F490800

General Info

Members Datasets Scaffolds Average Seq Length
1146 248 1146 298

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0316461|Ga0466967_0316461_142_1086
Length 314
Sequence MSVLVLAEHDGKSIKDATLATVTAGSKLGDVHLLVAGKDVAGVADAAARIAGVAKVLVADAPKLDHELAEAVAPVAAKLMEGYDAFLAPATTTGKNIAPRVAALLDVMQVSDILSVEGPDTFTRPIYAGNAIATVKSNDAKKVVTVRTTAFDKAAAEGGSAPIEQVDAGGADGKSEFVSLEASESERPELTSAKVIVSGGRAFGSSDQFHSLLDPLADKLGAAVGASRAAVDAGYAPNDYQVGQTGKIVAPQVYIAIGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVGDLFKVLPELDEELAKRQQ

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 4.1
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011575 3300001904 Bacteria 1434
2 JGI24740J21852_10004014 3300001979 Bacteria 6381
3 JGI24740J21852_10010653 3300001979 Bacteria 3529
4 JGI24740J21852_10014193 3300001979 Bacteria 2947
5 JGI24740J21852_10039052 3300001979 Bacteria 1451
6 JGI24740J21852_10062327 3300001979 Bacteria 1024
7 JGI24739J22299_10017808 3300001989 Bacteria 2559
8 JGI24739J22299_10033457 3300001989 Bacteria 1758
9 JGI24739J22299_10052734 3300001989 Bacteria 1307
10 JGI24737J22298_10000103 3300001990 Bacteria 25390
11 JGI24737J22298_10003852 3300001990 Bacteria 5273
12 JGI24737J22298_10016184 3300001990 Bacteria 2408
13 JGI24737J22298_10017220 3300001990 Bacteria 2330
14 JGI24737J22298_10024074 3300001990 Bacteria 1929
15 JGI24743J22301_10002970 3300001991 Bacteria 2630
16 JGI24735J21928_10018169 3300002067 Bacteria 2169
17 JGI24738J21930_10001387 3300002075 Bacteria 6730
18 JGI24738J21930_10018470 3300002075 Bacteria 1457
19 JGI24744J21845_10000984 3300002077 Bacteria 5442
20 Ga0065715_10119188 3300005293 Bacteria 2287
21 Ga0070658_10001186 3300005327 Bacteria 22303
22 Ga0070658_10014865 3300005327 Bacteria 6237
23 Ga0070658_10019967 3300005327 Bacteria 5367
24 Ga0070658_10030282 3300005327 Bacteria 4349
25 Ga0070658_10083841 3300005327 Bacteria 2620
26 Ga0070658_10091604 3300005327 Bacteria 2505
27 Ga0070658_10106170 3300005327 Bacteria 2323
28 Ga0070658_10220620 3300005327 Bacteria 1603
29 Ga0070658_10256097 3300005327 Bacteria 1485
30 Ga0070658_10343176 3300005327 Bacteria 1277
31 Ga0070658_10400857 3300005327 Bacteria 1178
32 Ga0070658_10435029 3300005327 Bacteria 1129
33 Ga0070676_10014283 3300005328 Bacteria 4363
34 Ga0070676_10052530 3300005328 Bacteria 2397
35 Ga0070676_10058763 3300005328 Bacteria 2280
36 Ga0070683_100007551 3300005329 Bacteria 9189
37 Ga0070683_100012114 3300005329 Bacteria 7484
38 Ga0070683_100048199 3300005329 Bacteria 3938
39 Ga0070683_100089119 3300005329 Bacteria 2895
40 Ga0070683_100161726 3300005329 Bacteria 2124
41 Ga0070683_100510641 3300005329 Bacteria 1148
42 Ga0070690_100022820 3300005330 Bacteria 3832
43 Ga0070690_100046725 3300005330 Bacteria 2753
44 Ga0070670_100014334 3300005331 Bacteria 6801
45 Ga0070670_100016152 3300005331 Bacteria 6408
46 Ga0070670_100094963 3300005331 Bacteria 2565
47 Ga0070670_100111216 3300005331 Bacteria 2360
48 Ga0070670_100234662 3300005331 Bacteria 1597
49 Ga0070677_10008726 3300005333 Bacteria 3420
50 Ga0068869_100000193 3300005334 Bacteria 31528
51 Ga0068869_100155956 3300005334 Bacteria 1774
52 Ga0070666_10001801 3300005335 Bacteria 13049
53 Ga0070666_10002433 3300005335 Bacteria 11254
54 Ga0070666_10007307 3300005335 Bacteria 6806
55 Ga0070666_10056204 3300005335 Bacteria 2657
56 Ga0070666_10144162 3300005335 Bacteria 1659
57 Ga0070666_10303341 3300005335 Bacteria 1137
58 Ga0070680_100000197 3300005336 Bacteria 39326
59 Ga0070680_100015711 3300005336 Bacteria 5943
60 Ga0070680_100026400 3300005336 Bacteria 4646
61 Ga0070680_100043283 3300005336 Bacteria 3658
62 Ga0070680_100049342 3300005336 Bacteria 3431
63 Ga0070680_100104192 3300005336 Bacteria 2357
64 Ga0070680_100119227 3300005336 Bacteria 2201
65 Ga0070680_100247308 3300005336 Bacteria 1508
66 Ga0070682_100039441 3300005337 Bacteria 2902
67 Ga0068868_100000032 3300005338 Bacteria 75803
68 Ga0068868_100000792 3300005338 Bacteria 21402
69 Ga0068868_100000972 3300005338 Bacteria 19505
70 Ga0068868_100018089 3300005338 Bacteria 5261
71 Ga0068868_100190698 3300005338 Bacteria 1704
72 Ga0070660_100000861 3300005339 Bacteria 20243
73 Ga0070660_100001425 3300005339 Bacteria 16289
74 Ga0070660_100003704 3300005339 Bacteria 10556
75 Ga0070660_100005433 3300005339 Bacteria 8826
76 Ga0070660_100021026 3300005339 Bacteria 4805
77 Ga0070660_100026648 3300005339 Bacteria 4306
78 Ga0070660_100028604 3300005339 Bacteria 4171
79 Ga0070660_100096583 3300005339 Bacteria 2337
80 Ga0070660_100098990 3300005339 Bacteria 2309
81 Ga0070660_100109001 3300005339 Bacteria 2201
82 Ga0070660_100127808 3300005339 Bacteria 2032
83 Ga0070660_100130546 3300005339 Bacteria 2010
84 Ga0070660_100194470 3300005339 Bacteria 1644
85 Ga0070660_100264979 3300005339 Bacteria 1403
86 Ga0070660_100342864 3300005339 Bacteria 1230
87 Ga0070689_100009488 3300005340 Bacteria 6900
88 Ga0070691_10001004 3300005341 Bacteria 11565
89 Ga0070661_100000101 3300005344 Bacteria 70279
90 Ga0070661_100001951 3300005344 Bacteria 14271
91 Ga0070661_100015230 3300005344 Bacteria 5427
92 Ga0070661_100042185 3300005344 Bacteria 3329
93 Ga0070661_100064493 3300005344 Bacteria 2691
94 Ga0070661_100093550 3300005344 Bacteria 2227
95 Ga0070661_100142732 3300005344 Bacteria 1805
96 Ga0070661_100176450 3300005344 Bacteria 1624
97 Ga0070661_100283121 3300005344 Bacteria 1287
98 Ga0070668_100000536 3300005347 Bacteria 25268
99 Ga0070668_100023928 3300005347 Bacteria 4626
100 Ga0070668_100089770 3300005347 Bacteria 2421
101 Ga0070668_100199147 3300005347 Bacteria 1644
102 Ga0070669_100001124 3300005353 Bacteria 19546
103 Ga0070669_100048071 3300005353 Bacteria 3113
104 Ga0070669_100051512 3300005353 Bacteria 3009
105 Ga0070675_100002279 3300005354 Bacteria 14247
106 Ga0070675_100006097 3300005354 Bacteria 9244
107 Ga0070675_100008840 3300005354 Bacteria 7829
108 Ga0070675_100060655 3300005354 Bacteria 3123
109 Ga0070675_100115478 3300005354 Bacteria 2275
110 Ga0070675_100249981 3300005354 Bacteria 1551
111 Ga0070675_100401572 3300005354 Bacteria 1223
112 Ga0070675_100532790 3300005354 Bacteria 1061
113 Ga0070671_100000533 3300005355 Bacteria 26740
114 Ga0070671_100001226 3300005355 Bacteria 19207
115 Ga0070671_100003349 3300005355 Bacteria 12499
116 Ga0070671_100014109 3300005355 Bacteria 6451
117 Ga0070671_100023452 3300005355 Bacteria 5049
118 Ga0070671_100034395 3300005355 Bacteria 4195
119 Ga0070671_100056250 3300005355 Bacteria 3273
120 Ga0070671_100102236 3300005355 Bacteria 2405
121 Ga0070671_100104973 3300005355 Bacteria 2371
122 Ga0070671_100148737 3300005355 Bacteria 1977
123 Ga0070671_100399242 3300005355 Bacteria 1176
124 Ga0070671_100401503 3300005355 Bacteria 1172
125 Ga0070674_100041966 3300005356 Bacteria 3105
126 Ga0070674_100089158 3300005356 Bacteria 2221
127 Ga0070674_100203020 3300005356 Bacteria 1532
128 Ga0070673_100008799 3300005364 Bacteria 6740
129 Ga0070673_100013681 3300005364 Bacteria 5624
130 Ga0070673_100018135 3300005364 Bacteria 5023
131 Ga0070673_100019681 3300005364 Bacteria 4850
132 Ga0070673_100029335 3300005364 Bacteria 4101
133 Ga0070673_100031532 3300005364 Bacteria 3979
134 Ga0070673_100035345 3300005364 Bacteria 3788
135 Ga0070673_100050958 3300005364 Bacteria 3239
136 Ga0070673_100065062 3300005364 Bacteria 2907
137 Ga0070673_100381025 3300005364 Bacteria 1257
138 Ga0070659_100000005 3300005366 Bacteria 259902
139 Ga0070659_100000045 3300005366 Bacteria 101520
140 Ga0070659_100017987 3300005366 Bacteria 5327
141 Ga0070659_100024072 3300005366 Bacteria 4665
142 Ga0070659_100036765 3300005366 Bacteria 3817
143 Ga0070659_100043521 3300005366 Bacteria 3511
144 Ga0070659_100135749 3300005366 Bacteria 2000
145 Ga0070659_100187050 3300005366 Bacteria 1701
146 Ga0070659_100192566 3300005366 Bacteria 1676
147 Ga0070659_100208943 3300005366 Bacteria 1608
148 Ga0070659_100215456 3300005366 Bacteria 1583
149 Ga0070659_100238388 3300005366 Bacteria 1504
150 Ga0070659_100450734 3300005366 Bacteria 1091
151 Ga0070659_100487559 3300005366 Bacteria 1049
152 Ga0070667_100001174 3300005367 Bacteria 23830
153 Ga0070667_100008070 3300005367 Bacteria 8731
154 Ga0070667_100010247 3300005367 Bacteria 7744
155 Ga0070667_100023963 3300005367 Bacteria 5068
156 Ga0070667_100025556 3300005367 Bacteria 4910
157 Ga0070667_100030771 3300005367 Bacteria 4476
158 Ga0070667_100071911 3300005367 Bacteria 2946
159 Ga0070667_100192142 3300005367 Bacteria 1809
160 Ga0070667_100226850 3300005367 Bacteria 1664
161 Ga0070667_100388562 3300005367 Bacteria 1268
162 Ga0070709_10090233 3300005434 Bacteria 2020
163 Ga0070714_100057580 3300005435 Bacteria 3328
164 Ga0070714_100540486 3300005435 Bacteria 1115
165 Ga0070694_100013393 3300005444 Bacteria 5122
166 Ga0070663_100036552 3300005455 Bacteria 3412
167 Ga0070663_100097962 3300005455 Bacteria 2184
168 Ga0070663_100103705 3300005455 Bacteria 2126
169 Ga0070663_100501828 3300005455 Bacteria 1008
170 Ga0070678_100035050 3300005456 Bacteria 3500
171 Ga0070678_100163571 3300005456 Bacteria 1805
172 Ga0070678_100378712 3300005456 Bacteria 1224
173 Ga0070662_100000036 3300005457 Bacteria 77190
174 Ga0070662_100000572 3300005457 Bacteria 22470
175 Ga0070662_100004956 3300005457 Bacteria 8456
176 Ga0070662_100006515 3300005457 Bacteria 7531
177 Ga0070662_100055161 3300005457 Bacteria 2882
178 Ga0070662_100060072 3300005457 Bacteria 2771
179 Ga0070662_100073767 3300005457 Bacteria 2522
180 Ga0070662_100209229 3300005457 Bacteria 1551
181 Ga0070681_10022649 3300005458 Bacteria 6310
182 Ga0070681_10309999 3300005458 Bacteria 1488
183 Ga0070681_10364019 3300005458 Bacteria 1356
184 Ga0068867_100003797 3300005459 Bacteria 10626
185 Ga0068867_100007359 3300005459 Bacteria 7790
186 Ga0068867_100026508 3300005459 Bacteria 4162
187 Ga0068867_100076728 3300005459 Bacteria 2510
188 Ga0068867_100096652 3300005459 Bacteria 2249
189 Ga0070679_100051898 3300005530 Bacteria 4085
190 Ga0070679_100077078 3300005530 Bacteria 3322
191 Ga0070679_100199174 3300005530 Bacteria 1969
192 Ga0070679_100458234 3300005530 Bacteria 1220
193 Ga0070684_100020379 3300005535 Bacteria 5502
194 Ga0070684_100022293 3300005535 Bacteria 5279
195 Ga0070684_100076758 3300005535 Bacteria 2949
196 Ga0068853_100000059 3300005539 Bacteria 78301
197 Ga0068853_100002446 3300005539 Bacteria 13906
198 Ga0068853_100010462 3300005539 Bacteria 7509
199 Ga0068853_100011312 3300005539 Bacteria 7244
200 Ga0068853_100026148 3300005539 Bacteria 4900
201 Ga0068853_100087160 3300005539 Bacteria 2739
202 Ga0068853_100089040 3300005539 Bacteria 2710
203 Ga0068853_100245835 3300005539 Bacteria 1641
204 Ga0068853_100332395 3300005539 Bacteria 1410
205 Ga0070672_100001833 3300005543 Bacteria 13248
206 Ga0070672_100012721 3300005543 Bacteria 5922
207 Ga0070672_100026341 3300005543 Bacteria 4325
208 Ga0070672_100067408 3300005543 Bacteria 2836
209 Ga0070672_100181372 3300005543 Bacteria 1755
210 Ga0070672_100226715 3300005543 Bacteria 1569
211 Ga0070686_100000479 3300005544 Bacteria 24157
212 Ga0070686_100042271 3300005544 Bacteria 2854
213 Ga0070686_100055545 3300005544 Bacteria 2537
214 Ga0070696_100038967 3300005546 Bacteria 3281
215 Ga0070693_100000361 3300005547 Bacteria 20637
216 Ga0070693_100139210 3300005547 Bacteria 1526
217 Ga0070665_100000993 3300005548 Bacteria 35947
218 Ga0070665_100004200 3300005548 Bacteria 15157
219 Ga0070665_100004600 3300005548 Bacteria 14436
220 Ga0070665_100024112 3300005548 Bacteria 6127
221 Ga0070665_100141417 3300005548 Bacteria 2410
222 Ga0070665_100147593 3300005548 Bacteria 2354
223 Ga0070665_100217247 3300005548 Bacteria 1912
224 Ga0070665_100217449 3300005548 Bacteria 1911
225 Ga0070665_100323544 3300005548 Bacteria 1546
226 Ga0070665_100346041 3300005548 Bacteria 1492
227 Ga0068855_100002282 3300005563 Bacteria 23688
228 Ga0068855_100003767 3300005563 Bacteria 18537
229 Ga0068855_100021990 3300005563 Bacteria 7647
230 Ga0068855_100033766 3300005563 Bacteria 6103
231 Ga0068855_100102679 3300005563 Bacteria 3291
232 Ga0068855_100110180 3300005563 Bacteria 3161
233 Ga0068855_100143524 3300005563 Bacteria 2719
234 Ga0068855_100332602 3300005563 Bacteria 1677
235 Ga0068855_100503095 3300005563 Bacteria 1316
236 Ga0068855_100509748 3300005563 Bacteria 1306
237 Ga0070664_100000027 3300005564 Bacteria 90881
238 Ga0070664_100002139 3300005564 Bacteria 15828
239 Ga0070664_100006623 3300005564 Bacteria 9342
240 Ga0070664_100008229 3300005564 Bacteria 8432
241 Ga0070664_100025634 3300005564 Bacteria 4890
242 Ga0070664_100033603 3300005564 Bacteria 4297
243 Ga0070664_100246492 3300005564 Bacteria 1605
244 Ga0070664_100319328 3300005564 Bacteria 1407
245 Ga0070664_100599427 3300005564 Bacteria 1021
246 Ga0068857_100003736 3300005577 Bacteria 12783
247 Ga0068857_100023125 3300005577 Bacteria 5467
248 Ga0068857_100061646 3300005577 Bacteria 3332
249 Ga0068857_100090673 3300005577 Bacteria 2735
250 Ga0068857_100173308 3300005577 Bacteria 1962
251 Ga0068857_100179476 3300005577 Bacteria 1927
252 Ga0068857_100212305 3300005577 Bacteria 1766
253 Ga0068857_100221451 3300005577 Bacteria 1728
254 Ga0068857_100346352 3300005577 Bacteria 1375
255 Ga0068854_100010224 3300005578 Bacteria 6080
256 Ga0068854_100025205 3300005578 Bacteria 4080
257 Ga0068854_100030707 3300005578 Bacteria 3729
258 Ga0068854_100055126 3300005578 Bacteria 2860
259 Ga0068854_100096981 3300005578 Bacteria 2203
260 Ga0068854_100175448 3300005578 Bacteria 1670
261 Ga0068854_100180774 3300005578 Bacteria 1647
262 Ga0068854_100270715 3300005578 Bacteria 1364
263 Ga0068856_100000699 3300005614 Bacteria 36354
264 Ga0068856_100123193 3300005614 Bacteria 2595
265 Ga0068856_100144071 3300005614 Bacteria 2390
266 Ga0068856_100241787 3300005614 Bacteria 1820
267 Ga0068856_100253600 3300005614 Bacteria 1774
268 Ga0068856_100692544 3300005614 Bacteria 1039
269 Ga0068852_100000433 3300005616 Bacteria 27783
270 Ga0068852_100001364 3300005616 Bacteria 16397
271 Ga0068852_100047204 3300005616 Bacteria 3673
272 Ga0068852_100151594 3300005616 Bacteria 2156
273 Ga0068859_100001400 3300005617 Bacteria 24475
274 Ga0068859_100004210 3300005617 Bacteria 14679
275 Ga0068859_100038160 3300005617 Bacteria 4820
276 Ga0068859_100098399 3300005617 Bacteria 2979
277 Ga0068864_100000247 3300005618 Bacteria 48323
278 Ga0068864_100004541 3300005618 Bacteria 11400
279 Ga0068864_100030285 3300005618 Bacteria 4586
280 Ga0068864_100046004 3300005618 Bacteria 3744
281 Ga0068864_100055638 3300005618 Bacteria 3417
282 Ga0068864_100060876 3300005618 Bacteria 3269
283 Ga0068864_100095817 3300005618 Bacteria 2625
284 Ga0068864_100238009 3300005618 Bacteria 1686
285 Ga0068861_100054765 3300005719 Bacteria 3040
286 Ga0068851_10003191 3300005834 Bacteria 7270
287 Ga0068851_10084784 3300005834 Bacteria 1660
288 Ga0068851_10155849 3300005834 Bacteria 1251
289 Ga0068870_10105444 3300005840 Bacteria 1601
290 Ga0068863_100001653 3300005841 Bacteria 22048
291 Ga0068863_100006869 3300005841 Bacteria 11153
292 Ga0068863_100010379 3300005841 Bacteria 9049
293 Ga0068863_100020450 3300005841 Bacteria 6325
294 Ga0068863_100025228 3300005841 Bacteria 5666
295 Ga0068863_100026484 3300005841 Bacteria 5531
296 Ga0068863_100029847 3300005841 Bacteria 5207
297 Ga0068863_100035648 3300005841 Bacteria 4737
298 Ga0068863_100073155 3300005841 Bacteria 3242
299 Ga0068858_100001094 3300005842 Bacteria 28064
300 Ga0068858_100001147 3300005842 Bacteria 27422
301 Ga0068858_100003322 3300005842 Bacteria 16018
302 Ga0068858_100015611 3300005842 Bacteria 7143
303 Ga0068858_100067364 3300005842 Bacteria 3316
304 Ga0068858_100080548 3300005842 Bacteria 3026
305 Ga0068858_100101879 3300005842 Bacteria 2678
306 Ga0068860_100007238 3300005843 Bacteria 11097
307 Ga0068860_100016138 3300005843 Bacteria 7288
308 Ga0068860_100022578 3300005843 Bacteria 6083
309 Ga0068860_100024143 3300005843 Bacteria 5879
310 Ga0068860_100027215 3300005843 Bacteria 5509
311 Ga0068860_100092266 3300005843 Bacteria 2885
312 Ga0068862_100002977 3300005844 Bacteria 14796
313 Ga0068862_100016695 3300005844 Bacteria 6113
314 Ga0068862_100024139 3300005844 Bacteria 5100
315 Ga0068862_100032599 3300005844 Bacteria 4402
316 Ga0068862_100270968 3300005844 Bacteria 1552
317 Ga0068862_100339265 3300005844 Bacteria 1391
318 Ga0081538_10159101 3300005981 Bacteria 1007
319 Ga0081539_10025333 3300005985 Bacteria 3824
320 Ga0081539_10029093 3300005985 Bacteria 3461
321 Ga0081539_10030718 3300005985 Bacteria 3329
322 Ga0070717_10050533 3300006028 Bacteria 3417
323 Ga0070717_10051402 3300006028 Bacteria 3392
324 Ga0070716_100073941 3300006173 Bacteria 2012
325 Ga0070712_100050847 3300006175 Bacteria 2885
326 Ga0070712_100189423 3300006175 Bacteria 1609
327 Ga0075369_10106558 3300006186 Bacteria 1261
328 Ga0097621_100052614 3300006237 Bacteria 3318
329 Ga0097621_100055221 3300006237 Bacteria 3243
330 Ga0097621_100085598 3300006237 Bacteria 2629
331 Ga0097621_100094898 3300006237 Bacteria 2501
332 Ga0097621_100134270 3300006237 Bacteria 2109
333 Ga0068871_100084148 3300006358 Bacteria 2640
334 Ga0068871_100101060 3300006358 Bacteria 2416
335 Ga0068871_100127815 3300006358 Bacteria 2152
336 Ga0068871_100159698 3300006358 Bacteria 1927
337 Ga0075433_10152916 3300006852 Bacteria 2052
338 Ga0075429_100112196 3300006880 Bacteria 2383
339 Ga0068865_100003787 3300006881 Bacteria 9082
340 Ga0068865_100022604 3300006881 Bacteria 4105
341 Ga0068865_100125184 3300006881 Bacteria 1917
342 Ga0068865_100389637 3300006881 Bacteria 1139
343 Ga0097620_100001400 3300006931 Bacteria 24475
344 Ga0097620_100004210 3300006931 Bacteria 14679
345 Ga0097620_100028084 3300006931 Bacteria 5641
346 Ga0097620_100038158 3300006931 Bacteria 4820
347 Ga0097620_100098410 3300006931 Bacteria 2979
348 Ga0105251_10025240 3300009011 Bacteria 3043
349 Ga0105240_10008382 3300009093 Bacteria 14794
350 Ga0105240_10010475 3300009093 Bacteria 13034
351 Ga0105240_10136646 3300009093 Bacteria 2935
352 Ga0105245_10000128 3300009098 Bacteria 72249
353 Ga0105245_10021109 3300009098 Bacteria 5712
354 Ga0105245_10051602 3300009098 Bacteria 3687
355 Ga0105245_10085446 3300009098 Bacteria 2892
356 Ga0105245_10635233 3300009098 Bacteria 1097
357 Ga0105243_10399361 3300009148 Bacteria 1276
358 Ga0105241_10009282 3300009174 Bacteria 7233
359 Ga0105241_10184043 3300009174 Bacteria 1735
360 Ga0105248_10000308 3300009177 Bacteria 58132
361 Ga0105248_10001451 3300009177 Bacteria 26388
362 Ga0105248_10003753 3300009177 Bacteria 16834
363 Ga0105248_10036329 3300009177 Bacteria 5509
364 Ga0105248_10053985 3300009177 Bacteria 4507
365 Ga0105248_10072912 3300009177 Bacteria 3859
366 Ga0105248_10074391 3300009177 Bacteria 3818
367 Ga0105248_10162803 3300009177 Bacteria 2516
368 Ga0105248_10186812 3300009177 Bacteria 2335
369 Ga0105248_10188544 3300009177 Bacteria 2323
370 Ga0105248_10440698 3300009177 Bacteria 1467
371 Ga0105248_10584128 3300009177 Bacteria 1260
372 Ga0105238_10011618 3300009551 Bacteria 8870
373 Ga0105238_10032642 3300009551 Bacteria 5298
374 Ga0105238_10039340 3300009551 Bacteria 4795
375 Ga0105239_10074433 3300010375 Bacteria 3734
376 Ga0105239_10086562 3300010375 Bacteria 3454
377 Ga0105246_10149112 3300011119 Bacteria 1768
378 Ga0157373_10006676 3300013100 Bacteria 8597
379 Ga0157373_10042129 3300013100 Bacteria 3263
380 Ga0157373_10068423 3300013100 Bacteria 2510
381 Ga0157373_10182746 3300013100 Bacteria 1477
382 Ga0157373_10272734 3300013100 Bacteria 1198
383 Ga0157371_10000850 3300013102 Bacteria 34892
384 Ga0157371_10164064 3300013102 Bacteria 1587
385 Ga0157370_10000686 3300013104 Bacteria 42199
386 Ga0157370_10005240 3300013104 Bacteria 14583
387 Ga0157370_10129911 3300013104 Bacteria 2350
388 Ga0157369_10008969 3300013105 Bacteria 11455
389 Ga0157369_10047220 3300013105 Bacteria 4677
390 Ga0157369_10068453 3300013105 Bacteria 3814
391 Ga0157369_10117472 3300013105 Bacteria 2823
392 Ga0157369_10238587 3300013105 Bacteria 1899
393 Ga0157369_10369738 3300013105 Bacteria 1488
394 Ga0157374_10118124 3300013296 Bacteria 2557
395 Ga0157378_10000396 3300013297 Bacteria 42907
396 Ga0157378_10049130 3300013297 Bacteria 3753
397 Ga0163162_10033926 3300013306 Bacteria 5075
398 Ga0163162_10147709 3300013306 Bacteria 2468
399 Ga0163162_10244284 3300013306 Bacteria 1927
400 Ga0163162_10445418 3300013306 Bacteria 1427
401 Ga0157372_10002901 3300013307 Bacteria 18541
402 Ga0157372_10183940 3300013307 Bacteria 2420
403 Ga0157372_10196986 3300013307 Bacteria 2333
404 Ga0157372_10355671 3300013307 Bacteria 1706
405 Ga0157372_10421893 3300013307 Bacteria 1555
406 Ga0157372_10492550 3300013307 Bacteria 1429
407 Ga0157375_10043324 3300013308 Bacteria 4364
408 Ga0157375_10282609 3300013308 Bacteria 1822
409 Ga0157375_10299054 3300013308 Bacteria 1773
410 Ga0157375_10429570 3300013308 Bacteria 1487
411 Ga0157375_10846347 3300013308 Bacteria 1061
412 Ga0163163_10000187 3300014325 Bacteria 63661
413 Ga0163163_10038010 3300014325 Bacteria 4687
414 Ga0163163_10172812 3300014325 Bacteria 2207
415 Ga0157377_10086772 3300014745 Bacteria 1840
416 Ga0157379_10000566 3300014968 Bacteria 29886
417 Ga0157379_10295666 3300014968 Bacteria 1475
418 Ga0157376_10631272 3300014969 Bacteria 1069
419 Ga0163161_10009814 3300017792 Bacteria 6631
420 Ga0163161_10166983 3300017792 Bacteria 1681
421 Ga0206356_10494831 3300020070 Bacteria 1834
422 Ga0206354_11338315 3300020081 Bacteria 3793
423 Ga0213876_10036667 3300021384 Bacteria 2586
424 Ga0213876_10094079 3300021384 Bacteria 1587
425 Ga0213875_10029054 3300021388 Bacteria 2621
426 Ga0207697_10001345 3300025315 Bacteria 13489
427 Ga0207656_10005305 3300025321 Bacteria 4548
428 Ga0207656_10049679 3300025321 Bacteria 1809
429 Ga0207656_10070440 3300025321 Bacteria 1553
430 Ga0207682_10000079 3300025893 Bacteria 42646
431 Ga0207682_10013573 3300025893 Bacteria 3173
432 Ga0207688_10000721 3300025901 Bacteria 16387
433 Ga0207688_10027488 3300025901 Bacteria 3130
434 Ga0207688_10039387 3300025901 Bacteria 2625
435 Ga0207688_10049871 3300025901 Bacteria 2341
436 Ga0207688_10058166 3300025901 Bacteria 2175
437 Ga0207688_10076593 3300025901 Bacteria 1905
438 Ga0207688_10107689 3300025901 Bacteria 1615
439 Ga0207688_10170120 3300025901 Bacteria 1295
440 Ga0207680_10002648 3300025903 Bacteria 8368
441 Ga0207680_10006265 3300025903 Bacteria 5742
442 Ga0207680_10020639 3300025903 Bacteria 3551
443 Ga0207680_10033350 3300025903 Bacteria 2937
444 Ga0207647_10000227 3300025904 Bacteria 46631
445 Ga0207647_10000517 3300025904 Bacteria 30788
446 Ga0207647_10000583 3300025904 Bacteria 28374
447 Ga0207647_10001932 3300025904 Bacteria 15842
448 Ga0207647_10014223 3300025904 Bacteria 5492
449 Ga0207647_10040813 3300025904 Bacteria 2920
450 Ga0207647_10068143 3300025904 Bacteria 2154
451 Ga0207647_10175290 3300025904 Bacteria 1248
452 Ga0207645_10002016 3300025907 Bacteria 16311
453 Ga0207645_10014762 3300025907 Bacteria 5216
454 Ga0207645_10082110 3300025907 Bacteria 2066
455 Ga0207643_10127773 3300025908 Bacteria 1510
456 Ga0207705_10000033 3300025909 Bacteria 223997
457 Ga0207705_10000912 3300025909 Bacteria 24200
458 Ga0207705_10004675 3300025909 Bacteria 10332
459 Ga0207705_10010979 3300025909 Bacteria 6577
460 Ga0207705_10014241 3300025909 Bacteria 5727
461 Ga0207705_10014531 3300025909 Bacteria 5664
462 Ga0207705_10015103 3300025909 Bacteria 5550
463 Ga0207705_10021424 3300025909 Bacteria 4612
464 Ga0207705_10027829 3300025909 Bacteria 4031
465 Ga0207705_10037980 3300025909 Bacteria 3447
466 Ga0207705_10041373 3300025909 Bacteria 3306
467 Ga0207705_10054790 3300025909 Bacteria 2874
468 Ga0207705_10058442 3300025909 Bacteria 2782
469 Ga0207705_10080652 3300025909 Bacteria 2371
470 Ga0207705_10150769 3300025909 Bacteria 1742
471 Ga0207705_10157171 3300025909 Bacteria 1706
472 Ga0207705_10193144 3300025909 Bacteria 1540
473 Ga0207705_10253077 3300025909 Bacteria 1343
474 Ga0207654_10017495 3300025911 Bacteria 3748
475 Ga0207654_10121724 3300025911 Bacteria 1639
476 Ga0207707_10126991 3300025912 Bacteria 2230
477 Ga0207707_10156960 3300025912 Bacteria 1990
478 Ga0207695_10008356 3300025913 Bacteria 12966
479 Ga0207695_10016871 3300025913 Bacteria 8522
480 Ga0207695_10030480 3300025913 Bacteria 5937
481 Ga0207695_10268356 3300025913 Bacteria 1603
482 Ga0207693_10055849 3300025915 Bacteria 3097
483 Ga0207693_10071078 3300025915 Bacteria 2723
484 Ga0207660_10000711 3300025917 Bacteria 22172
485 Ga0207660_10039797 3300025917 Bacteria 3288
486 Ga0207660_10094080 3300025917 Bacteria 2227
487 Ga0207660_10104748 3300025917 Bacteria 2118
488 Ga0207660_10190391 3300025917 Bacteria 1597
489 Ga0207662_10342305 3300025918 Bacteria 1002
490 Ga0207657_10000133 3300025919 Bacteria 75282
491 Ga0207657_10001331 3300025919 Bacteria 26231
492 Ga0207657_10005192 3300025919 Bacteria 13660
493 Ga0207657_10015073 3300025919 Bacteria 7508
494 Ga0207657_10019719 3300025919 Bacteria 6394
495 Ga0207657_10022951 3300025919 Bacteria 5822
496 Ga0207657_10035051 3300025919 Bacteria 4505
497 Ga0207657_10077391 3300025919 Bacteria 2803
498 Ga0207657_10098388 3300025919 Bacteria 2431
499 Ga0207657_10098980 3300025919 Bacteria 2422
500 Ga0207657_10125517 3300025919 Bacteria 2108
501 Ga0207657_10132145 3300025919 Bacteria 2045
502 Ga0207657_10175489 3300025919 Bacteria 1734
503 Ga0207657_10207449 3300025919 Bacteria 1574
504 Ga0207649_10000378 3300025920 Bacteria 33311
505 Ga0207649_10000827 3300025920 Bacteria 19901
506 Ga0207649_10014274 3300025920 Bacteria 4445
507 Ga0207649_10029545 3300025920 Bacteria 3237
508 Ga0207649_10053796 3300025920 Bacteria 2503
509 Ga0207649_10074523 3300025920 Bacteria 2178
510 Ga0207649_10149132 3300025920 Bacteria 1609
511 Ga0207649_10186125 3300025920 Bacteria 1457
512 Ga0207649_10198620 3300025920 Bacteria 1415
513 Ga0207649_10228831 3300025920 Bacteria 1328
514 Ga0207649_10240279 3300025920 Bacteria 1300
515 Ga0207649_10345573 3300025920 Bacteria 1100
516 Ga0207652_10026469 3300025921 Bacteria 4831
517 Ga0207652_10069558 3300025921 Bacteria 3056
518 Ga0207652_10071613 3300025921 Bacteria 3012
519 Ga0207652_10207383 3300025921 Bacteria 1764
520 Ga0207652_10280864 3300025921 Bacteria 1502
521 Ga0207652_10512709 3300025921 Bacteria 1079
522 Ga0207681_10014783 3300025923 Bacteria 4859
523 Ga0207681_10073047 3300025923 Bacteria 2398
524 Ga0207681_10415674 3300025923 Bacteria 1089
525 Ga0207694_10000781 3300025924 Bacteria 28578
526 Ga0207694_10039116 3300025924 Bacteria 3649
527 Ga0207694_10343110 3300025924 Bacteria 1235
528 Ga0207694_10353235 3300025924 Bacteria 1217
529 Ga0207650_10011138 3300025925 Bacteria 6185
530 Ga0207650_10018909 3300025925 Bacteria 4841
531 Ga0207650_10037396 3300025925 Bacteria 3537
532 Ga0207650_10099899 3300025925 Bacteria 2232
533 Ga0207659_10002718 3300025926 Bacteria 10545
534 Ga0207659_10015918 3300025926 Bacteria 4885
535 Ga0207659_10016216 3300025926 Bacteria 4844
536 Ga0207659_10054129 3300025926 Bacteria 2865
537 Ga0207659_10241570 3300025926 Bacteria 1461
538 Ga0207687_10000688 3300025927 Bacteria 22793
539 Ga0207687_10017203 3300025927 Bacteria 4755
540 Ga0207687_10064299 3300025927 Bacteria 2601
541 Ga0207687_10101304 3300025927 Bacteria 2120
542 Ga0207700_10081309 3300025928 Bacteria 2530
543 Ga0207664_10207797 3300025929 Bacteria 1693
544 Ga0207664_10281512 3300025929 Bacteria 1459
545 Ga0207644_10000810 3300025931 Bacteria 19859
546 Ga0207644_10000892 3300025931 Bacteria 18859
547 Ga0207644_10002130 3300025931 Bacteria 12841
548 Ga0207644_10012868 3300025931 Bacteria 5565
549 Ga0207644_10020478 3300025931 Bacteria 4497
550 Ga0207644_10033274 3300025931 Bacteria 3600
551 Ga0207644_10034379 3300025931 Bacteria 3546
552 Ga0207644_10092233 3300025931 Bacteria 2259
553 Ga0207644_10120333 3300025931 Bacteria 1998
554 Ga0207644_10168410 3300025931 Bacteria 1708
555 Ga0207644_10257375 3300025931 Bacteria 1394
556 Ga0207690_10000020 3300025932 Bacteria 218439
557 Ga0207690_10000080 3300025932 Bacteria 82082
558 Ga0207690_10003001 3300025932 Bacteria 10166
559 Ga0207690_10012320 3300025932 Bacteria 5117
560 Ga0207690_10014667 3300025932 Bacteria 4737
561 Ga0207690_10034091 3300025932 Bacteria 3278
562 Ga0207690_10063717 3300025932 Bacteria 2514
563 Ga0207690_10077417 3300025932 Bacteria 2312
564 Ga0207690_10098006 3300025932 Bacteria 2087
565 Ga0207690_10104453 3300025932 Bacteria 2030
566 Ga0207690_10191450 3300025932 Bacteria 1547
567 Ga0207690_10195166 3300025932 Bacteria 1534
568 Ga0207690_10295231 3300025932 Bacteria 1266
569 Ga0207690_10297800 3300025932 Bacteria 1261
570 Ga0207690_10372550 3300025932 Bacteria 1133
571 Ga0207690_10403083 3300025932 Bacteria 1091
572 Ga0207706_10000159 3300025933 Bacteria 75284
573 Ga0207706_10000648 3300025933 Bacteria 36742
574 Ga0207706_10003259 3300025933 Bacteria 15545
575 Ga0207706_10007371 3300025933 Bacteria 10166
576 Ga0207706_10009711 3300025933 Bacteria 8832
577 Ga0207706_10013736 3300025933 Bacteria 7349
578 Ga0207706_10013923 3300025933 Bacteria 7294
579 Ga0207706_10018102 3300025933 Bacteria 6339
580 Ga0207706_10018600 3300025933 Bacteria 6251
581 Ga0207706_10027266 3300025933 Bacteria 5109
582 Ga0207706_10093565 3300025933 Bacteria 2643
583 Ga0207706_10214968 3300025933 Bacteria 1684
584 Ga0207706_10215865 3300025933 Bacteria 1680
585 Ga0207706_10307044 3300025933 Bacteria 1382
586 Ga0207670_10026440 3300025936 Bacteria 3657
587 Ga0207669_10024181 3300025937 Bacteria 3261
588 Ga0207669_10063561 3300025937 Bacteria 2279
589 Ga0207669_10436416 3300025937 Bacteria 1034
590 Ga0207704_10001537 3300025938 Bacteria 10349
591 Ga0207704_10119550 3300025938 Bacteria 1800
592 Ga0207704_10144004 3300025938 Bacteria 1671
593 Ga0207704_10507240 3300025938 Bacteria 973
594 Ga0207665_10035217 3300025939 Bacteria 3322
595 Ga0207691_10000926 3300025940 Bacteria 29127
596 Ga0207691_10003338 3300025940 Bacteria 15625
597 Ga0207691_10036411 3300025940 Bacteria 4559
598 Ga0207691_10049167 3300025940 Bacteria 3864
599 Ga0207691_10055077 3300025940 Bacteria 3626
600 Ga0207691_10059868 3300025940 Bacteria 3462
601 Ga0207691_10088076 3300025940 Bacteria 2784
602 Ga0207711_10000760 3300025941 Bacteria 31645
603 Ga0207711_10003592 3300025941 Bacteria 13418
604 Ga0207711_10004362 3300025941 Bacteria 12072
605 Ga0207711_10008307 3300025941 Bacteria 8692
606 Ga0207711_10022518 3300025941 Bacteria 5269
607 Ga0207711_10032679 3300025941 Bacteria 4400
608 Ga0207711_10084802 3300025941 Bacteria 2774
609 Ga0207711_10144602 3300025941 Bacteria 2142
610 Ga0207711_10251259 3300025941 Bacteria 1624
611 Ga0207711_10268325 3300025941 Bacteria 1570
612 Ga0207711_10314482 3300025941 Bacteria 1446
613 Ga0207689_10000128 3300025942 Bacteria 64122
614 Ga0207689_10038297 3300025942 Bacteria 3972
615 Ga0207661_10007110 3300025944 Bacteria 7953
616 Ga0207661_10184159 3300025944 Bacteria 1827
617 Ga0207661_10297873 3300025944 Bacteria 1445
618 Ga0207679_10000155 3300025945 Bacteria 56504
619 Ga0207679_10002019 3300025945 Bacteria 12587
620 Ga0207679_10025734 3300025945 Bacteria 4051
621 Ga0207679_10048152 3300025945 Bacteria 3101
622 Ga0207679_10052855 3300025945 Bacteria 2981
623 Ga0207679_10078933 3300025945 Bacteria 2509
624 Ga0207679_10093649 3300025945 Bacteria 2331
625 Ga0207679_10096366 3300025945 Bacteria 2302
626 Ga0207679_10212473 3300025945 Bacteria 1623
627 Ga0207679_10232630 3300025945 Bacteria 1557
628 Ga0207679_10247188 3300025945 Bacteria 1514
629 Ga0207679_10332926 3300025945 Bacteria 1318
630 Ga0207679_10535368 3300025945 Bacteria 1049
631 Ga0207667_10020518 3300025949 Bacteria 7345
632 Ga0207667_10021357 3300025949 Bacteria 7174
633 Ga0207667_10030200 3300025949 Bacteria 5865
634 Ga0207667_10039636 3300025949 Bacteria 5020
635 Ga0207667_10078720 3300025949 Bacteria 3416
636 Ga0207667_10099523 3300025949 Bacteria 3000
637 Ga0207667_10108289 3300025949 Bacteria 2867
638 Ga0207667_10115211 3300025949 Bacteria 2770
639 Ga0207667_10376583 3300025949 Bacteria 1446
640 Ga0207651_10000620 3300025960 Bacteria 14946
641 Ga0207651_10001297 3300025960 Bacteria 11254
642 Ga0207651_10004424 3300025960 Bacteria 7077
643 Ga0207651_10020848 3300025960 Bacteria 3967
644 Ga0207651_10068223 3300025960 Bacteria 2506
645 Ga0207651_10073771 3300025960 Bacteria 2427
646 Ga0207651_10073997 3300025960 Bacteria 2424
647 Ga0207651_10166549 3300025960 Bacteria 1733
648 Ga0207651_10197447 3300025960 Bacteria 1609
649 Ga0207651_10210689 3300025960 Bacteria 1564
650 Ga0207651_10283123 3300025960 Bacteria 1371
651 Ga0207651_10408705 3300025960 Bacteria 1156
652 Ga0207712_10000572 3300025961 Bacteria 29742
653 Ga0207712_10173235 3300025961 Bacteria 1689
654 Ga0207668_10000325 3300025972 Bacteria 30851
655 Ga0207668_10054493 3300025972 Bacteria 2776
656 Ga0207668_10144019 3300025972 Bacteria 1836
657 Ga0207668_10146498 3300025972 Bacteria 1823
658 Ga0207668_10169962 3300025972 Bacteria 1709
659 Ga0207640_10001486 3300025981 Bacteria 12645
660 Ga0207640_10005541 3300025981 Bacteria 6879
661 Ga0207640_10016689 3300025981 Bacteria 4279
662 Ga0207640_10045676 3300025981 Bacteria 2814
663 Ga0207640_10087145 3300025981 Bacteria 2151
664 Ga0207640_10134927 3300025981 Bacteria 1790
665 Ga0207640_10248841 3300025981 Bacteria 1378
666 Ga0207640_10277796 3300025981 Bacteria 1314
667 Ga0207640_10382686 3300025981 Bacteria 1140
668 Ga0207658_10005634 3300025986 Bacteria 8569
669 Ga0207658_10008371 3300025986 Bacteria 7040
670 Ga0207658_10047135 3300025986 Bacteria 3152
671 Ga0207658_10076860 3300025986 Bacteria 2545
672 Ga0207658_10078811 3300025986 Bacteria 2518
673 Ga0207658_10094254 3300025986 Bacteria 2329
674 Ga0207658_10200223 3300025986 Bacteria 1667
675 Ga0207677_10000796 3300026023 Bacteria 18102
676 Ga0207677_10003817 3300026023 Bacteria 8011
677 Ga0207677_10011309 3300026023 Bacteria 5084
678 Ga0207677_10013508 3300026023 Bacteria 4736
679 Ga0207703_10003199 3300026035 Bacteria 13789
680 Ga0207703_10025476 3300026035 Bacteria 4652
681 Ga0207703_10034727 3300026035 Bacteria 4003
682 Ga0207703_10045212 3300026035 Bacteria 3541
683 Ga0207703_10156324 3300026035 Bacteria 1993
684 Ga0207703_10171121 3300026035 Bacteria 1911
685 Ga0207639_10000289 3300026041 Bacteria 35884
686 Ga0207639_10028716 3300026041 Bacteria 4064
687 Ga0207639_10047031 3300026041 Bacteria 3259
688 Ga0207639_10222993 3300026041 Bacteria 1629
689 Ga0207639_10234782 3300026041 Bacteria 1592
690 Ga0207639_10248029 3300026041 Bacteria 1551
691 Ga0207639_10265902 3300026041 Bacteria 1502
692 Ga0207678_10013918 3300026067 Bacteria 7070
693 Ga0207678_10015318 3300026067 Bacteria 6744
694 Ga0207678_10019007 3300026067 Bacteria 6036
695 Ga0207678_10028747 3300026067 Bacteria 4853
696 Ga0207678_10074482 3300026067 Bacteria 2909
697 Ga0207678_10077303 3300026067 Bacteria 2851
698 Ga0207678_10136274 3300026067 Bacteria 2095
699 Ga0207678_10147688 3300026067 Bacteria 2007
700 Ga0207678_10186857 3300026067 Bacteria 1770
701 Ga0207678_10193066 3300026067 Bacteria 1741
702 Ga0207678_10474243 3300026067 Bacteria 1089
703 Ga0207708_10142330 3300026075 Bacteria 1882
704 Ga0207702_10000246 3300026078 Bacteria 63201
705 Ga0207702_10084129 3300026078 Bacteria 2769
706 Ga0207702_10145782 3300026078 Bacteria 2148
707 Ga0207702_10169853 3300026078 Bacteria 1999
708 Ga0207702_10231607 3300026078 Bacteria 1727
709 Ga0207702_10466258 3300026078 Bacteria 1227
710 Ga0207641_10001758 3300026088 Bacteria 20880
711 Ga0207641_10004008 3300026088 Bacteria 12848
712 Ga0207641_10017291 3300026088 Bacteria 5903
713 Ga0207641_10026684 3300026088 Bacteria 4769
714 Ga0207641_10037112 3300026088 Bacteria 4069
715 Ga0207641_10044036 3300026088 Bacteria 3751
716 Ga0207641_10054345 3300026088 Bacteria 3397
717 Ga0207641_10061500 3300026088 Bacteria 3203
718 Ga0207641_10238679 3300026088 Bacteria 1693
719 Ga0207648_10000876 3300026089 Bacteria 33914
720 Ga0207648_10006885 3300026089 Bacteria 11268
721 Ga0207648_10007196 3300026089 Bacteria 10972
722 Ga0207648_10009898 3300026089 Bacteria 9087
723 Ga0207648_10065367 3300026089 Bacteria 3171
724 Ga0207648_10111618 3300026089 Bacteria 2400
725 Ga0207648_10335766 3300026089 Bacteria 1360
726 Ga0207676_10000220 3300026095 Bacteria 49329
727 Ga0207676_10007423 3300026095 Bacteria 7774
728 Ga0207676_10015579 3300026095 Bacteria 5488
729 Ga0207676_10016564 3300026095 Bacteria 5337
730 Ga0207676_10034855 3300026095 Bacteria 3813
731 Ga0207676_10041547 3300026095 Bacteria 3531
732 Ga0207676_10054659 3300026095 Bacteria 3130
733 Ga0207676_10144397 3300026095 Bacteria 2042
734 Ga0207676_10184236 3300026095 Bacteria 1831
735 Ga0207674_10000827 3300026116 Bacteria 40278
736 Ga0207674_10000859 3300026116 Bacteria 39717
737 Ga0207674_10001787 3300026116 Bacteria 27448
738 Ga0207674_10004351 3300026116 Bacteria 17085
739 Ga0207674_10007113 3300026116 Bacteria 13079
740 Ga0207674_10036696 3300026116 Bacteria 5103
741 Ga0207674_10041064 3300026116 Bacteria 4786
742 Ga0207674_10067703 3300026116 Bacteria 3594
743 Ga0207674_10134643 3300026116 Bacteria 2433
744 Ga0207674_10328059 3300026116 Bacteria 1480
745 Ga0207675_100077638 3300026118 Bacteria 3111
746 Ga0207683_10001953 3300026121 Bacteria 18252
747 Ga0207683_10010031 3300026121 Bacteria 8082
748 Ga0207683_10026311 3300026121 Bacteria 5022
749 Ga0207683_10056465 3300026121 Bacteria 3444
750 Ga0207683_10061884 3300026121 Bacteria 3295
751 Ga0207683_10253508 3300026121 Bacteria 1606
752 Ga0207698_10000421 3300026142 Bacteria 24394
753 Ga0207698_10009497 3300026142 Bacteria 6205
754 Ga0207698_10019885 3300026142 Bacteria 4609
755 Ga0207698_10048299 3300026142 Bacteria 3230
756 Ga0207698_10073262 3300026142 Bacteria 2727
757 Ga0207698_10123803 3300026142 Bacteria 2194
758 Ga0207698_10143375 3300026142 Bacteria 2062
759 Ga0207698_10170548 3300026142 Bacteria 1915
760 Ga0207698_10171097 3300026142 Bacteria 1913
761 Ga0207698_10205555 3300026142 Bacteria 1767
762 Ga0207698_10310045 3300026142 Bacteria 1473
763 Ga0207698_10409402 3300026142 Bacteria 1298
764 Ga0268266_10000151 3300028379 Bacteria 132529
765 Ga0268266_10003545 3300028379 Bacteria 15494
766 Ga0268266_10016069 3300028379 Bacteria 6397
767 Ga0268266_10023644 3300028379 Bacteria 5230
768 Ga0268266_10049654 3300028379 Bacteria 3598
769 Ga0268266_10073215 3300028379 Bacteria 2973
770 Ga0268266_10078096 3300028379 Bacteria 2880
771 Ga0268266_10145848 3300028379 Bacteria 2128
772 Ga0268266_10268995 3300028379 Bacteria 1581
773 Ga0268265_10003983 3300028380 Bacteria 10402
774 Ga0268265_10012837 3300028380 Bacteria 5689
775 Ga0268265_10022486 3300028380 Bacteria 4431
776 Ga0268265_10057886 3300028380 Bacteria 2956
777 Ga0268265_10157798 3300028380 Bacteria 1922
778 Ga0268264_10004357 3300028381 Bacteria 12081
779 Ga0268264_10006124 3300028381 Bacteria 10162
780 Ga0268264_10012754 3300028381 Bacteria 6916
781 Ga0268264_10014181 3300028381 Bacteria 6554
782 Ga0268264_10026360 3300028381 Bacteria 4748
783 Ga0268264_10521932 3300028381 Bacteria 1161
784 Ga0307408_100061768 3300031548 Bacteria 2735
785 Ga0307408_100105839 3300031548 Bacteria 2151
786 Ga0307408_100508765 3300031548 Bacteria 1055
787 Ga0307405_10014498 3300031731 Bacteria 4239
788 Ga0307405_10053499 3300031731 Bacteria 2515
789 Ga0307405_10203342 3300031731 Bacteria 1440
790 Ga0307405_10271531 3300031731 Bacteria 1272
791 Ga0307413_10005270 3300031824 Bacteria 5749
792 Ga0307413_10007603 3300031824 Bacteria 5049
793 Ga0307413_10048280 3300031824 Bacteria 2543
794 Ga0307413_10060395 3300031824 Bacteria 2333
795 Ga0307413_10073917 3300031824 Bacteria 2156
796 Ga0307413_10236513 3300031824 Bacteria 1345
797 Ga0307413_10246787 3300031824 Bacteria 1322
798 Ga0307410_10000178 3300031852 Bacteria 23344
799 Ga0307410_10004922 3300031852 Bacteria 6996
800 Ga0307410_10007484 3300031852 Bacteria 5980
801 Ga0307410_10019768 3300031852 Bacteria 4105
802 Ga0307410_10032283 3300031852 Bacteria 3368
803 Ga0307410_10055472 3300031852 Bacteria 2690
804 Ga0307410_10057818 3300031852 Bacteria 2642
805 Ga0307410_10081184 3300031852 Bacteria 2277
806 Ga0307410_10108646 3300031852 Bacteria 2003
807 Ga0307410_10263909 3300031852 Bacteria 1344
808 Ga0307410_10495352 3300031852 Bacteria 1004
809 Ga0307406_10012510 3300031901 Bacteria 4837
810 Ga0307406_10036212 3300031901 Bacteria 3039
811 Ga0307406_10081437 3300031901 Bacteria 2152
812 Ga0307406_10256055 3300031901 Bacteria 1321
813 Ga0307406_10330739 3300031901 Bacteria 1182
814 Ga0307407_10002066 3300031903 Bacteria 7689
815 Ga0307407_10037350 3300031903 Bacteria 2683
816 Ga0307407_10064505 3300031903 Bacteria 2153
817 Ga0307407_10068812 3300031903 Bacteria 2098
818 Ga0307412_10013840 3300031911 Bacteria 4741
819 Ga0307412_10529450 3300031911 Bacteria 986
820 Ga0307409_100000158 3300031995 Bacteria 26022
821 Ga0307409_100006740 3300031995 Bacteria 6792
822 Ga0307409_100051983 3300031995 Bacteria 3139
823 Ga0307409_100088727 3300031995 Bacteria 2525
824 Ga0307409_100094202 3300031995 Bacteria 2463
825 Ga0307409_100101908 3300031995 Bacteria 2384
826 Ga0307409_100114585 3300031995 Bacteria 2268
827 Ga0307409_100159149 3300031995 Bacteria 1972
828 Ga0307409_100179224 3300031995 Bacteria 1874
829 Ga0307409_100225437 3300031995 Bacteria 1695
830 Ga0307409_100255633 3300031995 Bacteria 1604
831 Ga0307409_100370743 3300031995 Bacteria 1357
832 Ga0307409_100412339 3300031995 Bacteria 1293
833 Ga0307409_100420939 3300031995 Bacteria 1281
834 Ga0307409_100671355 3300031995 Bacteria 1032
835 Ga0307416_100008572 3300032002 Bacteria 6611
836 Ga0307416_100008874 3300032002 Bacteria 6528
837 Ga0307416_100089820 3300032002 Bacteria 2632
838 Ga0307416_100089900 3300032002 Bacteria 2631
839 Ga0307416_100160691 3300032002 Bacteria 2076
840 Ga0307416_100673198 3300032002 Bacteria 1122
841 Ga0307416_100828869 3300032002 Bacteria 1022
842 Ga0307414_10005187 3300032004 Bacteria 7150
843 Ga0307414_10006068 3300032004 Bacteria 6701
844 Ga0307414_10008908 3300032004 Bacteria 5731
845 Ga0307414_10050844 3300032004 Bacteria 2873
846 Ga0307414_10088365 3300032004 Bacteria 2293
847 Ga0307414_10225552 3300032004 Bacteria 1541
848 Ga0307414_10303050 3300032004 Bacteria 1352
849 Ga0307414_10444717 3300032004 Bacteria 1135
850 Ga0307414_10450636 3300032004 Bacteria 1128
851 Ga0307411_10000340 3300032005 Bacteria 15745
852 Ga0307411_10003955 3300032005 Bacteria 6998
853 Ga0307411_10009400 3300032005 Bacteria 5136
854 Ga0307411_10012437 3300032005 Bacteria 4644
855 Ga0307411_10019689 3300032005 Bacteria 3904
856 Ga0307411_10024987 3300032005 Bacteria 3570
857 Ga0307411_10033134 3300032005 Bacteria 3201
858 Ga0307411_10041074 3300032005 Bacteria 2940
859 Ga0307411_10049486 3300032005 Bacteria 2731
860 Ga0307411_10057204 3300032005 Bacteria 2574
861 Ga0307411_10116829 3300032005 Bacteria 1921
862 Ga0307411_10193649 3300032005 Bacteria 1554
863 Ga0307411_10206210 3300032005 Bacteria 1514
864 Ga0307411_10300737 3300032005 Bacteria 1286
865 Ga0307415_100031234 3300032126 Bacteria 3428
866 Ga0373938_0009429 3300034957 Bacteria 1769
867 Ga0373936_0054877 3300035113 Bacteria 1617
868 Ga0373954_0022214 3300035118 Bacteria 2876
869 Ga0373943_0005877 3300035170 Bacteria 5511
870 Ga0373946_0029622 3300035171 Bacteria 2180
871 Ga0373931_0029151 3300035691 Bacteria 2831
872 Ga0373931_0200564 3300035691 Bacteria 1192
873 Ga0373931_0209213 3300035691 Bacteria 1169
874 Ga0373937_0050795 3300036401 Bacteria 3799
875 Ga0395899_0000596 3300037312 Bacteria 37960
876 Ga0395899_0001631 3300037312 Bacteria 18740
877 Ga0395899_0016472 3300037312 Bacteria 5636
878 Ga0395899_0020699 3300037312 Bacteria 4987
879 Ga0395899_0023759 3300037312 Bacteria 4639
880 Ga0395899_0051295 3300037312 Bacteria 3062
881 Ga0395899_0055982 3300037312 Bacteria 2916
882 Ga0395899_0067426 3300037312 Bacteria 2625
883 Ga0395899_0073423 3300037312 Bacteria 2501
884 Ga0395899_0082037 3300037312 Bacteria 2345
885 Ga0395899_0092698 3300037312 Bacteria 2187
886 Ga0395899_0115915 3300037312 Bacteria 1922
887 Ga0395899_0140115 3300037312 Bacteria 1721
888 Ga0395899_0151164 3300037312 Bacteria 1645
889 Ga0395899_0151311 3300037312 Bacteria 1644
890 Ga0395899_0183897 3300037312 Bacteria 1465
891 Ga0395899_0278161 3300037312 Bacteria 1139
892 Ga0395899_0287942 3300037312 Bacteria 1115
893 Ga0395899_0325759 3300037312 Bacteria 1033
894 Ga0395900_0000192 3300037418 Bacteria 98186
895 Ga0395900_0001367 3300037418 Bacteria 29340
896 Ga0395900_0003372 3300037418 Bacteria 17257
897 Ga0395900_0004245 3300037418 Bacteria 15205
898 Ga0395900_0013465 3300037418 Bacteria 8357
899 Ga0395900_0014283 3300037418 Bacteria 8105
900 Ga0395900_0015134 3300037418 Bacteria 7864
901 Ga0395900_0017226 3300037418 Bacteria 7374
902 Ga0395900_0021371 3300037418 Bacteria 6616
903 Ga0395900_0028500 3300037418 Bacteria 5721
904 Ga0395900_0076975 3300037418 Bacteria 3427
905 Ga0395900_0081899 3300037418 Bacteria 3315
906 Ga0395900_0096446 3300037418 Bacteria 3038
907 Ga0395900_0102780 3300037418 Bacteria 2935
908 Ga0395900_0103922 3300037418 Bacteria 2918
909 Ga0395900_0114277 3300037418 Bacteria 2770
910 Ga0395900_0115897 3300037418 Bacteria 2749
911 Ga0395900_0138309 3300037418 Bacteria 2495
912 Ga0395900_0147724 3300037418 Bacteria 2403
913 Ga0395900_0152745 3300037418 Bacteria 2358
914 Ga0395900_0162610 3300037418 Bacteria 2276
915 Ga0395900_0173760 3300037418 Bacteria 2192
916 Ga0395900_0201990 3300037418 Bacteria 2010
917 Ga0395900_0257134 3300037418 Bacteria 1745
918 Ga0395900_0292426 3300037418 Bacteria 1617
919 Ga0395900_0308138 3300037418 Bacteria 1567
920 Ga0395900_0327142 3300037418 Bacteria 1511
921 Ga0395900_0327511 3300037418 Bacteria 1510
922 Ga0395900_0449190 3300037418 Bacteria 1246
923 Ga0395900_0482810 3300037418 Bacteria 1191
924 Ga0395900_0521501 3300037418 Bacteria 1136
925 Ga0395900_0532023 3300037418 Bacteria 1122
926 Ga0395900_0577684 3300037418 Bacteria 1066
927 Ga0395900_0706290 3300037418 Bacteria 941
928 Ga0395898_0000055 3300037466 Bacteria 278557
929 Ga0395898_0030645 3300037466 Bacteria 5381
930 Ga0395898_0032698 3300037466 Bacteria 5193
931 Ga0395898_0033045 3300037466 Bacteria 5164
932 Ga0395898_0050902 3300037466 Bacteria 4052
933 Ga0395898_0053892 3300037466 Bacteria 3926
934 Ga0395898_0074416 3300037466 Bacteria 3280
935 Ga0395898_0081293 3300037466 Bacteria 3124
936 Ga0395898_0095126 3300037466 Bacteria 2862
937 Ga0395898_0198969 3300037466 Bacteria 1913
938 Ga0395898_0221996 3300037466 Bacteria 1802
939 Ga0395898_0240277 3300037466 Bacteria 1727
940 Ga0395898_0558748 3300037466 Bacteria 1087
941 Ga0395905_0000067 3300037471 Bacteria 181887
942 Ga0395905_0000187 3300037471 Bacteria 98895
943 Ga0395905_0000215 3300037471 Bacteria 89274
944 Ga0395905_0001138 3300037471 Bacteria 33269
945 Ga0395905_0004624 3300037471 Bacteria 14237
946 Ga0395905_0005031 3300037471 Bacteria 13615
947 Ga0395905_0007298 3300037471 Bacteria 11015
948 Ga0395905_0011975 3300037471 Bacteria 8363
949 Ga0395905_0015781 3300037471 Bacteria 7175
950 Ga0395905_0016621 3300037471 Bacteria 6994
951 Ga0395905_0018831 3300037471 Bacteria 6549
952 Ga0395905_0030275 3300037471 Bacteria 5101
953 Ga0395905_0030629 3300037471 Bacteria 5067
954 Ga0395905_0031034 3300037471 Bacteria 5033
955 Ga0395905_0031039 3300037471 Bacteria 5032
956 Ga0395905_0047050 3300037471 Bacteria 4044
957 Ga0395905_0050375 3300037471 Bacteria 3901
958 Ga0395905_0052176 3300037471 Bacteria 3829
959 Ga0395905_0052377 3300037471 Bacteria 3820
960 Ga0395905_0055550 3300037471 Bacteria 3705
961 Ga0395905_0073235 3300037471 Bacteria 3211
962 Ga0395905_0074215 3300037471 Bacteria 3187
963 Ga0395905_0075213 3300037471 Bacteria 3165
964 Ga0395905_0086429 3300037471 Bacteria 2939
965 Ga0395905_0094671 3300037471 Bacteria 2802
966 Ga0395905_0100290 3300037471 Bacteria 2719
967 Ga0395905_0109771 3300037471 Bacteria 2590
968 Ga0395905_0122634 3300037471 Bacteria 2443
969 Ga0395905_0140009 3300037471 Bacteria 2276
970 Ga0395905_0199922 3300037471 Bacteria 1874
971 Ga0395905_0216051 3300037471 Bacteria 1795
972 Ga0395905_0226315 3300037471 Bacteria 1749
973 Ga0395905_0250724 3300037471 Bacteria 1653
974 Ga0395905_0275713 3300037471 Bacteria 1567
975 Ga0395905_0308675 3300037471 Bacteria 1470
976 Ga0395905_0315817 3300037471 Bacteria 1451
977 Ga0395905_0323280 3300037471 Bacteria 1433
978 Ga0395905_0376078 3300037471 Bacteria 1314
979 Ga0395905_0376833 3300037471 Bacteria 1312
980 Ga0395905_0396581 3300037471 Bacteria 1274
981 Ga0395905_0532377 3300037471 Bacteria 1076
982 Ga0436364_0470435 3300037853 Bacteria 2024
983 Ga0436364_0597140 3300037853 Bacteria 17809
984 Ga0395901_0000041 3300038443 Bacteria 202314
985 Ga0395901_0005969 3300038443 Bacteria 12330
986 Ga0395901_0013254 3300038443 Bacteria 8370
987 Ga0395901_0019751 3300038443 Bacteria 6889
988 Ga0395901_0022456 3300038443 Bacteria 6467
989 Ga0395901_0033961 3300038443 Bacteria 5266
990 Ga0395901_0038534 3300038443 Bacteria 4945
991 Ga0395901_0038787 3300038443 Bacteria 4927
992 Ga0395901_0042195 3300038443 Bacteria 4729
993 Ga0395901_0045565 3300038443 Bacteria 4552
994 Ga0395901_0045815 3300038443 Bacteria 4540
995 Ga0395901_0073397 3300038443 Bacteria 3568
996 Ga0395901_0087952 3300038443 Bacteria 3249
997 Ga0395901_0095453 3300038443 Bacteria 3116
998 Ga0395901_0099223 3300038443 Bacteria 3053
999 Ga0395901_0161970 3300038443 Bacteria 2350
1000 Ga0395901_0166655 3300038443 Bacteria 2313
1001 Ga0395901_0171124 3300038443 Bacteria 2279
1002 Ga0395901_0172748 3300038443 Bacteria 2267
1003 Ga0395901_0185599 3300038443 Bacteria 2181
1004 Ga0395901_0188262 3300038443 Bacteria 2164
1005 Ga0395901_0306840 3300038443 Bacteria 1644
1006 Ga0395901_0507896 3300038443 Bacteria 1226
1007 Ga0395901_0596176 3300038443 Bacteria 1114
1008 Ga0436365_1792078 3300039437 Bacteria 12534
1009 Ga0439448_0003621 3300042005 Bacteria 4301
1010 Ga0439432_015466 3300042006 Bacteria 2575
1011 Ga0439449_0017516 3300042007 Bacteria 2691
1012 Ga0439449_0080659 3300042007 Bacteria 1200
1013 Ga0439455_0006061 3300042012 Bacteria 2488
1014 Ga0450889_000489 3300042144 Bacteria 4410
1015 Ga0439458_0000214 3300042157 Bacteria 13591
1016 Ga0439458_0008577 3300042157 Bacteria 2277
1017 Ga0439464_0001702 3300042439 Bacteria 5265
1018 Ga0466972_0067263 3300044658 Bacteria 1712
1019 Ga0466966_0022829 3300044684 Bacteria 4101
1020 Ga0466966_0032037 3300044684 Bacteria 3409
1021 Ga0466966_0072873 3300044684 Bacteria 2149
1022 Ga0466966_0094831 3300044684 Bacteria 1849
1023 Ga0466966_0119805 3300044684 Bacteria 1617
1024 Ga0466966_0154450 3300044684 Bacteria 1398
1025 Ga0466961_0185207 3300044693 Bacteria 1292
1026 Ga0466963_0007958 3300044694 Bacteria 6346
1027 Ga0466963_0014138 3300044694 Bacteria 4917
1028 Ga0466963_0032720 3300044694 Bacteria 3369
1029 Ga0466963_0060933 3300044694 Bacteria 2521
1030 Ga0466963_0081768 3300044694 Bacteria 2188
1031 Ga0466963_0087637 3300044694 Bacteria 2117
1032 Ga0466963_0092328 3300044694 Bacteria 2062
1033 Ga0466963_0116870 3300044694 Bacteria 1833
1034 Ga0466963_0257743 3300044694 Bacteria 1224
1035 Ga0453684_0267446 3300044712 Bacteria 1956
1036 Ga0466968_0025105 3300044735 Bacteria 2439
1037 Ga0466968_0074530 3300044735 Bacteria 1482
1038 Ga0466970_0067810 3300044765 Bacteria 1916
1039 Ga0466970_0192247 3300044765 Bacteria 1134
1040 Ga0466957_0009241 3300044842 Bacteria 5623
1041 Ga0466957_0017240 3300044842 Bacteria 4227
1042 Ga0466957_0065986 3300044842 Bacteria 2230
1043 Ga0466957_0095088 3300044842 Bacteria 1871
1044 Ga0466957_0124481 3300044842 Bacteria 1646
1045 Ga0466957_0185219 3300044842 Bacteria 1361
1046 Ga0466960_0075992 3300044901 Bacteria 1682
1047 Ga0466959_0147959 3300045049 Bacteria 1657
1048 Ga0466959_0175055 3300045049 Bacteria 1504
1049 Ga0466958_0025225 3300045836 Bacteria 3503
1050 Ga0466958_0090944 3300045836 Bacteria 1889
1051 Ga0466967_0012836 3300045976 Bacteria 6438
1052 Ga0466967_0020297 3300045976 Bacteria 5366
1053 Ga0466967_0021517 3300045976 Bacteria 5242
1054 Ga0466967_0036921 3300045976 Bacteria 4176
1055 Ga0466967_0063041 3300045976 Bacteria 3292
1056 Ga0466967_0064593 3300045976 Bacteria 3255
1057 Ga0466967_0125372 3300045976 Bacteria 2378
1058 Ga0466967_0130129 3300045976 Bacteria 2335
1059 Ga0466967_0175114 3300045976 Bacteria 2021
1060 Ga0466967_0193283 3300045976 Bacteria 1924
1061 Ga0466967_0316461 3300045976 Bacteria 1504
1062 Ga0466967_0356563 3300045976 Bacteria 1416
1063 Ga0466967_0808071 3300045976 Bacteria 931
1064 Ga0495629_0232680 3300046459 Bacteria 1270
1065 Ga0495585_0087093 3300046492 Bacteria 1686
1066 Ga0495663_0009747 3300046525 Bacteria 2666
1067 Ga0495598_0001866 3300046537 Bacteria 4247
1068 Ga0495621_0000387 3300046539 Bacteria 10793
1069 Ga0495633_0005340 3300046558 Bacteria 7877
1070 Ga0495668_0008099 3300046616 Bacteria 6618
1071 Ga0495668_0012311 3300046616 Bacteria 5074
1072 Ga0495668_0041325 3300046616 Bacteria 2568
1073 Ga0495625_0341829 3300046660 Bacteria 948
1074 Ga0495623_0052722 3300046679 Bacteria 2570
1075 Ga0495669_0000362 3300046684 Bacteria 23170
1076 Ga0495669_0000380 3300046684 Bacteria 22405
1077 Ga0495669_0007887 3300046684 Bacteria 4467
1078 Ga0495669_0029605 3300046684 Bacteria 2402
1079 Ga0495670_0000346 3300046691 Bacteria 22049
1080 Ga0495670_0078115 3300046691 Bacteria 1683
1081 Ga0495677_0012918 3300047445 Bacteria 3041
1082 Ga0495685_071096 3300047447 Bacteria 1165
1083 Ga0496100_0012786 3300048903 Bacteria 4823
1084 Ga0496100_0079147 3300048903 Bacteria 2214
1085 Ga0496101_0005826 3300048904 Bacteria 7882
1086 Ga0496101_0068222 3300048904 Bacteria 2600
1087 Ga0496102_0050481 3300048905 Bacteria 3787
1088 Ga0496102_0192559 3300048905 Bacteria 1921
1089 Ga0496103_0034721 3300048906 Bacteria 3085
1090 Ga0496103_0079006 3300048906 Bacteria 2067
1091 Ga0496105_0152497 3300048908 Bacteria 1899
1092 Ga0496106_0036590 3300048909 Bacteria 3671
1093 Ga0496106_0292954 3300048909 Bacteria 1305
1094 Ga0496107_0013246 3300048910 Bacteria 5762
1095 Ga0496108_0010343 3300048911 Bacteria 7575
1096 Ga0496108_0018282 3300048911 Bacteria 5739
1097 Ga0496108_0020169 3300048911 Bacteria 5478
1098 Ga0496108_0050722 3300048911 Bacteria 3474
1099 Ga0496109_0001322 3300048912 Bacteria 20436
1100 Ga0496109_0012191 3300048912 Bacteria 7416
1101 Ga0496109_0013298 3300048912 Bacteria 7130
1102 Ga0496109_0017282 3300048912 Bacteria 6318
1103 Ga0496109_0053198 3300048912 Bacteria 3692
1104 Ga0496109_0096770 3300048912 Bacteria 2735
1105 Ga0496109_0109524 3300048912 Bacteria 2567
1106 Ga0496109_0534987 3300048912 Bacteria 1106
1107 Ga0496110_0005603 3300048913 Bacteria 9856
1108 Ga0496110_0015944 3300048913 Bacteria 6266
1109 Ga0496110_0026569 3300048913 Bacteria 4956
1110 Ga0496110_0028449 3300048913 Bacteria 4800
1111 Ga0496110_0069043 3300048913 Bacteria 3128
1112 Ga0496110_0070772 3300048913 Bacteria 3091
1113 Ga0496111_0001589 3300048914 Bacteria 13126
1114 Ga0496111_0010931 3300048914 Bacteria 6106
1115 Ga0496111_0025571 3300048914 Bacteria 4166
1116 Ga0496111_0063397 3300048914 Bacteria 2680
1117 Ga0496112_0017710 3300048915 Bacteria 6702
1118 Ga0496112_0028468 3300048915 Bacteria 5393
1119 Ga0496112_0053506 3300048915 Bacteria 3965
1120 Ga0496112_0057540 3300048915 Bacteria 3827
1121 Ga0496112_0198106 3300048915 Bacteria 1968
1122 Ga0496112_0283600 3300048915 Bacteria 1603
1123 Ga0496113_0003389 3300048916 Bacteria 9534
1124 Ga0496113_0015304 3300048916 Bacteria 5268
1125 Ga0496113_0017118 3300048916 Bacteria 5025
1126 Ga0496113_0030047 3300048916 Bacteria 3930
1127 Ga0496113_0132024 3300048916 Bacteria 1960
1128 Ga0496113_0171644 3300048916 Bacteria 1717
1129 Ga0496114_0000029 3300048917 Bacteria 175132
1130 Ga0501307_005125 3300049162 Bacteria 1369
1131 Ga0501067_0016871 3300049583 Bacteria 4034
1132 Ga0501067_0091070 3300049583 Bacteria 1693
1133 Ga0501070_0132889 3300049586 Bacteria 2055
1134 Ga0501249_000705 3300049679 Bacteria 7579
1135 Ga0501080_0345872 3300049742 Bacteria 1343
1136 Ga0501044_0231161 3300049823 Bacteria 1797
1137 Ga0501204_007697 3300049850 Bacteria 1215
1138 nmdc:mga09592_114893_c1 3300050508 Bacteria 2310
1139 nmdc:mga0a205_3658_c1 3300050515 Bacteria 13771
1140 Ga0500646_0019148 3300053090 Bacteria 1809
1141 Ga0500641_0100338 3300053096 Bacteria 1241
1142 Ga0500658_0000164 3300053134 Bacteria 31944
1143 Ga0500616_0000444 3300053153 Bacteria 54244
1144 Ga0466962_0008030 3300061719 Bacteria 5062
1145 Ga0466962_0061303 3300061719 Bacteria 1795
1146 Ga0530510_0181334 3300061734 Bacteria 1562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10021109 Ga0105245_100211095 222
2 3300032005 Ga0307411_10049486 Ga0307411_100494863 223
3 3300037466 Ga0395898_0558748 Ga0395898_0558748_14_787 223
4 3300005355 Ga0070671_100056250 Ga0070671_1000562503 232
5 3300025918 Ga0207662_10342305 Ga0207662_103423052 233
6 3300046660 Ga0495625_0341829 Ga0495625_0341829_105_914 233
7 3300037418 Ga0395900_0706290 Ga0395900_0706290_116_928 236
8 3300009148 Ga0105243_10399361 Ga0105243_103993612 237
9 3300014969 Ga0157376_10631272 Ga0157376_106312722 237
10 3300045836 Ga0466958_0090944 Ga0466958_0090944_837_1766 237
11 3300005336 Ga0070680_100015711 Ga0070680_1000157113 239
12 3300005563 Ga0068855_100021990 Ga0068855_1000219905 239
13 3300025917 Ga0207660_10000711 Ga0207660_1000071121 239
14 3300025929 Ga0207664_10281512 Ga0207664_102815122 240
15 3300061734 Ga0530510_0181334 Ga0530510_0181334_209_1138 240
16 3300044694 Ga0466963_0081768 Ga0466963_0081768_109_1038 243
17 3300005336 Ga0070680_100000197 Ga0070680_1000001972 245
18 3300005616 Ga0068852_100000433 Ga0068852_10000043315 245
19 3300013307 Ga0157372_10196986 Ga0157372_101969862 245
20 3300025909 Ga0207705_10010979 Ga0207705_100109792 245
21 3300026142 Ga0207698_10000421 Ga0207698_1000042112 245
22 3300045976 Ga0466967_0808071 Ga0466967_0808071_63_902 245
23 3300032005 Ga0307411_10300737 Ga0307411_103007371 246
24 3300048917 Ga0496114_0000029 Ga0496114_0000029_105688_106617 246
25 3300005327 Ga0070658_10106170 Ga0070658_101061702 248
26 3300025909 Ga0207705_10193144 Ga0207705_101931442 248
27 3300026067 Ga0207678_10147688 Ga0207678_101476882 248
28 3300035691 Ga0373931_0209213 Ga0373931_0209213_147_1076 248
29 3300013100 Ga0157373_10182746 Ga0157373_101827462 249
30 3300013105 Ga0157369_10238587 Ga0157369_102385872 249
31 3300025909 Ga0207705_10058442 Ga0207705_100584423 249
32 3300025920 Ga0207649_10029545 Ga0207649_100295454 249
33 3300005336 Ga0070680_100026400 Ga0070680_1000264003 250
34 3300005364 Ga0070673_100050958 Ga0070673_1000509582 250
35 3300005458 Ga0070681_10309999 Ga0070681_103099992 250
36 3300005530 Ga0070679_100199174 Ga0070679_1001991742 250
37 3300025901 Ga0207688_10039387 Ga0207688_100393873 250
38 3300025912 Ga0207707_10156960 Ga0207707_101569602 250
39 3300025917 Ga0207660_10039797 Ga0207660_100397972 250
40 3300025932 Ga0207690_10195166 Ga0207690_101951661 250
41 3300025949 Ga0207667_10021357 Ga0207667_100213579 250
42 3300025960 Ga0207651_10068223 Ga0207651_100682232 250
43 3300026142 Ga0207698_10009497 Ga0207698_100094976 250
44 3300031824 Ga0307413_10246787 Ga0307413_102467871 250
45 3300031995 Ga0307409_100179224 Ga0307409_1001792242 250
46 3300031995 Ga0307409_100420939 Ga0307409_1004209391 250
47 3300032002 Ga0307416_100828869 Ga0307416_1008288691 250
48 3300001989 JGI24739J22299_10033457 JGI24739J22299_100334572 251
49 3300005327 Ga0070658_10220620 Ga0070658_102206202 251
50 3300005335 Ga0070666_10303341 Ga0070666_103033412 251
51 3300005338 Ga0068868_100018089 Ga0068868_1000180895 251
52 3300005339 Ga0070660_100264979 Ga0070660_1002649792 251
53 3300005364 Ga0070673_100381025 Ga0070673_1003810251 251
54 3300005456 Ga0070678_100035050 Ga0070678_1000350502 251
55 3300005457 Ga0070662_100055161 Ga0070662_1000551612 251
56 3300005548 Ga0070665_100147593 Ga0070665_1001475932 251
57 3300005614 Ga0068856_100253600 Ga0068856_1002536001 251
58 3300005616 Ga0068852_100047204 Ga0068852_1000472042 251
59 3300005617 Ga0068859_100038160 Ga0068859_1000381604 251
60 3300005618 Ga0068864_100030285 Ga0068864_1000302854 251
61 3300005841 Ga0068863_100026484 Ga0068863_1000264842 251
62 3300005842 Ga0068858_100101879 Ga0068858_1001018792 251
63 3300006237 Ga0097621_100134270 Ga0097621_1001342701 251
64 3300006358 Ga0068871_100159698 Ga0068871_1001596981 251
65 3300006881 Ga0068865_100022604 Ga0068865_1000226042 251
66 3300006931 Ga0097620_100038158 Ga0097620_1000381584 251
67 3300009177 Ga0105248_10584128 Ga0105248_105841282 251
68 3300009551 Ga0105238_10039340 Ga0105238_100393404 251
69 3300010375 Ga0105239_10086562 Ga0105239_100865622 251
70 3300013105 Ga0157369_10068453 Ga0157369_100684533 251
71 3300013308 Ga0157375_10846347 Ga0157375_108463471 251
72 3300014325 Ga0163163_10038010 Ga0163163_100380103 251
73 3300014968 Ga0157379_10295666 Ga0157379_102956662 251
74 3300025901 Ga0207688_10049871 Ga0207688_100498712 251
75 3300025909 Ga0207705_10054790 Ga0207705_100547903 251
76 3300025920 Ga0207649_10228831 Ga0207649_102288311 251
77 3300025924 Ga0207694_10353235 Ga0207694_103532352 251
78 3300025932 Ga0207690_10191450 Ga0207690_101914502 251
79 3300025933 Ga0207706_10013923 Ga0207706_100139237 251
80 3300026023 Ga0207677_10003817 Ga0207677_100038174 251
81 3300026035 Ga0207703_10045212 Ga0207703_100452122 251
82 3300026088 Ga0207641_10044036 Ga0207641_100440362 251
83 3300026089 Ga0207648_10006885 Ga0207648_1000688513 251
84 3300026121 Ga0207683_10056465 Ga0207683_100564653 251
85 3300026142 Ga0207698_10123803 Ga0207698_101238032 251
86 3300028379 Ga0268266_10073215 Ga0268266_100732152 251
87 3300038443 Ga0395901_0038787 Ga0395901_0038787_2301_3230 251
88 3300048911 Ga0496108_0050722 Ga0496108_0050722_745_1674 251
89 3300048913 Ga0496110_0028449 Ga0496110_0028449_1393_2322 251
90 3300048916 Ga0496113_0030047 Ga0496113_0030047_2298_3227 251
91 3300025981 Ga0207640_10277796 Ga0207640_102777961 252
92 3300031824 Ga0307413_10007603 Ga0307413_100076033 252
93 3300031852 Ga0307410_10081184 Ga0307410_100811841 252
94 3300031903 Ga0307407_10064505 Ga0307407_100645053 252
95 3300031995 Ga0307409_100225437 Ga0307409_1002254371 252
96 3300031995 Ga0307409_100255633 Ga0307409_1002556332 252
97 3300032004 Ga0307414_10006068 Ga0307414_100060685 252
98 3300032004 Ga0307414_10450636 Ga0307414_104506361 252
99 3300032005 Ga0307411_10116829 Ga0307411_101168292 252
100 3300037418 Ga0395900_0021371 Ga0395900_0021371_1367_2296 252
101 3300042007 Ga0439449_0080659 Ga0439449_0080659_126_1055 252
102 3300042144 Ga0450889_000489 Ga0450889_000489_3463_4392 253
103 3300031824 Ga0307413_10048280 Ga0307413_100482802 254
104 3300031901 Ga0307406_10081437 Ga0307406_100814372 254
105 3300032004 Ga0307414_10088365 Ga0307414_100883652 254
106 3300037418 Ga0395900_0138309 Ga0395900_0138309_1616_2482 254
107 3300048913 Ga0496110_0069043 Ga0496110_0069043_2252_3118 254
108 3300005614 Ga0068856_100144071 Ga0068856_1001440713 255
109 3300031731 Ga0307405_10271531 Ga0307405_102715312 255
110 3300032005 Ga0307411_10206210 Ga0307411_102062101 255
111 3300044684 Ga0466966_0094831 Ga0466966_0094831_156_1085 255
112 3300048906 Ga0496103_0079006 Ga0496103_0079006_681_1610 255
113 3300005329 Ga0070683_100048199 Ga0070683_1000481993 256
114 3300005366 Ga0070659_100192566 Ga0070659_1001925662 256
115 3300005367 Ga0070667_100023963 Ga0070667_1000239634 256
116 3300005435 Ga0070714_100057580 Ga0070714_1000575805 256
117 3300005539 Ga0068853_100026148 Ga0068853_1000261485 256
118 3300005577 Ga0068857_100179476 Ga0068857_1001794763 256
119 3300013105 Ga0157369_10117472 Ga0157369_101174722 256
120 3300025909 Ga0207705_10150769 Ga0207705_101507692 256
121 3300025926 Ga0207659_10241570 Ga0207659_102415702 256
122 3300025929 Ga0207664_10207797 Ga0207664_102077973 256
123 3300025941 Ga0207711_10032679 Ga0207711_100326792 256
124 3300025944 Ga0207661_10007110 Ga0207661_100071107 256
125 3300025945 Ga0207679_10232630 Ga0207679_102326302 256
126 3300031852 Ga0307410_10108646 Ga0307410_101086462 256
127 3300037312 Ga0395899_0073423 Ga0395899_0073423_1498_2427 256
128 3300037853 Ga0436364_0470435 Ga0436364_0470435_68_997 256
129 3300001979 JGI24740J21852_10014193 JGI24740J21852_100141932 258
130 3300002075 JGI24738J21930_10018470 JGI24738J21930_100184702 258
131 3300005327 Ga0070658_10083841 Ga0070658_100838412 258
132 3300005339 Ga0070660_100026648 Ga0070660_1000266483 258
133 3300005355 Ga0070671_100399242 Ga0070671_1003992421 258
134 3300005366 Ga0070659_100238388 Ga0070659_1002383882 258
135 3300005544 Ga0070686_100000479 Ga0070686_10000047922 258
136 3300005548 Ga0070665_100346041 Ga0070665_1003460412 258
137 3300005578 Ga0068854_100175448 Ga0068854_1001754482 258
138 3300013307 Ga0157372_10421893 Ga0157372_104218932 258
139 3300025920 Ga0207649_10074523 Ga0207649_100745232 258
140 3300025981 Ga0207640_10134927 Ga0207640_101349271 258
141 3300026067 Ga0207678_10074482 Ga0207678_100744822 258
142 3300032004 Ga0307414_10225552 Ga0307414_102255522 258
143 3300042007 Ga0439449_0017516 Ga0439449_0017516_1567_2496 258
144 3300001989 JGI24739J22299_10017808 JGI24739J22299_100178083 259
145 3300001989 JGI24739J22299_10052734 JGI24739J22299_100527341 259
146 3300001991 JGI24743J22301_10002970 JGI24743J22301_100029701 259
147 3300005331 Ga0070670_100014334 Ga0070670_1000143343 259
148 3300005335 Ga0070666_10001801 Ga0070666_1000180112 259
149 3300005367 Ga0070667_100388562 Ga0070667_1003885621 259
150 3300005563 Ga0068855_100102679 Ga0068855_1001026792 259
151 3300005577 Ga0068857_100090673 Ga0068857_1000906732 259
152 3300005616 Ga0068852_100151594 Ga0068852_1001515942 259
153 3300025919 Ga0207657_10098388 Ga0207657_100983882 259
154 3300026116 Ga0207674_10007113 Ga0207674_100071137 259
155 3300037418 Ga0395900_0004245 Ga0395900_0004245_6763_7692 259
156 3300037418 Ga0395900_0102780 Ga0395900_0102780_685_1611 259
157 3300037471 Ga0395905_0047050 Ga0395905_0047050_2013_2939 259
158 3300038443 Ga0395901_0161970 Ga0395901_0161970_100_1026 259
159 3300005338 Ga0068868_100000032 Ga0068868_10000003266 260
160 3300005355 Ga0070671_100001226 Ga0070671_10000122620 260
161 3300005356 Ga0070674_100089158 Ga0070674_1000891582 260
162 3300005366 Ga0070659_100000005 Ga0070659_100000005259 260
163 3300005457 Ga0070662_100060072 Ga0070662_1000600722 260
164 3300005535 Ga0070684_100022293 Ga0070684_1000222934 260
165 3300005981 Ga0081538_10159101 Ga0081538_101591011 260
166 3300009098 Ga0105245_10085446 Ga0105245_100854464 260
167 3300009177 Ga0105248_10162803 Ga0105248_101628033 260
168 3300020081 Ga0206354_11338315 Ga0206354_113383154 260
169 3300025927 Ga0207687_10017203 Ga0207687_100172035 260
170 3300025931 Ga0207644_10000892 Ga0207644_1000089219 260
171 3300025932 Ga0207690_10000020 Ga0207690_1000002075 260
172 3300025949 Ga0207667_10376583 Ga0207667_103765831 260
173 3300026023 Ga0207677_10000796 Ga0207677_1000079614 260
174 3300026089 Ga0207648_10335766 Ga0207648_103357662 260
175 3300026121 Ga0207683_10010031 Ga0207683_100100317 260
176 3300048904 Ga0496101_0068222 Ga0496101_0068222_1109_2038 260
177 3300031548 Ga0307408_100061768 Ga0307408_1000617682 261
178 3300042006 Ga0439432_015466 Ga0439432_015466_394_1323 261
179 3300005339 Ga0070660_100003704 Ga0070660_1000037048 262
180 3300005354 Ga0070675_100249981 Ga0070675_1002499812 262
181 3300025909 Ga0207705_10004675 Ga0207705_100046757 262
182 3300025919 Ga0207657_10001331 Ga0207657_1000133112 262
183 3300026075 Ga0207708_10142330 Ga0207708_101423301 262
184 3300005331 Ga0070670_100094963 Ga0070670_1000949632 263
185 3300005333 Ga0070677_10008726 Ga0070677_100087263 263
186 3300005347 Ga0070668_100023928 Ga0070668_1000239283 263
187 3300005354 Ga0070675_100006097 Ga0070675_1000060979 263
188 3300017792 Ga0163161_10009814 Ga0163161_100098143 263
189 3300025893 Ga0207682_10013573 Ga0207682_100135733 263
190 3300025926 Ga0207659_10015918 Ga0207659_100159183 263
191 3300025972 Ga0207668_10054493 Ga0207668_100544933 263
192 3300031852 Ga0307410_10032283 Ga0307410_100322834 263
193 3300032005 Ga0307411_10003955 Ga0307411_100039554 263
194 3300005339 Ga0070660_100001425 Ga0070660_10000142516 264
195 3300005539 Ga0068853_100002446 Ga0068853_10000244613 264
196 3300005563 Ga0068855_100033766 Ga0068855_1000337665 264
197 3300005564 Ga0070664_100319328 Ga0070664_1003193282 264
198 3300009093 Ga0105240_10010475 Ga0105240_100104752 264
199 3300013104 Ga0157370_10005240 Ga0157370_1000524012 264
200 3300013307 Ga0157372_10002901 Ga0157372_1000290118 264
201 3300025904 Ga0207647_10000583 Ga0207647_100005835 264
202 3300025913 Ga0207695_10008356 Ga0207695_1000835613 264
203 3300025919 Ga0207657_10005192 Ga0207657_1000519213 264
204 3300025924 Ga0207694_10000781 Ga0207694_1000078127 264
205 3300025945 Ga0207679_10332926 Ga0207679_103329262 264
206 3300025949 Ga0207667_10039636 Ga0207667_100396367 264
207 3300026041 Ga0207639_10000289 Ga0207639_1000028941 264
208 3300026116 Ga0207674_10001787 Ga0207674_100017874 264
209 3300026142 Ga0207698_10170548 Ga0207698_101705482 264
210 3300031901 Ga0307406_10330739 Ga0307406_103307392 264
211 3300031911 Ga0307412_10013840 Ga0307412_100138402 264
212 3300032005 Ga0307411_10057204 Ga0307411_100572041 264
213 3300037418 Ga0395900_0001367 Ga0395900_0001367_6136_7065 264
214 3300037471 Ga0395905_0001138 Ga0395905_0001138_26345_27274 264
215 3300037471 Ga0395905_0004624 Ga0395905_0004624_4254_5177 264
216 3300038443 Ga0395901_0019751 Ga0395901_0019751_5216_6145 264
217 3300046616 Ga0495668_0008099 Ga0495668_0008099_277_1206 264
218 3300053134 Ga0500658_0000164 Ga0500658_0000164_29767_30696 264
219 3300002075 JGI24738J21930_10001387 JGI24738J21930_100013872 265
220 3300005327 Ga0070658_10001186 Ga0070658_100011862 265
221 3300005329 Ga0070683_100007551 Ga0070683_10000755111 265
222 3300005335 Ga0070666_10007307 Ga0070666_100073073 265
223 3300005337 Ga0070682_100039441 Ga0070682_1000394414 265
224 3300005339 Ga0070660_100000861 Ga0070660_10000086114 265
225 3300005344 Ga0070661_100000101 Ga0070661_10000010138 265
226 3300005366 Ga0070659_100000045 Ga0070659_10000004577 265
227 3300005457 Ga0070662_100000036 Ga0070662_10000003644 265
228 3300005539 Ga0068853_100000059 Ga0068853_10000005948 265
229 3300005547 Ga0070693_100000361 Ga0070693_10000036114 265
230 3300005548 Ga0070665_100004200 Ga0070665_10000420016 265
231 3300005563 Ga0068855_100003767 Ga0068855_1000037677 265
232 3300005564 Ga0070664_100000027 Ga0070664_10000002744 265
233 3300005614 Ga0068856_100000699 Ga0068856_10000069944 265
234 3300005834 Ga0068851_10084784 Ga0068851_100847842 265
235 3300009174 Ga0105241_10184043 Ga0105241_101840432 265
236 3300009177 Ga0105248_10001451 Ga0105248_1000145113 265
237 3300013100 Ga0157373_10042129 Ga0157373_100421294 265
238 3300014325 Ga0163163_10000187 Ga0163163_1000018734 265
239 3300025321 Ga0207656_10070440 Ga0207656_100704402 265
240 3300025903 Ga0207680_10006265 Ga0207680_100062657 265
241 3300025909 Ga0207705_10000912 Ga0207705_100009126 265
242 3300025911 Ga0207654_10121724 Ga0207654_101217242 265
243 3300025919 Ga0207657_10000133 Ga0207657_1000013359 265
244 3300025920 Ga0207649_10000378 Ga0207649_1000037814 265
245 3300025931 Ga0207644_10120333 Ga0207644_101203332 265
246 3300025932 Ga0207690_10000080 Ga0207690_1000008048 265
247 3300025933 Ga0207706_10000159 Ga0207706_1000015959 265
248 3300025941 Ga0207711_10004362 Ga0207711_100043627 265
249 3300025945 Ga0207679_10000155 Ga0207679_1000015523 265
250 3300025949 Ga0207667_10020518 Ga0207667_100205185 265
251 3300025960 Ga0207651_10210689 Ga0207651_102106892 265
252 3300025986 Ga0207658_10005634 Ga0207658_100056345 265
253 3300026035 Ga0207703_10171121 Ga0207703_101711212 265
254 3300026078 Ga0207702_10000246 Ga0207702_1000024632 265
255 3300026121 Ga0207683_10253508 Ga0207683_102535082 265
256 3300028379 Ga0268266_10023644 Ga0268266_100236445 265
257 3300034957 Ga0373938_0009429 Ga0373938_0009429_396_1325 265
258 3300035691 Ga0373931_0029151 Ga0373931_0029151_1845_2774 265
259 3300048912 Ga0496109_0096770 Ga0496109_0096770_534_1463 265
260 3300005548 Ga0070665_100323544 Ga0070665_1003235441 266
261 3300013102 Ga0157371_10164064 Ga0157371_101640643 266
262 3300028379 Ga0268266_10078096 Ga0268266_100780963 266
263 3300032005 Ga0307411_10009400 Ga0307411_100094005 266
264 3300044842 Ga0466957_0185219 Ga0466957_0185219_193_1122 266
265 3300048915 Ga0496112_0017710 Ga0496112_0017710_4881_5810 266
266 3300005328 Ga0070676_10058763 Ga0070676_100587632 267
267 3300005355 Ga0070671_100401503 Ga0070671_1004015032 267
268 3300005459 Ga0068867_100096652 Ga0068867_1000966522 267
269 3300005578 Ga0068854_100030707 Ga0068854_1000307072 267
270 3300005834 Ga0068851_10003191 Ga0068851_100031913 267
271 3300006237 Ga0097621_100055221 Ga0097621_1000552212 267
272 3300011119 Ga0105246_10149112 Ga0105246_101491122 267
273 3300025321 Ga0207656_10005305 Ga0207656_100053053 267
274 3300025907 Ga0207645_10082110 Ga0207645_100821102 267
275 3300025981 Ga0207640_10016689 Ga0207640_100166892 267
276 3300026041 Ga0207639_10222993 Ga0207639_102229932 267
277 3300026089 Ga0207648_10065367 Ga0207648_100653672 267
278 3300026142 Ga0207698_10143375 Ga0207698_101433752 267
279 3300035118 Ga0373954_0022214 Ga0373954_0022214_1114_2043 267
280 3300037418 Ga0395900_0096446 Ga0395900_0096446_79_1008 267
281 3300038443 Ga0395901_0045565 Ga0395901_0045565_2501_3430 267
282 3300046558 Ga0495633_0005340 Ga0495633_0005340_6313_7242 267
283 3300046679 Ga0495623_0052722 Ga0495623_0052722_974_1903 267
284 3300046691 Ga0495670_0078115 Ga0495670_0078115_398_1327 267
285 3300048912 Ga0496109_0053198 Ga0496109_0053198_197_1126 267
286 3300053096 Ga0500641_0100338 Ga0500641_0100338_168_1097 267
287 3300037312 Ga0395899_0115915 Ga0395899_0115915_494_1423 268
288 3300037418 Ga0395900_0152745 Ga0395900_0152745_930_1859 268
289 3300037466 Ga0395898_0198969 Ga0395898_0198969_500_1429 268
290 3300045976 Ga0466967_0125372 Ga0466967_0125372_846_1775 268
291 3300014745 Ga0157377_10086772 Ga0157377_100867722 269
292 3300025945 Ga0207679_10096366 Ga0207679_100963661 269
293 3300037466 Ga0395898_0240277 Ga0395898_0240277_407_1336 269
294 3300037471 Ga0395905_0052377 Ga0395905_0052377_2757_3686 269
295 3300038443 Ga0395901_0073397 Ga0395901_0073397_998_1927 269
296 3300044842 Ga0466957_0124481 Ga0466957_0124481_382_1311 270
297 3300049162 Ga0501307_005125 Ga0501307_005125_98_1027 270
298 3300049679 Ga0501249_000705 Ga0501249_000705_6331_7260 270
299 3300049850 Ga0501204_007697 Ga0501204_007697_78_1007 270
300 3300001979 JGI24740J21852_10010653 JGI24740J21852_100106533 271
301 3300001990 JGI24737J22298_10000103 JGI24737J22298_1000010323 271
302 3300005328 Ga0070676_10014283 Ga0070676_100142833 271
303 3300005334 Ga0068869_100000193 Ga0068869_10000019327 271
304 3300005354 Ga0070675_100060655 Ga0070675_1000606553 271
305 3300005366 Ga0070659_100036765 Ga0070659_1000367652 271
306 3300005456 Ga0070678_100378712 Ga0070678_1003787121 271
307 3300005459 Ga0068867_100003797 Ga0068867_1000037974 271
308 3300005539 Ga0068853_100010462 Ga0068853_1000104627 271
309 3300005563 Ga0068855_100002282 Ga0068855_10000228220 271
310 3300005578 Ga0068854_100010224 Ga0068854_1000102246 271
311 3300005616 Ga0068852_100001364 Ga0068852_10000136415 271
312 3300005719 Ga0068861_100054765 Ga0068861_1000547653 271
313 3300005840 Ga0068870_10105444 Ga0068870_101054442 271
314 3300005841 Ga0068863_100001653 Ga0068863_10000165315 271
315 3300005842 Ga0068858_100001094 Ga0068858_10000109429 271
316 3300006237 Ga0097621_100052614 Ga0097621_1000526143 271
317 3300006358 Ga0068871_100084148 Ga0068871_1000841483 271
318 3300006881 Ga0068865_100003787 Ga0068865_1000037874 271
319 3300009098 Ga0105245_10000128 Ga0105245_1000012828 271
320 3300009174 Ga0105241_10009282 Ga0105241_100092824 271
321 3300009551 Ga0105238_10032642 Ga0105238_100326425 271
322 3300010375 Ga0105239_10074433 Ga0105239_100744333 271
323 3300013100 Ga0157373_10006676 Ga0157373_100066764 271
324 3300013102 Ga0157371_10000850 Ga0157371_1000085032 271
325 3300013297 Ga0157378_10000396 Ga0157378_1000039615 271
326 3300013306 Ga0163162_10033926 Ga0163162_100339263 271
327 3300025901 Ga0207688_10000721 Ga0207688_100007212 271
328 3300025907 Ga0207645_10014762 Ga0207645_100147625 271
329 3300025908 Ga0207643_10127773 Ga0207643_101277732 271
330 3300025911 Ga0207654_10017495 Ga0207654_100174953 271
331 3300025919 Ga0207657_10019719 Ga0207657_100197193 271
332 3300025921 Ga0207652_10512709 Ga0207652_105127091 271
333 3300025924 Ga0207694_10343110 Ga0207694_103431101 271
334 3300025927 Ga0207687_10000688 Ga0207687_1000068811 271
335 3300025938 Ga0207704_10001537 Ga0207704_100015374 271
336 3300025942 Ga0207689_10000128 Ga0207689_1000012816 271
337 3300026088 Ga0207641_10001758 Ga0207641_1000175812 271
338 3300026089 Ga0207648_10000876 Ga0207648_1000087636 271
339 3300026116 Ga0207674_10000827 Ga0207674_1000082730 271
340 3300037471 Ga0395905_0016621 Ga0395905_0016621_3505_4434 271
341 3300006880 Ga0075429_100112196 Ga0075429_1001121961 272
342 3300037471 Ga0395905_0000187 Ga0395905_0000187_56570_57499 272
343 3300050508 nmdc:mga09592_114893_c1 nmdc:mga09592_114893_c1_103_1032 272
344 3300001990 JGI24737J22298_10017220 JGI24737J22298_100172202 273
345 3300005327 Ga0070658_10030282 Ga0070658_100302823 273
346 3300005327 Ga0070658_10343176 Ga0070658_103431762 273
347 3300005328 Ga0070676_10052530 Ga0070676_100525302 273
348 3300005329 Ga0070683_100510641 Ga0070683_1005106411 273
349 3300005330 Ga0070690_100022820 Ga0070690_1000228204 273
350 3300005335 Ga0070666_10144162 Ga0070666_101441622 273
351 3300005336 Ga0070680_100247308 Ga0070680_1002473081 273
352 3300005344 Ga0070661_100176450 Ga0070661_1001764502 273
353 3300005347 Ga0070668_100000536 Ga0070668_1000005362 273
354 3300005353 Ga0070669_100051512 Ga0070669_1000515121 273
355 3300005364 Ga0070673_100008799 Ga0070673_1000087993 273
356 3300005366 Ga0070659_100024072 Ga0070659_1000240724 273
357 3300005367 Ga0070667_100025556 Ga0070667_1000255561 273
358 3300005367 Ga0070667_100030771 Ga0070667_1000307714 273
359 3300005367 Ga0070667_100226850 Ga0070667_1002268502 273
360 3300005457 Ga0070662_100209229 Ga0070662_1002092291 273
361 3300005459 Ga0068867_100007359 Ga0068867_1000073592 273
362 3300005539 Ga0068853_100087160 Ga0068853_1000871603 273
363 3300005543 Ga0070672_100067408 Ga0070672_1000674081 273
364 3300005544 Ga0070686_100042271 Ga0070686_1000422712 273
365 3300005548 Ga0070665_100141417 Ga0070665_1001414173 273
366 3300005548 Ga0070665_100217449 Ga0070665_1002174492 273
367 3300005564 Ga0070664_100599427 Ga0070664_1005994271 273
368 3300005843 Ga0068860_100027215 Ga0068860_1000272151 273
369 3300005844 Ga0068862_100002977 Ga0068862_10000297713 273
370 3300005844 Ga0068862_100270968 Ga0068862_1002709682 273
371 3300006237 Ga0097621_100085598 Ga0097621_1000855982 273
372 3300006358 Ga0068871_100127815 Ga0068871_1001278152 273
373 3300006881 Ga0068865_100125184 Ga0068865_1001251842 273
374 3300009098 Ga0105245_10051602 Ga0105245_100516022 273
375 3300009177 Ga0105248_10036329 Ga0105248_100363295 273
376 3300013306 Ga0163162_10147709 Ga0163162_101477092 273
377 3300013307 Ga0157372_10355671 Ga0157372_103556712 273
378 3300013308 Ga0157375_10299054 Ga0157375_102990542 273
379 3300017792 Ga0163161_10166983 Ga0163161_101669832 273
380 3300025901 Ga0207688_10076593 Ga0207688_100765932 273
381 3300025901 Ga0207688_10170120 Ga0207688_101701202 273
382 3300025904 Ga0207647_10014223 Ga0207647_100142233 273
383 3300025904 Ga0207647_10175290 Ga0207647_101752902 273
384 3300025907 Ga0207645_10002016 Ga0207645_100020167 273
385 3300025925 Ga0207650_10018909 Ga0207650_100189094 273
386 3300025927 Ga0207687_10064299 Ga0207687_100642992 273
387 3300025928 Ga0207700_10081309 Ga0207700_100813092 273
388 3300025932 Ga0207690_10014667 Ga0207690_100146673 273
389 3300025933 Ga0207706_10018600 Ga0207706_100186002 273
390 3300025933 Ga0207706_10093565 Ga0207706_100935653 273
391 3300025938 Ga0207704_10507240 Ga0207704_105072401 273
392 3300025940 Ga0207691_10059868 Ga0207691_100598683 273
393 3300025941 Ga0207711_10084802 Ga0207711_100848022 273
394 3300025945 Ga0207679_10535368 Ga0207679_105353681 273
395 3300025960 Ga0207651_10004424 Ga0207651_100044244 273
396 3300025960 Ga0207651_10020848 Ga0207651_100208482 273
397 3300025961 Ga0207712_10173235 Ga0207712_101732352 273
398 3300025972 Ga0207668_10000325 Ga0207668_1000032516 273
399 3300025986 Ga0207658_10008371 Ga0207658_100083715 273
400 3300025986 Ga0207658_10076860 Ga0207658_100768602 273
401 3300025986 Ga0207658_10094254 Ga0207658_100942542 273
402 3300026067 Ga0207678_10186857 Ga0207678_101868571 273
403 3300026067 Ga0207678_10474243 Ga0207678_104742431 273
404 3300026089 Ga0207648_10007196 Ga0207648_100071964 273
405 3300026095 Ga0207676_10054659 Ga0207676_100546593 273
406 3300028379 Ga0268266_10145848 Ga0268266_101458482 273
407 3300028379 Ga0268266_10268995 Ga0268266_102689952 273
408 3300028380 Ga0268265_10003983 Ga0268265_100039834 273
409 3300028381 Ga0268264_10004357 Ga0268264_1000435713 273
410 3300028381 Ga0268264_10521932 Ga0268264_105219321 273
411 3300037418 Ga0395900_0103922 Ga0395900_0103922_1263_2192 273
412 3300037418 Ga0395900_0449190 Ga0395900_0449190_81_1004 273
413 3300037471 Ga0395905_0005031 Ga0395905_0005031_6147_7070 273
414 3300037471 Ga0395905_0031034 Ga0395905_0031034_1366_2295 273
415 3300037471 Ga0395905_0122634 Ga0395905_0122634_373_1296 273
416 3300037471 Ga0395905_0216051 Ga0395905_0216051_383_1306 273
417 3300038443 Ga0395901_0038534 Ga0395901_0038534_3674_4597 273
418 3300038443 Ga0395901_0045815 Ga0395901_0045815_1510_2439 273
419 3300038443 Ga0395901_0099223 Ga0395901_0099223_1283_2206 273
420 3300044735 Ga0466968_0074530 Ga0466968_0074530_503_1432 273
421 3300046616 Ga0495668_0012311 Ga0495668_0012311_1980_2903 273
422 3300046616 Ga0495668_0041325 Ga0495668_0041325_1186_2109 273
423 3300046684 Ga0495669_0000362 Ga0495669_0000362_14567_15490 273
424 3300046684 Ga0495669_0007887 Ga0495669_0007887_3030_3953 273
425 3300047447 Ga0495685_071096 Ga0495685_071096_214_1137 273
426 3300048911 Ga0496108_0018282 Ga0496108_0018282_4398_5321 273
427 3300049586 Ga0501070_0132889 Ga0501070_0132889_926_1855 273
428 3300005344 Ga0070661_100015230 Ga0070661_1000152306 274
429 3300005548 Ga0070665_100004600 Ga0070665_10000460013 274
430 3300005563 Ga0068855_100332602 Ga0068855_1003326022 274
431 3300005843 Ga0068860_100016138 Ga0068860_1000161387 274
432 3300009551 Ga0105238_10011618 Ga0105238_100116183 274
433 3300013105 Ga0157369_10008969 Ga0157369_100089691 274
434 3300025921 Ga0207652_10280864 Ga0207652_102808641 274
435 3300025924 Ga0207694_10039116 Ga0207694_100391164 274
436 3300026041 Ga0207639_10234782 Ga0207639_102347822 274
437 3300026142 Ga0207698_10073262 Ga0207698_100732623 274
438 3300028379 Ga0268266_10003545 Ga0268266_1000354513 274
439 3300028381 Ga0268264_10014181 Ga0268264_100141816 274
440 3300037312 Ga0395899_0001631 Ga0395899_0001631_3546_4472 274
441 3300037418 Ga0395900_0081899 Ga0395900_0081899_2190_3119 274
442 3300037418 Ga0395900_0482810 Ga0395900_0482810_198_1127 274
443 3300037418 Ga0395900_0577684 Ga0395900_0577684_23_952 274
444 3300037466 Ga0395898_0081293 Ga0395898_0081293_790_1719 274
445 3300037471 Ga0395905_0030275 Ga0395905_0030275_888_1817 274
446 3300037471 Ga0395905_0074215 Ga0395905_0074215_1584_2513 274
447 3300038443 Ga0395901_0022456 Ga0395901_0022456_402_1331 274
448 3300045976 Ga0466967_0012836 Ga0466967_0012836_1738_2664 274
449 3300053090 Ga0500646_0019148 Ga0500646_0019148_141_1073 274
450 3300053153 Ga0500616_0000444 Ga0500616_0000444_10439_11371 274
451 3300001904 JGI24736J21556_1011575 JGI24736J21556_10115752 275
452 3300001979 JGI24740J21852_10004014 JGI24740J21852_100040147 275
453 3300001979 JGI24740J21852_10039052 JGI24740J21852_100390522 275
454 3300001979 JGI24740J21852_10062327 JGI24740J21852_100623271 275
455 3300001990 JGI24737J22298_10003852 JGI24737J22298_100038525 275
456 3300001990 JGI24737J22298_10016184 JGI24737J22298_100161842 275
457 3300001990 JGI24737J22298_10024074 JGI24737J22298_100240741 275
458 3300002067 JGI24735J21928_10018169 JGI24735J21928_100181692 275
459 3300002077 JGI24744J21845_10000984 JGI24744J21845_100009845 275
460 3300005293 Ga0065715_10119188 Ga0065715_101191882 275
461 3300005327 Ga0070658_10014865 Ga0070658_100148656 275
462 3300005327 Ga0070658_10019967 Ga0070658_100199674 275
463 3300005327 Ga0070658_10091604 Ga0070658_100916041 275
464 3300005327 Ga0070658_10256097 Ga0070658_102560973 275
465 3300005327 Ga0070658_10400857 Ga0070658_104008572 275
466 3300005327 Ga0070658_10435029 Ga0070658_104350291 275
467 3300005329 Ga0070683_100012114 Ga0070683_1000121146 275
468 3300005329 Ga0070683_100089119 Ga0070683_1000891193 275
469 3300005329 Ga0070683_100161726 Ga0070683_1001617263 275
470 3300005330 Ga0070690_100046725 Ga0070690_1000467251 275
471 3300005331 Ga0070670_100016152 Ga0070670_1000161524 275
472 3300005331 Ga0070670_100111216 Ga0070670_1001112163 275
473 3300005331 Ga0070670_100234662 Ga0070670_1002346622 275
474 3300005334 Ga0068869_100155956 Ga0068869_1001559562 275
475 3300005335 Ga0070666_10002433 Ga0070666_100024337 275
476 3300005335 Ga0070666_10056204 Ga0070666_100562042 275
477 3300005336 Ga0070680_100043283 Ga0070680_1000432834 275
478 3300005336 Ga0070680_100049342 Ga0070680_1000493423 275
479 3300005336 Ga0070680_100104192 Ga0070680_1001041923 275
480 3300005336 Ga0070680_100119227 Ga0070680_1001192272 275
481 3300005338 Ga0068868_100000792 Ga0068868_1000007925 275
482 3300005338 Ga0068868_100000972 Ga0068868_10000097215 275
483 3300005338 Ga0068868_100190698 Ga0068868_1001906982 275
484 3300005339 Ga0070660_100005433 Ga0070660_1000054335 275
485 3300005339 Ga0070660_100021026 Ga0070660_1000210262 275
486 3300005339 Ga0070660_100028604 Ga0070660_1000286043 275
487 3300005339 Ga0070660_100096583 Ga0070660_1000965832 275
488 3300005339 Ga0070660_100098990 Ga0070660_1000989901 275
489 3300005339 Ga0070660_100109001 Ga0070660_1001090012 275
490 3300005339 Ga0070660_100127808 Ga0070660_1001278082 275
491 3300005339 Ga0070660_100130546 Ga0070660_1001305462 275
492 3300005339 Ga0070660_100194470 Ga0070660_1001944703 275
493 3300005339 Ga0070660_100342864 Ga0070660_1003428641 275
494 3300005340 Ga0070689_100009488 Ga0070689_1000094885 275
495 3300005341 Ga0070691_10001004 Ga0070691_100010042 275
496 3300005344 Ga0070661_100001951 Ga0070661_10000195117 275
497 3300005344 Ga0070661_100042185 Ga0070661_1000421852 275
498 3300005344 Ga0070661_100064493 Ga0070661_1000644932 275
499 3300005344 Ga0070661_100093550 Ga0070661_1000935503 275
500 3300005344 Ga0070661_100142732 Ga0070661_1001427322 275
501 3300005344 Ga0070661_100283121 Ga0070661_1002831212 275
502 3300005347 Ga0070668_100089770 Ga0070668_1000897702 275
503 3300005347 Ga0070668_100199147 Ga0070668_1001991472 275
504 3300005353 Ga0070669_100001124 Ga0070669_10000112415 275
505 3300005353 Ga0070669_100048071 Ga0070669_1000480713 275
506 3300005354 Ga0070675_100002279 Ga0070675_1000022793 275
507 3300005354 Ga0070675_100008840 Ga0070675_1000088406 275
508 3300005354 Ga0070675_100115478 Ga0070675_1001154782 275
509 3300005354 Ga0070675_100401572 Ga0070675_1004015722 275
510 3300005354 Ga0070675_100532790 Ga0070675_1005327901 275
511 3300005355 Ga0070671_100000533 Ga0070671_1000005335 275
512 3300005355 Ga0070671_100003349 Ga0070671_1000033497 275
513 3300005355 Ga0070671_100014109 Ga0070671_1000141097 275
514 3300005355 Ga0070671_100023452 Ga0070671_1000234523 275
515 3300005355 Ga0070671_100034395 Ga0070671_1000343954 275
516 3300005355 Ga0070671_100102236 Ga0070671_1001022363 275
517 3300005355 Ga0070671_100104973 Ga0070671_1001049733 275
518 3300005355 Ga0070671_100148737 Ga0070671_1001487372 275
519 3300005356 Ga0070674_100041966 Ga0070674_1000419662 275
520 3300005356 Ga0070674_100203020 Ga0070674_1002030202 275
521 3300005364 Ga0070673_100013681 Ga0070673_1000136817 275
522 3300005364 Ga0070673_100018135 Ga0070673_1000181353 275
523 3300005364 Ga0070673_100019681 Ga0070673_1000196812 275
524 3300005364 Ga0070673_100029335 Ga0070673_1000293353 275
525 3300005364 Ga0070673_100031532 Ga0070673_1000315322 275
526 3300005364 Ga0070673_100035345 Ga0070673_1000353453 275
527 3300005364 Ga0070673_100065062 Ga0070673_1000650623 275
528 3300005366 Ga0070659_100017987 Ga0070659_1000179874 275
529 3300005366 Ga0070659_100043521 Ga0070659_1000435214 275
530 3300005366 Ga0070659_100135749 Ga0070659_1001357492 275
531 3300005366 Ga0070659_100187050 Ga0070659_1001870501 275
532 3300005366 Ga0070659_100208943 Ga0070659_1002089432 275
533 3300005366 Ga0070659_100215456 Ga0070659_1002154561 275
534 3300005366 Ga0070659_100450734 Ga0070659_1004507341 275
535 3300005366 Ga0070659_100487559 Ga0070659_1004875591 275
536 3300005367 Ga0070667_100001174 Ga0070667_10000117423 275
537 3300005367 Ga0070667_100008070 Ga0070667_1000080702 275
538 3300005367 Ga0070667_100010247 Ga0070667_1000102472 275
539 3300005367 Ga0070667_100071911 Ga0070667_1000719113 275
540 3300005367 Ga0070667_100192142 Ga0070667_1001921421 275
541 3300005434 Ga0070709_10090233 Ga0070709_100902332 275
542 3300005435 Ga0070714_100540486 Ga0070714_1005404861 275
543 3300005444 Ga0070694_100013393 Ga0070694_1000133936 275
544 3300005455 Ga0070663_100036552 Ga0070663_1000365523 275
545 3300005455 Ga0070663_100097962 Ga0070663_1000979622 275
546 3300005455 Ga0070663_100103705 Ga0070663_1001037052 275
547 3300005455 Ga0070663_100501828 Ga0070663_1005018281 275
548 3300005456 Ga0070678_100163571 Ga0070678_1001635712 275
549 3300005457 Ga0070662_100000572 Ga0070662_10000057219 275
550 3300005457 Ga0070662_100004956 Ga0070662_1000049567 275
551 3300005457 Ga0070662_100006515 Ga0070662_1000065153 275
552 3300005457 Ga0070662_100073767 Ga0070662_1000737671 275
553 3300005458 Ga0070681_10022649 Ga0070681_100226492 275
554 3300005458 Ga0070681_10364019 Ga0070681_103640191 275
555 3300005459 Ga0068867_100026508 Ga0068867_1000265083 275
556 3300005459 Ga0068867_100076728 Ga0068867_1000767282 275
557 3300005530 Ga0070679_100051898 Ga0070679_1000518983 275
558 3300005530 Ga0070679_100077078 Ga0070679_1000770782 275
559 3300005530 Ga0070679_100458234 Ga0070679_1004582342 275
560 3300005535 Ga0070684_100020379 Ga0070684_1000203794 275
561 3300005535 Ga0070684_100076758 Ga0070684_1000767582 275
562 3300005539 Ga0068853_100011312 Ga0068853_1000113124 275
563 3300005539 Ga0068853_100089040 Ga0068853_1000890401 275
564 3300005539 Ga0068853_100245835 Ga0068853_1002458352 275
565 3300005539 Ga0068853_100332395 Ga0068853_1003323951 275
566 3300005543 Ga0070672_100001833 Ga0070672_10000183313 275
567 3300005543 Ga0070672_100012721 Ga0070672_1000127211 275
568 3300005543 Ga0070672_100026341 Ga0070672_1000263412 275
569 3300005543 Ga0070672_100181372 Ga0070672_1001813722 275
570 3300005543 Ga0070672_100226715 Ga0070672_1002267152 275
571 3300005544 Ga0070686_100055545 Ga0070686_1000555452 275
572 3300005546 Ga0070696_100038967 Ga0070696_1000389673 275
573 3300005547 Ga0070693_100139210 Ga0070693_1001392102 275
574 3300005548 Ga0070665_100000993 Ga0070665_10000099319 275
575 3300005548 Ga0070665_100024112 Ga0070665_1000241123 275
576 3300005548 Ga0070665_100217247 Ga0070665_1002172472 275
577 3300005563 Ga0068855_100110180 Ga0068855_1001101804 275
578 3300005563 Ga0068855_100143524 Ga0068855_1001435243 275
579 3300005563 Ga0068855_100503095 Ga0068855_1005030951 275
580 3300005563 Ga0068855_100509748 Ga0068855_1005097482 275
581 3300005564 Ga0070664_100002139 Ga0070664_10000213915 275
582 3300005564 Ga0070664_100006623 Ga0070664_1000066234 275
583 3300005564 Ga0070664_100008229 Ga0070664_1000082298 275
584 3300005564 Ga0070664_100025634 Ga0070664_1000256342 275
585 3300005564 Ga0070664_100033603 Ga0070664_1000336033 275
586 3300005564 Ga0070664_100246492 Ga0070664_1002464922 275
587 3300005577 Ga0068857_100003736 Ga0068857_1000037368 275
588 3300005577 Ga0068857_100023125 Ga0068857_1000231254 275
589 3300005577 Ga0068857_100061646 Ga0068857_1000616463 275
590 3300005577 Ga0068857_100173308 Ga0068857_1001733083 275
591 3300005577 Ga0068857_100212305 Ga0068857_1002123053 275
592 3300005577 Ga0068857_100221451 Ga0068857_1002214512 275
593 3300005577 Ga0068857_100346352 Ga0068857_1003463521 275
594 3300005578 Ga0068854_100025205 Ga0068854_1000252054 275
595 3300005578 Ga0068854_100055126 Ga0068854_1000551263 275
596 3300005578 Ga0068854_100096981 Ga0068854_1000969812 275
597 3300005578 Ga0068854_100180774 Ga0068854_1001807742 275
598 3300005578 Ga0068854_100270715 Ga0068854_1002707152 275
599 3300005614 Ga0068856_100123193 Ga0068856_1001231932 275
600 3300005614 Ga0068856_100241787 Ga0068856_1002417872 275
601 3300005614 Ga0068856_100692544 Ga0068856_1006925441 275
602 3300005617 Ga0068859_100001400 Ga0068859_10000140025 275
603 3300005617 Ga0068859_100004210 Ga0068859_1000042101 275
604 3300005617 Ga0068859_100098399 Ga0068859_1000983993 275
605 3300005618 Ga0068864_100000247 Ga0068864_10000024731 275
606 3300005618 Ga0068864_100004541 Ga0068864_1000045413 275
607 3300005618 Ga0068864_100046004 Ga0068864_1000460042 275
608 3300005618 Ga0068864_100055638 Ga0068864_1000556386 275
609 3300005618 Ga0068864_100060876 Ga0068864_1000608763 275
610 3300005618 Ga0068864_100095817 Ga0068864_1000958172 275
611 3300005618 Ga0068864_100238009 Ga0068864_1002380092 275
612 3300005834 Ga0068851_10155849 Ga0068851_101558492 275
613 3300005841 Ga0068863_100006869 Ga0068863_1000068699 275
614 3300005841 Ga0068863_100010379 Ga0068863_1000103795 275
615 3300005841 Ga0068863_100020450 Ga0068863_1000204507 275
616 3300005841 Ga0068863_100025228 Ga0068863_1000252286 275
617 3300005841 Ga0068863_100029847 Ga0068863_1000298473 275
618 3300005841 Ga0068863_100035648 Ga0068863_1000356482 275
619 3300005841 Ga0068863_100073155 Ga0068863_1000731552 275
620 3300005842 Ga0068858_100001147 Ga0068858_1000011477 275
621 3300005842 Ga0068858_100003322 Ga0068858_1000033223 275
622 3300005842 Ga0068858_100015611 Ga0068858_1000156117 275
623 3300005842 Ga0068858_100067364 Ga0068858_1000673642 275
624 3300005842 Ga0068858_100080548 Ga0068858_1000805482 275
625 3300005843 Ga0068860_100007238 Ga0068860_1000072384 275
626 3300005843 Ga0068860_100022578 Ga0068860_1000225782 275
627 3300005843 Ga0068860_100024143 Ga0068860_1000241433 275
628 3300005843 Ga0068860_100092266 Ga0068860_1000922662 275
629 3300005844 Ga0068862_100016695 Ga0068862_1000166958 275
630 3300005844 Ga0068862_100024139 Ga0068862_1000241393 275
631 3300005844 Ga0068862_100032599 Ga0068862_1000325993 275
632 3300005844 Ga0068862_100339265 Ga0068862_1003392651 275
633 3300005985 Ga0081539_10025333 Ga0081539_100253332 275
634 3300005985 Ga0081539_10029093 Ga0081539_100290933 275
635 3300005985 Ga0081539_10030718 Ga0081539_100307182 275
636 3300006028 Ga0070717_10050533 Ga0070717_100505333 275
637 3300006028 Ga0070717_10051402 Ga0070717_100514023 275
638 3300006173 Ga0070716_100073941 Ga0070716_1000739412 275
639 3300006175 Ga0070712_100050847 Ga0070712_1000508472 275
640 3300006175 Ga0070712_100189423 Ga0070712_1001894231 275
641 3300006186 Ga0075369_10106558 Ga0075369_101065582 275
642 3300006237 Ga0097621_100094898 Ga0097621_1000948983 275
643 3300006358 Ga0068871_100101060 Ga0068871_1001010603 275
644 3300006852 Ga0075433_10152916 Ga0075433_101529162 275
645 3300006881 Ga0068865_100389637 Ga0068865_1003896371 275
646 3300006931 Ga0097620_100001400 Ga0097620_10000140026 275
647 3300006931 Ga0097620_100004210 Ga0097620_1000042101 275
648 3300006931 Ga0097620_100028084 Ga0097620_1000280843 275
649 3300006931 Ga0097620_100098410 Ga0097620_1000984103 275
650 3300009011 Ga0105251_10025240 Ga0105251_100252403 275
651 3300009093 Ga0105240_10008382 Ga0105240_1000838213 275
652 3300009093 Ga0105240_10136646 Ga0105240_101366463 275
653 3300009098 Ga0105245_10635233 Ga0105245_106352332 275
654 3300009177 Ga0105248_10000308 Ga0105248_100003086 275
655 3300009177 Ga0105248_10003753 Ga0105248_1000375317 275
656 3300009177 Ga0105248_10053985 Ga0105248_100539854 275
657 3300009177 Ga0105248_10072912 Ga0105248_100729123 275
658 3300009177 Ga0105248_10074391 Ga0105248_100743914 275
659 3300009177 Ga0105248_10186812 Ga0105248_101868123 275
660 3300009177 Ga0105248_10188544 Ga0105248_101885442 275
661 3300009177 Ga0105248_10440698 Ga0105248_104406981 275
662 3300013100 Ga0157373_10068423 Ga0157373_100684233 275
663 3300013100 Ga0157373_10272734 Ga0157373_102727341 275
664 3300013104 Ga0157370_10000686 Ga0157370_1000068640 275
665 3300013104 Ga0157370_10129911 Ga0157370_101299112 275
666 3300013105 Ga0157369_10047220 Ga0157369_100472203 275
667 3300013105 Ga0157369_10369738 Ga0157369_103697382 275
668 3300013296 Ga0157374_10118124 Ga0157374_101181243 275
669 3300013297 Ga0157378_10049130 Ga0157378_100491302 275
670 3300013306 Ga0163162_10244284 Ga0163162_102442842 275
671 3300013306 Ga0163162_10445418 Ga0163162_104454181 275
672 3300013307 Ga0157372_10183940 Ga0157372_101839404 275
673 3300013307 Ga0157372_10492550 Ga0157372_104925502 275
674 3300013308 Ga0157375_10043324 Ga0157375_100433242 275
675 3300013308 Ga0157375_10282609 Ga0157375_102826092 275
676 3300013308 Ga0157375_10429570 Ga0157375_104295702 275
677 3300014325 Ga0163163_10172812 Ga0163163_101728122 275
678 3300014968 Ga0157379_10000566 Ga0157379_100005662 275
679 3300020070 Ga0206356_10494831 Ga0206356_104948311 275
680 3300021384 Ga0213876_10036667 Ga0213876_100366673 275
681 3300021384 Ga0213876_10094079 Ga0213876_100940793 275
682 3300021388 Ga0213875_10029054 Ga0213875_100290542 275
683 3300025315 Ga0207697_10001345 Ga0207697_1000134512 275
684 3300025321 Ga0207656_10049679 Ga0207656_100496791 275
685 3300025893 Ga0207682_10000079 Ga0207682_1000007939 275
686 3300025901 Ga0207688_10027488 Ga0207688_100274884 275
687 3300025901 Ga0207688_10058166 Ga0207688_100581662 275
688 3300025901 Ga0207688_10107689 Ga0207688_101076892 275
689 3300025903 Ga0207680_10002648 Ga0207680_100026484 275
690 3300025903 Ga0207680_10020639 Ga0207680_100206392 275
691 3300025903 Ga0207680_10033350 Ga0207680_100333502 275
692 3300025904 Ga0207647_10000227 Ga0207647_1000022747 275
693 3300025904 Ga0207647_10000517 Ga0207647_1000051716 275
694 3300025904 Ga0207647_10001932 Ga0207647_100019322 275
695 3300025904 Ga0207647_10040813 Ga0207647_100408133 275
696 3300025904 Ga0207647_10068143 Ga0207647_100681432 275
697 3300025909 Ga0207705_10000033 Ga0207705_1000003326 275
698 3300025909 Ga0207705_10014241 Ga0207705_100142413 275
699 3300025909 Ga0207705_10014531 Ga0207705_100145315 275
700 3300025909 Ga0207705_10015103 Ga0207705_100151035 275
701 3300025909 Ga0207705_10021424 Ga0207705_100214245 275
702 3300025909 Ga0207705_10027829 Ga0207705_100278294 275
703 3300025909 Ga0207705_10037980 Ga0207705_100379803 275
704 3300025909 Ga0207705_10041373 Ga0207705_100413733 275
705 3300025909 Ga0207705_10080652 Ga0207705_100806522 275
706 3300025909 Ga0207705_10157171 Ga0207705_101571712 275
707 3300025909 Ga0207705_10253077 Ga0207705_102530772 275
708 3300025912 Ga0207707_10126991 Ga0207707_101269913 275
709 3300025913 Ga0207695_10016871 Ga0207695_100168715 275
710 3300025913 Ga0207695_10030480 Ga0207695_100304802 275
711 3300025913 Ga0207695_10268356 Ga0207695_102683562 275
712 3300025915 Ga0207693_10055849 Ga0207693_100558494 275
713 3300025915 Ga0207693_10071078 Ga0207693_100710782 275
714 3300025917 Ga0207660_10094080 Ga0207660_100940802 275
715 3300025917 Ga0207660_10104748 Ga0207660_101047482 275
716 3300025917 Ga0207660_10190391 Ga0207660_101903912 275
717 3300025919 Ga0207657_10015073 Ga0207657_100150738 275
718 3300025919 Ga0207657_10022951 Ga0207657_100229512 275
719 3300025919 Ga0207657_10035051 Ga0207657_100350512 275
720 3300025919 Ga0207657_10077391 Ga0207657_100773914 275
721 3300025919 Ga0207657_10098980 Ga0207657_100989802 275
722 3300025919 Ga0207657_10125517 Ga0207657_101255173 275
723 3300025919 Ga0207657_10132145 Ga0207657_101321452 275
724 3300025919 Ga0207657_10175489 Ga0207657_101754892 275
725 3300025919 Ga0207657_10207449 Ga0207657_102074492 275
726 3300025920 Ga0207649_10000827 Ga0207649_1000082716 275
727 3300025920 Ga0207649_10014274 Ga0207649_100142743 275
728 3300025920 Ga0207649_10053796 Ga0207649_100537963 275
729 3300025920 Ga0207649_10149132 Ga0207649_101491321 275
730 3300025920 Ga0207649_10186125 Ga0207649_101861252 275
731 3300025920 Ga0207649_10198620 Ga0207649_101986202 275
732 3300025920 Ga0207649_10240279 Ga0207649_102402792 275
733 3300025920 Ga0207649_10345573 Ga0207649_103455732 275
734 3300025921 Ga0207652_10026469 Ga0207652_100264692 275
735 3300025921 Ga0207652_10069558 Ga0207652_100695583 275
736 3300025921 Ga0207652_10071613 Ga0207652_100716133 275
737 3300025921 Ga0207652_10207383 Ga0207652_102073832 275
738 3300025923 Ga0207681_10014783 Ga0207681_100147834 275
739 3300025923 Ga0207681_10073047 Ga0207681_100730472 275
740 3300025923 Ga0207681_10415674 Ga0207681_104156742 275
741 3300025925 Ga0207650_10011138 Ga0207650_100111385 275
742 3300025925 Ga0207650_10037396 Ga0207650_100373962 275
743 3300025925 Ga0207650_10099899 Ga0207650_100998991 275
744 3300025926 Ga0207659_10002718 Ga0207659_100027184 275
745 3300025926 Ga0207659_10016216 Ga0207659_100162163 275
746 3300025926 Ga0207659_10054129 Ga0207659_100541292 275
747 3300025927 Ga0207687_10101304 Ga0207687_101013042 275
748 3300025931 Ga0207644_10000810 Ga0207644_100008102 275
749 3300025931 Ga0207644_10002130 Ga0207644_100021307 275
750 3300025931 Ga0207644_10012868 Ga0207644_100128684 275
751 3300025931 Ga0207644_10020478 Ga0207644_100204783 275
752 3300025931 Ga0207644_10033274 Ga0207644_100332742 275
753 3300025931 Ga0207644_10034379 Ga0207644_100343794 275
754 3300025931 Ga0207644_10092233 Ga0207644_100922332 275
755 3300025931 Ga0207644_10168410 Ga0207644_101684102 275
756 3300025931 Ga0207644_10257375 Ga0207644_102573752 275
757 3300025932 Ga0207690_10003001 Ga0207690_100030012 275
758 3300025932 Ga0207690_10012320 Ga0207690_100123203 275
759 3300025932 Ga0207690_10034091 Ga0207690_100340913 275
760 3300025932 Ga0207690_10063717 Ga0207690_100637174 275
761 3300025932 Ga0207690_10077417 Ga0207690_100774173 275
762 3300025932 Ga0207690_10098006 Ga0207690_100980063 275
763 3300025932 Ga0207690_10104453 Ga0207690_101044532 275
764 3300025932 Ga0207690_10295231 Ga0207690_102952312 275
765 3300025932 Ga0207690_10297800 Ga0207690_102978001 275
766 3300025932 Ga0207690_10372550 Ga0207690_103725502 275
767 3300025932 Ga0207690_10403083 Ga0207690_104030832 275
768 3300025933 Ga0207706_10000648 Ga0207706_100006485 275
769 3300025933 Ga0207706_10003259 Ga0207706_100032594 275
770 3300025933 Ga0207706_10007371 Ga0207706_100073717 275
771 3300025933 Ga0207706_10009711 Ga0207706_100097115 275
772 3300025933 Ga0207706_10013736 Ga0207706_100137366 275
773 3300025933 Ga0207706_10018102 Ga0207706_100181025 275
774 3300025933 Ga0207706_10027266 Ga0207706_100272666 275
775 3300025933 Ga0207706_10214968 Ga0207706_102149682 275
776 3300025933 Ga0207706_10215865 Ga0207706_102158651 275
777 3300025933 Ga0207706_10307044 Ga0207706_103070441 275
778 3300025936 Ga0207670_10026440 Ga0207670_100264403 275
779 3300025937 Ga0207669_10024181 Ga0207669_100241812 275
780 3300025937 Ga0207669_10063561 Ga0207669_100635612 275
781 3300025937 Ga0207669_10436416 Ga0207669_104364162 275
782 3300025938 Ga0207704_10119550 Ga0207704_101195502 275
783 3300025938 Ga0207704_10144004 Ga0207704_101440041 275
784 3300025939 Ga0207665_10035217 Ga0207665_100352172 275
785 3300025940 Ga0207691_10000926 Ga0207691_100009269 275
786 3300025940 Ga0207691_10003338 Ga0207691_1000333812 275
787 3300025940 Ga0207691_10036411 Ga0207691_100364111 275
788 3300025940 Ga0207691_10049167 Ga0207691_100491672 275
789 3300025940 Ga0207691_10055077 Ga0207691_100550772 275
790 3300025940 Ga0207691_10088076 Ga0207691_100880763 275
791 3300025941 Ga0207711_10000760 Ga0207711_1000076023 275
792 3300025941 Ga0207711_10003592 Ga0207711_100035927 275
793 3300025941 Ga0207711_10008307 Ga0207711_100083078 275
794 3300025941 Ga0207711_10022518 Ga0207711_100225185 275
795 3300025941 Ga0207711_10144602 Ga0207711_101446022 275
796 3300025941 Ga0207711_10251259 Ga0207711_102512592 275
797 3300025941 Ga0207711_10268325 Ga0207711_102683252 275
798 3300025941 Ga0207711_10314482 Ga0207711_103144822 275
799 3300025942 Ga0207689_10038297 Ga0207689_100382974 275
800 3300025944 Ga0207661_10184159 Ga0207661_101841592 275
801 3300025944 Ga0207661_10297873 Ga0207661_102978732 275
802 3300025945 Ga0207679_10002019 Ga0207679_100020195 275
803 3300025945 Ga0207679_10025734 Ga0207679_100257343 275
804 3300025945 Ga0207679_10048152 Ga0207679_100481524 275
805 3300025945 Ga0207679_10052855 Ga0207679_100528553 275
806 3300025945 Ga0207679_10078933 Ga0207679_100789332 275
807 3300025945 Ga0207679_10093649 Ga0207679_100936493 275
808 3300025945 Ga0207679_10212473 Ga0207679_102124732 275
809 3300025945 Ga0207679_10247188 Ga0207679_102471882 275
810 3300025949 Ga0207667_10030200 Ga0207667_100302006 275
811 3300025949 Ga0207667_10078720 Ga0207667_100787203 275
812 3300025949 Ga0207667_10099523 Ga0207667_100995233 275
813 3300025949 Ga0207667_10108289 Ga0207667_101082893 275
814 3300025949 Ga0207667_10115211 Ga0207667_101152112 275
815 3300025960 Ga0207651_10000620 Ga0207651_100006204 275
816 3300025960 Ga0207651_10001297 Ga0207651_1000129714 275
817 3300025960 Ga0207651_10073771 Ga0207651_100737712 275
818 3300025960 Ga0207651_10073997 Ga0207651_100739973 275
819 3300025960 Ga0207651_10166549 Ga0207651_101665492 275
820 3300025960 Ga0207651_10197447 Ga0207651_101974471 275
821 3300025960 Ga0207651_10283123 Ga0207651_102831232 275
822 3300025960 Ga0207651_10408705 Ga0207651_104087051 275
823 3300025961 Ga0207712_10000572 Ga0207712_1000057212 275
824 3300025972 Ga0207668_10144019 Ga0207668_101440192 275
825 3300025972 Ga0207668_10146498 Ga0207668_101464982 275
826 3300025972 Ga0207668_10169962 Ga0207668_101699622 275
827 3300025981 Ga0207640_10001486 Ga0207640_1000148611 275
828 3300025981 Ga0207640_10005541 Ga0207640_100055413 275
829 3300025981 Ga0207640_10045676 Ga0207640_100456763 275
830 3300025981 Ga0207640_10087145 Ga0207640_100871452 275
831 3300025981 Ga0207640_10248841 Ga0207640_102488412 275
832 3300025981 Ga0207640_10382686 Ga0207640_103826861 275
833 3300025986 Ga0207658_10047135 Ga0207658_100471352 275
834 3300025986 Ga0207658_10078811 Ga0207658_100788113 275
835 3300025986 Ga0207658_10200223 Ga0207658_102002232 275
836 3300026023 Ga0207677_10011309 Ga0207677_100113094 275
837 3300026023 Ga0207677_10013508 Ga0207677_100135083 275
838 3300026035 Ga0207703_10003199 Ga0207703_1000319911 275
839 3300026035 Ga0207703_10025476 Ga0207703_100254762 275
840 3300026035 Ga0207703_10034727 Ga0207703_100347273 275
841 3300026035 Ga0207703_10156324 Ga0207703_101563242 275
842 3300026041 Ga0207639_10028716 Ga0207639_100287162 275
843 3300026041 Ga0207639_10047031 Ga0207639_100470314 275
844 3300026041 Ga0207639_10248029 Ga0207639_102480292 275
845 3300026041 Ga0207639_10265902 Ga0207639_102659023 275
846 3300026067 Ga0207678_10013918 Ga0207678_100139184 275
847 3300026067 Ga0207678_10015318 Ga0207678_100153186 275
848 3300026067 Ga0207678_10019007 Ga0207678_100190077 275
849 3300026067 Ga0207678_10028747 Ga0207678_100287474 275
850 3300026067 Ga0207678_10077303 Ga0207678_100773032 275
851 3300026067 Ga0207678_10136274 Ga0207678_101362742 275
852 3300026067 Ga0207678_10193066 Ga0207678_101930662 275
853 3300026078 Ga0207702_10084129 Ga0207702_100841294 275
854 3300026078 Ga0207702_10145782 Ga0207702_101457822 275
855 3300026078 Ga0207702_10169853 Ga0207702_101698532 275
856 3300026078 Ga0207702_10231607 Ga0207702_102316071 275
857 3300026078 Ga0207702_10466258 Ga0207702_104662581 275
858 3300026088 Ga0207641_10004008 Ga0207641_100040089 275
859 3300026088 Ga0207641_10017291 Ga0207641_100172912 275
860 3300026088 Ga0207641_10026684 Ga0207641_100266842 275
861 3300026088 Ga0207641_10037112 Ga0207641_100371124 275
862 3300026088 Ga0207641_10054345 Ga0207641_100543453 275
863 3300026088 Ga0207641_10061500 Ga0207641_100615004 275
864 3300026088 Ga0207641_10238679 Ga0207641_102386792 275
865 3300026089 Ga0207648_10009898 Ga0207648_1000989812 275
866 3300026089 Ga0207648_10111618 Ga0207648_101116182 275
867 3300026095 Ga0207676_10000220 Ga0207676_1000022022 275
868 3300026095 Ga0207676_10007423 Ga0207676_100074236 275
869 3300026095 Ga0207676_10015579 Ga0207676_100155793 275
870 3300026095 Ga0207676_10016564 Ga0207676_100165645 275
871 3300026095 Ga0207676_10034855 Ga0207676_100348553 275
872 3300026095 Ga0207676_10041547 Ga0207676_100415475 275
873 3300026095 Ga0207676_10144397 Ga0207676_101443973 275
874 3300026095 Ga0207676_10184236 Ga0207676_101842362 275
875 3300026116 Ga0207674_10000859 Ga0207674_1000085944 275
876 3300026116 Ga0207674_10004351 Ga0207674_1000435113 275
877 3300026116 Ga0207674_10036696 Ga0207674_100366966 275
878 3300026116 Ga0207674_10041064 Ga0207674_100410645 275
879 3300026116 Ga0207674_10067703 Ga0207674_100677033 275
880 3300026116 Ga0207674_10134643 Ga0207674_101346432 275
881 3300026116 Ga0207674_10328059 Ga0207674_103280592 275
882 3300026118 Ga0207675_100077638 Ga0207675_1000776382 275
883 3300026121 Ga0207683_10001953 Ga0207683_1000195313 275
884 3300026121 Ga0207683_10026311 Ga0207683_100263112 275
885 3300026121 Ga0207683_10061884 Ga0207683_100618843 275
886 3300026142 Ga0207698_10019885 Ga0207698_100198855 275
887 3300026142 Ga0207698_10048299 Ga0207698_100482993 275
888 3300026142 Ga0207698_10171097 Ga0207698_101710973 275
889 3300026142 Ga0207698_10205555 Ga0207698_102055552 275
890 3300026142 Ga0207698_10310045 Ga0207698_103100452 275
891 3300026142 Ga0207698_10409402 Ga0207698_104094022 275
892 3300028379 Ga0268266_10000151 Ga0268266_10000151112 275
893 3300028379 Ga0268266_10016069 Ga0268266_100160691 275
894 3300028379 Ga0268266_10049654 Ga0268266_100496543 275
895 3300028380 Ga0268265_10012837 Ga0268265_100128378 275
896 3300028380 Ga0268265_10022486 Ga0268265_100224862 275
897 3300028380 Ga0268265_10057886 Ga0268265_100578862 275
898 3300028380 Ga0268265_10157798 Ga0268265_101577982 275
899 3300028381 Ga0268264_10006124 Ga0268264_1000612411 275
900 3300028381 Ga0268264_10012754 Ga0268264_100127543 275
901 3300028381 Ga0268264_10026360 Ga0268264_100263602 275
902 3300031548 Ga0307408_100105839 Ga0307408_1001058392 275
903 3300031548 Ga0307408_100508765 Ga0307408_1005087651 275
904 3300031731 Ga0307405_10014498 Ga0307405_100144982 275
905 3300031731 Ga0307405_10053499 Ga0307405_100534992 275
906 3300031731 Ga0307405_10203342 Ga0307405_102033422 275
907 3300031824 Ga0307413_10005270 Ga0307413_100052705 275
908 3300031824 Ga0307413_10060395 Ga0307413_100603952 275
909 3300031824 Ga0307413_10073917 Ga0307413_100739172 275
910 3300031824 Ga0307413_10236513 Ga0307413_102365132 275
911 3300031852 Ga0307410_10000178 Ga0307410_1000017825 275
912 3300031852 Ga0307410_10004922 Ga0307410_100049222 275
913 3300031852 Ga0307410_10007484 Ga0307410_100074844 275
914 3300031852 Ga0307410_10019768 Ga0307410_100197683 275
915 3300031852 Ga0307410_10055472 Ga0307410_100554723 275
916 3300031852 Ga0307410_10057818 Ga0307410_100578182 275
917 3300031852 Ga0307410_10263909 Ga0307410_102639092 275
918 3300031852 Ga0307410_10495352 Ga0307410_104953521 275
919 3300031901 Ga0307406_10012510 Ga0307406_100125104 275
920 3300031901 Ga0307406_10036212 Ga0307406_100362123 275
921 3300031901 Ga0307406_10256055 Ga0307406_102560552 275
922 3300031903 Ga0307407_10002066 Ga0307407_100020667 275
923 3300031903 Ga0307407_10037350 Ga0307407_100373502 275
924 3300031903 Ga0307407_10068812 Ga0307407_100688122 275
925 3300031911 Ga0307412_10529450 Ga0307412_105294501 275
926 3300031995 Ga0307409_100000158 Ga0307409_1000001589 275
927 3300031995 Ga0307409_100006740 Ga0307409_1000067407 275
928 3300031995 Ga0307409_100051983 Ga0307409_1000519833 275
929 3300031995 Ga0307409_100088727 Ga0307409_1000887271 275
930 3300031995 Ga0307409_100094202 Ga0307409_1000942022 275
931 3300031995 Ga0307409_100101908 Ga0307409_1001019083 275
932 3300031995 Ga0307409_100114585 Ga0307409_1001145852 275
933 3300031995 Ga0307409_100159149 Ga0307409_1001591491 275
934 3300031995 Ga0307409_100370743 Ga0307409_1003707431 275
935 3300031995 Ga0307409_100412339 Ga0307409_1004123392 275
936 3300031995 Ga0307409_100671355 Ga0307409_1006713552 275
937 3300032002 Ga0307416_100008572 Ga0307416_1000085726 275
938 3300032002 Ga0307416_100008874 Ga0307416_1000088745 275
939 3300032002 Ga0307416_100089820 Ga0307416_1000898202 275
940 3300032002 Ga0307416_100089900 Ga0307416_1000899003 275
941 3300032002 Ga0307416_100160691 Ga0307416_1001606913 275
942 3300032002 Ga0307416_100673198 Ga0307416_1006731982 275
943 3300032004 Ga0307414_10005187 Ga0307414_100051874 275
944 3300032004 Ga0307414_10008908 Ga0307414_100089082 275
945 3300032004 Ga0307414_10050844 Ga0307414_100508442 275
946 3300032004 Ga0307414_10303050 Ga0307414_103030502 275
947 3300032004 Ga0307414_10444717 Ga0307414_104447172 275
948 3300032005 Ga0307411_10000340 Ga0307411_100003404 275
949 3300032005 Ga0307411_10012437 Ga0307411_100124373 275
950 3300032005 Ga0307411_10019689 Ga0307411_100196894 275
951 3300032005 Ga0307411_10024987 Ga0307411_100249873 275
952 3300032005 Ga0307411_10033134 Ga0307411_100331342 275
953 3300032005 Ga0307411_10041074 Ga0307411_100410743 275
954 3300032005 Ga0307411_10193649 Ga0307411_101936493 275
955 3300032126 Ga0307415_100031234 Ga0307415_1000312344 275
956 3300035113 Ga0373936_0054877 Ga0373936_0054877_210_1139 275
957 3300035170 Ga0373943_0005877 Ga0373943_0005877_11_940 275
958 3300035171 Ga0373946_0029622 Ga0373946_0029622_254_1183 275
959 3300035691 Ga0373931_0200564 Ga0373931_0200564_13_942 275
960 3300036401 Ga0373937_0050795 Ga0373937_0050795_23_952 275
961 3300037312 Ga0395899_0000596 Ga0395899_0000596_6639_7568 275
962 3300037312 Ga0395899_0016472 Ga0395899_0016472_3088_4017 275
963 3300037312 Ga0395899_0020699 Ga0395899_0020699_2910_3839 275
964 3300037312 Ga0395899_0023759 Ga0395899_0023759_3645_4574 275
965 3300037312 Ga0395899_0051295 Ga0395899_0051295_1831_2760 275
966 3300037312 Ga0395899_0055982 Ga0395899_0055982_1699_2628 275
967 3300037312 Ga0395899_0067426 Ga0395899_0067426_1580_2509 275
968 3300037312 Ga0395899_0082037 Ga0395899_0082037_69_998 275
969 3300037312 Ga0395899_0092698 Ga0395899_0092698_1020_1949 275
970 3300037312 Ga0395899_0140115 Ga0395899_0140115_741_1670 275
971 3300037312 Ga0395899_0151164 Ga0395899_0151164_560_1489 275
972 3300037312 Ga0395899_0151311 Ga0395899_0151311_156_1085 275
973 3300037312 Ga0395899_0183897 Ga0395899_0183897_11_940 275
974 3300037312 Ga0395899_0278161 Ga0395899_0278161_81_1010 275
975 3300037312 Ga0395899_0287942 Ga0395899_0287942_141_1070 275
976 3300037312 Ga0395899_0325759 Ga0395899_0325759_53_982 275
977 3300037418 Ga0395900_0000192 Ga0395900_0000192_74049_74978 275
978 3300037418 Ga0395900_0003372 Ga0395900_0003372_1333_2262 275
979 3300037418 Ga0395900_0013465 Ga0395900_0013465_220_1149 275
980 3300037418 Ga0395900_0014283 Ga0395900_0014283_2549_3478 275
981 3300037418 Ga0395900_0015134 Ga0395900_0015134_1743_2672 275
982 3300037418 Ga0395900_0017226 Ga0395900_0017226_5367_6296 275
983 3300037418 Ga0395900_0028500 Ga0395900_0028500_4189_5118 275
984 3300037418 Ga0395900_0076975 Ga0395900_0076975_429_1358 275
985 3300037418 Ga0395900_0114277 Ga0395900_0114277_1620_2549 275
986 3300037418 Ga0395900_0115897 Ga0395900_0115897_501_1430 275
987 3300037418 Ga0395900_0147724 Ga0395900_0147724_1220_2149 275
988 3300037418 Ga0395900_0162610 Ga0395900_0162610_490_1419 275
989 3300037418 Ga0395900_0173760 Ga0395900_0173760_1245_2174 275
990 3300037418 Ga0395900_0201990 Ga0395900_0201990_80_1009 275
991 3300037418 Ga0395900_0257134 Ga0395900_0257134_394_1323 275
992 3300037418 Ga0395900_0292426 Ga0395900_0292426_560_1489 275
993 3300037418 Ga0395900_0308138 Ga0395900_0308138_33_962 275
994 3300037418 Ga0395900_0327142 Ga0395900_0327142_438_1367 275
995 3300037418 Ga0395900_0327511 Ga0395900_0327511_560_1489 275
996 3300037418 Ga0395900_0521501 Ga0395900_0521501_138_1073 275
997 3300037418 Ga0395900_0532023 Ga0395900_0532023_68_997 275
998 3300037466 Ga0395898_0000055 Ga0395898_0000055_273964_274893 275
999 3300037466 Ga0395898_0030645 Ga0395898_0030645_3117_4046 275
1000 3300037466 Ga0395898_0032698 Ga0395898_0032698_600_1529 275
1001 3300037466 Ga0395898_0033045 Ga0395898_0033045_2350_3279 275
1002 3300037466 Ga0395898_0050902 Ga0395898_0050902_3061_3990 275
1003 3300037466 Ga0395898_0053892 Ga0395898_0053892_556_1485 275
1004 3300037466 Ga0395898_0074416 Ga0395898_0074416_512_1441 275
1005 3300037466 Ga0395898_0095126 Ga0395898_0095126_1699_2628 275
1006 3300037466 Ga0395898_0221996 Ga0395898_0221996_15_944 275
1007 3300037471 Ga0395905_0000067 Ga0395905_0000067_3665_4594 275
1008 3300037471 Ga0395905_0000215 Ga0395905_0000215_3800_4729 275
1009 3300037471 Ga0395905_0007298 Ga0395905_0007298_1959_2888 275
1010 3300037471 Ga0395905_0011975 Ga0395905_0011975_5893_6822 275
1011 3300037471 Ga0395905_0015781 Ga0395905_0015781_1228_2157 275
1012 3300037471 Ga0395905_0018831 Ga0395905_0018831_5189_6118 275
1013 3300037471 Ga0395905_0030629 Ga0395905_0030629_69_998 275
1014 3300037471 Ga0395905_0031039 Ga0395905_0031039_1886_2815 275
1015 3300037471 Ga0395905_0050375 Ga0395905_0050375_1439_2368 275
1016 3300037471 Ga0395905_0052176 Ga0395905_0052176_428_1357 275
1017 3300037471 Ga0395905_0055550 Ga0395905_0055550_482_1411 275
1018 3300037471 Ga0395905_0073235 Ga0395905_0073235_1366_2295 275
1019 3300037471 Ga0395905_0075213 Ga0395905_0075213_977_1906 275
1020 3300037471 Ga0395905_0086429 Ga0395905_0086429_1133_2062 275
1021 3300037471 Ga0395905_0094671 Ga0395905_0094671_986_1915 275
1022 3300037471 Ga0395905_0100290 Ga0395905_0100290_838_1767 275
1023 3300037471 Ga0395905_0109771 Ga0395905_0109771_622_1551 275
1024 3300037471 Ga0395905_0140009 Ga0395905_0140009_413_1342 275
1025 3300037471 Ga0395905_0199922 Ga0395905_0199922_650_1579 275
1026 3300037471 Ga0395905_0226315 Ga0395905_0226315_398_1327 275
1027 3300037471 Ga0395905_0250724 Ga0395905_0250724_219_1148 275
1028 3300037471 Ga0395905_0275713 Ga0395905_0275713_33_962 275
1029 3300037471 Ga0395905_0308675 Ga0395905_0308675_251_1180 275
1030 3300037471 Ga0395905_0315817 Ga0395905_0315817_400_1329 275
1031 3300037471 Ga0395905_0323280 Ga0395905_0323280_76_1005 275
1032 3300037471 Ga0395905_0376078 Ga0395905_0376078_160_1089 275
1033 3300037471 Ga0395905_0376833 Ga0395905_0376833_244_1173 275
1034 3300037471 Ga0395905_0396581 Ga0395905_0396581_81_1010 275
1035 3300037471 Ga0395905_0532377 Ga0395905_0532377_10_939 275
1036 3300037853 Ga0436364_0597140 Ga0436364_0597140_1727_2656 275
1037 3300038443 Ga0395901_0000041 Ga0395901_0000041_159410_160339 275
1038 3300038443 Ga0395901_0005969 Ga0395901_0005969_7737_8666 275
1039 3300038443 Ga0395901_0013254 Ga0395901_0013254_3777_4706 275
1040 3300038443 Ga0395901_0033961 Ga0395901_0033961_1053_1982 275
1041 3300038443 Ga0395901_0042195 Ga0395901_0042195_906_1835 275
1042 3300038443 Ga0395901_0087952 Ga0395901_0087952_931_1860 275
1043 3300038443 Ga0395901_0095453 Ga0395901_0095453_1568_2497 275
1044 3300038443 Ga0395901_0166655 Ga0395901_0166655_400_1329 275
1045 3300038443 Ga0395901_0171124 Ga0395901_0171124_329_1258 275
1046 3300038443 Ga0395901_0172748 Ga0395901_0172748_779_1708 275
1047 3300038443 Ga0395901_0185599 Ga0395901_0185599_566_1495 275
1048 3300038443 Ga0395901_0188262 Ga0395901_0188262_1070_1999 275
1049 3300038443 Ga0395901_0306840 Ga0395901_0306840_560_1489 275
1050 3300038443 Ga0395901_0507896 Ga0395901_0507896_157_1086 275
1051 3300038443 Ga0395901_0596176 Ga0395901_0596176_51_980 275
1052 3300039437 Ga0436365_1792078 Ga0436365_1792078_70_999 275
1053 3300042005 Ga0439448_0003621 Ga0439448_0003621_3011_3940 275
1054 3300042012 Ga0439455_0006061 Ga0439455_0006061_597_1526 275
1055 3300042157 Ga0439458_0000214 Ga0439458_0000214_10701_11630 275
1056 3300042157 Ga0439458_0008577 Ga0439458_0008577_198_1127 275
1057 3300042439 Ga0439464_0001702 Ga0439464_0001702_3800_4729 275
1058 3300044658 Ga0466972_0067263 Ga0466972_0067263_185_1114 275
1059 3300044684 Ga0466966_0022829 Ga0466966_0022829_561_1490 275
1060 3300044684 Ga0466966_0032037 Ga0466966_0032037_1592_2521 275
1061 3300044684 Ga0466966_0072873 Ga0466966_0072873_1053_1982 275
1062 3300044684 Ga0466966_0119805 Ga0466966_0119805_33_962 275
1063 3300044684 Ga0466966_0154450 Ga0466966_0154450_296_1225 275
1064 3300044693 Ga0466961_0185207 Ga0466961_0185207_16_945 275
1065 3300044694 Ga0466963_0007958 Ga0466963_0007958_2931_3860 275
1066 3300044694 Ga0466963_0014138 Ga0466963_0014138_393_1322 275
1067 3300044694 Ga0466963_0032720 Ga0466963_0032720_2020_2949 275
1068 3300044694 Ga0466963_0060933 Ga0466963_0060933_1375_2304 275
1069 3300044694 Ga0466963_0087637 Ga0466963_0087637_679_1608 275
1070 3300044694 Ga0466963_0092328 Ga0466963_0092328_256_1185 275
1071 3300044694 Ga0466963_0116870 Ga0466963_0116870_17_946 275
1072 3300044694 Ga0466963_0257743 Ga0466963_0257743_164_1093 275
1073 3300044712 Ga0453684_0267446 Ga0453684_0267446_861_1790 275
1074 3300044735 Ga0466968_0025105 Ga0466968_0025105_458_1387 275
1075 3300044765 Ga0466970_0067810 Ga0466970_0067810_521_1450 275
1076 3300044765 Ga0466970_0192247 Ga0466970_0192247_178_1107 275
1077 3300044842 Ga0466957_0009241 Ga0466957_0009241_391_1320 275
1078 3300044842 Ga0466957_0017240 Ga0466957_0017240_1595_2524 275
1079 3300044842 Ga0466957_0065986 Ga0466957_0065986_885_1814 275
1080 3300044842 Ga0466957_0095088 Ga0466957_0095088_817_1746 275
1081 3300044901 Ga0466960_0075992 Ga0466960_0075992_124_1053 275
1082 3300045049 Ga0466959_0147959 Ga0466959_0147959_242_1171 275
1083 3300045049 Ga0466959_0175055 Ga0466959_0175055_299_1228 275
1084 3300045836 Ga0466958_0025225 Ga0466958_0025225_109_1038 275
1085 3300045976 Ga0466967_0020297 Ga0466967_0020297_216_1145 275
1086 3300045976 Ga0466967_0021517 Ga0466967_0021517_3424_4353 275
1087 3300045976 Ga0466967_0036921 Ga0466967_0036921_2829_3758 275
1088 3300045976 Ga0466967_0063041 Ga0466967_0063041_1931_2860 275
1089 3300045976 Ga0466967_0064593 Ga0466967_0064593_59_988 275
1090 3300045976 Ga0466967_0130129 Ga0466967_0130129_684_1613 275
1091 3300045976 Ga0466967_0175114 Ga0466967_0175114_847_1776 275
1092 3300045976 Ga0466967_0193283 Ga0466967_0193283_600_1529 275
1093 3300045976 Ga0466967_0316461 Ga0466967_0316461_142_1086 275
1094 3300045976 Ga0466967_0356563 Ga0466967_0356563_127_1056 275
1095 3300046459 Ga0495629_0232680 Ga0495629_0232680_119_1048 275
1096 3300046492 Ga0495585_0087093 Ga0495585_0087093_86_1015 275
1097 3300046525 Ga0495663_0009747 Ga0495663_0009747_36_965 275
1098 3300046537 Ga0495598_0001866 Ga0495598_0001866_533_1462 275
1099 3300046539 Ga0495621_0000387 Ga0495621_0000387_7599_8528 275
1100 3300046684 Ga0495669_0000380 Ga0495669_0000380_17323_18252 275
1101 3300046684 Ga0495669_0029605 Ga0495669_0029605_1177_2106 275
1102 3300046691 Ga0495670_0000346 Ga0495670_0000346_540_1469 275
1103 3300047445 Ga0495677_0012918 Ga0495677_0012918_1649_2578 275
1104 3300048903 Ga0496100_0012786 Ga0496100_0012786_1429_2358 275
1105 3300048903 Ga0496100_0079147 Ga0496100_0079147_733_1662 275
1106 3300048904 Ga0496101_0005826 Ga0496101_0005826_132_1061 275
1107 3300048905 Ga0496102_0050481 Ga0496102_0050481_2768_3697 275
1108 3300048905 Ga0496102_0192559 Ga0496102_0192559_412_1341 275
1109 3300048906 Ga0496103_0034721 Ga0496103_0034721_925_1854 275
1110 3300048908 Ga0496105_0152497 Ga0496105_0152497_423_1352 275
1111 3300048909 Ga0496106_0036590 Ga0496106_0036590_28_957 275
1112 3300048909 Ga0496106_0292954 Ga0496106_0292954_344_1273 275
1113 3300048910 Ga0496107_0013246 Ga0496107_0013246_778_1707 275
1114 3300048911 Ga0496108_0010343 Ga0496108_0010343_517_1446 275
1115 3300048911 Ga0496108_0020169 Ga0496108_0020169_3276_4205 275
1116 3300048912 Ga0496109_0001322 Ga0496109_0001322_14518_15447 275
1117 3300048912 Ga0496109_0012191 Ga0496109_0012191_1474_2403 275
1118 3300048912 Ga0496109_0013298 Ga0496109_0013298_840_1769 275
1119 3300048912 Ga0496109_0017282 Ga0496109_0017282_3076_4005 275
1120 3300048912 Ga0496109_0109524 Ga0496109_0109524_324_1253 275
1121 3300048912 Ga0496109_0534987 Ga0496109_0534987_42_971 275
1122 3300048913 Ga0496110_0005603 Ga0496110_0005603_2165_3094 275
1123 3300048913 Ga0496110_0015944 Ga0496110_0015944_2201_3130 275
1124 3300048913 Ga0496110_0026569 Ga0496110_0026569_3958_4887 275
1125 3300048913 Ga0496110_0070772 Ga0496110_0070772_117_1046 275
1126 3300048914 Ga0496111_0001589 Ga0496111_0001589_1017_1946 275
1127 3300048914 Ga0496111_0010931 Ga0496111_0010931_2837_3766 275
1128 3300048914 Ga0496111_0025571 Ga0496111_0025571_2290_3219 275
1129 3300048914 Ga0496111_0063397 Ga0496111_0063397_1577_2506 275
1130 3300048915 Ga0496112_0028468 Ga0496112_0028468_2445_3374 275
1131 3300048915 Ga0496112_0053506 Ga0496112_0053506_2519_3448 275
1132 3300048915 Ga0496112_0057540 Ga0496112_0057540_317_1246 275
1133 3300048915 Ga0496112_0198106 Ga0496112_0198106_791_1720 275
1134 3300048915 Ga0496112_0283600 Ga0496112_0283600_98_1027 275
1135 3300048916 Ga0496113_0003389 Ga0496113_0003389_874_1803 275
1136 3300048916 Ga0496113_0015304 Ga0496113_0015304_2932_3861 275
1137 3300048916 Ga0496113_0017118 Ga0496113_0017118_2392_3321 275
1138 3300048916 Ga0496113_0132024 Ga0496113_0132024_764_1693 275
1139 3300048916 Ga0496113_0171644 Ga0496113_0171644_342_1271 275
1140 3300049583 Ga0501067_0016871 Ga0501067_0016871_2830_3759 275
1141 3300049583 Ga0501067_0091070 Ga0501067_0091070_262_1191 275
1142 3300049742 Ga0501080_0345872 Ga0501080_0345872_229_1158 275
1143 3300049823 Ga0501044_0231161 Ga0501044_0231161_552_1484 275
1144 3300050515 nmdc:mga0a205_3658_c1 nmdc:mga0a205_3658_c1_7764_8693 275
1145 3300061719 Ga0466962_0008030 Ga0466962_0008030_3895_4824 275
1146 3300061719 Ga0466962_0061303 Ga0466962_0061303_218_1147 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

189

270

0.98

PF01012

ETF

Electron transfer flavoprotein domain

3

170

0.95

Feature Viewer

pLDDT pTM Quality
70.17 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map