 Bacteria 2379
45 Ga0070668_100077272 3300005347 Bacteria 2602
46 Ga0070668_100101014 3300005347 Bacteria 2285
47 Ga0070668_100159462 3300005347 Bacteria 1830
48 Ga0070669_100003120 3300005353 Bacteria 11928
49 Ga0070675_100014385 3300005354 Bacteria 6240
50 Ga0070671_100006278 3300005355 Bacteria 9471
51 Ga0070674_100119544 3300005356 Bacteria 1949
52 Ga0070674_100135465 3300005356 Bacteria 1841
53 Ga0070673_100104548 3300005364 Bacteria 2338
54 Ga0070673_100300593 3300005364 Bacteria 1413
55 Ga0070688_100009296 3300005365 Bacteria 5369
56 Ga0070667_100041355 3300005367 Bacteria 3867
57 Ga0070709_10005000 3300005434 Bacteria 7160
58 Ga0070714_100018509 3300005435 Bacteria 5660
59 Ga0070714_100031780 3300005435 Bacteria 4406
60 Ga0070701_10018964 3300005438 Bacteria 3242
61 Ga0070705_100011668 3300005440 Bacteria 4441
62 Ga0070700_100039252 3300005441 Bacteria 2891
63 Ga0070708_100089217 3300005445 Bacteria 2805
64 Ga0070708_100129160 3300005445 Bacteria 2338
65 Ga0070663_100102357 3300005455 Bacteria 2139
66 Ga0070663_100135042 3300005455 Bacteria 1878
67 Ga0070662_100034622 3300005457 Bacteria 3563
68 Ga0070662_100132035 3300005457 Bacteria 1926
69 Ga0070681_10031256 3300005458 Bacteria 5344
70 Ga0070681_10075350 3300005458 Bacteria 3334
71 Ga0068867_100077272 3300005459 Bacteria 2501
72 Ga0070685_10039064 3300005466 Bacteria 2695
73 Ga0070707_100038824 3300005468 Bacteria 4549
74 Ga0070707_100108705 3300005468 Bacteria 2690
75 Ga0070707_100260423 3300005468 Bacteria 1687
76 Ga0070698_100000484 3300005471 Bacteria 42229
77 Ga0070698_100175054 3300005471 Bacteria 2085
78 Ga0070699_100009192 3300005518 Bacteria 8569
79 Ga0070699_100079622 3300005518 Bacteria 2854
80 Ga0070699_100272913 3300005518 Bacteria 1514
81 Ga0070679_100038534 3300005530 Bacteria 4752
82 Ga0070679_100056647 3300005530 Bacteria 3905
83 Ga0070684_100060876 3300005535 Bacteria 3303
84 Ga0070684_100090907 3300005535 Bacteria 2715
85 Ga0070697_100017134 3300005536 Bacteria 5699
86 Ga0070686_100004150 3300005544 Bacteria 7972
87 Ga0070686_100015298 3300005544 Bacteria 4440
88 Ga0070686_100075541 3300005544 Bacteria 2217
89 Ga0070695_100007796 3300005545 Bacteria 6343
90 Ga0070695_100062465 3300005545 Bacteria 2419
91 Ga0070693_100018861 3300005547 Bacteria 3609
92 Ga0070665_100000052 3300005548 Bacteria 245694
93 Ga0070665_100006016 3300005548 Bacteria 12404
94 Ga0070704_100155599 3300005549 Bacteria 1802
95 Ga0070704_100183339 3300005549 Bacteria 1676
96 Ga0068855_100003325 3300005563 Bacteria 19675
97 Ga0068855_100189121 3300005563 Bacteria 2323
98 Ga0070664_100264754 3300005564 Bacteria 1547
99 Ga0068857_100002263 3300005577 Bacteria 15653
100 Ga0068854_100003405 3300005578 Bacteria 9911
101 Ga0068856_100123520 3300005614 Bacteria 2591
102 Ga0068856_100228329 3300005614 Bacteria 1877
103 Ga0068856_100229555 3300005614 Bacteria 1871
104 Ga0068856_100238857 3300005614 Bacteria 1832
105 Ga0068852_100002286 3300005616 Bacteria 13174
106 Ga0068859_100020736 3300005617 Bacteria 6595
107 Ga0068859_100050191 3300005617 Bacteria 4191
108 Ga0068859_100191161 3300005617 Bacteria 2131
109 Ga0068864_100015042 3300005618 Bacteria 6431
110 Ga0068866_10001011 3300005718 Bacteria 12363
111 Ga0068861_100027831 3300005719 Bacteria 4121
112 Ga0068851_10023722 3300005834 Bacteria 3000
113 Ga0068863_100086154 3300005841 Bacteria 2976
114 Ga0068858_100286665 3300005842 Bacteria 1569
115 Ga0068860_100015244 3300005843 Bacteria 7507
116 Ga0068860_100060789 3300005843 Bacteria 3590
117 Ga0068860_100063199 3300005843 Bacteria 3517
118 Ga0068862_100020156 3300005844 Bacteria 5569
119 Ga0068862_100200403 3300005844 Bacteria 1799
120 Ga0081538_10007210 3300005981 Bacteria 9653
121 Ga0081540_1006707 3300005983 Bacteria 8324
122 Ga0081539_10006712 3300005985 Bacteria 10849
123 Ga0081539_10071117 3300005985 Bacteria 1865
124 Ga0070717_10000643 3300006028 Bacteria 22445
125 Ga0070717_10002130 3300006028 Bacteria 13875
126 Ga0070717_10016626 3300006028 Bacteria 5708
127 Ga0070717_10074020 3300006028 Bacteria 2847
128 Ga0070717_10185058 3300006028 Bacteria 1817
129 Ga0075432_10000834 3300006058 Bacteria 9666
130 Ga0075432_10005043 3300006058 Bacteria 4495
131 Ga0070716_100004647 3300006173 Bacteria 6580
132 Ga0075366_10033239 3300006195 Unclassified 3038
133 Ga0097621_100034759 3300006237 Bacteria 4022
134 Ga0068871_100012612 3300006358 Bacteria 6240
135 Ga0075428_100002012 3300006844 Bacteria 21927
136 Ga0075428_100006970 3300006844 Bacteria 12535
137 Ga0075428_100058917 3300006844 Bacteria 4205
138 Ga0075433_10105330 3300006852 Bacteria 2499
139 Ga0075434_100003524 3300006871 Bacteria 13977
140 Ga0075434_100057099 3300006871 Bacteria 3880
141 Ga0075429_100004649 3300006880 Bacteria 11807
142 Ga0075429_100025409 3300006880 Bacteria 5140
143 Ga0068865_100147416 3300006881 Bacteria 1781
144 Ga0075436_100005727 3300006914 Bacteria 8536
145 Ga0097620_100020735 3300006931 Bacteria 6595
146 Ga0097620_100050189 3300006931 Bacteria 4191
147 Ga0097620_100191165 3300006931 Bacteria 2131
148 Ga0099826_10000004 3300006948 Bacteria 802669
149 Ga0075435_100062925 3300007076 Bacteria 3012
150 Ga0099795_10032322 3300007788 Bacteria 1809
151 Ga0105251_10001687 3300009011 Bacteria 18559
152 Ga0105251_10002207 3300009011 Bacteria 15558
153 Ga0105251_10002240 3300009011 Bacteria 15414
154 Ga0105244_10000345 3300009036 Bacteria 43661
155 Ga0105250_10000221 3300009092 Bacteria 47509
156 Ga0105240_10015342 3300009093 Bacteria 10420
157 Ga0105240_10071601 3300009093 Bacteria 4287
158 Ga0105240_10099949 3300009093 Bacteria 3530
159 Ga0105240_10377453 3300009093 Bacteria 1602
160 Ga0105240_10525843 3300009093 Bacteria 1312
161 Ga0111539_10001696 3300009094 Bacteria 29343
162 Ga0111539_10035440 3300009094 Bacteria 6041
163 Ga0105245_10342855 3300009098 Bacteria 1478
164 Ga0114129_10040105 3300009147 Bacteria 6602
165 Ga0114129_10055090 3300009147 Bacteria 5574
166 Ga0105243_10000106 3300009148 Bacteria 95432
167 Ga0105243_10008728 3300009148 Bacteria 7768
168 Ga0105243_10026218 3300009148 Bacteria 4461
169 Ga0105243_10055460 3300009148 Bacteria 3149
170 Ga0105241_10015984 3300009174 Bacteria 5499
171 Ga0105241_10048375 3300009174 Bacteria 3236
172 Ga0105242_10038782 3300009176 Bacteria 3833
173 Ga0105242_10040216 3300009176 Bacteria 3767
174 Ga0105242_10051662 3300009176 Bacteria 3351
175 Ga0105248_10003289 3300009177 Bacteria 17935
176 Ga0105248_10030891 3300009177 Bacteria 5984
177 Ga0105248_10109102 3300009177 Bacteria 3120
178 Ga0105237_10061430 3300009545 Bacteria 3757
179 Ga0105238_10000980 3300009551 Bacteria 29183
180 Ga0105238_10081230 3300009551 Bacteria 3231
181 Ga0105238_10196612 3300009551 Bacteria 1992
182 Ga0105238_10287239 3300009551 Bacteria 1627
183 Ga0105249_10099006 3300009553 Bacteria 2740
184 Ga0105239_10001049 3300010375 Bacteria 38505
185 Ga0105239_10059456 3300010375 Bacteria 4195
186 Ga0105239_10065751 3300010375 Bacteria 3983
187 Ga0105246_10081362 3300011119 Bacteria 2308
188 Ga0105246_10106436 3300011119 Bacteria 2052
189 Ga0157373_10000064 3300013100 Bacteria 94176
190 Ga0157373_10069946 3300013100 Bacteria 2480
191 Ga0157371_10001420 3300013102 Bacteria 24898
192 Ga0157371_10102296 3300013102 Bacteria 2033
193 Ga0157370_10002043 3300013104 Bacteria 24786
194 Ga0157370_10019032 3300013104 Bacteria 6903
195 Ga0157369_10003853 3300013105 Bacteria 17827
196 Ga0157374_10001916 3300013296 Bacteria 17440
197 Ga0157378_10006718 3300013297 Bacteria 10049
198 Ga0157378_10044269 3300013297 Bacteria 3953
199 Ga0163162_10017826 3300013306 Bacteria 6947
200 Ga0163162_10304973 3300013306 Unclassified 1725
201 Ga0157372_10000305 3300013307 Bacteria 54763
202 Ga0157372_10049397 3300013307 Bacteria 4678
203 Ga0157372_10058064 3300013307 Unclassified 4325
204 Ga0157372_10263098 3300013307 Bacteria 2003
205 Ga0157375_10014341 3300013308 Bacteria 7067
206 Ga0157375_10027352 3300013308 Bacteria 5330
207 Ga0157375_10325809 3300013308 Bacteria 1701
208 Ga0163163_10037843 3300014325 Bacteria 4695
209 Ga0163163_10062965 3300014325 Bacteria 3677
210 Ga0157380_10058688 3300014326 Bacteria 3068
211 Ga0157380_10078710 3300014326 Unclassified 2690
212 Ga0157380_10087627 3300014326 Bacteria 2560
213 Ga0182008_10000813 3300014497 Bacteria 21786
214 Ga0157377_10068217 3300014745 Bacteria 2049
215 Ga0157379_10086758 3300014968 Bacteria 2806
216 Ga0182006_1000562 3300015261 Bacteria 27817
217 Ga0182006_1003241 3300015261 Bacteria 8442
218 Ga0182006_1009535 3300015261 Bacteria 4347
219 Ga0182007_10000152 3300015262 Bacteria 46887
220 Ga0182005_1000181 3300015265 Bacteria 43402
221 Ga0182005_1000857 3300015265 Bacteria 13521
222 Ga0182005_1005618 3300015265 Bacteria 3903
223 Ga0213874_10005916 3300021377 Bacteria 2870
224 Ga0213876_10112985 3300021384 Bacteria 1441
225 Ga0213875_10000271 3300021388 Bacteria 51315
226 Ga0213875_10058761 3300021388 Bacteria 1800
227 Ga0213871_10015002 3300021441 Bacteria 1846
228 Ga0209672_100025 3300025228 Bacteria 350006
229 Ga0209147_100032 3300025229 Bacteria 350006
230 Ga0209437_100017 3300025233 Bacteria 694471
231 Ga0209258_100050 3300025242 Bacteria 350006
232 Ga0209258_100074 3300025242 Bacteria 271062
233 Ga0209148_1000060 3300025254 Bacteria 350006
234 Ga0209148_1002491 3300025254 Bacteria 6243
235 Ga0209759_1000123 3300025256 Bacteria 137819
236 Ga0209759_1007857 3300025256 Bacteria 3378
237 Ga0209565_1000021 3300025263 Bacteria 406281
238 Ga0209455_1000055 3300025272 Bacteria 350006
239 Ga0209455_1000066 3300025272 Bacteria 316811
240 Ga0209673_1025730 3300025273 Bacteria 1950
241 Ga0209676_1000105 3300025292 Bacteria 224151
242 Ga0209676_1002918 3300025292 Bacteria 11180
243 Ga0209025_1000008 3300025294 Bacteria 1130876
244 Ga0209025_1000018 3300025294 Bacteria 686898
245 Ga0209025_1000029 3300025294 Bacteria 488571
246 Ga0209564_1000452 3300025295 Bacteria 69505
247 Ga0209758_1018729 3300025297 Bacteria 3377
248 Ga0209050_1001242 3300025298 Bacteria 29500
249 Ga0209050_1001283 3300025298 Bacteria 28639
250 Ga0209256_1001235 3300025299 Bacteria 28367
251 Ga0207426_1000345 3300025302 Bacteria 85840
252 Ga0209051_1000064 3300025303 Bacteria 231735
253 Ga0209257_1000109 3300025304 Bacteria 239439
254 Ga0207696_1000349 3300025711 Bacteria 47521
255 Ga0207655_1002880 3300025728 Bacteria 13283
256 Ga0207713_1001485 3300025735 Bacteria 18548
257 Ga0207713_1001516 3300025735 Bacteria 18323
258 Ga0207713_1010220 3300025735 Bacteria 5211
259 Ga0207710_10001303 3300025900 Bacteria 12616
260 Ga0207710_10073733 3300025900 Bacteria 1570
261 Ga0207680_10004104 3300025903 Bacteria 6890
262 Ga0207647_10033715 3300025904 Bacteria 3275
263 Ga0207699_10019885 3300025906 Bacteria 3590
264 Ga0207684_10050199 3300025910 Bacteria 3539
265 Ga0207654_10025322 3300025911 Bacteria 3199
266 Ga0207654_10053538 3300025911 Bacteria 2330
267 Ga0207707_10003517 3300025912 Bacteria 13869
268 Ga0207707_10070443 3300025912 Bacteria 3047
269 Ga0207695_10000013 3300025913 Bacteria 821265
270 Ga0207695_10003264 3300025913 Bacteria 23061
271 Ga0207695_10095188 3300025913 Bacteria 2983
272 Ga0207695_10146268 3300025913 Bacteria 2307
273 Ga0207671_10013327 3300025914 Bacteria 6554
274 Ga0207671_10128845 3300025914 Bacteria 1941
275 Ga0207693_10005142 3300025915 Bacteria 10960
276 Ga0207693_10041339 3300025915 Bacteria 3629
277 Ga0207693_10144071 3300025915 Bacteria 1873
278 Ga0207663_10123804 3300025916 Bacteria 1775
279 Ga0207663_10160386 3300025916 Bacteria 1587
280 Ga0207660_10052743 3300025917 Bacteria 2896
281 Ga0207662_10000171 3300025918 Bacteria 30909
282 Ga0207662_10093455 3300025918 Bacteria 1853
283 Ga0207657_10035391 3300025919 Bacteria 4478
284 Ga0207652_10148747 3300025921 Bacteria 2096
285 Ga0207646_10007712 3300025922 Bacteria 10895
286 Ga0207646_10036647 3300025922 Bacteria 4426
287 Ga0207646_10051439 3300025922 Bacteria 3686
288 Ga0207646_10140776 3300025922 Bacteria 2172
289 Ga0207646_10214928 3300025922 Bacteria 1736
290 Ga0207659_10045953 3300025926 Bacteria 3081
291 Ga0207659_10260242 3300025926 Unclassified 1411
292 Ga0207687_10006965 3300025927 Bacteria 7450
293 Ga0207687_10097740 3300025927 Bacteria 2154
294 Ga0207700_10016809 3300025928 Bacteria 4871
295 Ga0207700_10091916 3300025928 Bacteria 2398
296 Ga0207700_10108110 3300025928 Bacteria 2233
297 Ga0207664_10055962 3300025929 Bacteria 3131
298 Ga0207664_10064776 3300025929 Bacteria 2924
299 Ga0207644_10003326 3300025931 Bacteria 10373
300 Ga0207644_10110972 3300025931 Bacteria 2074
301 Ga0207690_10020395 3300025932 Bacteria 4095
302 Ga0207706_10016073 3300025933 Bacteria 6764
303 Ga0207706_10026104 3300025933 Bacteria 5229
304 Ga0207686_10005874 3300025934 Bacteria 6586
305 Ga0207686_10009011 3300025934 Bacteria 5402
306 Ga0207709_10113678 3300025935 Bacteria 1815
307 Ga0207704_10052906 3300025938 Bacteria 2464
308 Ga0207704_10065272 3300025938 Bacteria 2278
309 Ga0207691_10008491 3300025940 Bacteria 9865
310 Ga0207691_10026254 3300025940 Bacteria 5466
311 Ga0207711_10001071 3300025941 Bacteria 26139
312 Ga0207711_10012903 3300025941 Bacteria 6939
313 Ga0207711_10020061 3300025941 Bacteria 5571
314 Ga0207689_10001391 3300025942 Bacteria 23137
315 Ga0207689_10028039 3300025942 Bacteria 4711
316 Ga0207689_10128941 3300025942 Bacteria 2081
317 Ga0207679_10044133 3300025945 Bacteria 3215
318 Ga0207667_10000968 3300025949 Bacteria 36617
319 Ga0207651_10055124 3300025960 Bacteria 2728
320 Ga0207651_10286558 3300025960 Bacteria 1364
321 Ga0207668_10013857 3300025972 Bacteria 4979
322 Ga0207640_10036117 3300025981 Bacteria 3099
323 Ga0207658_10015729 3300025986 Bacteria 5194
324 Ga0207703_10006798 3300026035 Bacteria 9117
325 Ga0207678_10044253 3300026067 Bacteria 3851
326 Ga0207678_10064848 3300026067 Bacteria 3138
327 Ga0207678_10188047 3300026067 Bacteria 1764
328 Ga0207708_10003464 3300026075 Bacteria 11631
329 Ga0207708_10006349 3300026075 Bacteria 8761
330 Ga0207702_10079134 3300026078 Bacteria 2848
331 Ga0207702_10184944 3300026078 Bacteria 1921
332 Ga0207641_10072572 3300026088 Bacteria 2964
333 Ga0207648_10002207 3300026089 Bacteria 21115
334 Ga0207648_10018847 3300026089 Bacteria 6237
335 Ga0207676_10014002 3300026095 Bacteria 5758
336 Ga0207676_10107019 3300026095 Bacteria 2331
337 Ga0207674_10000629 3300026116 Bacteria 46056
338 Ga0207674_10073309 3300026116 Bacteria 3437
339 Ga0207675_100001449 3300026118 Bacteria 23775
340 Ga0207675_100004866 3300026118 Bacteria 12942
341 Ga0207675_100008588 3300026118 Bacteria 9607
342 Ga0207683_10010051 3300026121 Bacteria 8075
343 Ga0207698_10047152 3300026142 Bacteria 3261
344 Ga0210000_1004378 3300027462 Bacteria 2042
345 Ga0209968_1009597 3300027526 Bacteria 1482
346 Ga0209282_1000290 3300027666 Bacteria 24803
347 Ga0207428_10001108 3300027907 Bacteria 29314
348 Ga0207428_10014412 3300027907 Bacteria 6870
349 Ga0207428_10028695 3300027907 Bacteria 4620
350 Ga0207428_10121168 3300027907 Unclassified 2005
351 Ga0268266_10000070 3300028379 Bacteria 235423
352 Ga0268266_10002016 3300028379 Bacteria 22644
353 Ga0268265_10010915 3300028380 Bacteria 6135
354 Ga0268265_10015675 3300028380 Bacteria 5191
355 Ga0268265_10042398 3300028380 Bacteria 3377
356 Ga0268264_10062188 3300028381 Bacteria 3134
357 Ga0268264_10163497 3300028381 Bacteria 2007
358 Ga0265336_10000029 3300028666 Bacteria 178897
359 Ga0307517_10003354 3300028786 Bacteria 24920
360 Ga0307515_10000378 3300028794 Bacteria 108916
361 Ga0307515_10000734 3300028794 Bacteria 75701
362 Ga0307515_10048368 3300028794 Bacteria 6431
363 Ga0265338_10009351 3300028800 Bacteria 11710
364 Ga0265338_10042081 3300028800 Bacteria 4261
365 Ga0265324_10000372 3300029957 Bacteria 32416
366 Ga0265760_10020075 3300031090 Bacteria 1927
367 Ga0265325_10031398 3300031241 Bacteria 2843
368 Ga0265340_10056728 3300031247 Bacteria 1883
369 Ga0265327_10000108 3300031251 Bacteria 183209
370 Ga0307513_10016290 3300031456 Bacteria 8972
371 Ga0307513_10070494 3300031456 Bacteria 3653
372 Ga0307408_100232538 3300031548 Bacteria 1510
373 Ga0307514_10000827 3300031649 Bacteria 50048
374 Ga0316575_10028247 3300031665 Bacteria 2187
375 Ga0316576_10232137 3300031727 Bacteria 1387
376 Ga0307405_10000100 3300031731 Bacteria 35488
377 Ga0307413_10102439 3300031824 Bacteria 1895
378 Ga0307413_10202401 3300031824 Bacteria 1435
379 Ga0307410_10156890 3300031852 Bacteria 1701
380 Ga0307407_10037805 3300031903 Bacteria 2670
381 Ga0307412_10000009 3300031911 Bacteria 445987
382 Ga0307412_10000323 3300031911 Bacteria 30222
383 Ga0307409_100037524 3300031995 Bacteria 3573
384 Ga0307416_100166651 3300032002 Bacteria 2044
385 Ga0307414_10000440 3300032004 Bacteria 22028
386 Ga0307414_10185375 3300032004 Bacteria 1678
387 Ga0307411_10020413 3300032005 Bacteria 3853
388 Ga0307411_10103951 3300032005 Bacteria 2016
389 Ga0307415_100137738 3300032126 Bacteria 1859
390 Ga0307510_10068787 3300033180 Bacteria 3551
391 Ga0373930_0000713 3300034816 Bacteria 4686
392 Ga0373958_0000992 3300034819 Bacteria 3699
393 Ga0373959_0000111 3300034820 Bacteria 18330
394 Ga0373938_0000386 3300034957 Bacteria 7080
395 Ga0373928_0000045 3300035084 Bacteria 21176
396 Ga0373929_0010706 3300035085 Bacteria 1718
397 Ga0373940_0007169 3300035088 Bacteria 2504
398 Ga0373944_0009265 3300035089 Bacteria 2667
399 Ga0373944_0011427 3300035089 Bacteria 2433
400 Ga0373949_0003496 3300035090 Bacteria 3722
401 Ga0373949_0004030 3300035090 Bacteria 3407
402 Ga0373951_0000335 3300035091 Bacteria 14582
403 Ga0373952_0000179 3300035092 Bacteria 9804
404 Ga0373952_0020885 3300035092 Bacteria 1377
405 Ga0373923_0000978 3300035111 Bacteria 7693
406 Ga0373923_0004485 3300035111 Bacteria 4637
407 Ga0373932_0000271 3300035112 Bacteria 15633
408 Ga0373932_0010265 3300035112 Bacteria 2264
409 Ga0373936_0002402 3300035113 Bacteria 7011
410 Ga0373939_0001296 3300035114 Bacteria 6082
411 Ga0373939_0006400 3300035114 Bacteria 2836
412 Ga0373941_0024709 3300035115 Bacteria 1728
413 Ga0373945_0020517 3300035116 Bacteria 2262
414 Ga0373953_0004302 3300035117 Bacteria 4527
415 Ga0373953_0008474 3300035117 Bacteria 3494
416 Ga0373953_0010836 3300035117 Bacteria 3184
417 Ga0373953_0028595 3300035117 Bacteria 2151
418 Ga0373954_0000707 3300035118 Bacteria 12831
419 Ga0373943_0007851 3300035170 Bacteria 4791
420 Ga0373946_0007584 3300035171 Bacteria 3970
421 Ga0373955_0001092 3300035172 Bacteria 11522
422 Ga0373955_0005439 3300035172 Bacteria 5722
423 Ga0373955_0086564 3300035172 Bacteria 1780
424 Ga0373961_0000592 3300035241 Bacteria 13503
425 Ga0373962_0000848 3300035242 Bacteria 6984
426 Ga0373962_0026107 3300035242 Bacteria 1572
427 Ga0373924_0018420 3300035410 Bacteria 2690
428 Ga0373924_0035685 3300035410 Bacteria 2017
429 Ga0373931_0004514 3300035691 Bacteria 6366
430 Ga0373931_0064214 3300035691 Bacteria 1986
431 Ga0373931_0073717 3300035691 Bacteria 1869
432 Ga0373931_0092016 3300035691 Bacteria 1691
433 Ga0373935_0000377 3300035692 Bacteria 22883
434 Ga0373935_0003956 3300035692 Bacteria 8651
435 Ga0373927_0008962 3300035695 Bacteria 6718
436 Ga0373927_0021648 3300035695 Bacteria 4214
437 Ga0373927_0033526 3300035695 Bacteria 3343
438 Ga0373933_0002035 3300035724 Bacteria 11627
439 Ga0373933_0002410 3300035724 Bacteria 10543
440 Ga0373947_0000280 3300035725 Bacteria 28900
441 Ga0373947_0047961 3300035725 Bacteria 2561
442 Ga0373937_0001849 3300036401 Bacteria 17776
443 Ga0373937_0003772 3300036401 Bacteria 12811
444 Ga0373937_0030178 3300036401 Bacteria 4911
445 Ga0373937_0031620 3300036401 Bacteria 4797
446 Ga0373925_0000075 3300037068 Bacteria 105395
447 Ga0373925_0001434 3300037068 Bacteria 20657
448 Ga0373925_0013932 3300037068 Bacteria 5820
449 Ga0373925_0028128 3300037068 Bacteria 4118
450 Ga0395900_0010459 3300037418 Bacteria 9488
451 Ga0395900_0096654 3300037418 Bacteria 3035
452 Ga0395898_0003614 3300037466 Bacteria 17214
453 Ga0395898_0208029 3300037466 Bacteria 1867
454 Ga0395905_0000160 3300037471 Bacteria 111265
455 Ga0395905_0000312 3300037471 Bacteria 70621
456 Ga0395905_0005282 3300037471 Bacteria 13207
457 Ga0395905_0011507 3300037471 Bacteria 8549
458 Ga0395905_0036400 3300037471 Bacteria 4622
459 Ga0436364_0140072 3300037853 Bacteria 2167
460 Ga0436364_0191954 3300037853 Bacteria 66423
461 Ga0436364_0623699 3300037853 Bacteria 7969
462 Ga0436364_0881244 3300037853 Bacteria 28600
463 Ga0436364_1510300 3300037853 Bacteria 30483
464 Ga0395901_0006291 3300038443 Bacteria 12027
465 Ga0436365_0313432 3300039437 Bacteria 3021
466 Ga0436365_1386178 3300039437 Bacteria 5179
467 Ga0436365_1644591 3300039437 Bacteria 5160
468 Ga0436360_1211585 3300039438 Bacteria 1830
469 Ga0436360_1267658 3300039438 Bacteria 1803
470 Ga0436363_0568637 3300039450 Bacteria 7962
471 Ga0436362_0755809 3300039453 Bacteria 1863
472 Ga0439465_0003630 3300041413 Bacteria 5032
473 Ga0439441_010185 3300042001 Bacteria 1571
474 Ga0450923_013215 3300042125 Bacteria 1515
475 Ga0450907_006652 3300042146 Bacteria 1931
476 Ga0439435_0007814 3300042436 Bacteria 2463
477 Ga0439460_0000006 3300042461 Bacteria 38075
478 Ga0451577_0024385 3300042876 Bacteria 5503
479 Ga0466969_0003234 3300044656 Bacteria 8666
480 Ga0466972_0021056 3300044658 Bacteria 3255
481 Ga0466966_0022455 3300044684 Bacteria 4140
482 Ga0466961_0000259 3300044693 Bacteria 35409
483 Ga0466968_0021887 3300044735 Bacteria 2592
484 Ga0466957_0038538 3300044842 Bacteria 2880
485 Ga0451576_0006479 3300045051 Bacteria 14344
486 Ga0466967_0008760 3300045976 Bacteria 7453
487 Ga0466967_0015127 3300045976 Bacteria 6040
488 Ga0495617_000254 3300046452 Bacteria 31339
489 Ga0495617_023056 3300046452 Bacteria 2103
490 Ga0495627_004049 3300046453 Bacteria 6247
491 Ga0495627_006396 3300046453 Bacteria 4620
492 Ga0495592_0000060 3300046454 Bacteria 100113
493 Ga0495592_0005925 3300046454 Bacteria 9075
494 Ga0495592_0034343 3300046454 Bacteria 3823
495 Ga0495603_0004025 3300046455 Bacteria 8751
496 Ga0495603_0004739 3300046455 Bacteria 8122
497 Ga0495603_0023263 3300046455 Bacteria 3751
498 Ga0495603_0028911 3300046455 Bacteria 3344
499 Ga0495590_0000100 3300046457 Bacteria 52320
500 Ga0495591_000008 3300046458 Bacteria 353558
501 Ga0495591_000981 3300046458 Bacteria 19446
502 Ga0495629_0000139 3300046459 Bacteria 63649
503 Ga0495629_0001903 3300046459 Bacteria 16256
504 Ga0495629_0058038 3300046459 Bacteria 2705
505 Ga0495629_0114205 3300046459 Bacteria 1882
506 Ga0495638_0000125 3300046460 Bacteria 125288
507 Ga0495638_0000827 3300046460 Bacteria 32493
508 Ga0495638_0000830 3300046460 Bacteria 32408
509 Ga0495638_0078656 3300046460 Bacteria 2006
510 Ga0495641_0015170 3300046461 Bacteria 4131
511 Ga0495651_0000181 3300046462 Bacteria 46803
512 Ga0495651_0000347 3300046462 Bacteria 35746
513 Ga0495651_0000971 3300046462 Bacteria 22205
514 Ga0495651_0001419 3300046462 Bacteria 18593
515 Ga0495651_0004794 3300046462 Bacteria 10354
516 Ga0495651_0059889 3300046462 Bacteria 2918
517 Ga0495653_0000442 3300046463 Bacteria 32578
518 Ga0495653_0000740 3300046463 Bacteria 24927
519 Ga0495653_0001990 3300046463 Bacteria 16063
520 Ga0495653_0007581 3300046463 Bacteria 8872
521 Ga0495653_0013957 3300046463 Bacteria 6551
522 Ga0495653_0085474 3300046463 Bacteria 2320
523 Ga0495653_0130937 3300046463 Bacteria 1776
524 Ga0495650_0000101 3300046471 Bacteria 212903
525 Ga0495650_0000793 3300046471 Bacteria 38715
526 Ga0495650_0023178 3300046471 Bacteria 2959
527 Ga0495580_0002473 3300046472 Bacteria 16117
528 Ga0495580_0013053 3300046472 Bacteria 6358
529 Ga0495582_0001586 3300046473 Bacteria 12828
530 Ga0495582_0036443 3300046473 Bacteria 2706
531 Ga0495582_0036839 3300046473 Bacteria 2691
532 Ga0495605_0000002 3300046474 Bacteria 522417
533 Ga0495605_0000170 3300046474 Bacteria 82318
534 Ga0495605_0001103 3300046474 Bacteria 17970
535 Ga0495605_0001149 3300046474 Bacteria 17565
536 Ga0495605_0001490 3300046474 Bacteria 15289
537 Ga0495605_0007792 3300046474 Bacteria 6068
538 Ga0495605_0031950 3300046474 Bacteria 2684
539 Ga0495605_0045784 3300046474 Bacteria 2154
540 Ga0495639_0005719 3300046475 Bacteria 5349
541 Ga0495639_0025290 3300046475 Bacteria 2618
542 Ga0495662_0001139 3300046476 Bacteria 13118
543 Ga0495662_0044168 3300046476 Bacteria 2151
544 Ga0495664_0000003 3300046477 Bacteria 551602
545 Ga0495664_0032446 3300046477 Bacteria 3064
546 Ga0495664_0055449 3300046477 Bacteria 2358
547 Ga0495584_0000012 3300046491 Bacteria 189225
548 Ga0495584_0000332 3300046491 Bacteria 32909
549 Ga0495584_0008448 3300046491 Bacteria 5334
550 Ga0495585_0000056 3300046492 Bacteria 113739
551 Ga0495585_0000105 3300046492 Bacteria 89432
552 Ga0495585_0001030 3300046492 Bacteria 23180
553 Ga0495585_0023883 3300046492 Bacteria 3507
554 Ga0495594_0002129 3300046499 Bacteria 10306
555 Ga0495594_0009963 3300046499 Bacteria 4920
556 Ga0495594_0015379 3300046499 Bacteria 4019
557 Ga0495594_0054388 3300046499 Bacteria 2206
558 Ga0495596_0000024 3300046500 Bacteria 108222
559 Ga0495596_0000161 3300046500 Bacteria 46832
560 Ga0495596_0010487 3300046500 Bacteria 4032
561 Ga0495607_0000194 3300046501 Bacteria 64377
562 Ga0495607_0002405 3300046501 Bacteria 15273
563 Ga0495607_0003246 3300046501 Bacteria 12529
564 Ga0495607_0008052 3300046501 Bacteria 7237
565 Ga0495607_0011382 3300046501 Bacteria 5924
566 Ga0495607_0025635 3300046501 Bacteria 3665
567 Ga0495607_0063589 3300046501 Bacteria 2087
568 Ga0495607_0079125 3300046501 Bacteria 1811
569 Ga0495583_0000012 3300046506 Bacteria 324839
570 Ga0495583_0000354 3300046506 Bacteria 72235
571 Ga0495583_0000715 3300046506 Bacteria 42513
572 Ga0495583_0000875 3300046506 Bacteria 36501
573 Ga0495583_0011078 3300046506 Bacteria 5197
574 Ga0495606_0000354 3300046507 Bacteria 78470
575 Ga0495606_0020057 3300046507 Bacteria 4943
576 Ga0495606_0053092 3300046507 Bacteria 2631
577 Ga0495606_0065969 3300046507 Bacteria 2298
578 Ga0495608_0000011 3300046511 Bacteria 248514
579 Ga0495608_0020720 3300046511 Bacteria 4517
580 Ga0495608_0036267 3300046511 Bacteria 3320
581 Ga0495610_0000399 3300046512 Bacteria 45092
582 Ga0495610_0001011 3300046512 Bacteria 25894
583 Ga0495610_0002250 3300046512 Bacteria 16324
584 Ga0495610_0014593 3300046512 Bacteria 4606
585 Ga0495610_0093855 3300046512 Bacteria 1355
586 Ga0495616_0000455 3300046513 Bacteria 31233
587 Ga0495616_0001164 3300046513 Bacteria 18609
588 Ga0495616_0001464 3300046513 Bacteria 16385
589 Ga0495616_0003793 3300046513 Bacteria 9637
590 Ga0495616_0006071 3300046513 Bacteria 7360
591 Ga0495616_0006725 3300046513 Bacteria 6934
592 Ga0495616_0037377 3300046513 Bacteria 2498
593 Ga0495618_0000044 3300046514 Bacteria 95526
594 Ga0495618_0017292 3300046514 Bacteria 4419
595 Ga0495618_0058276 3300046514 Bacteria 2446
596 Ga0495618_0087980 3300046514 Bacteria 1987
597 Ga0495620_0000010 3300046515 Bacteria 173604
598 Ga0495620_0000367 3300046515 Bacteria 31046
599 Ga0495620_0002382 3300046515 Bacteria 10897
600 Ga0495620_0002511 3300046515 Bacteria 10633
601 Ga0495628_0000001 3300046516 Bacteria 917742
602 Ga0495628_0000133 3300046516 Bacteria 63350
603 Ga0495628_0015643 3300046516 Bacteria 6334
604 Ga0495628_0107478 3300046516 Bacteria 2148
605 Ga0495630_0000574 3300046517 Bacteria 26824
606 Ga0495630_0001474 3300046517 Bacteria 16277
607 Ga0495630_0011656 3300046517 Bacteria 6370
608 Ga0495630_0021901 3300046517 Bacteria 4720
609 Ga0495631_0018055 3300046518 Bacteria 3325
610 Ga0495631_0021492 3300046518 Bacteria 3005
611 Ga0495632_0000298 3300046519 Bacteria 48057
612 Ga0495632_0001005 3300046519 Bacteria 24459
613 Ga0495632_0001671 3300046519 Bacteria 18178
614 Ga0495632_0004399 3300046519 Bacteria 9577
615 Ga0495632_0023482 3300046519 Bacteria 3293
616 Ga0495637_0014377 3300046520 Bacteria 3734
617 Ga0495637_0031287 3300046520 Bacteria 2355
618 Ga0495643_0000849 3300046522 Bacteria 32986
619 Ga0495643_0001779 3300046522 Bacteria 18477
620 Ga0495643_0008509 3300046522 Bacteria 6487
621 Ga0495643_0009432 3300046522 Bacteria 6067
622 Ga0495644_0000089 3300046523 Bacteria 45629
623 Ga0495644_0000122 3300046523 Bacteria 36964
624 Ga0495644_0004763 3300046523 Bacteria 5329
625 Ga0495644_0020303 3300046523 Bacteria 2535
626 Ga0495648_0000471 3300046524 Bacteria 43369
627 Ga0495648_0000779 3300046524 Bacteria 33991
628 Ga0495648_0002321 3300046524 Bacteria 17712
629 Ga0495648_0004234 3300046524 Bacteria 12314
630 Ga0495648_0012924 3300046524 Bacteria 6200
631 Ga0495648_0029882 3300046524 Bacteria 3611
632 Ga0495648_0064997 3300046524 Bacteria 2147
633 Ga0495666_0002030 3300046526 Bacteria 10010
634 Ga0495666_0031579 3300046526 Bacteria 2594
635 Ga0495642_0000015 3300046528 Bacteria 121192
636 Ga0495652_0000002 3300046529 Bacteria 946606
637 Ga0495652_0017402 3300046529 Bacteria 6414
638 Ga0495652_0032084 3300046529 Bacteria 4595
639 Ga0495652_0061574 3300046529 Bacteria 3167
640 Ga0495652_0209455 3300046529 Bacteria 1473
641 Ga0495654_0000333 3300046530 Bacteria 41443
642 Ga0495654_0000780 3300046530 Bacteria 24559
643 Ga0495654_0001049 3300046530 Bacteria 20229
644 Ga0495654_0011507 3300046530 Bacteria 4784
645 Ga0495654_0039974 3300046530 Bacteria 2339
646 Ga0495665_0000217 3300046531 Bacteria 29018
647 Ga0495665_0004686 3300046531 Bacteria 7373
648 Ga0495640_0000002 3300046533 Bacteria 646434
649 Ga0495640_0000544 3300046533 Bacteria 27687
650 Ga0495640_0035698 3300046533 Bacteria 3518
651 Ga0495586_0004363 3300046535 Bacteria 7563
652 Ga0495586_0006035 3300046535 Bacteria 6477
653 Ga0495586_0037010 3300046535 Bacteria 2620
654 Ga0495587_0000001 3300046536 Bacteria 724132
655 Ga0495587_0000387 3300046536 Bacteria 31427
656 Ga0495587_0000458 3300046536 Bacteria 28539
657 Ga0495587_0000606 3300046536 Bacteria 24416
658 Ga0495587_0003798 3300046536 Bacteria 10023
659 Ga0495609_0000008 3300046538 Bacteria 383025
660 Ga0495609_0000016 3300046538 Bacteria 312882
661 Ga0495609_0000026 3300046538 Bacteria 251973
662 Ga0495609_0002455 3300046538 Bacteria 11400
663 Ga0495609_0025539 3300046538 Bacteria 2708
664 Ga0495597_0002701 3300046542 Bacteria 10948
665 Ga0495597_0003192 3300046542 Bacteria 9775
666 Ga0495597_0017128 3300046542 Bacteria 3415
667 Ga0495597_0022648 3300046542 Bacteria 2912
668 Ga0495597_0024152 3300046542 Bacteria 2807
669 Ga0495645_0000002 3300046543 Bacteria 651644
670 Ga0495645_0002303 3300046543 Bacteria 12969
671 Ga0495645_0021849 3300046543 Bacteria 4626
672 Ga0495622_0001383 3300046557 Bacteria 12371
673 Ga0495622_0001895 3300046557 Bacteria 10293
674 Ga0495633_0000009 3300046558 Bacteria 293183
675 Ga0495633_0004113 3300046558 Bacteria 9379
676 Ga0495667_0000039 3300046559 Bacteria 131308
677 Ga0495667_0008755 3300046559 Bacteria 6878
678 Ga0495667_0009304 3300046559 Bacteria 6661
679 Ga0495667_0011473 3300046559 Bacteria 5999
680 Ga0495667_0023899 3300046559 Bacteria 4116
681 Ga0495667_0119386 3300046559 Bacteria 1703
682 Ga0495656_0002001 3300046615 Bacteria 6713
683 Ga0495656_0013793 3300046615 Bacteria 3014
684 Ga0495668_0001168 3300046616 Bacteria 26730
685 Ga0495668_0035276 3300046616 Bacteria 2803
686 Ga0495634_0000010 3300046642 Bacteria 143792
687 Ga0495634_0138578 3300046642 Bacteria 1546
688 Ga0495611_0003046 3300046648 Bacteria 7465
689 Ga0495611_0007603 3300046648 Bacteria 4598
690 Ga0495611_0055828 3300046648 Bacteria 1787
691 Ga0495625_0000012 3300046660 Bacteria 363006
692 Ga0495625_0001308 3300046660 Bacteria 31077
693 Ga0495625_0002329 3300046660 Bacteria 20762
694 Ga0495625_0006644 3300046660 Bacteria 10264
695 Ga0495625_0010875 3300046660 Bacteria 7479
696 Ga0495625_0030346 3300046660 Bacteria 4035
697 Ga0495625_0088501 3300046660 Bacteria 2145
698 Ga0495635_0000001 3300046663 Bacteria 704901
699 Ga0495635_0000159 3300046663 Bacteria 41596
700 Ga0495635_0008273 3300046663 Bacteria 7258
701 Ga0495635_0024486 3300046663 Bacteria 4207
702 Ga0495635_0137614 3300046663 Bacteria 1664
703 Ga0495659_0001555 3300046664 Bacteria 7730
704 Ga0495661_0000029 3300046665 Bacteria 173899
705 Ga0495661_0000043 3300046665 Bacteria 149067
706 Ga0495661_0000152 3300046665 Bacteria 81192
707 Ga0495661_0000850 3300046665 Bacteria 28430
708 Ga0495661_0032511 3300046665 Bacteria 3297
709 Ga0495588_0001377 3300046674 Bacteria 10379
710 Ga0495588_0005052 3300046674 Bacteria 5858
711 Ga0495588_0010028 3300046674 Bacteria 4391
712 Ga0495588_0033132 3300046674 Bacteria 2608
713 Ga0495588_0035338 3300046674 Bacteria 2532
714 Ga0495588_0050625 3300046674 Bacteria 2137
715 Ga0495657_0000042 3300046675 Bacteria 114669
716 Ga0495657_0001028 3300046675 Bacteria 24494
717 Ga0495657_0001942 3300046675 Bacteria 17644
718 Ga0495599_0000013 3300046678 Bacteria 179828
719 Ga0495599_0010519 3300046678 Bacteria 5661
720 Ga0495599_0010539 3300046678 Bacteria 5656
721 Ga0495599_0055667 3300046678 Bacteria 2476
722 Ga0495599_0070773 3300046678 Bacteria 2177
723 Ga0495623_0000050 3300046679 Bacteria 72959
724 Ga0495623_0016199 3300046679 Bacteria 4815
725 Ga0495646_0000009 3300046680 Bacteria 200698
726 Ga0495646_0000197 3300046680 Bacteria 30139
727 Ga0495646_0010033 3300046680 Bacteria 6021
728 Ga0495647_0006801 3300046681 Bacteria 3807
729 Ga0495658_0000065 3300046683 Bacteria 52835
730 Ga0495658_0003618 3300046683 Bacteria 7651
731 Ga0495669_0006270 3300046684 Bacteria 4965
732 Ga0495613_0000403 3300046689 Bacteria 37100
733 Ga0495613_0006292 3300046689 Bacteria 8882
734 Ga0495624_0000130 3300046690 Bacteria 53133
735 Ga0495624_0011107 3300046690 Bacteria 6196
736 Ga0495624_0029667 3300046690 Bacteria 3567
737 Ga0495624_0043247 3300046690 Bacteria 2874
738 Ga0495671_0000410 3300046692 Bacteria 34465
739 Ga0495671_0001099 3300046692 Bacteria 18677
740 Ga0495671_0001111 3300046692 Bacteria 18606
741 Ga0495671_0002075 3300046692 Bacteria 12853
742 Ga0495671_0005269 3300046692 Bacteria 7593
743 Ga0495671_0041177 3300046692 Bacteria 2327
744 Ga0495671_0051736 3300046692 Bacteria 2042
745 Ga0495671_0053015 3300046692 Bacteria 2014
746 Ga0495649_0001219 3300046694 Bacteria 19807
747 Ga0495649_0006023 3300046694 Bacteria 7586
748 Ga0495649_0009751 3300046694 Bacteria 5687
749 Ga0495649_0011341 3300046694 Bacteria 5232
750 Ga0495649_0029987 3300046694 Bacteria 3005
751 Ga0495649_0045548 3300046694 Bacteria 2391
752 Ga0495589_0000101 3300046794 Bacteria 82583
753 Ga0495589_0000251 3300046794 Bacteria 43879
754 Ga0495589_0001783 3300046794 Bacteria 12244
755 Ga0495589_0001792 3300046794 Bacteria 12217
756 Ga0495589_0004826 3300046794 Bacteria 7164
757 Ga0495589_0042126 3300046794 Bacteria 2276
758 Ga0495600_0000209 3300046809 Bacteria 33688
759 Ga0495600_0000561 3300046809 Bacteria 19318
760 Ga0495600_0013607 3300046809 Bacteria 5117
761 Ga0495600_0039972 3300046809 Bacteria 3054
762 Ga0495600_0184861 3300046809 Bacteria 1342
763 Ga0495660_0000151 3300046810 Bacteria 74982
764 Ga0495660_0000276 3300046810 Bacteria 48147
765 Ga0495660_0000561 3300046810 Bacteria 30321
766 Ga0495660_0000926 3300046810 Bacteria 21613
767 Ga0495660_0001106 3300046810 Bacteria 19273
768 Ga0495660_0001193 3300046810 Bacteria 18236
769 Ga0495660_0015344 3300046810 Bacteria 4426
770 Ga0495581_0007122 3300047315 Bacteria 6478
771 Ga0495581_0020331 3300047315 Bacteria 3854
772 Ga0495581_0045174 3300047315 Bacteria 2547
773 Ga0495604_0000069 3300047317 Bacteria 89935
774 Ga0495604_0007076 3300047317 Bacteria 8897
775 Ga0495604_0027675 3300047317 Bacteria 4507
776 Ga0495604_0029121 3300047317 Bacteria 4394
777 Ga0495674_0000002 3300047319 Bacteria 642785
778 Ga0495674_0000732 3300047319 Bacteria 30989
779 Ga0495674_0003006 3300047319 Bacteria 16427
780 Ga0495674_0042484 3300047319 Bacteria 4055
781 Ga0495674_0053964 3300047319 Bacteria 3531
782 Ga0495674_0066199 3300047319 Bacteria 3136
783 Ga0495674_0069865 3300047319 Bacteria 3036
784 Ga0495674_0070948 3300047319 Bacteria 3009
785 Ga0495672_0000671 3300047320 Bacteria 37991
786 Ga0495672_0000828 3300047320 Bacteria 33069
787 Ga0495672_0000860 3300047320 Bacteria 32038
788 Ga0495672_0004493 3300047320 Bacteria 11407
789 Ga0495672_0010948 3300047320 Bacteria 6431
790 Ga0495672_0123707 3300047320 Bacteria 1371
791 Ga0495676_0000001 3300047321 Bacteria 624167
792 Ga0495676_0006417 3300047321 Bacteria 10834
793 Ga0495676_0179997 3300047321 Bacteria 1482
794 Ga0495680_0000036 3300047322 Bacteria 103310
795 Ga0495680_0000079 3300047322 Bacteria 86013
796 Ga0495680_0000328 3300047322 Bacteria 53287
797 Ga0495680_0001052 3300047322 Bacteria 30524
798 Ga0495680_0002410 3300047322 Bacteria 19153
799 Ga0495680_0014348 3300047322 Bacteria 6867
800 Ga0495680_0029091 3300047322 Bacteria 4527
801 Ga0495680_0032116 3300047322 Bacteria 4266
802 Ga0495680_0036061 3300047322 Bacteria 3975
803 Ga0495680_0054503 3300047322 Bacteria 3104
804 Ga0495680_0085468 3300047322 Bacteria 2375
805 Ga0495683_0000022 3300047323 Bacteria 163268
806 Ga0495683_0000042 3300047323 Bacteria 137528
807 Ga0495683_0000300 3300047323 Bacteria 42071
808 Ga0495683_0012140 3300047323 Bacteria 4527
809 Ga0495687_000037 3300047443 Bacteria 252363
810 Ga0495675_0000200 3300047444 Bacteria 43734
811 Ga0495675_0000245 3300047444 Bacteria 39142
812 Ga0495675_0000527 3300047444 Bacteria 24798
813 Ga0495675_0019046 3300047444 Bacteria 4359
814 Ga0495677_0000014 3300047445 Bacteria 136236
815 Ga0495677_0001369 3300047445 Bacteria 9750
816 Ga0495679_000042 3300047446 Bacteria 143151
817 Ga0495679_000060 3300047446 Bacteria 109240
818 Ga0495673_0000142 3300047469 Bacteria 128538
819 Ga0495673_0000824 3300047469 Bacteria 29082
820 Ga0495673_0000849 3300047469 Bacteria 28392
821 Ga0495673_0001705 3300047469 Bacteria 16832
822 Ga0495673_0004583 3300047469 Bacteria 8611
823 Ga0495673_0017928 3300047469 Bacteria 3581
824 Ga0495681_0001555 3300047470 Bacteria 17121
825 Ga0495681_0001678 3300047470 Bacteria 16420
826 Ga0495681_0003122 3300047470 Bacteria 11623
827 Ga0495681_0012199 3300047470 Bacteria 5063
828 Ga0495684_0000016 3300047471 Bacteria 169338
829 Ga0495684_0001073 3300047471 Bacteria 22129
830 Ga0495684_0001328 3300047471 Bacteria 19903
831 Ga0495684_0001824 3300047471 Bacteria 17119
832 Ga0495684_0004613 3300047471 Bacteria 10756
833 Ga0495684_0095899 3300047471 Bacteria 2245
834 Ga0495684_0177015 3300047471 Bacteria 1583
835 Ga0495686_0001995 3300047472 Bacteria 20251
836 Ga0495686_0011831 3300047472 Bacteria 6137
837 Ga0495686_0037241 3300047472 Bacteria 3117
838 Ga0495593_0001060 3300047673 Bacteria 16072
839 Ga0495593_0001500 3300047673 Bacteria 13713
840 Ga0495593_0001523 3300047673 Bacteria 13634
841 Ga0495593_0018915 3300047673 Bacteria 3865
842 Ga0495593_0062137 3300047673 Bacteria 1952
843 Ga0495602_0000024 3300048088 Bacteria 151162
844 Ga0495602_0003267 3300048088 Bacteria 16748
845 Ga0495614_0003207 3300048089 Bacteria 7303
846 Ga0495626_0000002 3300048091 Bacteria 436012
847 Ga0495626_0000049 3300048091 Bacteria 161052
848 Ga0495626_0000243 3300048091 Bacteria 63145
849 Ga0495626_0000289 3300048091 Bacteria 54458
850 Ga0496100_0002405 3300048903 Bacteria 9481
851 Ga0496100_0003748 3300048903 Bacteria 7959
852 Ga0496100_0020498 3300048903 Bacteria 3964
853 Ga0496100_0077569 3300048903 Bacteria 2234
854 Ga0496100_0100760 3300048903 Bacteria 1990
855 Ga0496101_0001763 3300048904 Bacteria 12984
856 Ga0496101_0002134 3300048904 Bacteria 12066
857 Ga0496101_0005234 3300048904 Bacteria 8254
858 Ga0496101_0049568 3300048904 Bacteria 3021
859 Ga0496101_0095338 3300048904 Bacteria 2219
860 Ga0496102_0000130 3300048905 Bacteria 104052
861 Ga0496102_0005532 3300048905 Bacteria 10730
862 Ga0496102_0011817 3300048905 Bacteria 7536
863 Ga0496102_0018808 3300048905 Bacteria 6077
864 Ga0496102_0229335 3300048905 Bacteria 1751
865 Ga0496103_0000419 3300048906 Bacteria 37226
866 Ga0496103_0003142 3300048906 Bacteria 10157
867 Ga0496104_0002323 3300048907 Bacteria 16428
868 Ga0496104_0002943 3300048907 Bacteria 14673
869 Ga0496104_0017455 3300048907 Bacteria 6535
870 Ga0496104_0041528 3300048907 Bacteria 4313
871 Ga0496104_0106764 3300048907 Bacteria 2683
872 Ga0496104_0146255 3300048907 Bacteria 2269
873 Ga0496104_0203393 3300048907 Bacteria 1892
874 Ga0496104_0277861 3300048907 Bacteria 1588
875 Ga0496105_0017486 3300048908 Bacteria 5750
876 Ga0496105_0020488 3300048908 Bacteria 5344
877 Ga0496105_0032692 3300048908 Bacteria 4270
878 Ga0496105_0073963 3300048908 Bacteria 2815
879 Ga0496105_0099626 3300048908 Bacteria 2400
880 Ga0496105_0229312 3300048908 Bacteria 1509
881 Ga0496106_0008421 3300048909 Bacteria 7629
882 Ga0496106_0015311 3300048909 Bacteria 5674
883 Ga0496106_0033756 3300048909 Bacteria 3819
884 Ga0496106_0094117 3300048909 Bacteria 2316
885 Ga0496106_0147435 3300048909 Bacteria 1854
886 Ga0496107_0010740 3300048910 Bacteria 6369
887 Ga0496107_0019213 3300048910 Bacteria 4821
888 Ga0496108_0010986 3300048911 Bacteria 7354
889 Ga0496108_0014948 3300048911 Bacteria 6335
890 Ga0496108_0027735 3300048911 Bacteria 4680
891 Ga0496108_0034543 3300048911 Bacteria 4202
892 Ga0496108_0043531 3300048911 Bacteria 3749
893 Ga0496108_0180073 3300048911 Bacteria 1830
894 Ga0496109_0002420 3300048912 Bacteria 15629
895 Ga0496109_0013194 3300048912 Bacteria 7151
896 Ga0496109_0014820 3300048912 Bacteria 6784
897 Ga0496109_0016348 3300048912 Bacteria 6484
898 Ga0496109_0098338 3300048912 Bacteria 2713
899 Ga0496109_0131477 3300048912 Bacteria 2336
900 Ga0496110_0002430 3300048913 Bacteria 13955
901 Ga0496110_0005366 3300048913 Bacteria 10043
902 Ga0496110_0014024 3300048913 Bacteria 6642
903 Ga0496110_0034472 3300048913 Bacteria 4384
904 Ga0496110_0034753 3300048913 Bacteria 4369
905 Ga0496110_0053532 3300048913 Bacteria 3549
906 Ga0496111_0002323 3300048914 Bacteria 11453
907 Ga0496111_0003314 3300048914 Bacteria 9963
908 Ga0496111_0003533 3300048914 Bacteria 9672
909 Ga0496111_0017099 3300048914 Bacteria 5008
910 Ga0496111_0038133 3300048914 Bacteria 3442
911 Ga0496111_0043228 3300048914 Bacteria 3238
912 Ga0496112_0001155 3300048915 Bacteria 19707
913 Ga0496112_0007606 3300048915 Bacteria 9629
914 Ga0496112_0008924 3300048915 Bacteria 8999
915 Ga0496112_0072427 3300048915 Bacteria 3406
916 Ga0496112_0109353 3300048915 Bacteria 2734
917 Ga0496112_0191113 3300048915 Bacteria 2009
918 Ga0496113_0001528 3300048916 Bacteria 12957
919 Ga0496113_0008099 3300048916 Bacteria 6824
920 Ga0496113_0011117 3300048916 Bacteria 5989
921 Ga0496113_0015597 3300048916 Bacteria 5229
922 Ga0496114_0001306 3300048917 Bacteria 18867
923 Ga0496114_0014735 3300048917 Bacteria 6283
924 Ga0496115_0031578 3300048918 Bacteria 4173
925 Ga0496115_0074356 3300048918 Bacteria 2759
926 Ga0496116_0002711 3300048919 Bacteria 18241
927 Ga0496116_0043572 3300048919 Bacteria 3056
928 Ga0496116_0053591 3300048919 Bacteria 2663
929 Ga0496117_0002642 3300048920 Bacteria 22219
930 Ga0496117_0024264 3300048920 Bacteria 4802
931 Ga0496118_0003017 3300048921 Bacteria 21741
932 Ga0496118_0005276 3300048921 Bacteria 14752
933 Ga0496119_0003545 3300048922 Bacteria 16111
934 Ga0496120_0094270 3300048923 Bacteria 1594
935 Ga0496121_0000197 3300048924 Bacteria 135555
936 Ga0496121_0007804 3300048924 Bacteria 12815
937 Ga0496121_0009668 3300048924 Bacteria 11046
938 Ga0496122_0000963 3300048925 Bacteria 51691
939 Ga0496122_0001032 3300048925 Bacteria 48968
940 Ga0496122_0007096 3300048925 Bacteria 12585
941 Ga0496123_0000608 3300048926 Bacteria 60350
942 Ga0496123_0000806 3300048926 Bacteria 50579
943 Ga0496124_0017736 3300048927 Bacteria 6697
944 Ga0496125_0005258 3300048928 Bacteria 14494
945 Ga0496125_0084236 3300048928 Bacteria 2415
946 Ga0496126_0000612 3300048929 Bacteria 67231
947 Ga0496126_0020582 3300048929 Bacteria 6461
948 Ga0496126_0104849 3300048929 Bacteria 2470
949 Ga0495678_000011 3300049459 Bacteria 335512
950 Ga0495678_000873 3300049459 Bacteria 26824
951 Ga0495678_008279 3300049459 Bacteria 5266
952 Ga0495682_0000322 3300049460 Bacteria 35481
953 Ga0501298_010528 3300049521 Bacteria 1593
954 Ga0501031_0015894 3300049568 Bacteria 4887
955 Ga0501031_0043820 3300049568 Bacteria 2919
956 Ga0501031_0106923 3300049568 Bacteria 1826
957 Ga0501032_0111256 3300049569 Bacteria 1812
958 Ga0501034_0249591 3300049571 Bacteria 1719
959 Ga0501036_0001202 3300049572 Bacteria 19754
960 Ga0501036_0011773 3300049572 Bacteria 7249
961 Ga0501039_0004199 3300049575 Bacteria 10844
962 Ga0501039_0007339 3300049575 Bacteria 8397
963 Ga0501039_0032753 3300049575 Bacteria 4008
964 Ga0501039_0046794 3300049575 Bacteria 3343
965 Ga0501040_0005453 3300049576 Bacteria 8229
966 Ga0501040_0109292 3300049576 Bacteria 1933
967 Ga0501041_0001526 3300049577 Bacteria 12855
968 Ga0501041_0011429 3300049577 Bacteria 5246
969 Ga0501041_0058997 3300049577 Bacteria 2349
970 Ga0501042_0005162 3300049578 Bacteria 8387
971 Ga0501042_0088860 3300049578 Bacteria 2217
972 Ga0501046_0051523 3300049580 Bacteria 3248
973 Ga0501046_0176088 3300049580 Bacteria 1602
974 Ga0501048_0060290 3300049582 Bacteria 2689
975 Ga0501048_0130659 3300049582 Bacteria 1776
976 Ga0501068_0034841 3300049584 Bacteria 3004
977 Ga0501068_0142391 3300049584 Bacteria 1503
978 Ga0501069_0055149 3300049585 Bacteria 2214
979 Ga0501071_0000122 3300049587 Bacteria 31193
980 Ga0501071_0158636 3300049587 Bacteria 1690
981 Ga0501071_0167558 3300049587 Bacteria 1644
982 Ga0501072_0001662 3300049588 Bacteria 16579
983 Ga0501072_0001697 3300049588 Bacteria 16409
984 Ga0501072_0169706 3300049588 Bacteria 1741
985 Ga0501073_0163880 3300049589 Bacteria 1540
986 Ga0501074_0001550 3300049590 Bacteria 15533
987 Ga0501074_0077578 3300049590 Bacteria 2384
988 Ga0501074_0090080 3300049590 Bacteria 2197
989 Ga0501075_0000366 3300049591 Bacteria 25923
990 Ga0501075_0001616 3300049591 Bacteria 14762
991 Ga0501075_0015017 3300049591 Bacteria 5556
992 Ga0501075_0048774 3300049591 Bacteria 3182
993 Ga0501075_0068951 3300049591 Bacteria 2672
994 Ga0501075_0070250 3300049591 Bacteria 2646
995 Ga0501076_0003741 3300049592 Bacteria 10699
996 Ga0501076_0005033 3300049592 Bacteria 9458
997 Ga0501076_0008353 3300049592 Bacteria 7587
998 Ga0501076_0008894 3300049592 Bacteria 7387
999 Ga0501076_0166013 3300049592 Bacteria 1799
1000 Ga0501076_0194302 3300049592 Bacteria 1656
1001 Ga0501077_0042661 3300049593 Bacteria 2884
1002 Ga0501079_0023807 3300049741 Bacteria 4698
1003 Ga0501079_0104511 3300049741 Bacteria 2197
1004 Ga0501079_0112499 3300049741 Bacteria 2116
1005 Ga0501079_0140996 3300049741 Bacteria 1878
1006 Ga0501080_0022865 3300049742 Bacteria 5796
1007 Ga0501080_0302855 3300049742 Bacteria 1449
1008 Ga0501081_0001904 3300049743 Bacteria 12947
1009 Ga0501081_0010162 3300049743 Bacteria 6142
1010 Ga0501081_0010538 3300049743 Bacteria 6033
1011 Ga0501081_0018805 3300049743 Bacteria 4590
1012 Ga0501081_0241506 3300049743 Bacteria 1317
1013 Ga0501035_0111751 3300049822 Bacteria 2394
1014 Ga0501044_0107645 3300049823 Bacteria 2799
1015 Ga0501045_0011349 3300049824 Bacteria 6255
1016 Ga0501045_0019906 3300049824 Bacteria 4790
1017 Ga0501045_0031928 3300049824 Bacteria 3814
1018 Ga0501045_0059322 3300049824 Bacteria 2803
1019 nmdc:mga00v17_527_c1 3300050491 Bacteria 21481
1020 nmdc:mga0k408_155_c2 3300050493 Bacteria 16666
1021 nmdc:mga05p37_19658_c1 3300050507 Bacteria 8171
1022 nmdc:mga05p37_213844_c1 3300050507 Bacteria 2329
1023 nmdc:mga05p37_7272_c1 3300050507 Bacteria 13063
1024 nmdc:mga09592_14450_c1 3300050508 Bacteria 6444
1025 nmdc:mga08y16_113485_c1 3300050511 Bacteria 2821
1026 nmdc:mga08y16_16965_c1 3300050511 Bacteria 7667
1027 nmdc:mga08y16_30808_c1 3300050511 Bacteria 5642
1028 nmdc:mga08y16_72164_c1 3300050511 Bacteria 3598
1029 nmdc:mga0n895_1531_c1 3300050512 Bacteria 17366
1030 nmdc:mga0n895_172665_c1 3300050512 Bacteria 2193
1031 nmdc:mga0n895_65468_c1 3300050512 Bacteria 3597
1032 nmdc:mga0n895_78359_c1 3300050512 Bacteria 3289
1033 nmdc:mga0rr50_40898_c1 3300050513 Bacteria 3373
1034 nmdc:mga08x19_13632_c1 3300050514 Bacteria 4918
1035 nmdc:mga08x19_96017_c1 3300050514 Bacteria 1962
1036 nmdc:mga0a205_280561_c1 3300050515 Bacteria 1541
1037 nmdc:mga0a205_65894_c1 3300050515 Bacteria 3500
1038 Ga0495601_0000001 3300053077 Bacteria 549454
1039 Ga0495612_0000017 3300053078 Bacteria 152112
1040 Ga0495612_0005030 3300053078 Bacteria 5474
1041 Ga0495595_0000010 3300053084 Bacteria 178819
1042 Ga0495595_0002115 3300053084 Bacteria 7710
1043 Ga0495619_0000004 3300053085 Bacteria 500068
1044 Ga0495619_0000256 3300053085 Bacteria 38697
1045 Ga0495619_0046064 3300053085 Bacteria 2866
1046 Ga0495619_0047360 3300053085 Bacteria 2830
1047 Ga0495619_0133506 3300053085 Bacteria 1707
1048 Ga0500616_0051832 3300053153 Bacteria 2160
1049 Ga0501084_0001586 3300054114 Bacteria 17999
1050 Ga0501084_0069416 3300054114 Bacteria 2950
1051 Ga0501084_0074699 3300054114 Bacteria 2839
1052 Ga0501084_0087457 3300054114 Bacteria 2616
1053 Ga0501084_0248081 3300054114 Bacteria 1503
1054 Ga0501082_0010569 3300060353 Bacteria 7944
1055 Ga0501082_0044116 3300060353 Bacteria 3846
1056 Ga0501082_0076312 3300060353 Bacteria 2889
1057 Ga0501082_0082809 3300060353 Bacteria 2768
1058 Ga0530510_0002303 3300061734 Bacteria 13086
1059 Ga0530510_0031828 3300061734 Bacteria 3793
1060 Ga0530510_0034963 3300061734 Bacteria 3621

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0167558 Ga0501071_0167558_463_1599 373
2 3300049591 Ga0501075_0070250 Ga0501075_0070250_1487_2623 373
3 3300053085 Ga0495619_0047360 Ga0495619_0047360_1475_2611 376
4 3300047319 Ga0495674_0070948 Ga0495674_0070948_1241_2380 377
5 iso_pu_bacteria 2889016732 2889020876 378
6 3300009093 Ga0105240_10525843 Ga0105240_105258431 382
7 3300005337 Ga0070682_100099984 Ga0070682_1000999842 386
8 3300048912 Ga0496109_0098338 Ga0496109_0098338_1375_2547 387
9 3300025942 Ga0207689_10128941 Ga0207689_101289412 390
10 3300044842 Ga0466957_0038538 Ga0466957_0038538_877_2184 392
11 iso_pu_bacteria 2961136820 2961144484 392
12 3300031824 Ga0307413_10102439 Ga0307413_101024391 394
13 3300032002 Ga0307416_100166651 Ga0307416_1001666512 394
14 3300032004 Ga0307414_10185375 Ga0307414_101853751 394
15 3300032005 Ga0307411_10103951 Ga0307411_101039512 394
16 3300053153 Ga0500616_0051832 Ga0500616_0051832_811_2094 397
17 3300049584 Ga0501068_0034841 Ga0501068_0034841_1739_2950 398
18 3300005434 Ga0070709_10005000 Ga0070709_100050004 399
19 3300005985 Ga0081539_10071117 Ga0081539_100711172 399
20 3300013296 Ga0157374_10001916 Ga0157374_100019169 399
21 3300025928 Ga0207700_10108110 Ga0207700_101081102 399
22 3300037853 Ga0436364_0140072 Ga0436364_0140072_615_1892 401
23 3300042876 Ga0451577_0024385 Ga0451577_0024385_3973_5274 401
24 3300031995 Ga0307409_100037524 Ga0307409_1000375242 402
25 3300032126 Ga0307415_100137738 Ga0307415_1001377382 402
26 3300049568 Ga0501031_0043820 Ga0501031_0043820_1469_2755 403
27 3300049572 Ga0501036_0011773 Ga0501036_0011773_261_1547 403
28 3300049575 Ga0501039_0004199 Ga0501039_0004199_2417_3703 403
29 3300049576 Ga0501040_0005453 Ga0501040_0005453_4067_5353 403
30 3300049577 Ga0501041_0001526 Ga0501041_0001526_8764_10050 403
31 3300049578 Ga0501042_0005162 Ga0501042_0005162_2849_4135 403
32 3300049580 Ga0501046_0051523 Ga0501046_0051523_125_1411 403
33 3300049584 Ga0501068_0142391 Ga0501068_0142391_11_1237 403
34 3300049587 Ga0501071_0000122 Ga0501071_0000122_29239_30525 403
35 3300049588 Ga0501072_0001697 Ga0501072_0001697_8338_9624 403
36 3300049590 Ga0501074_0077578 Ga0501074_0077578_404_1690 403
37 3300049591 Ga0501075_0000366 Ga0501075_0000366_17124_18410 403
38 3300049592 Ga0501076_0003741 Ga0501076_0003741_7210_8496 403
39 3300049741 Ga0501079_0023807 Ga0501079_0023807_623_1909 403
40 3300049742 Ga0501080_0022865 Ga0501080_0022865_3679_4965 403
41 3300049743 Ga0501081_0001904 Ga0501081_0001904_2417_3703 403
42 3300049823 Ga0501044_0107645 Ga0501044_0107645_703_1989 403
43 3300049824 Ga0501045_0031928 Ga0501045_0031928_161_1447 403
44 3300054114 Ga0501084_0001586 Ga0501084_0001586_10572_11858 403
45 3300054114 Ga0501084_0074699 Ga0501084_0074699_560_1849 403
46 3300061734 Ga0530510_0034963 Ga0530510_0034963_1214_2500 403
47 3300031903 Ga0307407_10037805 Ga0307407_100378052 404
48 iso_pu_bacteria 2977915119 2977922119 404
49 3300003781 Ga0055536_1000524 Ga0055536_10005246 406
50 3300003791 Ga0055530_10004363 Ga0055530_100043637 406
51 3300003792 Ga0055540_1000054 Ga0055540_1000054115 406
52 3300003794 Ga0055531_10000037 Ga0055531_1000003725 406
53 3300015261 Ga0182006_1003241 Ga0182006_10032412 406
54 3300025292 Ga0209676_1000105 Ga0209676_1000105102 406
55 3300025298 Ga0209050_1001283 Ga0209050_100128322 406
56 3300025303 Ga0209051_1000064 Ga0209051_1000064119 406
57 3300025304 Ga0209257_1000109 Ga0209257_1000109119 406
58 3300031852 Ga0307410_10156890 Ga0307410_101568902 406
59 3300035092 Ga0373952_0020885 Ga0373952_0020885_140_1363 406
60 3300046477 Ga0495664_0032446 Ga0495664_0032446_1225_2544 406
61 3300046517 Ga0495630_0011656 Ga0495630_0011656_2981_4264 406
62 3300046533 Ga0495640_0000544 Ga0495640_0000544_2943_4226 406
63 3300046543 Ga0495645_0021849 Ga0495645_0021849_1818_3137 406
64 3300046660 Ga0495625_0000012 Ga0495625_0000012_80202_81485 406
65 3300047471 Ga0495684_0001824 Ga0495684_0001824_2196_3479 406
66 3300060353 Ga0501082_0010569 Ga0501082_0010569_2936_4252 406
67 3300046520 Ga0495637_0014377 Ga0495637_0014377_2128_3411 408
68 3300005445 Ga0070708_100089217 Ga0070708_1000892172 409
69 3300005471 Ga0070698_100000484 Ga0070698_10000048420 409
70 3300005518 Ga0070699_100009192 Ga0070699_1000091927 409
71 3300006028 Ga0070717_10002130 Ga0070717_100021307 409
72 3300041413 Ga0439465_0003630 Ga0439465_0003630_389_1735 409
73 3300049580 Ga0501046_0176088 Ga0501046_0176088_35_1279 409
74 3300011119 Ga0105246_10081362 Ga0105246_100813622 410
75 3300046524 Ga0495648_0012924 Ga0495648_0012924_4846_6129 410
76 3300046694 Ga0495649_0029987 Ga0495649_0029987_523_1806 410
77 3300002705 JGI25156J39149_1001315 JGI25156J39149_10013157 411
78 3300009011 Ga0105251_10001687 Ga0105251_1000168716 411
79 3300009092 Ga0105250_10000221 Ga0105250_100002213 411
80 3300021388 Ga0213875_10058761 Ga0213875_100587612 411
81 3300025256 Ga0209759_1000123 Ga0209759_100012343 411
82 3300025711 Ga0207696_1000349 Ga0207696_100034937 411
83 3300025735 Ga0207713_1001485 Ga0207713_10014854 411
84 3300025302 Ga0207426_1000345 Ga0207426_100034560 412
85 3300049585 Ga0501069_0055149 Ga0501069_0055149_577_1896 412
86 3300005458 Ga0070681_10031256 Ga0070681_100312565 413
87 3300025912 Ga0207707_10003517 Ga0207707_1000351716 413
88 3300048924 Ga0496121_0000197 Ga0496121_0000197_67263_68582 413
89 3300049590 Ga0501074_0090080 Ga0501074_0090080_923_2173 413
90 3300049743 Ga0501081_0241506 Ga0501081_0241506_19_1275 413
91 3300009551 Ga0105238_10081230 Ga0105238_100812301 414
92 3300013307 Ga0157372_10049397 Ga0157372_100493974 414
93 3300044658 Ga0466972_0021056 Ga0466972_0021056_396_1679 414
94 3300044735 Ga0466968_0021887 Ga0466968_0021887_269_1552 414
95 3300046459 Ga0495629_0001903 Ga0495629_0001903_4722_6041 414
96 3300046463 Ga0495653_0001990 Ga0495653_0001990_4861_6180 414
97 3300046471 Ga0495650_0023178 Ga0495650_0023178_178_1491 414
98 3300046472 Ga0495580_0002473 Ga0495580_0002473_10153_11472 414
99 3300046473 Ga0495582_0036839 Ga0495582_0036839_1055_2374 414
100 3300046690 Ga0495624_0000130 Ga0495624_0000130_47105_48424 414
101 3300047319 Ga0495674_0003006 Ga0495674_0003006_4642_5961 414
102 3300047673 Ga0495593_0001523 Ga0495593_0001523_5684_7003 414
103 3300048922 Ga0496119_0003545 Ga0496119_0003545_45_1295 414
104 3300005329 Ga0070683_100066175 Ga0070683_1000661753 415
105 3300005340 Ga0070689_100146936 Ga0070689_1001469361 415
106 3300005344 Ga0070661_100132427 Ga0070661_1001324272 415
107 3300005345 Ga0070692_10040657 Ga0070692_100406571 415
108 3300005347 Ga0070668_100101014 Ga0070668_1001010141 415
109 3300005356 Ga0070674_100135465 Ga0070674_1001354651 415
110 3300005364 Ga0070673_100104548 Ga0070673_1001045482 415
111 3300005440 Ga0070705_100011668 Ga0070705_1000116683 415
112 3300005455 Ga0070663_100135042 Ga0070663_1001350422 415
113 3300005457 Ga0070662_100132035 Ga0070662_1001320352 415
114 3300005459 Ga0068867_100077272 Ga0068867_1000772721 415
115 3300005518 Ga0070699_100272913 Ga0070699_1002729132 415
116 3300005535 Ga0070684_100060876 Ga0070684_1000608763 415
117 3300005544 Ga0070686_100015298 Ga0070686_1000152983 415
118 3300005563 Ga0068855_100189121 Ga0068855_1001891212 415
119 3300005618 Ga0068864_100015042 Ga0068864_1000150422 415
120 3300005834 Ga0068851_10023722 Ga0068851_100237223 415
121 3300005841 Ga0068863_100086154 Ga0068863_1000861542 415
122 3300005843 Ga0068860_100015244 Ga0068860_1000152442 415
123 3300006881 Ga0068865_100147416 Ga0068865_1001474162 415
124 3300009148 Ga0105243_10055460 Ga0105243_100554603 415
125 3300009176 Ga0105242_10051662 Ga0105242_100516622 415
126 3300009177 Ga0105248_10109102 Ga0105248_101091021 415
127 3300009553 Ga0105249_10099006 Ga0105249_100990063 415
128 3300014326 Ga0157380_10087627 Ga0157380_100876271 415
129 3300014968 Ga0157379_10086758 Ga0157379_100867583 415
130 3300025900 Ga0207710_10073733 Ga0207710_100737331 415
131 3300025918 Ga0207662_10093455 Ga0207662_100934552 415
132 3300025919 Ga0207657_10035391 Ga0207657_100353914 415
133 3300025921 Ga0207652_10148747 Ga0207652_101487472 415
134 3300025926 Ga0207659_10045953 Ga0207659_100459532 415
135 3300025931 Ga0207644_10110972 Ga0207644_101109722 415
136 3300025933 Ga0207706_10016073 Ga0207706_100160734 415
137 3300025940 Ga0207691_10008491 Ga0207691_100084913 415
138 3300025942 Ga0207689_10028039 Ga0207689_100280392 415
139 3300026067 Ga0207678_10044253 Ga0207678_100442533 415
140 3300026075 Ga0207708_10006349 Ga0207708_100063492 415
141 3300026089 Ga0207648_10018847 Ga0207648_100188473 415
142 3300026095 Ga0207676_10107019 Ga0207676_101070192 415
143 3300026118 Ga0207675_100008588 Ga0207675_1000085887 415
144 3300035090 Ga0373949_0004030 Ga0373949_0004030_819_2102 415
145 3300035112 Ga0373932_0010265 Ga0373932_0010265_702_1985 415
146 3300035114 Ga0373939_0006400 Ga0373939_0006400_222_1505 415
147 3300035115 Ga0373941_0024709 Ga0373941_0024709_284_1567 415
148 3300035242 Ga0373962_0026107 Ga0373962_0026107_141_1424 415
149 3300035691 Ga0373931_0064214 Ga0373931_0064214_29_1312 415
150 3300048903 Ga0496100_0100760 Ga0496100_0100760_534_1817 415
151 3300048904 Ga0496101_0049568 Ga0496101_0049568_425_1708 415
152 3300048905 Ga0496102_0229335 Ga0496102_0229335_327_1610 415
153 3300048907 Ga0496104_0017455 Ga0496104_0017455_2317_3636 415
154 3300048907 Ga0496104_0041528 Ga0496104_0041528_1515_2798 415
155 3300048909 Ga0496106_0094117 Ga0496106_0094117_458_1741 415
156 3300048911 Ga0496108_0027735 Ga0496108_0027735_1807_3090 415
157 3300048913 Ga0496110_0034753 Ga0496110_0034753_1515_2798 415
158 3300048923 Ga0496120_0094270 Ga0496120_0094270_105_1424 415
159 3300050511 nmdc:mga08y16_113485_c1 nmdc:mga08y16_113485_c1_165_1448 415
160 3300005329 Ga0070683_100233527 Ga0070683_1002335272 416
161 3300009551 Ga0105238_10196612 Ga0105238_101966122 416
162 3300026116 Ga0207674_10073309 Ga0207674_100733093 416
163 3300046463 Ga0495653_0007581 Ga0495653_0007581_5323_6642 416
164 3300046507 Ga0495606_0053092 Ga0495606_0053092_116_1435 416
165 3300046516 Ga0495628_0015643 Ga0495628_0015643_417_1736 416
166 3300046517 Ga0495630_0021901 Ga0495630_0021901_3301_4620 416
167 3300046529 Ga0495652_0061574 Ga0495652_0061574_958_2277 416
168 3300046531 Ga0495665_0000217 Ga0495665_0000217_27535_28854 416
169 3300046663 Ga0495635_0024486 Ga0495635_0024486_184_1503 416
170 3300046679 Ga0495623_0016199 Ga0495623_0016199_3312_4631 416
171 3300046680 Ga0495646_0010033 Ga0495646_0010033_2245_3564 416
172 3300046690 Ga0495624_0029667 Ga0495624_0029667_451_1770 416
173 3300047317 Ga0495604_0027675 Ga0495604_0027675_1527_2846 416
174 3300047322 Ga0495680_0014348 Ga0495680_0014348_761_2080 416
175 3300048088 Ga0495602_0003267 Ga0495602_0003267_7627_8946 416
176 3300005468 Ga0070707_100038824 Ga0070707_1000388243 417
177 3300005545 Ga0070695_100062465 Ga0070695_1000624653 417
178 3300005549 Ga0070704_100155599 Ga0070704_1001555991 417
179 3300013307 Ga0157372_10263098 Ga0157372_102630982 417
180 3300025960 Ga0207651_10286558 Ga0207651_102865581 417
181 3300028380 Ga0268265_10042398 Ga0268265_100423982 417
182 3300046460 Ga0495638_0000125 Ga0495638_0000125_84489_85772 417
183 3300046513 Ga0495616_0037377 Ga0495616_0037377_792_2075 417
184 3300046519 Ga0495632_0023482 Ga0495632_0023482_885_2168 417
185 3300046530 Ga0495654_0011507 Ga0495654_0011507_424_1707 417
186 3300046542 Ga0495597_0003192 Ga0495597_0003192_2094_3377 417
187 3300047320 Ga0495672_0004493 Ga0495672_0004493_3078_4361 417
188 3300050515 nmdc:mga0a205_280561_c1 nmdc:mga0a205_280561_c1_147_1430 417
189 3300005290 Ga0065712_10074695 Ga0065712_100746955 418
190 3300005544 Ga0070686_100075541 Ga0070686_1000755412 418
191 3300005842 Ga0068858_100286665 Ga0068858_1002866652 418
192 3300009036 Ga0105244_10000345 Ga0105244_1000034522 418
193 3300025728 Ga0207655_1002880 Ga0207655_10028806 418
194 3300039438 Ga0436360_1211585 Ga0436360_1211585_524_1816 418
195 3300044656 Ga0466969_0003234 Ga0466969_0003234_3085_4386 418
196 3300044684 Ga0466966_0022455 Ga0466966_0022455_988_2289 418
197 3300046542 Ga0495597_0022648 Ga0495597_0022648_202_1461 418
198 3300048908 Ga0496105_0099626 Ga0496105_0099626_1052_2359 418
199 3300048912 Ga0496109_0002420 Ga0496109_0002420_13199_14506 418
200 3300048914 Ga0496111_0043228 Ga0496111_0043228_945_2252 418
201 3300048916 Ga0496113_0001528 Ga0496113_0001528_1335_2642 418
202 3300039437 Ga0436365_0313432 Ga0436365_0313432_1477_2760 419
203 3300005981 Ga0081538_10007210 Ga0081538_100072103 420
204 3300010375 Ga0105239_10059456 Ga0105239_100594563 420
205 3300013308 Ga0157375_10014341 Ga0157375_100143413 420
206 3300021377 Ga0213874_10005916 Ga0213874_100059162 420
207 3300026067 Ga0207678_10188047 Ga0207678_101880472 420
208 3300035118 Ga0373954_0000707 Ga0373954_0000707_10908_12173 420
209 3300039437 Ga0436365_1386178 Ga0436365_1386178_988_2295 420
210 3300039450 Ga0436363_0568637 Ga0436363_0568637_1254_2561 420
211 3300047323 Ga0495683_0000300 Ga0495683_0000300_4767_6050 420
212 3300003322 rootL2_10152113 rootL2_101521131 421
213 3300005445 Ga0070708_100129160 Ga0070708_1001291601 421
214 3300005563 Ga0068855_100003325 Ga0068855_10000332512 421
215 3300005577 Ga0068857_100002263 Ga0068857_1000022633 421
216 3300005578 Ga0068854_100003405 Ga0068854_1000034052 421
217 3300005616 Ga0068852_100002286 Ga0068852_1000022867 421
218 3300009093 Ga0105240_10099949 Ga0105240_100999492 421
219 3300009094 Ga0111539_10001696 Ga0111539_1000169612 421
220 3300009176 Ga0105242_10040216 Ga0105242_100402163 421
221 3300009177 Ga0105248_10030891 Ga0105248_100308915 421
222 3300011119 Ga0105246_10106436 Ga0105246_101064362 421
223 3300013102 Ga0157371_10102296 Ga0157371_101022962 421
224 3300013104 Ga0157370_10002043 Ga0157370_1000204310 421
225 3300013307 Ga0157372_10000305 Ga0157372_1000030542 421
226 3300013308 Ga0157375_10325809 Ga0157375_103258092 421
227 3300021388 Ga0213875_10000271 Ga0213875_1000027143 421
228 3300025904 Ga0207647_10033715 Ga0207647_100337153 421
229 3300025913 Ga0207695_10095188 Ga0207695_100951882 421
230 3300025949 Ga0207667_10000968 Ga0207667_100009683 421
231 3300025981 Ga0207640_10036117 Ga0207640_100361172 421
232 3300026116 Ga0207674_10000629 Ga0207674_1000062915 421
233 3300026142 Ga0207698_10047152 Ga0207698_100471522 421
234 3300034816 Ga0373930_0000713 Ga0373930_0000713_2355_3638 421
235 3300034819 Ga0373958_0000992 Ga0373958_0000992_593_1876 421
236 3300034820 Ga0373959_0000111 Ga0373959_0000111_9606_10889 421
237 3300034957 Ga0373938_0000386 Ga0373938_0000386_4860_6143 421
238 3300035084 Ga0373928_0000045 Ga0373928_0000045_8135_9418 421
239 3300035085 Ga0373929_0010706 Ga0373929_0010706_308_1591 421
240 3300035089 Ga0373944_0011427 Ga0373944_0011427_913_2196 421
241 3300035090 Ga0373949_0003496 Ga0373949_0003496_553_1836 421
242 3300035091 Ga0373951_0000335 Ga0373951_0000335_6927_8210 421
243 3300035092 Ga0373952_0000179 Ga0373952_0000179_4985_6268 421
244 3300035111 Ga0373923_0000978 Ga0373923_0000978_3547_4830 421
245 3300035111 Ga0373923_0004485 Ga0373923_0004485_3332_4615 421
246 3300035112 Ga0373932_0000271 Ga0373932_0000271_7218_8501 421
247 3300035113 Ga0373936_0002402 Ga0373936_0002402_4972_6255 421
248 3300035114 Ga0373939_0001296 Ga0373939_0001296_3537_4820 421
249 3300035116 Ga0373945_0020517 Ga0373945_0020517_198_1481 421
250 3300035117 Ga0373953_0004302 Ga0373953_0004302_2240_3523 421
251 3300035117 Ga0373953_0008474 Ga0373953_0008474_1693_2976 421
252 3300035172 Ga0373955_0001092 Ga0373955_0001092_7920_9203 421
253 3300035241 Ga0373961_0000592 Ga0373961_0000592_10499_11782 421
254 3300035242 Ga0373962_0000848 Ga0373962_0000848_5646_6929 421
255 3300035410 Ga0373924_0018420 Ga0373924_0018420_792_2075 421
256 3300035691 Ga0373931_0004514 Ga0373931_0004514_1537_2820 421
257 3300035691 Ga0373931_0092016 Ga0373931_0092016_269_1552 421
258 3300035692 Ga0373935_0000377 Ga0373935_0000377_16641_17924 421
259 3300035692 Ga0373935_0003956 Ga0373935_0003956_909_2192 421
260 3300035695 Ga0373927_0021648 Ga0373927_0021648_1289_2572 421
261 3300035724 Ga0373933_0002410 Ga0373933_0002410_7839_9122 421
262 3300035725 Ga0373947_0000280 Ga0373947_0000280_1110_2393 421
263 3300036401 Ga0373937_0001849 Ga0373937_0001849_10004_11287 421
264 3300037068 Ga0373925_0000075 Ga0373925_0000075_26416_27699 421
265 3300037068 Ga0373925_0001434 Ga0373925_0001434_8635_9918 421
266 3300037853 Ga0436364_1510300 Ga0436364_1510300_8496_9821 421
267 3300045051 Ga0451576_0006479 Ga0451576_0006479_1175_2458 421
268 3300046454 Ga0495592_0000060 Ga0495592_0000060_22330_23613 421
269 3300046454 Ga0495592_0005925 Ga0495592_0005925_285_1568 421
270 3300046455 Ga0495603_0004025 Ga0495603_0004025_6262_7545 421
271 3300046459 Ga0495629_0000139 Ga0495629_0000139_40869_42152 421
272 3300046459 Ga0495629_0114205 Ga0495629_0114205_394_1677 421
273 3300046461 Ga0495641_0015170 Ga0495641_0015170_1004_2287 421
274 3300046462 Ga0495651_0000181 Ga0495651_0000181_23250_24533 421
275 3300046462 Ga0495651_0004794 Ga0495651_0004794_5782_7065 421
276 3300046463 Ga0495653_0000740 Ga0495653_0000740_1312_2595 421
277 3300046473 Ga0495582_0001586 Ga0495582_0001586_8166_9449 421
278 3300046476 Ga0495662_0001139 Ga0495662_0001139_7622_8905 421
279 3300046476 Ga0495662_0044168 Ga0495662_0044168_387_1670 421
280 3300046477 Ga0495664_0000003 Ga0495664_0000003_60120_61403 421
281 3300046499 Ga0495594_0002129 Ga0495594_0002129_6304_7587 421
282 3300046511 Ga0495608_0000011 Ga0495608_0000011_6124_7407 421
283 3300046514 Ga0495618_0000044 Ga0495618_0000044_71953_73236 421
284 3300046514 Ga0495618_0087980 Ga0495618_0087980_50_1333 421
285 3300046516 Ga0495628_0000001 Ga0495628_0000001_549521_550804 421
286 3300046517 Ga0495630_0000574 Ga0495630_0000574_930_2213 421
287 3300046529 Ga0495652_0000002 Ga0495652_0000002_764055_765338 421
288 3300046529 Ga0495652_0032084 Ga0495652_0032084_1309_2592 421
289 3300046533 Ga0495640_0000002 Ga0495640_0000002_4384_5667 421
290 3300046535 Ga0495586_0037010 Ga0495586_0037010_68_1351 421
291 3300046536 Ga0495587_0000001 Ga0495587_0000001_76790_78073 421
292 3300046538 Ga0495609_0025539 Ga0495609_0025539_19_1302 421
293 3300046543 Ga0495645_0000002 Ga0495645_0000002_549534_550817 421
294 3300046559 Ga0495667_0000039 Ga0495667_0000039_107679_108962 421
295 3300046642 Ga0495634_0000010 Ga0495634_0000010_91678_92961 421
296 3300046663 Ga0495635_0000001 Ga0495635_0000001_62614_63897 421
297 3300046674 Ga0495588_0033132 Ga0495588_0033132_1135_2418 421
298 3300046675 Ga0495657_0000042 Ga0495657_0000042_91200_92483 421
299 3300046675 Ga0495657_0001942 Ga0495657_0001942_11865_13148 421
300 3300046678 Ga0495599_0000013 Ga0495599_0000013_100809_102092 421
301 3300046679 Ga0495623_0000050 Ga0495623_0000050_7060_8343 421
302 3300046680 Ga0495646_0000009 Ga0495646_0000009_77623_78906 421
303 3300046681 Ga0495647_0006801 Ga0495647_0006801_2018_3301 421
304 3300046683 Ga0495658_0000065 Ga0495658_0000065_30897_32180 421
305 3300046689 Ga0495613_0006292 Ga0495613_0006292_5800_7083 421
306 3300046690 Ga0495624_0043247 Ga0495624_0043247_61_1344 421
307 3300046809 Ga0495600_0000209 Ga0495600_0000209_614_1897 421
308 3300047315 Ga0495581_0007122 Ga0495581_0007122_2193_3476 421
309 3300047315 Ga0495581_0020331 Ga0495581_0020331_1375_2658 421
310 3300047317 Ga0495604_0000069 Ga0495604_0000069_51539_52822 421
311 3300047319 Ga0495674_0000002 Ga0495674_0000002_549522_550805 421
312 3300047321 Ga0495676_0006417 Ga0495676_0006417_9145_10428 421
313 3300047321 Ga0495676_0179997 Ga0495676_0179997_47_1330 421
314 3300047322 Ga0495680_0000328 Ga0495680_0000328_29642_30925 421
315 3300047322 Ga0495680_0036061 Ga0495680_0036061_2450_3733 421
316 3300047444 Ga0495675_0000245 Ga0495675_0000245_26403_27686 421
317 3300047471 Ga0495684_0000016 Ga0495684_0000016_141238_142521 421
318 3300047673 Ga0495593_0001500 Ga0495593_0001500_1045_2328 421
319 3300047673 Ga0495593_0018915 Ga0495593_0018915_750_2033 421
320 3300047673 Ga0495593_0062137 Ga0495593_0062137_414_1697 421
321 3300048088 Ga0495602_0000024 Ga0495602_0000024_138442_139725 421
322 3300048903 Ga0496100_0002405 Ga0496100_0002405_3813_5096 421
323 3300048903 Ga0496100_0003748 Ga0496100_0003748_4534_5817 421
324 3300048903 Ga0496100_0020498 Ga0496100_0020498_837_2120 421
325 3300048904 Ga0496101_0001763 Ga0496101_0001763_3663_4946 421
326 3300048904 Ga0496101_0002134 Ga0496101_0002134_9938_11221 421
327 3300048904 Ga0496101_0005234 Ga0496101_0005234_51_1334 421
328 3300048905 Ga0496102_0005532 Ga0496102_0005532_1818_3101 421
329 3300048905 Ga0496102_0011817 Ga0496102_0011817_4054_5337 421
330 3300048905 Ga0496102_0018808 Ga0496102_0018808_4403_5686 421
331 3300048906 Ga0496103_0003142 Ga0496103_0003142_4322_5605 421
332 3300048907 Ga0496104_0002323 Ga0496104_0002323_1604_2887 421
333 3300048907 Ga0496104_0106764 Ga0496104_0106764_1227_2510 421
334 3300048907 Ga0496104_0146255 Ga0496104_0146255_392_1675 421
335 3300048908 Ga0496105_0017486 Ga0496105_0017486_2102_3385 421
336 3300048908 Ga0496105_0032692 Ga0496105_0032692_923_2206 421
337 3300048908 Ga0496105_0073963 Ga0496105_0073963_909_2192 421
338 3300048908 Ga0496105_0229312 Ga0496105_0229312_44_1327 421
339 3300048909 Ga0496106_0008421 Ga0496106_0008421_3290_4573 421
340 3300048909 Ga0496106_0033756 Ga0496106_0033756_1029_2312 421
341 3300048909 Ga0496106_0147435 Ga0496106_0147435_51_1334 421
342 3300048910 Ga0496107_0010740 Ga0496107_0010740_1342_2625 421
343 3300048911 Ga0496108_0010986 Ga0496108_0010986_2687_3970 421
344 3300048911 Ga0496108_0014948 Ga0496108_0014948_904_2187 421
345 3300048911 Ga0496108_0034543 Ga0496108_0034543_1396_2679 421
346 3300048912 Ga0496109_0014820 Ga0496109_0014820_886_2169 421
347 3300048912 Ga0496109_0016348 Ga0496109_0016348_2912_4195 421
348 3300048912 Ga0496109_0131477 Ga0496109_0131477_848_2131 421
349 3300048913 Ga0496110_0002430 Ga0496110_0002430_9248_10531 421
350 3300048913 Ga0496110_0005366 Ga0496110_0005366_1281_2564 421
351 3300048913 Ga0496110_0053532 Ga0496110_0053532_1293_2576 421
352 3300048914 Ga0496111_0003314 Ga0496111_0003314_3358_4641 421
353 3300048914 Ga0496111_0003533 Ga0496111_0003533_866_2149 421
354 3300048914 Ga0496111_0017099 Ga0496111_0017099_669_1952 421
355 3300048914 Ga0496111_0038133 Ga0496111_0038133_690_1973 421
356 3300048915 Ga0496112_0008924 Ga0496112_0008924_6221_7504 421
357 3300048915 Ga0496112_0109353 Ga0496112_0109353_617_1900 421
358 3300048915 Ga0496112_0191113 Ga0496112_0191113_662_1945 421
359 3300048916 Ga0496113_0008099 Ga0496113_0008099_51_1334 421
360 3300048916 Ga0496113_0011117 Ga0496113_0011117_748_2031 421
361 3300048917 Ga0496114_0001306 Ga0496114_0001306_4161_5444 421
362 3300048917 Ga0496114_0014735 Ga0496114_0014735_1187_2470 421
363 3300048918 Ga0496115_0031578 Ga0496115_0031578_863_2146 421
364 3300049741 Ga0501079_0112499 Ga0501079_0112499_288_1571 421
365 3300050507 nmdc:mga05p37_7272_c1 nmdc:mga05p37_7272_c1_1125_2408 421
366 3300050512 nmdc:mga0n895_78359_c1 nmdc:mga0n895_78359_c1_545_1828 421
367 3300050515 nmdc:mga0a205_65894_c1 nmdc:mga0a205_65894_c1_1528_2811 421
368 3300053077 Ga0495601_0000001 Ga0495601_0000001_481522_482805 421
369 3300053078 Ga0495612_0000017 Ga0495612_0000017_73307_74590 421
370 3300053084 Ga0495595_0000010 Ga0495595_0000010_100785_102068 421
371 3300053085 Ga0495619_0000004 Ga0495619_0000004_481559_482842 421
372 3300053085 Ga0495619_0000256 Ga0495619_0000256_26316_27599 421
373 iso_pu_bacteria 2857465823 2857467614 421
374 iso_pu_bacteria 2857591370 2857594872 421
375 iso_pu_bacteria 2929177148 2929179756 421
376 iso_pu_bacteria 2945977869 2945982178 421
377 iso_pu_bacteria 2946013367 2946018431 421
378 iso_pu_bacteria 2970627176 2970630301 421
379 3300013297 Ga0157378_10006718 Ga0157378_100067184 422
380 3300025927 Ga0207687_10097740 Ga0207687_100977402 422
381 3300035691 Ga0373931_0073717 Ga0373931_0073717_39_1358 422
382 3300037418 Ga0395900_0096654 Ga0395900_0096654_253_1530 422
383 3300037466 Ga0395898_0208029 Ga0395898_0208029_426_1703 422
384 3300048907 Ga0496104_0277861 Ga0496104_0277861_62_1354 422
385 iso_pu_bacteria 2511231008 2511276579 422
386 iso_pu_bacteria 2511231012 2511301797 422
387 iso_pu_bacteria 2511231015 2511319118 422
388 iso_pu_bacteria 2511231021 2511358085 422
389 iso_pu_bacteria 2511231156 2511822812 422
390 iso_pu_bacteria 2599185248 2599768580 422
391 iso_pu_bacteria 2599185289 2599889663 422
392 iso_pu_bacteria 2599185291 2599901288 422
393 iso_pu_bacteria 2599185315 2600019745 422
394 iso_pu_bacteria 2599185318 2600036228 422
395 iso_pu_bacteria 2599185321 2600054255 422
396 iso_pu_bacteria 2667528170 2671094015 422
397 iso_pu_bacteria 2667528176 2671126807 422
398 iso_pu_bacteria 2765235841 2765584748 422
399 iso_pu_bacteria 2773857670 2774120070 422
400 iso_pu_bacteria 2784132072 2784311999 422
401 iso_pu_bacteria 2900634093 2900638987 422
402 iso_pu_bacteria 2904434214 2904436230 422
403 iso_pu_bacteria 2919481497 2919483553 422
404 3300005435 Ga0070714_100018509 Ga0070714_1000185094 423
405 3300006028 Ga0070717_10016626 Ga0070717_100166265 423
406 3300006844 Ga0075428_100058917 Ga0075428_1000589172 423
407 3300031727 Ga0316576_10232137 Ga0316576_102321372 423
408 3300045976 Ga0466967_0008760 Ga0466967_0008760_4976_6298 423
409 3300049568 Ga0501031_0106923 Ga0501031_0106923_243_1529 423
410 3300049575 Ga0501039_0046794 Ga0501039_0046794_35_1321 423
411 3300049577 Ga0501041_0058997 Ga0501041_0058997_906_2192 423
412 3300049582 Ga0501048_0060290 Ga0501048_0060290_1025_2311 423
413 3300049591 Ga0501075_0068951 Ga0501075_0068951_125_1411 423
414 3300049592 Ga0501076_0008353 Ga0501076_0008353_4367_5653 423
415 3300049741 Ga0501079_0104511 Ga0501079_0104511_139_1425 423
416 3300049743 Ga0501081_0010162 Ga0501081_0010162_4633_5919 423
417 3300049824 Ga0501045_0059322 Ga0501045_0059322_1271_2557 423
418 3300054114 Ga0501084_0087457 Ga0501084_0087457_712_1998 423
419 3300060353 Ga0501082_0076312 Ga0501082_0076312_791_2077 423
420 iso_pu_bacteria 2687453737 2689963826 423
421 iso_pu_bacteria 2956897341 2956902667 423
422 3300033180 Ga0307510_10068787 Ga0307510_100687871 424
423 3300042461 Ga0439460_0000006 Ga0439460_0000006_17926_19203 424
424 3300046453 Ga0495627_006396 Ga0495627_006396_1913_3190 424
425 3300046471 Ga0495650_0000101 Ga0495650_0000101_33163_34440 424
426 3300046474 Ga0495605_0000002 Ga0495605_0000002_148393_149670 424
427 3300046474 Ga0495605_0001149 Ga0495605_0001149_9867_11144 424
428 3300046474 Ga0495605_0007792 Ga0495605_0007792_3308_4585 424
429 3300046491 Ga0495584_0008448 Ga0495584_0008448_3040_4317 424
430 3300046492 Ga0495585_0023883 Ga0495585_0023883_195_1472 424
431 3300046499 Ga0495594_0009963 Ga0495594_0009963_1319_2596 424
432 3300046500 Ga0495596_0010487 Ga0495596_0010487_2360_3637 424
433 3300046501 Ga0495607_0025635 Ga0495607_0025635_354_1631 424
434 3300046506 Ga0495583_0000012 Ga0495583_0000012_283149_284426 424
435 3300046507 Ga0495606_0020057 Ga0495606_0020057_720_1997 424
436 3300046512 Ga0495610_0002250 Ga0495610_0002250_5938_7215 424
437 3300046513 Ga0495616_0006071 Ga0495616_0006071_4360_5637 424
438 3300046515 Ga0495620_0000010 Ga0495620_0000010_52667_53944 424
439 3300046515 Ga0495620_0002511 Ga0495620_0002511_5248_6525 424
440 3300046518 Ga0495631_0018055 Ga0495631_0018055_1889_3166 424
441 3300046518 Ga0495631_0021492 Ga0495631_0021492_1297_2574 424
442 3300046519 Ga0495632_0004399 Ga0495632_0004399_868_2145 424
443 3300046522 Ga0495643_0001779 Ga0495643_0001779_8721_9998 424
444 3300046523 Ga0495644_0004763 Ga0495644_0004763_1388_2665 424
445 3300046524 Ga0495648_0002321 Ga0495648_0002321_4542_5819 424
446 3300046524 Ga0495648_0004234 Ga0495648_0004234_2924_4201 424
447 3300046530 Ga0495654_0000333 Ga0495654_0000333_25081_26358 424
448 3300046538 Ga0495609_0000008 Ga0495609_0000008_109680_110957 424
449 3300046538 Ga0495609_0000016 Ga0495609_0000016_123793_125070 424
450 3300046557 Ga0495622_0001895 Ga0495622_0001895_6838_8115 424
451 3300046558 Ga0495633_0000009 Ga0495633_0000009_130483_131760 424
452 3300046616 Ga0495668_0001168 Ga0495668_0001168_14269_15546 424
453 3300046648 Ga0495611_0003046 Ga0495611_0003046_3185_4462 424
454 3300046648 Ga0495611_0055828 Ga0495611_0055828_142_1419 424
455 3300046660 Ga0495625_0006644 Ga0495625_0006644_7433_8710 424
456 3300046665 Ga0495661_0000029 Ga0495661_0000029_149138_150415 424
457 3300046692 Ga0495671_0005269 Ga0495671_0005269_4236_5513 424
458 3300046692 Ga0495671_0051736 Ga0495671_0051736_45_1322 424
459 3300046694 Ga0495649_0011341 Ga0495649_0011341_232_1509 424
460 3300046794 Ga0495589_0000251 Ga0495589_0000251_38818_40095 424
461 3300046810 Ga0495660_0000926 Ga0495660_0000926_11999_13276 424
462 3300046810 Ga0495660_0001193 Ga0495660_0001193_244_1521 424
463 3300047321 Ga0495676_0000001 Ga0495676_0000001_136909_138186 424
464 3300047323 Ga0495683_0000042 Ga0495683_0000042_68990_70267 424
465 3300047323 Ga0495683_0012140 Ga0495683_0012140_1992_3269 424
466 3300047446 Ga0495679_000042 Ga0495679_000042_72631_73908 424
467 3300047446 Ga0495679_000060 Ga0495679_000060_68134_69411 424
468 3300047469 Ga0495673_0001705 Ga0495673_0001705_13196_14473 424
469 3300047469 Ga0495673_0017928 Ga0495673_0017928_1431_2708 424
470 3300047472 Ga0495686_0037241 Ga0495686_0037241_139_1416 424
471 3300048091 Ga0495626_0000002 Ga0495626_0000002_181938_183215 424
472 3300048925 Ga0496122_0007096 Ga0496122_0007096_10222_11499 424
473 3300049459 Ga0495678_000011 Ga0495678_000011_118653_119930 424
474 3300049459 Ga0495678_008279 Ga0495678_008279_3619_4896 424
475 iso_pu_bacteria 2857453340 2857454870 424
476 iso_pu_bacteria 2883291878 2883295589 424
477 3300048915 Ga0496112_0001155 Ga0496112_0001155_12427_13707 425
478 iso_pu_bacteria 2513237094 2513639871 425
479 iso_pu_bacteria 2643221629 2644168612 425
480 iso_pu_bacteria 2643221662 2644346509 425
481 iso_pu_bacteria 2849560528 2849563501 425
482 iso_pu_bacteria 2856328259 2856332302 425
483 iso_pu_bacteria 2869169390 2869175115 425
484 iso_pu_bacteria 2869242130 2869246688 425
485 iso_pu_bacteria 2869249662 2869250476 425
486 iso_pu_bacteria 2869264136 2869269098 425
487 iso_pu_bacteria 2869271264 2869273829 425
488 iso_pu_bacteria 2871435913 2871439557 425
489 iso_pu_bacteria 2871481445 2871481824 425
490 iso_pu_bacteria 2874116593 2874122728 425
491 iso_pu_bacteria 2874131515 2874138946 425
492 iso_pu_bacteria 2876386047 2876389416 425
493 iso_pu_bacteria 2876399893 2876400758 425
494 iso_pu_bacteria 2876420981 2876423143 425
495 iso_pu_bacteria 2881412998 2881413395 425
496 iso_pu_bacteria 2885270888 2885276973 425
497 iso_pu_bacteria 2898329390 2898330641 425
498 iso_pu_bacteria 2904541872 2904542756 425
499 iso_pu_bacteria 2906363423 2906365484 425
500 iso_pu_bacteria 2906370794 2906373358 425
501 iso_pu_bacteria 2906393657 2906400299 425
502 iso_pu_bacteria 2906401398 2906403281 425
503 iso_pu_bacteria 2924710171 2924712672 425
504 iso_pu_bacteria 2924741084 2924741819 425
505 iso_pu_bacteria 2929160207 2929168005 425
506 iso_pu_bacteria 2929199973 2929201684 425
507 iso_pu_bacteria 2937861824 2937862810 425
508 iso_pu_bacteria 2937868953 2937874559 425
509 iso_pu_bacteria 2937980651 2937982078 425
510 iso_pu_bacteria 2958108152 2958114586 425
511 iso_pu_bacteria 2961183825 2961190464 425
512 iso_pu_bacteria 2965025482 2965028230 425
513 iso_pu_bacteria 2965040258 2965041911 425
514 iso_pu_bacteria 2965089291 2965092394 425
515 iso_pu_bacteria 2970547951 2970551477 425
516 iso_pu_bacteria 2977851361 2977853770 425
517 iso_pu_bacteria 2977907340 2977912884 425
518 iso_pu_bacteria 2977950692 2977950817 425
519 iso_pu_bacteria 2979764755 2979768989 425
520 iso_pu_bacteria 2979772303 2979772962 425
521 iso_pu_bacteria 2996386984 2996388653 425
522 iso_pu_bacteria 3004195979 3004202362 425
523 iso_pu_bacteria 3004248173 3004250009 425
524 iso_pu_bacteria 8004312739 8004320055 425
525 iso_pu_bacteria 8004361976 8004362416 425
526 iso_pu_bacteria 8004727605 8004730486 425
527 iso_pu_bacteria 8055909800 8055915880 425
528 3300003761 Ga0055535_1000052 Ga0055535_100005292 426
529 3300003763 Ga0055529_1000239 Ga0055529_100023948 426
530 3300003791 Ga0055530_10008875 Ga0055530_100088753 426
531 3300005288 Ga0065714_10065580 Ga0065714_100655802 426
532 3300005364 Ga0070673_100300593 Ga0070673_1003005931 426
533 3300005441 Ga0070700_100039252 Ga0070700_1000392521 426
534 3300005535 Ga0070684_100090907 Ga0070684_1000909072 426
535 3300005536 Ga0070697_100017134 Ga0070697_1000171345 426
536 3300006058 Ga0075432_10000834 Ga0075432_100008343 426
537 3300006914 Ga0075436_100005727 Ga0075436_1000057272 426
538 3300009011 Ga0105251_10002240 Ga0105251_100022404 426
539 3300009098 Ga0105245_10342855 Ga0105245_103428551 426
540 3300009148 Ga0105243_10026218 Ga0105243_100262184 426
541 3300009176 Ga0105242_10038782 Ga0105242_100387823 426
542 3300014325 Ga0163163_10062965 Ga0163163_100629652 426
543 3300014326 Ga0157380_10058688 Ga0157380_100586881 426
544 3300014497 Ga0182008_10000813 Ga0182008_100008139 426
545 3300015261 Ga0182006_1000562 Ga0182006_10005627 426
546 3300015261 Ga0182006_1009535 Ga0182006_10095352 426
547 3300015262 Ga0182007_10000152 Ga0182007_1000015213 426
548 3300015265 Ga0182005_1000181 Ga0182005_100018128 426
549 3300015265 Ga0182005_1000857 Ga0182005_10008578 426
550 3300015265 Ga0182005_1005618 Ga0182005_10056182 426
551 3300021384 Ga0213876_10112985 Ga0213876_101129851 426
552 3300025242 Ga0209258_100074 Ga0209258_100074200 426
553 3300025254 Ga0209148_1002491 Ga0209148_10024912 426
554 3300025256 Ga0209759_1007857 Ga0209759_10078573 426
555 3300025272 Ga0209455_1000066 Ga0209455_1000066240 426
556 3300025292 Ga0209676_1002918 Ga0209676_10029188 426
557 3300025298 Ga0209050_1001242 Ga0209050_10012424 426
558 3300025735 Ga0207713_1010220 Ga0207713_10102203 426
559 3300025922 Ga0207646_10036647 Ga0207646_100366473 426
560 3300025938 Ga0207704_10065272 Ga0207704_100652722 426
561 3300025940 Ga0207691_10026254 Ga0207691_100262544 426
562 3300027907 Ga0207428_10014412 Ga0207428_100144123 426
563 3300028381 Ga0268264_10062188 Ga0268264_100621882 426
564 3300028666 Ga0265336_10000029 Ga0265336_100000298 426
565 3300028794 Ga0307515_10000378 Ga0307515_10000378100 426
566 3300029957 Ga0265324_10000372 Ga0265324_1000037222 426
567 3300031456 Ga0307513_10016290 Ga0307513_100162905 426
568 3300031548 Ga0307408_100232538 Ga0307408_1002325381 426
569 3300031649 Ga0307514_10000827 Ga0307514_1000082712 426
570 3300031731 Ga0307405_10000100 Ga0307405_1000010027 426
571 3300031911 Ga0307412_10000323 Ga0307412_1000032310 426
572 3300032005 Ga0307411_10020413 Ga0307411_100204132 426
573 3300039437 Ga0436365_1644591 Ga0436365_1644591_1111_2433 426
574 3300039453 Ga0436362_0755809 Ga0436362_0755809_29_1351 426
575 3300046452 Ga0495617_000254 Ga0495617_000254_14483_15766 426
576 3300046452 Ga0495617_023056 Ga0495617_023056_620_1960 426
577 3300046453 Ga0495627_004049 Ga0495627_004049_637_1977 426
578 3300046455 Ga0495603_0004739 Ga0495603_0004739_1738_3021 426
579 3300046457 Ga0495590_0000100 Ga0495590_0000100_35746_37029 426
580 3300046458 Ga0495591_000008 Ga0495591_000008_55124_56407 426
581 3300046458 Ga0495591_000981 Ga0495591_000981_17605_18945 426
582 3300046460 Ga0495638_0000827 Ga0495638_0000827_30295_31578 426
583 3300046460 Ga0495638_0000830 Ga0495638_0000830_16171_17454 426
584 3300046460 Ga0495638_0078656 Ga0495638_0078656_342_1625 426
585 3300046463 Ga0495653_0000442 Ga0495653_0000442_20997_22337 426
586 3300046463 Ga0495653_0085474 Ga0495653_0085474_311_1594 426
587 3300046471 Ga0495650_0000793 Ga0495650_0000793_8527_9810 426
588 3300046473 Ga0495582_0036443 Ga0495582_0036443_1210_2550 426
589 3300046474 Ga0495605_0000170 Ga0495605_0000170_34474_35757 426
590 3300046474 Ga0495605_0001103 Ga0495605_0001103_4381_5664 426
591 3300046474 Ga0495605_0001490 Ga0495605_0001490_4245_5528 426
592 3300046474 Ga0495605_0045784 Ga0495605_0045784_288_1571 426
593 3300046491 Ga0495584_0000012 Ga0495584_0000012_49911_51194 426
594 3300046491 Ga0495584_0000332 Ga0495584_0000332_25303_26586 426
595 3300046492 Ga0495585_0000056 Ga0495585_0000056_49009_50292 426
596 3300046492 Ga0495585_0000105 Ga0495585_0000105_20130_21413 426
597 3300046499 Ga0495594_0054388 Ga0495594_0054388_102_1442 426
598 3300046500 Ga0495596_0000161 Ga0495596_0000161_39434_40717 426
599 3300046501 Ga0495607_0000194 Ga0495607_0000194_57219_58505 426
600 3300046501 Ga0495607_0002405 Ga0495607_0002405_2862_4145 426
601 3300046501 Ga0495607_0003246 Ga0495607_0003246_4652_5935 426
602 3300046501 Ga0495607_0008052 Ga0495607_0008052_2851_4191 426
603 3300046501 Ga0495607_0079125 Ga0495607_0079125_26_1366 426
604 3300046506 Ga0495583_0000354 Ga0495583_0000354_52250_53533 426
605 3300046506 Ga0495583_0000715 Ga0495583_0000715_35212_36495 426
606 3300046506 Ga0495583_0000875 Ga0495583_0000875_34873_36213 426
607 3300046506 Ga0495583_0011078 Ga0495583_0011078_877_2160 426
608 3300046507 Ga0495606_0000354 Ga0495606_0000354_55417_56757 426
609 3300046507 Ga0495606_0065969 Ga0495606_0065969_920_2260 426
610 3300046512 Ga0495610_0001011 Ga0495610_0001011_8977_10260 426
611 3300046512 Ga0495610_0014593 Ga0495610_0014593_323_1606 426
612 3300046512 Ga0495610_0093855 Ga0495610_0093855_31_1314 426
613 3300046513 Ga0495616_0000455 Ga0495616_0000455_9840_11123 426
614 3300046513 Ga0495616_0001464 Ga0495616_0001464_5718_7058 426
615 3300046513 Ga0495616_0003793 Ga0495616_0003793_3770_5053 426
616 3300046513 Ga0495616_0006725 Ga0495616_0006725_1011_2297 426
617 3300046515 Ga0495620_0000367 Ga0495620_0000367_4908_6248 426
618 3300046515 Ga0495620_0002382 Ga0495620_0002382_5600_6940 426
619 3300046517 Ga0495630_0001474 Ga0495630_0001474_10950_12233 426
620 3300046519 Ga0495632_0000298 Ga0495632_0000298_4784_6067 426
621 3300046519 Ga0495632_0001005 Ga0495632_0001005_299_1582 426
622 3300046519 Ga0495632_0001671 Ga0495632_0001671_16255_17595 426
623 3300046520 Ga0495637_0031287 Ga0495637_0031287_683_1966 426
624 3300046522 Ga0495643_0000849 Ga0495643_0000849_4599_5882 426
625 3300046522 Ga0495643_0008509 Ga0495643_0008509_2888_4171 426
626 3300046522 Ga0495643_0009432 Ga0495643_0009432_3840_5180 426
627 3300046523 Ga0495644_0000089 Ga0495644_0000089_25084_26367 426
628 3300046523 Ga0495644_0000122 Ga0495644_0000122_9326_10666 426
629 3300046523 Ga0495644_0020303 Ga0495644_0020303_1056_2339 426
630 3300046524 Ga0495648_0000471 Ga0495648_0000471_22714_24054 426
631 3300046524 Ga0495648_0000779 Ga0495648_0000779_5082_6365 426
632 3300046524 Ga0495648_0029882 Ga0495648_0029882_328_1611 426
633 3300046524 Ga0495648_0064997 Ga0495648_0064997_796_2136 426
634 3300046528 Ga0495642_0000015 Ga0495642_0000015_89560_90843 426
635 3300046529 Ga0495652_0209455 Ga0495652_0209455_168_1451 426
636 3300046530 Ga0495654_0000780 Ga0495654_0000780_5717_7057 426
637 3300046530 Ga0495654_0001049 Ga0495654_0001049_338_1621 426
638 3300046530 Ga0495654_0039974 Ga0495654_0039974_342_1625 426
639 3300046535 Ga0495586_0004363 Ga0495586_0004363_3934_5274 426
640 3300046536 Ga0495587_0000458 Ga0495587_0000458_10250_11590 426
641 3300046536 Ga0495587_0000606 Ga0495587_0000606_9148_10431 426
642 3300046538 Ga0495609_0000026 Ga0495609_0000026_5873_7159 426
643 3300046542 Ga0495597_0002701 Ga0495597_0002701_9366_10649 426
644 3300046542 Ga0495597_0024152 Ga0495597_0024152_98_1381 426
645 3300046557 Ga0495622_0001383 Ga0495622_0001383_5707_6990 426
646 3300046615 Ga0495656_0002001 Ga0495656_0002001_5143_6426 426
647 3300046615 Ga0495656_0013793 Ga0495656_0013793_296_1582 426
648 3300046616 Ga0495668_0035276 Ga0495668_0035276_648_1931 426
649 3300046660 Ga0495625_0001308 Ga0495625_0001308_9771_11054 426
650 3300046660 Ga0495625_0002329 Ga0495625_0002329_4667_5950 426
651 3300046660 Ga0495625_0030346 Ga0495625_0030346_2578_3918 426
652 3300046660 Ga0495625_0088501 Ga0495625_0088501_758_2041 426
653 3300046663 Ga0495635_0000159 Ga0495635_0000159_27635_28975 426
654 3300046665 Ga0495661_0000043 Ga0495661_0000043_84559_85899 426
655 3300046665 Ga0495661_0000152 Ga0495661_0000152_5855_7141 426
656 3300046665 Ga0495661_0000850 Ga0495661_0000850_10727_12067 426
657 3300046665 Ga0495661_0032511 Ga0495661_0032511_213_1553 426
658 3300046674 Ga0495588_0001377 Ga0495588_0001377_290_1573 426
659 3300046674 Ga0495588_0005052 Ga0495588_0005052_3057_4340 426
660 3300046674 Ga0495588_0050625 Ga0495588_0050625_657_1940 426
661 3300046678 Ga0495599_0070773 Ga0495599_0070773_182_1465 426
662 3300046680 Ga0495646_0000197 Ga0495646_0000197_23099_24382 426
663 3300046684 Ga0495669_0006270 Ga0495669_0006270_1936_3219 426
664 3300046689 Ga0495613_0000403 Ga0495613_0000403_10686_11969 426
665 3300046692 Ga0495671_0000410 Ga0495671_0000410_6761_8044 426
666 3300046692 Ga0495671_0001111 Ga0495671_0001111_3899_5239 426
667 3300046692 Ga0495671_0002075 Ga0495671_0002075_5442_6725 426
668 3300046692 Ga0495671_0053015 Ga0495671_0053015_427_1710 426
669 3300046694 Ga0495649_0001219 Ga0495649_0001219_10031_11314 426
670 3300046694 Ga0495649_0006023 Ga0495649_0006023_5803_7143 426
671 3300046694 Ga0495649_0009751 Ga0495649_0009751_1788_3071 426
672 3300046694 Ga0495649_0045548 Ga0495649_0045548_698_1981 426
673 3300046794 Ga0495589_0000101 Ga0495589_0000101_75425_76711 426
674 3300046794 Ga0495589_0001783 Ga0495589_0001783_9811_11094 426
675 3300046794 Ga0495589_0001792 Ga0495589_0001792_9418_10758 426
676 3300046794 Ga0495589_0004826 Ga0495589_0004826_4181_5521 426
677 3300046809 Ga0495600_0000561 Ga0495600_0000561_15674_16957 426
678 3300046809 Ga0495600_0013607 Ga0495600_0013607_1343_2683 426
679 3300046810 Ga0495660_0000151 Ga0495660_0000151_52250_53533 426
680 3300046810 Ga0495660_0000276 Ga0495660_0000276_3100_4383 426
681 3300046810 Ga0495660_0000561 Ga0495660_0000561_551_1834 426
682 3300046810 Ga0495660_0001106 Ga0495660_0001106_12319_13602 426
683 3300046810 Ga0495660_0015344 Ga0495660_0015344_266_1549 426
684 3300047319 Ga0495674_0042484 Ga0495674_0042484_2559_3842 426
685 3300047320 Ga0495672_0000671 Ga0495672_0000671_16602_17885 426
686 3300047320 Ga0495672_0000828 Ga0495672_0000828_31510_32850 426
687 3300047320 Ga0495672_0000860 Ga0495672_0000860_20481_21764 426
688 3300047322 Ga0495680_0000079 Ga0495680_0000079_19103_20443 426
689 3300047322 Ga0495680_0001052 Ga0495680_0001052_5834_7117 426
690 3300047322 Ga0495680_0002410 Ga0495680_0002410_15096_16379 426
691 3300047323 Ga0495683_0000022 Ga0495683_0000022_53533_54873 426
692 3300047443 Ga0495687_000037 Ga0495687_000037_5873_7159 426
693 3300047444 Ga0495675_0000527 Ga0495675_0000527_13709_14992 426
694 3300047445 Ga0495677_0000014 Ga0495677_0000014_129078_130364 426
695 3300047445 Ga0495677_0001369 Ga0495677_0001369_3727_5010 426
696 3300047469 Ga0495673_0000142 Ga0495673_0000142_92564_93847 426
697 3300047469 Ga0495673_0000824 Ga0495673_0000824_2489_3772 426
698 3300047469 Ga0495673_0000849 Ga0495673_0000849_10726_12009 426
699 3300047469 Ga0495673_0004583 Ga0495673_0004583_5122_6405 426
700 3300047470 Ga0495681_0001555 Ga0495681_0001555_568_1908 426
701 3300047470 Ga0495681_0001678 Ga0495681_0001678_2888_4171 426
702 3300047470 Ga0495681_0003122 Ga0495681_0003122_5466_6806 426
703 3300047470 Ga0495681_0012199 Ga0495681_0012199_3407_4747 426
704 3300047472 Ga0495686_0001995 Ga0495686_0001995_13477_14760 426
705 3300047673 Ga0495593_0001060 Ga0495593_0001060_9630_10913 426
706 3300048091 Ga0495626_0000049 Ga0495626_0000049_82126_83409 426
707 3300048091 Ga0495626_0000243 Ga0495626_0000243_14375_15658 426
708 3300048091 Ga0495626_0000289 Ga0495626_0000289_47300_48586 426
709 3300048905 Ga0496102_0000130 Ga0496102_0000130_78089_79372 426
710 3300048906 Ga0496103_0000419 Ga0496103_0000419_24885_26168 426
711 3300048907 Ga0496104_0203393 Ga0496104_0203393_53_1336 426
712 3300048911 Ga0496108_0180073 Ga0496108_0180073_333_1616 426
713 3300048918 Ga0496115_0074356 Ga0496115_0074356_1403_2686 426
714 3300048919 Ga0496116_0043572 Ga0496116_0043572_32_1315 426
715 3300048920 Ga0496117_0002642 Ga0496117_0002642_16407_17690 426
716 3300048920 Ga0496117_0024264 Ga0496117_0024264_882_2222 426
717 3300048921 Ga0496118_0003017 Ga0496118_0003017_15907_17190 426
718 3300048921 Ga0496118_0005276 Ga0496118_0005276_9661_11001 426
719 3300048927 Ga0496124_0017736 Ga0496124_0017736_4763_6103 426
720 3300048929 Ga0496126_0020582 Ga0496126_0020582_1061_2344 426
721 3300049459 Ga0495678_000873 Ga0495678_000873_25137_26420 426
722 3300049460 Ga0495682_0000322 Ga0495682_0000322_19869_21152 426
723 3300049575 Ga0501039_0032753 Ga0501039_0032753_1918_3207 426
724 3300049577 Ga0501041_0011429 Ga0501041_0011429_3573_4862 426
725 3300049582 Ga0501048_0130659 Ga0501048_0130659_154_1443 426
726 3300049588 Ga0501072_0001662 Ga0501072_0001662_12276_13565 426
727 3300049591 Ga0501075_0001616 Ga0501075_0001616_6660_7949 426
728 3300049824 Ga0501045_0011349 Ga0501045_0011349_3048_4337 426
729 3300050514 nmdc:mga08x19_96017_c1 nmdc:mga08x19_96017_c1_410_1750 426
730 3300061734 Ga0530510_0002303 Ga0530510_0002303_10326_11615 426
731 iso_pu_bacteria 2791355137 2792833816 426
732 iso_pu_bacteria 2842854478 2842857996 426
733 iso_pu_bacteria 2857357740 2857365366 426
734 iso_pu_bacteria 642555112 642599031 426
735 3300003758 Ga0055532_1000249 Ga0055532_100024924 427
736 3300003760 Ga0055527_1000207 Ga0055527_100020712 427
737 3300003761 Ga0055535_1000437 Ga0055535_100043712 427
738 3300003762 Ga0055542_1000457 Ga0055542_100045712 427
739 3300003763 Ga0055529_1000395 Ga0055529_100039510 427
740 3300005295 Ga0065707_10169157 Ga0065707_101691571 427
741 3300005336 Ga0070680_100008502 Ga0070680_1000085028 427
742 3300005337 Ga0070682_100019858 Ga0070682_1000198582 427
743 3300005438 Ga0070701_10018964 Ga0070701_100189641 427
744 3300005530 Ga0070679_100056647 Ga0070679_1000566471 427
745 3300005544 Ga0070686_100004150 Ga0070686_1000041504 427
746 3300005545 Ga0070695_100007796 Ga0070695_1000077962 427
747 3300005547 Ga0070693_100018861 Ga0070693_1000188612 427
748 3300005614 Ga0068856_100229555 Ga0068856_1002295553 427
749 3300005614 Ga0068856_100238857 Ga0068856_1002388572 427
750 3300005617 Ga0068859_100050191 Ga0068859_1000501915 427
751 3300005718 Ga0068866_10001011 Ga0068866_100010119 427
752 3300006237 Ga0097621_100034759 Ga0097621_1000347592 427
753 3300006844 Ga0075428_100006970 Ga0075428_1000069706 427
754 3300006871 Ga0075434_100003524 Ga0075434_10000352415 427
755 3300006880 Ga0075429_100004649 Ga0075429_1000046499 427
756 3300006931 Ga0097620_100050189 Ga0097620_1000501892 427
757 3300009093 Ga0105240_10015342 Ga0105240_100153425 427
758 3300009093 Ga0105240_10071601 Ga0105240_100716013 427
759 3300009148 Ga0105243_10008728 Ga0105243_100087284 427
760 3300013104 Ga0157370_10019032 Ga0157370_100190323 427
761 3300013297 Ga0157378_10044269 Ga0157378_100442694 427
762 3300014325 Ga0163163_10037843 Ga0163163_100378434 427
763 3300025228 Ga0209672_100025 Ga0209672_100025308 427
764 3300025229 Ga0209147_100032 Ga0209147_100032308 427
765 3300025242 Ga0209258_100050 Ga0209258_100050308 427
766 3300025254 Ga0209148_1000060 Ga0209148_1000060308 427
767 3300025272 Ga0209455_1000055 Ga0209455_1000055308 427
768 3300025911 Ga0207654_10053538 Ga0207654_100535382 427
769 3300025913 Ga0207695_10146268 Ga0207695_101462682 427
770 3300025916 Ga0207663_10123804 Ga0207663_101238042 427
771 3300025918 Ga0207662_10000171 Ga0207662_1000017114 427
772 3300025928 Ga0207700_10091916 Ga0207700_100919162 427
773 3300025934 Ga0207686_10009011 Ga0207686_100090113 427
774 3300025938 Ga0207704_10052906 Ga0207704_100529063 427
775 3300025942 Ga0207689_10001391 Ga0207689_1000139122 427
776 3300026075 Ga0207708_10003464 Ga0207708_100034645 427
777 3300026089 Ga0207648_10002207 Ga0207648_1000220713 427
778 3300026118 Ga0207675_100001449 Ga0207675_1000014493 427
779 3300027462 Ga0210000_1004378 Ga0210000_10043781 427
780 3300027526 Ga0209968_1009597 Ga0209968_10095971 427
781 3300028786 Ga0307517_10003354 Ga0307517_100033548 427
782 3300028800 Ga0265338_10042081 Ga0265338_100420816 427
783 3300031456 Ga0307513_10070494 Ga0307513_100704943 427
784 3300035088 Ga0373940_0007169 Ga0373940_0007169_569_1861 427
785 3300035089 Ga0373944_0009265 Ga0373944_0009265_1257_2549 427
786 3300035172 Ga0373955_0086564 Ga0373955_0086564_469_1755 427
787 3300035410 Ga0373924_0035685 Ga0373924_0035685_629_1915 427
788 3300035695 Ga0373927_0033526 Ga0373927_0033526_121_1413 427
789 3300035725 Ga0373947_0047961 Ga0373947_0047961_711_2003 427
790 3300036401 Ga0373937_0031620 Ga0373937_0031620_1173_2459 427
791 3300037068 Ga0373925_0028128 Ga0373925_0028128_2663_3949 427
792 3300042125 Ga0450923_013215 Ga0450923_013215_183_1484 427
793 3300042146 Ga0450907_006652 Ga0450907_006652_400_1704 427
794 3300042436 Ga0439435_0007814 Ga0439435_0007814_693_1985 427
795 3300044693 Ga0466961_0000259 Ga0466961_0000259_9728_11095 427
796 3300045976 Ga0466967_0015127 Ga0466967_0015127_1251_2564 427
797 3300046455 Ga0495603_0028911 Ga0495603_0028911_581_1873 427
798 3300046462 Ga0495651_0059889 Ga0495651_0059889_96_1382 427
799 3300046472 Ga0495580_0013053 Ga0495580_0013053_3683_4975 427
800 3300046475 Ga0495639_0025290 Ga0495639_0025290_1140_2432 427
801 3300046526 Ga0495666_0031579 Ga0495666_0031579_1172_2464 427
802 3300046535 Ga0495586_0006035 Ga0495586_0006035_3442_4734 427
803 3300046559 Ga0495667_0119386 Ga0495667_0119386_281_1567 427
804 3300046674 Ga0495588_0035338 Ga0495588_0035338_749_2041 427
805 3300046678 Ga0495599_0010539 Ga0495599_0010539_1743_3029 427
806 3300046683 Ga0495658_0003618 Ga0495658_0003618_1168_2460 427
807 3300047315 Ga0495581_0045174 Ga0495581_0045174_41_1333 427
808 3300047319 Ga0495674_0053964 Ga0495674_0053964_1743_3029 427
809 3300047471 Ga0495684_0095899 Ga0495684_0095899_585_1871 427
810 3300047471 Ga0495684_0177015 Ga0495684_0177015_239_1525 427
811 3300049521 Ga0501298_010528 Ga0501298_010528_87_1400 427
812 3300049568 Ga0501031_0015894 Ga0501031_0015894_1515_2822 427
813 3300049569 Ga0501032_0111256 Ga0501032_0111256_327_1634 427
814 3300049572 Ga0501036_0001202 Ga0501036_0001202_1424_2731 427
815 3300049575 Ga0501039_0007339 Ga0501039_0007339_1479_2786 427
816 3300049576 Ga0501040_0109292 Ga0501040_0109292_93_1418 427
817 3300049578 Ga0501042_0088860 Ga0501042_0088860_305_1612 427
818 3300049587 Ga0501071_0158636 Ga0501071_0158636_189_1496 427
819 3300049588 Ga0501072_0169706 Ga0501072_0169706_119_1426 427
820 3300049589 Ga0501073_0163880 Ga0501073_0163880_232_1518 427
821 3300049590 Ga0501074_0001550 Ga0501074_0001550_9397_10704 427
822 3300049591 Ga0501075_0015017 Ga0501075_0015017_2110_3441 427
823 3300049591 Ga0501075_0048774 Ga0501075_0048774_537_1844 427
824 3300049592 Ga0501076_0005033 Ga0501076_0005033_7849_9156 427
825 3300049592 Ga0501076_0008894 Ga0501076_0008894_3850_5157 427
826 3300049592 Ga0501076_0166013 Ga0501076_0166013_235_1542 427
827 3300049592 Ga0501076_0194302 Ga0501076_0194302_15_1346 427
828 3300049593 Ga0501077_0042661 Ga0501077_0042661_1316_2623 427
829 3300049741 Ga0501079_0140996 Ga0501079_0140996_293_1600 427
830 3300049742 Ga0501080_0302855 Ga0501080_0302855_72_1379 427
831 3300049743 Ga0501081_0010538 Ga0501081_0010538_3231_4538 427
832 3300049743 Ga0501081_0018805 Ga0501081_0018805_1229_2536 427
833 3300049822 Ga0501035_0111751 Ga0501035_0111751_606_1913 427
834 3300049824 Ga0501045_0019906 Ga0501045_0019906_82_1389 427
835 3300050508 nmdc:mga09592_14450_c1 nmdc:mga09592_14450_c1_812_2104 427
836 3300050512 nmdc:mga0n895_1531_c1 nmdc:mga0n895_1531_c1_15875_17188 427
837 3300050513 nmdc:mga0rr50_40898_c1 nmdc:mga0rr50_40898_c1_2009_3322 427
838 3300054114 Ga0501084_0069416 Ga0501084_0069416_148_1455 427
839 3300054114 Ga0501084_0248081 Ga0501084_0248081_56_1351 427
840 3300060353 Ga0501082_0044116 Ga0501082_0044116_582_1889 427
841 3300060353 Ga0501082_0082809 Ga0501082_0082809_419_1726 427
842 3300061734 Ga0530510_0031828 Ga0530510_0031828_1242_2549 427
843 3300005843 Ga0068860_100063199 Ga0068860_1000631993 428
844 3300006058 Ga0075432_10005043 Ga0075432_100050432 428
845 3300009093 Ga0105240_10377453 Ga0105240_103774532 428
846 3300027907 Ga0207428_10028695 Ga0207428_100286952 428
847 3300028800 Ga0265338_10009351 Ga0265338_100093514 428
848 3300031090 Ga0265760_10020075 Ga0265760_100200752 428
849 3300031247 Ga0265340_10056728 Ga0265340_100567281 428
850 3300037471 Ga0395905_0036400 Ga0395905_0036400_1215_2510 428
851 3300046462 Ga0495651_0000971 Ga0495651_0000971_1591_2880 428
852 3300046463 Ga0495653_0130937 Ga0495653_0130937_419_1708 428
853 3300046501 Ga0495607_0063589 Ga0495607_0063589_585_1874 428
854 3300046511 Ga0495608_0020720 Ga0495608_0020720_3080_4369 428
855 3300046516 Ga0495628_0107478 Ga0495628_0107478_567_1856 428
856 3300046533 Ga0495640_0035698 Ga0495640_0035698_2102_3415 428
857 3300046559 Ga0495667_0008755 Ga0495667_0008755_4415_5704 428
858 3300046663 Ga0495635_0137614 Ga0495635_0137614_151_1464 428
859 3300046692 Ga0495671_0041177 Ga0495671_0041177_301_1590 428
860 3300046809 Ga0495600_0184861 Ga0495600_0184861_19_1308 428
861 3300047319 Ga0495674_0069865 Ga0495674_0069865_1652_2941 428
862 3300047322 Ga0495680_0000036 Ga0495680_0000036_82479_83768 428
863 3300047322 Ga0495680_0085468 Ga0495680_0085468_1070_2359 428
864 3300047444 Ga0495675_0019046 Ga0495675_0019046_1471_2760 428
865 3300047471 Ga0495684_0004613 Ga0495684_0004613_9218_10507 428
866 2162886007 SwRhRL2b_contig_1664813 SwRhRL2b_0282.00001350 429
867 3300000041 ARcpr5oldR_c000037 ARcpr5oldR_00003713 429
868 3300000043 ARcpr5yngRDRAFT_c000014 ARcpr5yngRDRAFT_00001413 429
869 3300000044 ARSoilOldRDRAFT_c000005 ARSoilOldRDRAFT_00000513 429
870 3300000652 ARCol0yngRDRAFT_1000099 ARCol0yngRDRAFT_100009913 429
871 3300001990 JGI24737J22298_10003080 JGI24737J22298_100030805 429
872 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011180 429
873 3300003187 JGI25151J46595_10000019 JGI25151J46595_10000019101 429
874 3300003187 JGI25151J46595_10001080 JGI25151J46595_1000108013 429
875 3300003773 Ga0055537_1001658 Ga0055537_10016582 429
876 3300005289 Ga0065704_10000208 Ga0065704_1000020846 429
877 3300005328 Ga0070676_10145783 Ga0070676_101457831 429
878 3300005335 Ga0070666_10006171 Ga0070666_100061716 429
879 3300005336 Ga0070680_100019478 Ga0070680_1000194783 429
880 3300005337 Ga0070682_100051802 Ga0070682_1000518022 429
881 3300005338 Ga0068868_100122270 Ga0068868_1001222702 429
882 3300005339 Ga0070660_100035891 Ga0070660_1000358912 429
883 3300005340 Ga0070689_100039107 Ga0070689_1000391073 429
884 3300005344 Ga0070661_100080147 Ga0070661_1000801473 429
885 3300005347 Ga0070668_100077272 Ga0070668_1000772722 429
886 3300005347 Ga0070668_100159462 Ga0070668_1001594621 429
887 3300005353 Ga0070669_100003120 Ga0070669_1000031207 429
888 3300005354 Ga0070675_100014385 Ga0070675_1000143853 429
889 3300005355 Ga0070671_100006278 Ga0070671_1000062785 429
890 3300005356 Ga0070674_100119544 Ga0070674_1001195441 429
891 3300005365 Ga0070688_100009296 Ga0070688_1000092961 429
892 3300005367 Ga0070667_100041355 Ga0070667_1000413551 429
893 3300005435 Ga0070714_100031780 Ga0070714_1000317803 429
894 3300005455 Ga0070663_100102357 Ga0070663_1001023572 429
895 3300005457 Ga0070662_100034622 Ga0070662_1000346222 429
896 3300005458 Ga0070681_10075350 Ga0070681_100753502 429
897 3300005466 Ga0070685_10039064 Ga0070685_100390643 429
898 3300005468 Ga0070707_100108705 Ga0070707_1001087053 429
899 3300005468 Ga0070707_100260423 Ga0070707_1002604232 429
900 3300005471 Ga0070698_100175054 Ga0070698_1001750543 429
901 3300005518 Ga0070699_100079622 Ga0070699_1000796223 429
902 3300005530 Ga0070679_100038534 Ga0070679_1000385342 429
903 3300005548 Ga0070665_100000052 Ga0070665_10000005218 429
904 3300005548 Ga0070665_100006016 Ga0070665_1000060166 429
905 3300005549 Ga0070704_100183339 Ga0070704_1001833392 429
906 3300005564 Ga0070664_100264754 Ga0070664_1002647542 429
907 3300005614 Ga0068856_100123520 Ga0068856_1001235202 429
908 3300005614 Ga0068856_100228329 Ga0068856_1002283291 429
909 3300005617 Ga0068859_100020736 Ga0068859_1000207363 429
910 3300005617 Ga0068859_100191161 Ga0068859_1001911613 429
911 3300005719 Ga0068861_100027831 Ga0068861_1000278313 429
912 3300005843 Ga0068860_100060789 Ga0068860_1000607892 429
913 3300005844 Ga0068862_100020156 Ga0068862_1000201563 429
914 3300005844 Ga0068862_100200403 Ga0068862_1002004032 429
915 3300005983 Ga0081540_1006707 Ga0081540_10067074 429
916 3300005985 Ga0081539_10006712 Ga0081539_1000671216 429
917 3300006028 Ga0070717_10000643 Ga0070717_1000064321 429
918 3300006028 Ga0070717_10074020 Ga0070717_100740202 429
919 3300006028 Ga0070717_10185058 Ga0070717_101850582 429
920 3300006173 Ga0070716_100004647 Ga0070716_1000046472 429
921 3300006195 Ga0075366_10033239 Ga0075366_100332392 429
922 3300006358 Ga0068871_100012612 Ga0068871_1000126122 429
923 3300006844 Ga0075428_100002012 Ga0075428_10000201214 429
924 3300006852 Ga0075433_10105330 Ga0075433_101053303 429
925 3300006871 Ga0075434_100057099 Ga0075434_1000570993 429
926 3300006880 Ga0075429_100025409 Ga0075429_1000254093 429
927 3300006931 Ga0097620_100020735 Ga0097620_1000207353 429
928 3300006931 Ga0097620_100191165 Ga0097620_1001911653 429
929 3300006948 Ga0099826_10000004 Ga0099826_10000004233 429
930 3300007076 Ga0075435_100062925 Ga0075435_1000629252 429
931 3300007788 Ga0099795_10032322 Ga0099795_100323222 429
932 3300009011 Ga0105251_10002207 Ga0105251_100022075 429
933 3300009094 Ga0111539_10035440 Ga0111539_100354404 429
934 3300009147 Ga0114129_10040105 Ga0114129_100401054 429
935 3300009147 Ga0114129_10055090 Ga0114129_100550904 429
936 3300009148 Ga0105243_10000106 Ga0105243_100001067 429
937 3300009174 Ga0105241_10015984 Ga0105241_100159842 429
938 3300009174 Ga0105241_10048375 Ga0105241_100483752 429
939 3300009177 Ga0105248_10003289 Ga0105248_100032897 429
940 3300009545 Ga0105237_10061430 Ga0105237_100614302 429
941 3300009551 Ga0105238_10000980 Ga0105238_1000098014 429
942 3300009551 Ga0105238_10287239 Ga0105238_102872392 429
943 3300010375 Ga0105239_10001049 Ga0105239_1000104910 429
944 3300010375 Ga0105239_10065751 Ga0105239_100657512 429
945 3300013100 Ga0157373_10000064 Ga0157373_1000006431 429
946 3300013100 Ga0157373_10069946 Ga0157373_100699462 429
947 3300013102 Ga0157371_10001420 Ga0157371_1000142016 429
948 3300013105 Ga0157369_10003853 Ga0157369_100038533 429
949 3300013306 Ga0163162_10017826 Ga0163162_100178262 429
950 3300013306 Ga0163162_10304973 Ga0163162_103049732 429
951 3300013307 Ga0157372_10058064 Ga0157372_100580642 429
952 3300013308 Ga0157375_10027352 Ga0157375_100273525 429
953 3300014326 Ga0157380_10078710 Ga0157380_100787102 429
954 3300014745 Ga0157377_10068217 Ga0157377_100682171 429
955 3300021441 Ga0213871_10015002 Ga0213871_100150022 429
956 3300025233 Ga0209437_100017 Ga0209437_100017344 429
957 3300025263 Ga0209565_1000021 Ga0209565_1000021120 429
958 3300025273 Ga0209673_1025730 Ga0209673_10257302 429
959 3300025294 Ga0209025_1000008 Ga0209025_1000008396 429
960 3300025294 Ga0209025_1000018 Ga0209025_1000018232 429
961 3300025294 Ga0209025_1000029 Ga0209025_1000029401 429
962 3300025295 Ga0209564_1000452 Ga0209564_10004528 429
963 3300025297 Ga0209758_1018729 Ga0209758_10187293 429
964 3300025299 Ga0209256_1001235 Ga0209256_100123511 429
965 3300025735 Ga0207713_1001516 Ga0207713_10015166 429
966 3300025900 Ga0207710_10001303 Ga0207710_100013039 429
967 3300025903 Ga0207680_10004104 Ga0207680_100041046 429
968 3300025906 Ga0207699_10019885 Ga0207699_100198852 429
969 3300025910 Ga0207684_10050199 Ga0207684_100501992 429
970 3300025911 Ga0207654_10025322 Ga0207654_100253222 429
971 3300025912 Ga0207707_10070443 Ga0207707_100704431 429
972 3300025913 Ga0207695_10000013 Ga0207695_10000013668 429
973 3300025913 Ga0207695_10003264 Ga0207695_100032648 429
974 3300025914 Ga0207671_10013327 Ga0207671_100133273 429
975 3300025914 Ga0207671_10128845 Ga0207671_101288452 429
976 3300025915 Ga0207693_10005142 Ga0207693_100051425 429
977 3300025915 Ga0207693_10041339 Ga0207693_100413392 429
978 3300025915 Ga0207693_10144071 Ga0207693_101440712 429
979 3300025916 Ga0207663_10160386 Ga0207663_101603861 429
980 3300025917 Ga0207660_10052743 Ga0207660_100527431 429
981 3300025922 Ga0207646_10007712 Ga0207646_100077129 429
982 3300025922 Ga0207646_10051439 Ga0207646_100514393 429
983 3300025922 Ga0207646_10140776 Ga0207646_101407761 429
984 3300025922 Ga0207646_10214928 Ga0207646_102149281 429
985 3300025926 Ga0207659_10260242 Ga0207659_102602421 429
986 3300025927 Ga0207687_10006965 Ga0207687_100069652 429
987 3300025928 Ga0207700_10016809 Ga0207700_100168093 429
988 3300025929 Ga0207664_10055962 Ga0207664_100559622 429
989 3300025929 Ga0207664_10064776 Ga0207664_100647762 429
990 3300025931 Ga0207644_10003326 Ga0207644_100033265 429
991 3300025932 Ga0207690_10020395 Ga0207690_100203952 429
992 3300025933 Ga0207706_10026104 Ga0207706_100261043 429
993 3300025934 Ga0207686_10005874 Ga0207686_100058746 429
994 3300025935 Ga0207709_10113678 Ga0207709_101136782 429
995 3300025941 Ga0207711_10001071 Ga0207711_1000107114 429
996 3300025941 Ga0207711_10012903 Ga0207711_100129036 429
997 3300025941 Ga0207711_10020061 Ga0207711_100200613 429
998 3300025945 Ga0207679_10044133 Ga0207679_100441332 429
999 3300025960 Ga0207651_10055124 Ga0207651_100551242 429
1000 3300025972 Ga0207668_10013857 Ga0207668_100138573 429
1001 3300025986 Ga0207658_10015729 Ga0207658_100157292 429
1002 3300026035 Ga0207703_10006798 Ga0207703_100067988 429
1003 3300026067 Ga0207678_10064848 Ga0207678_100648482 429
1004 3300026078 Ga0207702_10079134 Ga0207702_100791342 429
1005 3300026078 Ga0207702_10184944 Ga0207702_101849441 429
1006 3300026088 Ga0207641_10072572 Ga0207641_100725722 429
1007 3300026095 Ga0207676_10014002 Ga0207676_100140025 429
1008 3300026118 Ga0207675_100004866 Ga0207675_1000048668 429
1009 3300026121 Ga0207683_10010051 Ga0207683_100100516 429
1010 3300027666 Ga0209282_1000290 Ga0209282_100029018 429
1011 3300027907 Ga0207428_10001108 Ga0207428_1000110818 429
1012 3300027907 Ga0207428_10121168 Ga0207428_101211682 429
1013 3300028379 Ga0268266_10000070 Ga0268266_10000070163 429
1014 3300028379 Ga0268266_10002016 Ga0268266_1000201613 429
1015 3300028380 Ga0268265_10010915 Ga0268265_100109154 429
1016 3300028380 Ga0268265_10015675 Ga0268265_100156752 429
1017 3300028381 Ga0268264_10163497 Ga0268264_101634971 429
1018 3300028794 Ga0307515_10000734 Ga0307515_1000073441 429
1019 3300028794 Ga0307515_10048368 Ga0307515_100483682 429
1020 3300031241 Ga0265325_10031398 Ga0265325_100313982 429
1021 3300031251 Ga0265327_10000108 Ga0265327_1000010839 429
1022 3300031665 Ga0316575_10028247 Ga0316575_100282472 429
1023 3300031824 Ga0307413_10202401 Ga0307413_102024011 429
1024 3300031911 Ga0307412_10000009 Ga0307412_10000009132 429
1025 3300032004 Ga0307414_10000440 Ga0307414_100004406 429
1026 3300035117 Ga0373953_0010836 Ga0373953_0010836_1457_2749 429
1027 3300035117 Ga0373953_0028595 Ga0373953_0028595_720_2129 429
1028 3300035170 Ga0373943_0007851 Ga0373943_0007851_1111_2520 429
1029 3300035171 Ga0373946_0007584 Ga0373946_0007584_2340_3749 429
1030 3300035172 Ga0373955_0005439 Ga0373955_0005439_1343_2752 429
1031 3300035695 Ga0373927_0008962 Ga0373927_0008962_5312_6691 429
1032 3300035724 Ga0373933_0002035 Ga0373933_0002035_2763_4055 429
1033 3300036401 Ga0373937_0003772 Ga0373937_0003772_1836_3128 429
1034 3300036401 Ga0373937_0030178 Ga0373937_0030178_2342_3634 429
1035 3300037068 Ga0373925_0013932 Ga0373925_0013932_2222_3631 429
1036 3300037418 Ga0395900_0010459 Ga0395900_0010459_5610_6917 429
1037 3300037466 Ga0395898_0003614 Ga0395898_0003614_9404_10711 429
1038 3300037471 Ga0395905_0000160 Ga0395905_0000160_94333_95634 429
1039 3300037471 Ga0395905_0000312 Ga0395905_0000312_23972_25279 429
1040 3300037471 Ga0395905_0005282 Ga0395905_0005282_11367_12674 429
1041 3300037471 Ga0395905_0011507 Ga0395905_0011507_239_1546 429
1042 3300037853 Ga0436364_0191954 Ga0436364_0191954_35735_37027 429
1043 3300037853 Ga0436364_0623699 Ga0436364_0623699_2040_3332 429
1044 3300037853 Ga0436364_0881244 Ga0436364_0881244_1561_2853 429
1045 3300038443 Ga0395901_0006291 Ga0395901_0006291_1151_2458 429
1046 3300039438 Ga0436360_1267658 Ga0436360_1267658_126_1418 429
1047 3300042001 Ga0439441_010185 Ga0439441_010185_251_1558 429
1048 3300046454 Ga0495592_0034343 Ga0495592_0034343_2212_3504 429
1049 3300046455 Ga0495603_0023263 Ga0495603_0023263_1550_2959 429
1050 3300046459 Ga0495629_0058038 Ga0495629_0058038_223_1602 429
1051 3300046462 Ga0495651_0000347 Ga0495651_0000347_1290_2582 429
1052 3300046462 Ga0495651_0001419 Ga0495651_0001419_7393_8733 429
1053 3300046463 Ga0495653_0013957 Ga0495653_0013957_4746_6038 429
1054 3300046474 Ga0495605_0031950 Ga0495605_0031950_608_1930 429
1055 3300046475 Ga0495639_0005719 Ga0495639_0005719_1775_3184 429
1056 3300046477 Ga0495664_0055449 Ga0495664_0055449_50_1342 429
1057 3300046492 Ga0495585_0001030 Ga0495585_0001030_15467_16876 429
1058 3300046499 Ga0495594_0015379 Ga0495594_0015379_1156_2565 429
1059 3300046500 Ga0495596_0000024 Ga0495596_0000024_43540_44862 429
1060 3300046501 Ga0495607_0011382 Ga0495607_0011382_3494_4816 429
1061 3300046511 Ga0495608_0036267 Ga0495608_0036267_567_1907 429
1062 3300046512 Ga0495610_0000399 Ga0495610_0000399_41445_42767 429
1063 3300046513 Ga0495616_0001164 Ga0495616_0001164_8319_9641 429
1064 3300046514 Ga0495618_0017292 Ga0495618_0017292_2218_3627 429
1065 3300046514 Ga0495618_0058276 Ga0495618_0058276_1143_2435 429
1066 3300046516 Ga0495628_0000133 Ga0495628_0000133_47981_49273 429
1067 3300046526 Ga0495666_0002030 Ga0495666_0002030_6196_7605 429
1068 3300046529 Ga0495652_0017402 Ga0495652_0017402_1390_2682 429
1069 3300046531 Ga0495665_0004686 Ga0495665_0004686_3364_4662 429
1070 3300046536 Ga0495587_0000387 Ga0495587_0000387_27616_28908 429
1071 3300046536 Ga0495587_0003798 Ga0495587_0003798_3991_5370 429
1072 3300046538 Ga0495609_0002455 Ga0495609_0002455_263_1585 429
1073 3300046542 Ga0495597_0017128 Ga0495597_0017128_1916_3238 429
1074 3300046543 Ga0495645_0002303 Ga0495645_0002303_7031_8362 429
1075 3300046558 Ga0495633_0004113 Ga0495633_0004113_1787_3196 429
1076 3300046559 Ga0495667_0009304 Ga0495667_0009304_4341_5633 429
1077 3300046559 Ga0495667_0011473 Ga0495667_0011473_4317_5609 429
1078 3300046559 Ga0495667_0023899 Ga0495667_0023899_1340_2680 429
1079 3300046642 Ga0495634_0138578 Ga0495634_0138578_212_1504 429
1080 3300046648 Ga0495611_0007603 Ga0495611_0007603_2863_4272 429
1081 3300046660 Ga0495625_0010875 Ga0495625_0010875_5035_6333 429
1082 3300046663 Ga0495635_0008273 Ga0495635_0008273_925_2217 429
1083 3300046664 Ga0495659_0001555 Ga0495659_0001555_495_1904 429
1084 3300046674 Ga0495588_0010028 Ga0495588_0010028_2482_3891 429
1085 3300046675 Ga0495657_0001028 Ga0495657_0001028_2234_3526 429
1086 3300046678 Ga0495599_0010519 Ga0495599_0010519_2779_4071 429
1087 3300046678 Ga0495599_0055667 Ga0495599_0055667_665_1996 429
1088 3300046690 Ga0495624_0011107 Ga0495624_0011107_2346_3755 429
1089 3300046692 Ga0495671_0001099 Ga0495671_0001099_2533_3855 429
1090 3300046794 Ga0495589_0042126 Ga0495589_0042126_529_1938 429
1091 3300046809 Ga0495600_0039972 Ga0495600_0039972_1230_2522 429
1092 3300047317 Ga0495604_0007076 Ga0495604_0007076_1057_2349 429
1093 3300047317 Ga0495604_0029121 Ga0495604_0029121_568_1908 429
1094 3300047319 Ga0495674_0000732 Ga0495674_0000732_28131_29423 429
1095 3300047319 Ga0495674_0066199 Ga0495674_0066199_1321_2652 429
1096 3300047320 Ga0495672_0010948 Ga0495672_0010948_1970_3292 429
1097 3300047320 Ga0495672_0123707 Ga0495672_0123707_44_1351 429
1098 3300047322 Ga0495680_0029091 Ga0495680_0029091_1236_2528 429
1099 3300047322 Ga0495680_0032116 Ga0495680_0032116_2844_4136 429
1100 3300047322 Ga0495680_0054503 Ga0495680_0054503_327_1667 429
1101 3300047444 Ga0495675_0000200 Ga0495675_0000200_29559_30851 429
1102 3300047471 Ga0495684_0001073 Ga0495684_0001073_19353_20693 429
1103 3300047471 Ga0495684_0001328 Ga0495684_0001328_956_2248 429
1104 3300047472 Ga0495686_0011831 Ga0495686_0011831_4439_5752 429
1105 3300048089 Ga0495614_0003207 Ga0495614_0003207_1112_2521 429
1106 3300048903 Ga0496100_0077569 Ga0496100_0077569_411_1718 429
1107 3300048904 Ga0496101_0095338 Ga0496101_0095338_487_1794 429
1108 3300048907 Ga0496104_0002943 Ga0496104_0002943_397_1704 429
1109 3300048908 Ga0496105_0020488 Ga0496105_0020488_3706_5013 429
1110 3300048909 Ga0496106_0015311 Ga0496106_0015311_3113_4420 429
1111 3300048910 Ga0496107_0019213 Ga0496107_0019213_3090_4397 429
1112 3300048911 Ga0496108_0043531 Ga0496108_0043531_1964_3271 429
1113 3300048912 Ga0496109_0013194 Ga0496109_0013194_2128_3435 429
1114 3300048913 Ga0496110_0014024 Ga0496110_0014024_3082_4389 429
1115 3300048913 Ga0496110_0034472 Ga0496110_0034472_1724_3031 429
1116 3300048914 Ga0496111_0002323 Ga0496111_0002323_8854_10161 429
1117 3300048915 Ga0496112_0007606 Ga0496112_0007606_607_1914 429
1118 3300048915 Ga0496112_0072427 Ga0496112_0072427_841_2133 429
1119 3300048916 Ga0496113_0015597 Ga0496113_0015597_3543_4850 429
1120 3300048919 Ga0496116_0002711 Ga0496116_0002711_16300_17622 429
1121 3300048919 Ga0496116_0053591 Ga0496116_0053591_637_1950 429
1122 3300048924 Ga0496121_0007804 Ga0496121_0007804_3537_4856 429
1123 3300048924 Ga0496121_0009668 Ga0496121_0009668_7165_8487 429
1124 3300048925 Ga0496122_0000963 Ga0496122_0000963_9276_10598 429
1125 3300048925 Ga0496122_0001032 Ga0496122_0001032_45565_46881 429
1126 3300048926 Ga0496123_0000608 Ga0496123_0000608_17692_19014 429
1127 3300048926 Ga0496123_0000806 Ga0496123_0000806_45401_46717 429
1128 3300048928 Ga0496125_0005258 Ga0496125_0005258_4437_5732 429
1129 3300048928 Ga0496125_0084236 Ga0496125_0084236_830_2152 429
1130 3300048929 Ga0496126_0000612 Ga0496126_0000612_52122_53519 429
1131 3300048929 Ga0496126_0104849 Ga0496126_0104849_210_1532 429
1132 3300049571 Ga0501034_0249591 Ga0501034_0249591_136_1449 429
1133 3300050491 nmdc:mga00v17_527_c1 nmdc:mga00v17_527_c1_15602_16921 429
1134 3300050493 nmdc:mga0k408_155_c2 nmdc:mga0k408_155_c2_13214_14509 429
1135 3300050507 nmdc:mga05p37_19658_c1 nmdc:mga05p37_19658_c1_5017_6324 429
1136 3300050507 nmdc:mga05p37_213844_c1 nmdc:mga05p37_213844_c1_866_2185 429
1137 3300050511 nmdc:mga08y16_16965_c1 nmdc:mga08y16_16965_c1_5095_6402 429
1138 3300050511 nmdc:mga08y16_30808_c1 nmdc:mga08y16_30808_c1_3195_4490 429
1139 3300050511 nmdc:mga08y16_72164_c1 nmdc:mga08y16_72164_c1_1408_2718 429
1140 3300050512 nmdc:mga0n895_172665_c1 nmdc:mga0n895_172665_c1_446_1753 429
1141 3300050512 nmdc:mga0n895_65468_c1 nmdc:mga0n895_65468_c1_1228_2541 429
1142 3300050514 nmdc:mga08x19_13632_c1 nmdc:mga08x19_13632_c1_1286_2578 429
1143 3300053078 Ga0495612_0005030 Ga0495612_0005030_1452_2792 429
1144 3300053084 Ga0495595_0002115 Ga0495595_0002115_5709_7049 429
1145 3300053085 Ga0495619_0046064 Ga0495619_0046064_1273_2565 429
1146 3300053085 Ga0495619_0133506 Ga0495619_0133506_311_1603 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00815

Histidinol_dh

Histidinol dehydrogenase

53

462

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vld-assembly1.cif.gz_A crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidine and nad+ 0.9446 18 423
5vlc-assembly2.cif.gz_D crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol 0.9386 18 423
5vlc-assembly3.cif.gz_E crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol 0.9343 18 424
1vh6-assembly1.cif.gz_B crystal structure of a flagellar protein 0.9326 389 427
4g09-assembly1.cif.gz_A-2 the crystal structure of the c366s mutant of hdh from brucella suis in complex with a substituted benzyl ketone 0.9324 21 429
ID Description Score Start End Superfamily
af_P9WNW9_250_396_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9742 225 370 3.40.50.1980
4gicB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9718 226 341 3.40.50.1980
af_Q2FUT8_220_366_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9714 225 370 3.40.50.1980
4g07A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9657 226 370 3.40.50.1980
1k75B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9639 227 369 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A349SFH3-F1-model_v4 Histidinol dehydrogenase 0.9892 1 370 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A349SFH3-F1-model_v4 Histidinol dehydrogenase 0.9865 1 370 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A5N5PHA1-F1-model_v4 histidinol dehydrogenase (EC 1.1.1.23) 0.9837 135 424 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A257KSF9-F1-model_v4 Histidinol dehydrogenase 0.982 41 424 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A7C7HN34-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9817 243 424 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287

Feature Viewer

pLDDT pTM Quality
95.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map